3TG8A

Mutant ribosomal protein l1 lacking ala158 from thermus thermophilus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
214
structure length
214
Chain Sequence
b'VDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
molecule tags Ribosomal protein
source organism Thermus thermophilus
publication title Structural analysis of interdomain mobility in ribosomal L1 proteins.
pubmed doi rcsb
total genus 66
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 3tg8A01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tg8A02
3U4MA 1CJSA 4QVIA 1U63A 4DFCB 4QG3A 4REOA 1DWUA 5DM70 1AD2A 3U56A 2HW8A 4LQ4A 3QOYA 1I2AA 3FPNA 3ZQJA 1MZPA 4F9TA 4QGBA 3TG8A 1ZHOA 3UMYA 5DM60
chains in the Genus database with same CATH superfamily
2EZ9A 5EMKA 3ROXA 1EUZA 2PNJA 1FZTA 3TO5A 2PZAA 3F6BX 4JBIA 4PQRA 1ICIA 2VZ9A 4DEXA 3T12A 3ND7A 1UQRA 1VCHA 4MVJD 1MH9A 4TTJA 1J39A 2J4CA 4M21A 3OX4A 2WUDA 4MCIA 2GPJA 1G4UR 4G4GA 4R2KA 1D1SA 4JB0A 1WCWA 4C3VA 2RE8A 1TCBA 2GZSA 4MVJH 5HF5A 4MLCA 3CW2A 1DBRA 2PGJA 2P3QA 2O1XA 1CY6A 2RI6A 4EIWA 2DPYA 1UANA 1XV5A 4WLUA 5LNK6 3EIQA 4EGCB 2ONKA 3KSRA 2AC4A 2VDOB 2YS7A 3ANNA 3G0IA 4HCJA 1PFVA 4LWZA 3V7UA 2EBFX 3FWNA 3HCOA 1S96A 1PRYA 1U99A 1Y5MA 2IZ0A 2B9VA 1CUGA 4U8GA 1N0WA 4QVGA 2FZ4A 2GX6A 4QBHA 5IVIA 2IYOA 2W2OA 4NENA 4R1LA 5GAJA 3W7BA 4LJ9A 3GLGB 5JRDS 5IHXA 1HMYA 3KVYA 1Z33A 4YT4A 1JDUA 5JEEA 2HIHA 1DXOA 3PP8A 3OF2A 3V7FA 1S0UA 4UBOA 5C52B 1DWOA 1JQJC 2H48A 3QBVA 1A9OA 1HE5A 4JLBA 5BMVA 3HCEA 2FUNB 3RC2A 1AZTA 1V11B 3WDLA 4LNUA 3RS0A 4YYEA 1COWD 1YMUA 1RAEA 1ZS9A 2G9ZA 4RPJA 1QGUB 3HKCA 2IP2A 2E5WA 4IRXA 5TJHA 1WMBA 2R2GA 3RHTA 4YCJA 4OK5A 1FVFA 4GH5A 5K0SA 3VYWA 3H7AA 4BO4A 5B2EA 1X87A 2IRWA 2FDRA 3P20A 3OU2A 4HEJA 4CF4A 2HD4A 2HHAA 4OHKA 4HWPA 1WXGA 2GR9A 2ZAOA 5CPFA 5AKIA 2NPOA 4D8TA 4PICA 1HX7A 2ZJYA 4E03A 2P9FA 4G5FA 5HKBA 3IVGA 1TPZA 3IP6A 4F2DA 2WAOA 4FI3F 4GM1A 4R1UA 1JNYA 4G0QA 2PT7A 4LHSA 2WTEA 4RCVA 3R7AA 2LCQA 3VSCA 4G07A 4DYVA 3WB9A 1NJFA 1UPTA 3ONNA 2AQKA 2FQQA 3DSRA 3IAXA 1P0FA 1SVLA 5ESXA 4JC4A 3ZBUA 3R3ZA 4TXNA 3I6YA 1YO6A 1F6BA 1N75A 3EXIA 3GLHB 4BQIA 2HH9A 3ZBPA 1J8VA 3QY0A 3UEOA 4F7DA 2VF8A 3A8TA 1N1MA 3BB3A 4Z0NA 3DGFC 1KH3A 3AM5A 1LEHA 3GLQA 4WD3A 4P4NA 1ES9A 3DCYA 4IWXA 3E8XA 2FV8A 2G63A 4N3NA 3ROTA 2LWIA 5C37A 1GJRA 3WK8A 1XU4A 2QUJA 3Q1LA 4N6GA 4QULA 1YL6A 4QZVA 3MS4A 1YB5A 4WZAA 1USVA 4GE3A 5GOZA 4CQMA 5CYOA 4ENRA 4RPHA 1QMPA 2Q4BA 3FHOA 5AM0A 1FUYB 3IKLA 3RUFA 1WVGA 3W4JA 1PYGA 3C15C 1UM9A 3OE7D 3QKIA 3IR5A 3RAFC 3B3QA 1Z6GA 3FYUB 1E94E 4Z8YA 1KAOA 2IUSA 2D5BA 1XN1A 3G9QA 5ALLA 4G37A 3KEQA 4QPPA 3AY3A 3NC4A 4JROA 4BBPA 5BWNA 3LDHA 3A6EA 1PR9A 2FCRA 1X3LA 3L79A 4UE3S 1VTKA 2XNJA 1SZJG 2IYRA 3OZGA 1SC9A 3V4PB 4CE6A 5H81A 4MRRA 1K6IA 1KJNA 2E4YA 2PYIA 3FRJA 4R9NA 1N0HA 4E5SA 1DKNA 4XWKA 5HUHA 2GZMA 3EZ6A 3QI2A 3ZH2A 3R9IA 2ZRDA 1T9HA 2X4DA 2ZCVA 2UV8A 4BNGA 2QAJA 4LVNA 5IJWA 1SVDM 4NBNA 1L2TA 4FBLA 4DARA 3NT2A 5I48A 2E1RA 5JY1A 4Z3DA 2DQYA 4ABYA 3PXXA 4LSWA 4C6HA 2QPLA 1VJCA 1E2JA 2XITA 3P2JA 2H92A 3KQMA 3L05A 4CKEB 3WLHA 1SEVA 2C4KA 1SHLA 3HUEA 3DWEX 5IMBA 4XJTA 3VKUA 3JR3A 2YRXA 4D8XA 5KWEA 1GL6A 3LBNA 2EEZA 1YQWA 4FXOA 3X1JA 2VJNA 1Y1KE 2XYRA 1N33B 2QRMA 3NYWA 1IRIA 3ACDA 3E23A 3KNZA 1CF2O 4EQZA 1EE2A 1UC4B 1ZUNA 2B1RA 5FWDA 1XCMA 1H8ED 2IKQA 3ROPA 1QPZA 5K3OA 4F2WA 2YV2A 4FYJA 1U2DC 3PR2B 1S2IA 3HSSA 1YC5A 1KK3A 3MJ4A 4K9PA 1EFVB 3OLZA 4XSGA 4HVLA 2ET6A 4ZYLA 1GHTA 1II0A 2JVIA 1UOOA 4IGEA 3ZGVA 3GEPA 1FFBA 4W5JA 5TIIA 4BWGA 1BWSA 1GGEA 3HLYA 3KUDA 4B8ZA 2VQDA 3HPQA 4C0SA 4QODA 2C58A 1HTBA 2AD5A 2IHYA 5BQFA 4B73A 3NVMB 1UL1X 1Y7LA 1JT2A 2JEOA 3GV0A 3JPYA 3LLCA 3P9IA 4RTMA 2J9YB 3LRXA 1L0BA 2BEWB 3THYA 5AI5A 3FWKA 4O4HB 4AP5A 1Z4OA 2VXBA 2I3DA 1T4CB 2L19A 2WZQA 3PNBA 2ALJA 3GGDA 4J76A 3HSYA 4W7IA 4AS3A 1Y89A 1F17A 4BX9A 4R2LA 2C7BA 5EYPA 4B8WA 3H9BA 1ZR4A 3UOWA 1T2NA 5B57C 1UDCA 2J32A 3DLPX 5HXAA 1SOMA 4JUCA 5I4KA 1Z4NA 1NPYA 2ZDGA 4ZWNA 4OQQA 3TQQA 4JJFA 4B7ZA 4DABA 3WWDA 4ZZ1A 3QKSA 1TYDE 1CUXA 1HI9A 4JBGA 4O29A 2XLCA 5FL7D 3IRVA 2FWIA 4BRUA 3TOCA 1U0SY 3WO1A 3IV7A 3ROGA 5I8PA 4WTOA 2AN5A 1QPBA 5FHRA 3GLTA 4JI6B 1C3JA 1PJQA 3IALA 5GJCA 4CR6A 3W5DA 2X7HA 1HNXB 1DRKA 1E18A 2DSTA 2B25A 2YJ5A 3HB9A 2VJCA 5J3JA 3A6PC 1W8DA 3L6DA 4KN8A 4RZ2A 3WGQA 4DA4A 3B1JA 2QY6A 2Z1DA 4GBGA 4HNRA 5CNKA 3GZTB 1BX3A 1DL5A 1E1QA 1M2NA 4CIDA 2GARA 1HT3A 4JLPA 3CO0S 3DLCA 3TZEA 2X1VA 2QTZA 1G98A 3RUDA 1Q12A 5A3QA 1D1TA 4J4BA 3RSCA 1TLTA 4E5KA 2IS1A 2B92A 2GZ2A 1JSLA 4MUYA 4PSUA 2NG1A 1PJZA 3OY2A 4HAWA 2P65A 1M6WA 1YTLA 4JC8A 1CQZA 4ZCPA 4FM9A 3F67A 4ER7A 2ZBFA 5FUXA 4DPMA 1NBEA 2WLSA 4CMEC 2HA4A 1FNMA 2CXSA 4WSOA 1YHYA 5I7OA 1J8FA 4DILA 4OH1A 1O94C 4PR3A 5A4IS 1LK7A 4ZI5A 3H1EA 3IAM1 4BTEA 2VK2A 3GUZA 4G4JA 4RGQA 4EB8A 2PN1A 3LCRA 5HZKA 5BXQC 3AFHA 2DY0A 2XUHA 1JBKA 3KKQA 3K0FA 1XT6A 3EYAA 4UKDA 3CNEA 2NACA 2Y1EA 5F1KA 1U31A 3OMLA 4M6WB 2YVUA 3ZEAA 2QRUA 3BRSA 1UT8A 3IXMA 1DVRA 1YR2A 4HDRB 1MOPA 2V6JA 4K6CA 1X1BA 2QTCA 1P7WA 2AFRA 1V6SA 2POQX 2XNCA 3EULA 3MS2A 3RYCA 4IQFA 1RXVA 1RM5A 1LLDA 5HOEA 4IGFA 3KQUA 2YJ6A 1FSFA 4ZYZA 1FSPA 1CEYA 3TRIA 2FLVA 2ZEJA 1GZ4A 5IC5A 1A2KC 5CGQB 3WZMA 5EJGA 1BU8A 1Q0PA 3L41A 4NJEA 4AO7A 3DXFA 1L3IA 5F52A 3RG8A 1O4VA 2H8GA 3RAGA 4AF6A 4WT7A 1JPUA 3MB8A 2YICA 4FFBB 2IWRA 3K71B 5KNCD 3JQAD 4RORA 1SU4A 2R6ZA 4FQ7A 5EC8A 3SEQA 5BNZA 2OCLA 1W9MA 4W4TA 5CFOA 1KBQA 4IIXA 1XKLA 5TRTA 3CR8A 2PZJA 3GJ4A 3F97A 1YKFA 3AVTA 3JY6A 4AG5A 1W5AA 2XMPA 1QYIA 3AVPA 4I8DA 1XQVA 4MMZB 1E3IA 4GBMA 1KO1A 4LHYA 4LZNA 4BE4A 2JS7A 4HPXB 4R2HA 1XQ9A 5JCJD 3DVSX 1EGAA 1VIYA 3DEJA 4JK3A 1L5ZA 5EXXA 3FM9A 4LXIA 3VO8A 4CG0A 3OA2A 1E5DA 3NKFA 5DIZA 1LI5A 1O97C 4F5WA 2GCIA 1B1CA 2V69I 2NO0A 3W5CA 3BFPA 4EAAA 3LLSA 3WV4A 2DETA 1UBHS 4D9MA 1A9RA 3OLYA 1CNFA 2BEWA 3THYB 1OH7A 4DKXA 1H42A 2PJZA 4L9RA 3WJ2A 1AXEA 1NF9A 4MVJA 3W2IA 4YRRA 3SM3A 4WBNF 2H9IA 1MOQA 3EFOB 2WTBA 1P17A 3LA8A 1ESCA 5AFSA 4RK5A 2C97A 3IDAA 1PZNA 3BIOA 2WLTA 2FFAA 3QF4A 1XTIA 2WT8A 5F9MA 4GSYA 4OV6B 4KDCA 3KQHA 4G1CA 1D5CA 4LFAB 4JUIA 1V8ZA 3FUTA 1NUPA 1UJ6A 1Z5UA 4FSXA 1AQUA 1UKVY 1TM7E 4NBRA 3QG1A 5DYNA 2ZRNA 5HEKA 2M6RA 1VECA 1E4OA 3K72B 1QLHA 1ZDMA 4Q1DA 1C7IA 3DD1A 1A76A 3VX4A 2AUMA 3K3PA 4Z9XA 4Y1EA 1OX6A 1DP4A 4AYWA 2AFHE 1YQXA 1CZUA 2CGEA 2OSVA 4J1SA 4JYBA 4QEKA 1DADA 2WHQA 4Z4IA 4KR3A 1DRJA 2H2DA 2LRHA 4BFXA 3TK1A 1T6YA 4MS1A 5J4LA 4CKBA 3ZK9A 4UHHA 1Y6GA 2C8KA 3QX8A 1NBMA 1EHYA 3Q1KA 5FRDA 5K0FA 3R24A 3AGPA 2WJAA 3CRQA 4E51A 5KYYA 4QT4A 2J7PA 1SUIA 4WBXC 1F8YA 1XAGA 3CA8A 3A25A 3TTVA 1OHHA 3VR5D 2J5KA 3LXRA 2IUTA 2HU8A 4FSHA 3L8CA 3B6ZA 1MXFA 1THZA 3ZLVA 3R41A 2D2IA 2V9ZA 5CH5A 1Z39A 2BV3A 5CURA 2FEXA 3HV2A 7MHTA 3OF3A 1WHSB 3V42A 1KJ9A 5F7ZA 2O50A 3V55A 3QV2A 2BIFA 4YYZA 3ZDBA 4D9IA 1W59A 1RQXA 4EPRA 4V3CA 3I1JA 3TX6A 3ZV3A 4AS1A 3KD3A 4KWHA 3QLUA 3AJ8A 5T8KC 4GT1A 4BEJA 1FS6A 5SYAA 3VPXA 1I6WA 2VHQA 4MV8A 1TM1E 3LI2A 2XD4A 3O8QA 1K0UA 2OK7A 2AH5A 2V3WA 3AU9A 3SOPA 3ZWPA 4O25A 4Y7DA 2QRVB 5DM60 2HWYA 5FR1A 1IQ0A 2JZNA 1FB5A 1R27A 1NASA 2MHCA 2RDMA 2VYFA 3KXLA 3LUKA 4MLZA 4EKDA 3PUHA 4NQZA 4ANFA 3LC2O 1NSTA 1UBMS 4YJDA 4D3XA 3H3XA 1QRTA 4Z54A 1UP7A 4MR7A 4F6LA 1B2LA 1G7RA 5LB2A 4AMBA 1U6IA 3PEWA 3FKQA 4UHCA 1WKVA 3QGMA 2OV1A 5CD1A 2FPUA 2J09A 5FULA 2CLFB 3U4IA 5JSKA 3UKDA 4YC7A 5FLXA 4DLAA 5D84A 3RFCA 3ZDDA 3U3OA 4R1OA 1LPPA 3F73A 2Y99A 3A0UA 2FRDC 5K03A 2GF2A 4DDKA 2AMYA 3SD7A 5EIHA 1AK2A 1NDUA 4NU8X 4X3OA 3K0BA 1QFYA 1TYZA 3LLUA 2J48A 2ERYA 1VE6A 5JBQA 4NYIQ 2IXGA 4R3WA 3RK0A 3UMFA 2QTHA 3JQBA 2J9RA 4NBLA 3A1TA 5F1YA 1IY2A 5I7HA 1WY5A 2XQKA 4BJ5A 3OA0A 4JUDX 2IE8A 2CEAA 1YQUA 3PFIA 1TIKA 1A8SA 2PQ6A 4YR9A 1BXZA 3FNHA 4H60A 1XRQA 3JWJA 1K97A 1UKBA 2VT2A 5BW5A 2FB9A 3EHDA 1H3EA 4P92A 2Q9UA 1XHFA 3CE9A 5LQAA 1I3MA 4WNIA 5B4VA 5HZMA 1GUAA 5C3MA 1PSZA 2Z5LA 3NEYA 4ESHA 3O7WA 3FVWA 4F56A 1NNLA 4FHDA 3C6QA 4RM3A 4A6XA 1DIGA 1IWAB 2RCYA 3PTLA 1IQRA 4O4HF 2C98A 2GM9A 4D8UA 3I9NA 3BMXA 5EJ7A 3BH0A 4P3KA 2HCRA 2H54A 3VAZA 2JJ2D 5DNCA 1F1BA 1FRFS 3GNLA 4MITA 5LFAA 3WJAA 1CS4C 4FWIB 1Z5WA 3PRJA 1GZ6A 4G5YA 2PR2A 2ONJA 4BQEA 1A8IA 4NOMA 5DEOA 1IBMB 5EIBD 3ELYA 2QKYA 2HZ7A 1FJXA 5G2OA 4GLOA 5AOBA 4Q05A 4M1OA 1MPXA 1YVDA 3NTLA 4HZGA 4LDJA 4MUNA 1XROA 1A2QA 1XRJA 3PFBA 2N1BA 3O8BA 5T4BA 2O0KA 4M37A 3AHDA 3IEUA 3HSKA 4OBXA 4F8YA 1LWNA 3NHLA 3WAKA 2UU9B 2XYVA 4CF5A 3D3EA 3EG9A 4GGPA 3GNSA 3E9QA 5EKXA 1NKSA 4QQNA 2ASVA 4RK4A 5CMLA 4J94A 1UH5A 3LOPA 2P91A 2C57A 3GT7A 5FOTA 4OB6A 1KFBB 1VLHA 1WOYA 3VKGA 3GD5A 3MOGA 4PSDA 5DHTA 2LW7A 2AFIB 2IJGX 2B36A 1OTXA 2VR1A 2FN3A 3L4SO 4FYKA 2O3RA 3SFVA 1IUKA 3ICOA 5AM4A 4E3ZA 1Z3IX 2XWPA 2C9BA 3AEUB 4RFSB 4EHDA 1LS1A 4HO1X 4Z9BA 3QPUA 4JYPA 3SZRA 1QIHA 2G5CA 4MAMA 1G63A 1KMHA 1W29A 1Q5PA 5I47A 1RXWA 4F91B 1BNCA 1KYIA 1XEWX 3BIJA 3GP5A 5CDTA 2JHFA 3KJQA 4TLEA 1M6VB 3HG7A 3L5OA 2WSSD 3TLGA 2CVOA 1FXSA 3PNYA 3LUJA 1TKBA 4MJXA 2PY6A 3EBPA 5JBIA 1P31A 2L0XA 3T7EA 4AJ1A 5BYAA 1AK9A 2PWBA 4UTXA 2YX1A 4KH1A 3EJ6A 1UW9C 4HR7A 1NR7A 1O77A 2FSUA 2PYDA 3GJYA 3PSAA 4C87A 4CQNA 4WASA 1DG3A 1CQJB 4F0JA 3PFFA 4DA8A 5LXTA 3RRZA 4NAUA 3DL7A 4CFYA 4FI3C 3KR1A 4MICA 1R8SA 2WHXA 5C1PA 2M6SA 3BDIA 3ZDFA 4A7PA 2CXQA 2WF8A 3W79A 1QH1A 2QB5A 4Y6OA 1C4KA 2G77B 2HHCA 1D2NA 2IZ6A 2Q21A 3TI9A 1ZO8A 2AUNA 3JSXA 1A50B 1QTNA 3SEZA 1YC2A 4XPZA 3QA9A 4RPKA 3Q3CA 4MWDA 4OQDA 1NDHA 4JY7A 4DMUB 5KVCA 3VC7A 1KR2A 5KPDA 4X66B 4WAUA 4GD3Q 4S35A 4UMDA 1QGDA 1R5BA 4KQCA 4ZALA 3SQNA 3NDIA 1RSZA 3LF2A 5FWXA 4YHHB 2BZGA 4C0LA 4TN5A 5D3MA 5AOCA 4Q03A 3LA6A 5CDYA 3DXZA 4UARA 4YASA 1OMOA 1Z2EA 4G0YA 4NYMQ 4TKZA 5FB3A 2IV3A 1G5FA 4X64B 4YHBA 1ONOA 2NYUA 2WOJA 3DZKA 5EKUA 1UZAA 2XQVA 1V8FA 1XKTA 5EHGA 4CWAA 2ZRCA 2ZIXB 3PUKA 5T3YA 2XR1A 1GOTA 1Y3HA 4DUGD 1WW2A 2PD4A 2J0UB 1T9GR 2Z5VA 4X7PA 4H2DA 2GUGA 4UUOA 4Y2UA 5K6AA 1PBNA 5ES3A 1N9GB 1V9LA 1GK8I 2V4MA 2HEIA 3V6MA 2EXXA 2ZI7A 3PG5A 5C2JB 4OTZA 1NXPA 4PZPA 4NI5A 5A0VA 3BA1A 4OB7A 4Z99A 1L4NA 1DTWB 3U13A 2G5GX 1MTZA 3RUIA 3QZUA 5DBIA 2EKBA 4NJMA 2EF1A 1ZVVA 3AHEA 1JLRA 2GCOA 3S28A 4ERNA 2OESA 3I9OA 1KSFX 3UK6A 1T3GA 2FFJA 3MTBA 3KJIA 4C88A 2VPWA 3HJNA 4AUKA 3A4YA 1CG6A 3A6JA 2W11A 1UPPI 3DM9B 1RLJA 1T0UA 3B1FA 1ST2A 3P2KA 3OUTA 1JAZA 1LV8A 1AM4D 4U5XA 1T34A 4PAQA 2BSQA 1QHNA 4N5MA 2NSJA 1DO8A 1W1WA 3P45A 1CF4A 1E2DA 1Z38A 2AG1A 2HNKA 1E9VA 2OZKA 2ZYIA 2DFTA 4R05A 5DLPA 5A3SA 1GAJA 3FOWA 4LF4B 3C98A 3CLTD 5EE5B 1VLQA 3PITA 4TV8F 1RIIA 1AQ6A 1IXKA 1NMXA 5F2NA 3U3RA 4MW0A 2VDRB 4M83A 3V6LA 1K75A 3IA2A 4OF4A 3W5IA 3ZHRA 3OOWA 4YMUA 2HDWA 4N8DA 2C9MA 2WM8A 4OJKA 1NVWQ 4MV1A 2AUTA 3CLRD 5TQVA 3TIVA 1U0NA 3PWZA 2ZCJA 3C8MA 3NNNA 2NOAA 4Y7CA 7REQA 2WQZA 3Q11A 1ELOA 4LRSB 4NZPA 4XLLA 4N5IX 3H13A 5FAKA 4TLBA 1EK6A 4CLEA 1QONA 2YWXA 3OZDA 4TSFA 2VL7A 1NUAA 3AVOA 3B9BA 3O74A 3C1AA 5DSTA 1KMNA 4A1OA 1NBOA 2C2ZA 4EYOA 4KW7A 5KYVA 4XWOA 5L40A 4YRMA 5EJ4A 4E15A 1XNRB 1UZUA 3LD9A 1P3Y1 2OMKA 3ICVA 1NHWA 2Y0DA 1GQSA 1ZOLA 3NKLA 3PD1A 4TKMA 2XJ9A 2PX8A 4UHFA 2IYWA 2QNBA 3E9RA 4E2YA 2HWKA 2A0YA 5JT1A 1JLLA 3E84A 4I4TF 4ZVRA 3H42B 4B2YA 1G18A 2EZUA 4FUQA 2ZTVA 4LHXA 4QUDA 4ZDJA 621PA 1IMOA 5JG7A 1DKMA 3DVAB 2NZUG 1C2TA 4QC2A 4R69A 1I30A 3UC9A 4CNBA 2WYHA 3T41A 4CR7A 4CDNA 4DV6B 1JS1X 1SCNE 4FOLA 3T7KA 2GAJA 3VI3B 4MIOA 2ZLBA 1T0JB 2F8MA 1GFZA 3ETHA 1S2NA 2JFQA 3OZIA 3PC4A 4V3BA 5EUMA 5IP5A 4CRWB 5JYBA 4JEHA 3NIBA 3RSOA 4FN5A 1RWPA 1A72A 1M2OA 1Z68A 4PHCA 4FB5A 3FZYA 4KPEC 1H93A 4F85A 4JYZA 2VHTA 4C4XA 1QRUA 2E21A 3ROKA 1R4AA 2OC9A 2OXIA 1ZJJA 4H9GA 8AT1A 5AICA 2QW8A 4NCNA 4HFRA 4AO6A 2P2YA 4OXQA 5D1NA 4O2BF 1FCJA 1RLIA 4AY5A 1LJ8A 3DDUA 4LRXA 1H6AA 5C5IA 1RWMA 4XWWA 4HXGA 3G79A 4LOHA 5CGZA 2FOIA 4OEHA 2CFOA 3VPBA 2JFGA 3B6IA 3C8UA 5HJ2A 1MDBA 4RPIA 1BDHA 1MB0A 3S8YA 4TKVB 4ZODA 4BBZA 3IHLA 4ESOA 4TV8A 1ISMA 5DMXA 2X5KO 4GKVA 5IDYA 4K6HA 4IDGA 5LD2B 2C04A 1EEHA 5JCJA 3P32A 3RABA 1N57A 4A5SA 4C06A 3BF8A 1OKKD 3N0VA 3RUPA 1CUYA 3GPCA 3IULA 5CH3A 4LYHA 2ADMA 4H7HA 2OYRA 2IH4A 1TQDA 3H6KA 1U0FA 3CW8X 3D6NB 4MGZR 1QLWA 5G3ZA 2PMBA 3QY9A 2WWTA 2Q9CA 2XQIA 5FV4A 2QENA 3FI9A 4CM8A 4L5YA 2PUDA 4XW2A 1V43A 4D96A 3A04A 4YA6A 4BNWA 4YMVA 3GA5A 5ICSA 3DBIA 2MR5A 3E22B 5AP9A 1JFTA 4YP6A 3URKA 3IEMA 2DTDA 1WG8A 3RIMA 2ZRBA 1L7DA 3N8GA 3C5EA 3W5SA 1E1NA 2BCGY 1QOPB 4RY2A 2PUTA 3W3AH 5ERXA 2RGBA 5BWLA 4AJNA 4KL8S 5AW6A 4B0OA 3A31A 2GCEA 1LTQA 3DVQX 4BO8A 1Y1TA 4QBIA 4FYIA 2O7NA 4IIGA 2XUJA 1W4ZA 5CVTA 3LXMA 4P34A 1Y34E 2PZLA 2Z3WA 2H4XA 1TO6A 4HDAA 3K16A 1R3UA 3F5FA 2NIPA 4LY0A 4UFNA 1CQIA 2NN3C 1B6SA 5FKJA 5BNFA 2DHCA 4Y6QA 3U4GA 3R3VA 2FHZA 1QU3A 5E38A 2G80A 1A88A 1K86A 1YDWA 1JDVA 3D0KA 4K8RB 1NXQA 1MFZA 2QX6A 2BFMA 2R8ZA 3H5NA 4LDRA 3C3YA 4ITUA 4LOLA 3L77A 3H1TA 3FUVA 1WP4A 2XMSA 4U6SA 3FYSA 2CV0A 2WJHA 2FF7A 1P4RA 1GG9A 3UGTA 4D7AA 1NVFA 1BWQA 4ARCA 3FPNA 1UJMA 5AHWA 4C2BA 4ZV4A 1N2XA 3K0CC 3RVMA 1S3SA 4D6YA 5LOVF 4KREA 5AW4A 3SZOA 5EFZA 2RGNA 1P7PA 1NN5A 5ULLA 4BB0A 1XZHA 1AC5A 2FN7A 3MAAC 3THXB 2QWXA 1DWQA 4ZZ2A 1U2GC 2XH8A 5BORA 5A62A 1NKVA 1XEXA 1V7CA 1T36A 4Q1AA 1UZNA 4J4TA 2FFBA 2ODWA 3MUFA 5T41A 4EPWA 3GP8A 3TNJA 4MKHA 3WIOA 1QKJA 3B6JA 4GX1A 4O4IA 4CIWA 1NVAA 1G1AA 3MK31 2WU0A 3NIDB 1Z2NX 2WYIA 3P96A 1UWAC 2WIJA 1TQHA 4MAFA 4MVJE 3FPSA 4OXKA 5K8CA 3PBKA 3KZNA 3WGLA 4G23A 4YQEA 3O0DA 4EB6B 3QYAA 4IBOA 2VPQA 4G97A 3PT5A 4YXWD 3WRXC 1GRVA 3HPRA 3R7WB 3JYOA 3KL4A 2WIGA 2O8EA 2JLVA 4Z0TA 3M5PA 2QN8A 5LLSA 4JOBA 2VPYA 1CR0A 1O5TA 4KQHA 4TWRA 2RGCA 1M1ZA 4OP3A 4TL7A 3RIXA 4DMMA 7REQB 2DPXA 5IJXA 3CRVA 4WNAA 2D1TA 2C84A 4UJ5A 3WQBA 2VP9A 3WLJA 7AT1A 1TZBA 2VTBB 4V2UA 3U4QB 4JKYA 5HKLA 1TECE 3LHDA 2LZ0A 4J1QA 1AV6A 3RQIA 5DE3A 4KFCA 1L5FA 4O0LA 3HWWA 4E4TA 2ZTLA 1C8BA 1P2VA 4ID9A 3NI2A 1ZCBA 3WIDA 3ZCXA 4TYPA 1V8BA 2JFZA 3X1WA 1B7GO 4POAA 2R5NA 2I6UA 2BM9A 3D3KA 3JALA 1YHZA 1DIHA 1J5PA 1T36B 2VO1A 4UQPA 1JA1A 2GA8A 4ZOCA 1A0OA 5DJ5A 4TL9A 221PA 1XRLA 3UJCA 2ZRKA 3OQVA 1A97A 4M87A 4O4JA 1BHO1 3FHCB 4KQXA 5IAKA 3TZLA 5BV0A 1E0AA 3TL2A 2OM2A 4TKUA 1E2NA 4FYWA 1G21E 4EI2A 1PVDA 4GBJA 4GHWA 1U90A 1DX9A 3T7DA 5J2UA 3UUGA 4MQEA 3INGA 1K7EB 4KGDA 5EAIA 4WVLA 3ZNQA 4LF7B 4DFCB 1RD4A 4QQFA 4BAGA 4BP8A 4ZOLB 1TTPB 2VP3A 3A37A 1CERA 1DKLA 4RH3A 1WZ2A 2WG1A 3BD7A 3PQEA 1SEPA 3KT3A 1AO0A 3LE8A 1C9NA 5LDGA 2O2GA 3DOUA 1Q6YA 3O93A 2J4FA 1J99A 3ZIAA 4EF6A 3G49A 2OHGA 3EHEA 2X19A 3O0TA 1SC4A 3DKIA 4H16A 3DPSA 4M1EA 2CB0A 2Y9MB 1U7HA 1HF3A 3IP1A 4R2IA 4ZEOA 3S2EA 4JB2A 3FPGA 3LPCA 4HB2A 2PJUA 2XGGA 5J63A 1ZL0A 3ZXIA 4OQEA 5FNZA 3T9AA 1VKZA 4OM8A 3HQ4O 2PU5A 3A9TA 4YVFA 1LDMA 5B3JC 3FLEA 1CUUA 2OXRA 3FDXA 4NZOA 5E7QA 1R0BA 1E60A 1OREA 1O95C 3O5AA 4P08A 5B37A 1FQJA 1I2BA 2IEAA 3IUYA 3RB8A 2KQUA 4L8FA 2DRIA 2YJNA 1ZL2A 4CM6A 4B32A 5HM6A 1P1RA 3ISVA 4BNJA 2XCLA 3A6GA 4X1OA 5D00A 1ZVKA 2YFKA 3SZUA 4H31A 5DWQA 5KDDA 4LRTB 3S2SA 4DQUA 1N2CA 5LZ5A 5IXSA 4TKUB 2II6A 3G9TA 2IH5A 3VOSA 1VPTA 4G41A 2WSMA 4L0QA 3CFYA 3EQ9A 2B1JA 2B34A 3ONWA 2YHIA 4QTTB 1ZNWA 3U61B 4HGNA 1ABFA 3AXTA 3TR6A 4IOMA 4TYYA 1LUAA 3DXYA 3IEVA 2CFRA 1UIMA 2D1FA 3NO4A 1B3RA 1Y4AE 1VJ0A 4BNIA 4EHLA 1JI3A 1F5SA 2FVXA 1T6NA 3EASA 2Y1CA 3N58A 3N6XA 1AHNA 4H4CA 2FSVA 4YV2A 1Z6QA 4UUAA 2Z58A 1SC3A 1M2VA 1T10A 1X38A 3M81A 4QGAA 2H9AA 4EQ6B 1FRNA 4PGFA 2P77A 4GO1A 1PL8A 1K66A 3C85A 1ZXLA 1M1NB 1XTVA 1DJMA 4R8VA 4RVGA 4WFKA 3H1AA 3TJRA 1CRPA 5HKKD 2GEUA 1Q22A 3PHGA 4NCKA 2F1KA 2Z6UA 1E9BA 2E6KA 4JASB 5A4MS 4RQUA 3HDHA 5K3FA 1RC1A 4P86A 4FDUA 1OT5A 2HQBA 3RARA 1MVOA 2PQ2A 3B6EA 4IEIA 5HPYB 1OH8A 2FI1A 3ZV7A 3QE2A 1N7HA 3ZY6A 3W6OA 2I7CA 2JFVA 1VMEA 1LLFA 1OI7A 2ACVA 4RX1A 1OILA 1GV0A 1G16A 1N1DA 1RBQA 3HB0A 3LUAA 5KNDA 3DR3A 3IELA 2J3HA 2ENUA 3LYAA 4IJQA 2HMUA 1TKAA 4RF5A 3WV5A 4DMCA 4I6JA 1NKTA 3B38A 4YAFA 1E7YA 2BR3A 2QUKA 4BKPA 3H9GA 5ECYA 2WVHA 4NESA 4A4DA 5JH7F 4GZLA 3JARA 4BGDA 4RIGA 3H5TA 2RHCA 4LOAA 2L18A 2ZE8A 3GLSA 3G8DA 4KE6A 4QPNA 1TVEA 3U19A 1H4VB 1YBMA 1JH8A 1WUJS 1WZUA 2QI9C 4YN3A 1T2EA 5C80A 2BGRA 4ILEA 2VTBA 3WK7A 3SHQA 1EE9A 1EAYA 2JGIA 1NJSA 4CMBA 3P2MA 2WVGA 2XNKA 2XA2A 1BVRA 1BQ3A 3AP3A 4IHKA 4WXHA 4WY2A 1VKOA 5JS8A 3A3PA 4Y9SA 3RDPA 3THWB 3ZBTA 4BKRA 1WE2A 4CIBA 3ICWA 4QYIA 4IIJB 4EJSB 1IXYA 4B9AA 5EUQB 1J8QA 2RB5A 5MFPA 2C0QA 4TSRA 2BFFB 1XPUA 1IPFA 1GIAA 1XJCA 3A32A 1UBNA 2VRCD 4ER5A 2C88A 4N4AA 2BONA 4O1HA 3ITKA 2QD4A 2BOVA 1GDDA 3RADC 3E15A 5TQ0B 2YXNA 4DSUA 1Z5GA 1PJTA 3DT9A 4Y2GA 4J0EA 1WHTB 1A4RA 1YJXA 5FBHA 4D0GA 4LE1A 4HVCA 2QLJA 2QZJA 3UB3A 5I7EA 2AIRA 5AJWA 2GKGA 2XNSA 2IVZA 1C3OB 1VJDA 5EP1A 2F1HA 3P0HA 2J46A 2RJ3A 2QF7A 3PDUA 4IJMA 3KUKA 3R8XA 3ZE8A 4BDSA 2A1TS 2VT7A 3AQ4A 1N25A 2F3RA 3I4FA 1NLMA 4E1BA 4KR2A 2QN7A 1P7VA 1RAHA 3JAKA 4FCVA 4K3VA 1R0XA 2JFFA 3ENNA 3PEEA 4RS3A 4LJ7A 4XRGA 3T1YB 2FR8A 3CZ5A 1ZZEA 2CE7A 4KWEA 4MWGA 4KI7A 1JR3D 4M1TA 2PKRA 3QM1A 3R0JA 3QUCA 3TJMA 2Y3IA 1KEEB 3ZQUA 1XE3A 1XFAA 4XD2A 1SBTA 1X1AA 3LTNC 1QYXA 3DR5A 4TV9B 3UTDA 2YJGA 1QFMA 3OQ6A 4KXQA 1CIPA 2UZ0A 3U4QA 3QKSB 2RHMA 1AS0A 5GONF 1IULA 2C9CA 4I0WB 4GZ3A 3D0OA 1U3TA 1VL1A 1JG1A 3N2ZB 2OC4A 1MRSA 3A26A 3RIHA 1MFPA 3F3KA 5T5QA 2JH8A 1VZ3A 3ILSA 1EA7A 2IXBA 3N3BC 4LOKA 4JAVC 1DOZA 3OCYA 2VP6A 4HSGA 4PPGA 3RVSA 1SC1A 3AERA 3ED5A 2QTRA 1EEXB 3OTWA 3Q6MA 4ODIA 1K8RA 1QR6A 4U7WA 1X7WA 3FNRA 5GOTA 1HYBA 3E61A 2Y05A 3NASA 4C7MA 2QUAA 3FYTA 1PS9A 3OQMA 2J9ZB 1M10A 1EUCB 3W5VA 3MEQA 1PJ2A 4L4ZA 4RE5A 1KY4A 4EQ6A 3ZE0B 3WRYC 2X86A 2GD0A 1X70A 4PC3A 4B2PA 2PLAA 3DUFB 4MVJF 2H5EA 1M1NA 1E3MA 2ZDHA 4HQRA 4YP7A 4YCLA 1KVTA 4HZUA 4AYTA 3FZEA 2BFEB 2QRKA 2O59A 2EV9A 2E0IA 4DXAA 3COYA 2H7CA 4O2RA 2YOFA 3K8QA 3LBHA 1UMCB 3JQ7B 3GMIA 3K0HA 4L5BA 2WMDA 2QN9A 3EXFA 3PI7A 3VC2A 3GUVA 1D7AA 1ZICA 5AW1A 1CY0A 1OXBB 3TIGA 4CM5A 1YE3A 1GQRA 4JFAA 2J3LA 3I28A 4AG3A 1P3DA 3W7VA 3W1EA 1ORTA 3ZUPA 1ZEJA 4OK6A 5ILGA 5E1MA 3LBAA 1Z06A 2H1VA 1ECGA 1CFZA 2VPXA 3TBKA 3RWOA 4EK9A 3DBRB 1ZJ4A 3ECAA 1N3IA 1JHVA 2XUGA 4IIBA 4E07A 4G5SA 2IT1A 3ORFA 1X7WB 3ZGNA 3NRBA 4Q24A 4EYKA 5KVVA 3F71A 1O8BA 2YQZA 1NYRA 4ZICA 1SBNE 2F8LA 5JNUA 2O0HA 2A3NA 1D2MA 1OWOA 1U8XX 3L7BA 1UK7A 4DUZB 2C9OA 4CMJA 5JNLA 4PSVA 2J3QA 2VOEA 4QD3A 4KSCA 3WIBA 4WN9A 3CVVA 1SB8A 1PX2A 1GCGA 3ACBA 3HY4A 1FL9A 1GA1A 1XDWA 4CEJA 2H4YA 2QSYA 2CFTA 5DCUA 1U0RA 2AJTA 5LP6A 4ZEXA 3K6RA 2RGYA 1W4BA 1WVMA 2HPAA 3LXXA 3BSWA 1CJKC 4YACA 5DYIA 3VFDA 4EJSA 2BM1A 1NVEA 3E81A 1E62A 1KYTA 3OMXA 4IWNA 4UTZA 3EIHA 5CLQA 3PC6A 4OXXA 3MCWA 4MUFA 3NT5A 4GS5A 3AOEC 4F2HA 2O2EA 2CXUA 5EMJA 2H85A 1L9KA 3A1VA 4G09A 1VMKA 4NDNE 4V0SA 4OL0A 2CNNA 2PS0A 2V7QA 3R09A 3SXPA 3OPXA 2FEMA 4D79A 1FF9A 4LEIA 3R6LA 2GCPA 3K09A 1MLDA 1RMTA 3DBRA 2QN2A 3I1IA 2X22A 2W43A 4BNYA 4C7OB 5JALA 3OM1A 1Y4DE 3ZYZA 3H04A 4MWSA 1PT8A 1QHIA 1HTWA 1NM5C 2XEXA 3EQ6A 3PSHA 5JNWA 5JWRA 4WV3A 1GPUA 1YIOA 3OQ1A 2XEDA 2V5VA 4Q4AB 5C7LO 2UUBB 1XLTC 5FT9A 2PH3A 3QTTA 2VH1A 3FYCA 2H7VA 5LBTA 2BY4A 3C3DA 1K88A 1K7FB 3AKZA 4Y2XA 1CJUC 3LUPA 1AURA 3RYFB 4RSMA 4B74A 4FYXA 4ZOBA 1GT91 4URUR 1XLUA 4RKEA 1FS5A 2EGGA 4X1KA 3GJ3A 2OYCA 4PRKA 4V0MA 2F55A 1KDRA 1QVZA 4ZANA 1PYOA 2EU8A 4E4YA 1LRKA 3U60B 1LQ2A 4QRDA 2IDZA 3KFVA 3LJKA 1A82A 1L8QA 2YXLA 1R5OA 2G7ZA 3B1KA 4JBNA 4WJKB 3D8HA 2MINA 2C2BA 5DI3B 5AKEA 2PVSA 4YCAA 2H8KA 3PNSA 2C5SA 3NTVA 3UK2A 2BM8A 4LHEA 4S1WA 4BUCA 2P11A 3C3AA 1ZI9A 4NMLA 5EJ2A 1XMSA 1WOMA 3UH1A 4CMIB 1KZ9A 2VJAA 1TUBB 3EGDB 3K70B 1WS6A 4NFHA 1TM3E 4ENQA 1ZNXA 4DV7B 4OVKA 4Z7JA 2FZWA 1SHUX 1L5NA 5IYZA 5IZ4A 1TT7A 3NJ4A 3IUBA 5ALYA 1ZAYA 3RH0A 4JX8A 1QYWA 3DOFA 3EC7A 4CCYB 1I14A 4D74A 3QRWA 3R3WA 2YFHA 3K05A 3U0VA 1H2BA 5A5GA 1X1DA 4D0SA 2GBLC 2H7XA 1PTJA 2PXXA 3DOIA 3B53X 3BERA 4EA7A 4CEHB 1ESDA 4MDYA 4AP9A 4LZWA 5C8YA 4X1KB 3KQPA 4B2LA 1TTQB 2Q28A 4LGMA 2A58A 2PLWA 1P2UA 4J7XA 1H66A 1NPTO 3X44A 3WGHA 3CR7A 1S9DA 3IPYA 5D7BA 4BMDA 1NSYA 2GD2A 5F33A 5LA6A 2HA0A 1EG2A 2ZRIA 3OZTA 1P19A 2VH5R 2WJVA 4M7OA 5LIRA 1CCWA 2VUTA 4ND2A 3FAZA 1N9KA 4BP9A 2Y6VA 3ISJA 4TM7A 3AO0B 4ISCA 4MZDA 4MUKA 4GWGA 4P82A 3RVRA 1V1RA 1Z8NA 4KQIA 5GWXA 2O2DA 2IV7A 1CUJA 3U7GA 5ALQA 1C50A 5FI1B 3WK6A 1DZIA 4AMZA 2H3HA 5HQJA 1SHJA 3ER8A 1LPNA 2HC9A 2IXAA 1WB6A 5CB8A 2K5UA 3KG2A 4E4RA 2WSBA 8ATCA 5LPNA 3HYNA 4WBSA 4LQCA 4R01A 1MRZA 1XL1A 3SC2B 1PT7A 2FW8A 3NVKI 1ABEA 1OZAA 4M0DA 1QHHA 3ED1A 2DFXI 3D4OA 5HIAA 3O84A 4CUZA 1Y1PA 3P0FA 4ALIA 1D2GA 1S5PA 1FYVA 1O9BA 2JRLA 1TYEB 4D4JA 3VO2A 2AWOA 1SBIA 5AVTA 2OCPA 5BWBA 4G81A 2D2EA 4ZVSA 4CZ2A 2Q4OA 3S2GA 5L45A 1YE8A 5IS2A 3I37X 2IGTA 2FWAA 4XYBA 4DJAA 4N3CA 2XDAA 3VZQA 1SGWA 4ZYUA 3QU4A 1N0UA 5IBQA 4MRMB 2FN9A 3SKVA 2GILA 2R1ZA 3REOA 4EHBA 2XGSA 1VSUA 4MGHA 3ZE2B 3OESA 2HGSA 4PBSA 1KP2A 5ECWA 1DT3A 3QJYA 5M5BA 3WHIA 4ALMA 3JASB 4AQ7A 5MN5A 3WBBA 5DOZA 2DSNA 3EDYA 3UVEA 5H82A 3SPXA 1G8JA 3KX2A 4M7RA 4YV1A 2R62A 1KF0A 2I6XA 3SC2A 3F90A 3JQPA 3M9XA 2IQIA 2GO1A 4CU2A 1FRZA 4D46A 5FEUA 1O8CA 5I3CA 5KIAA 3LYUA 1DZ3A 4YWHA 2RHWA 2L82A 1JR4A 1C80A 3DE4X 3DVAA 2DUJA 3E7DA 2NVWA 4PSKA 4RK1A 1JIQA 1THMA 3VTZA 1US8A 1HNWB 4OJTA 4OBEA 3ONFA 2P2GA 1V3TA 3H9JA 1JQ5A 1IM5A 2EBHX 2MSKA 2Z9DA 3OFVA 4GDFA 4E33A 1TUGA 3LQ2A 4ARZA 1WEHA 1NW5A 1M2OB 1TE2A 4ND3A 2GK7A 1JEQA 3D6FA 3HBAA 1MF7A 3MINA 3KFXA 3KOZA 3G1WA 4RYLA 1K6MA 3CLHA 4UNNA 5ANRB 5CDFE 4ARSA 4G1UC 3TNLA 4TS9A 4PLYA 4XGQA 1K3UB 4U7JA 3BMOB 3QWFA 1ISIA 821PA 4J03A 1EBFA 2H4JA 4CM9A 4DOMA 3FPCA 2O2XA 4PHGA 3VHRA 3HXQA 4OHWA 2VI5A 4P33A 3BE5A 2AF3C 1E92A 2ZYHA 2PG3A 5LUAA 3G2QA 4XDHA 1JR3A 2H4FA 3IT1A 1SO8A 1T35A 3CN7A 4WERA 1XXHB 3QVJA 2FW7A 2DMRA 5AVWA 4GLFA 4JVSB 1G21A 1X7YB 2BZ1A 2PKEA 2XYHA 5TPZA 5JMPA 3ZXXA 5IZCC 3O9VA 4LOIA 4YXFA 3IE1A 1PJ4A 1Y80A 3ZHUA 4P4SB 1AY0A 3WGTA 1W30A 1BDMA 5T57A 3G5AA 4L9AA 5KWIA 2ZM6B 1WL8A 4E14A 1JF8A 1H3NA 1LRJA 1VI6A 2WABA 2G4VA 3OAAD 3WGOA 2FG6C 4B43A 4LUCA 2RH5A 3LAWA 1QHSA 3L8MA 4DCPA 3IR6A 4CV0A 3FRHA 2CNWD 2C8JA 4Q7EA 4Z53A 4JKIA 3RROA 1JEDA 2WPDD 4P1ZA 2MMGA 4ARZB 4RF3A 4PLPA 4BV9A 5CA0A 1P4HA 3AZQA 1QZTA 2WTXA 3D2BA 1JDZA 3RWMB 2FE4A 1M6VA 1GRNA 3KR0A 3HVRA 2FA9A 1SUFA 1UBFA 2GBFA 1DNPA 4V2IA 1T6ZA 3GIWA 4QXQA 3PUYA 5INTA 1H6DA 1RP7A 1TM2A 2JA2A 3R9KA 5K0ZA 1GZHB 4HB0A 5I9IA 1I4WA 3ZU4A 3EC2A 2I71A 2OCKA 4YLEA 2IIBA 4O2LA 4V02A 4LJLA 1VHDA 4C22A 2RHTA 2WJWA 4MP3A 5IH3A 3X2FA 1IK4A 2MMCA 3MAJA 2G9VA 4S12A 2PJRA 3DOEA 4F38A 1X14A 5DNDA 1JZSA 2AG8A 1Y5NA 1EHIA 3IQEA 4CG1A 1WY7A 4N5HX 2C8VA 1G8YA 1Z4KA 2GPNA 3HBJA 4TMZA 4EMSA 1X9IA 1T5BA 1N6PA 1WLYA 3MRXA 4X61A 3HUFA 3UC5A 3WY9A 1DAGA 1T1IA 1XMIA 2GYYA 1ML3A 4TXMA 1FUEA 5T6BA 2AOTA 4PQYA 3A1SA 4HNGA 4BYMA 1HQCA 5CR9A 2Y1XA 5EMMA 4NCAA 4IDNA 2FPRA 3T0GA 3VO1A 2BC9A 1UEIA 3PGKA 1HLGA 4L85A 1NMQA 4DZTA 1TJYA 1WUIS 1Z08A 5IUJC 1U0GA 3GLFA 3DAPA 4FSDA 5A4KA 2JLQA 3HM2A 4Z1MD 5JFTA 2LV8A 3IP7A 4TTSA 4E12A 1T4MA 2PUJA 4UEKA 4DEYA 3A9CA 5H1YA 4IDCA 3ZHSA 1S3FA 3BEDA 1FXWF 3TQRA 2O7RA 2X6TA 4UE2A 3O8QB 3OU6A 1QH8B 1HYGA 1DHTA 1IAQA 1TLLA 3IERA 3LO8A 3PJFA 4WKOA 2JFUA 3EZ9A 4YJKA 1JSCA 4BNZA 1JHRA 1I2DA 2J07A 2QRVA 4I2NA 4ZU1X 1TJ3A 4BVAA 1GAQA 5BP7A 3WP1B 3TKLA 3RRBA 3ZWNA 4AK9A 1LBTA 2WYOA 1HE4A 4O4IB 5AHRA 4B83A 4V24A 4N0QA 2A1UB 3HRIA 2FPLA 3ZCVA 4CBVA 5JD5A 1Y0BA 2X7XA 3CH4B 3I6QA 4BVHA 5CA1F 4WVFA 4ZXPA 4EG4A 1J4AA 4PWZA 4NG4A 5IWCA 2VZ0A 3IUPA 5AI8A 3OZWA 4JD5A 4RV4A 2RBKA 4C43A 1Y5LA 3PC3A 3S3TA 4K88A 3T34A 1SA0A 4ETIA 3G9UA 1C8VB 2Y1FA 5ALOA 4X91A 1Q7CA 4JA2A 3UZUA 4AZSA 5G1PA 1AS2A 2RH9B 3D8SA 1HYHA 3IE2A 4U7GA 3UA3A 3AKCA 5FADA 1P6UA 1R66A 1Z4PX 2HLDD 2ZZMA 4I1RA 3OZUA 1Z16A 4I3HA 4OQZA 4EYEA 4QGSA 5JQGB 5K01A 4PFKA 5KQGA 5LJLA 1Q21A 2PBLA 1ETHA 5HA5A 1K89A 1MVNA 4C1NA 4NATA 3C3MA 5AVOA 1J97A 1MC1A 2B8TA 3O2QB 3W1VA 2XBMA 1XAJA 1DJQA 1HDRA 3PDIB 4AKHA 2FZEA 3NIWA 4I8IA 4OCZA 2QXTA 3A6DA 3BJMA 1EQ2A 2CMGA 2QZ9A 3A1UA 1N2CE 2GCGA 1QP8A 3O8NA 1I1HA 5M3BA 4CN8A 3JQGB 3Q72A 3K70C 3WLSA 1TK2A 2VBGA 3PXGA 3RLIA 4ZMRA 1N5OX 2FSGA 2NTYC 5DN6A 3SS7X 3K9FC 4NXNB 2AN4A 3ABOB 4EYGA 5B1EA 2D8AA 2JGAA 3WWCA 2QRPA 3IAS1 2EHJA 3ZVRA 2YJZA 3WG9A 2WYUA 3NHMA 5AH0A 5CIWA 4M0PA 3RUCA 8ADHA 2G76A 3I8XA 4QOSA 4LBWA 5LWHA 5KYWA 1AHHA 4QQ8A 3W04A 4HPJB 1EBBA 4RH1A 3KKOA 1JR6A 1N3YA 5KDLA 2FVYA 3SZGA 2DCUA 5JJ5A 1BVHA 1U0EA 3GAFA 1NR5A 1VHWA 3LL7A 3RSSA 4V1CB 1DAKA 1FYDA 2QRJA 1XP8A 1K0FA 1X1SA 2C94A 2QG9A 4ZOAA 4EA6A 2XUOA 1E3SA 3MM4A 2BKXA 4IL5A 3TQCA 3TLMA 1IHPA 3LP6A 1HORA 3X1KA 5KJ1A 5KYTA 1XNQB 2W6MA 1YRBA 3WA6A 2DF8A 1K06A 1XZGA 4GZ5A 4Q9HA 4Z51A 2GN0A 1CVLA 4D8VA 3VYSB 1Z74A 1DKQA 5DX0A 3RJZA 5L8VA 1ECFA 2B0JA 1NGSA 2DQZA 3D8BA 1Y9ZA 4HEA6 5M29A 4NYIR 3JQGA 5FA6A 1UIRA 1RJGA 1CZOA 3GK3A 2HJRA 1MQ9A 1N2CB 4ME6A 3UN1A 4C0KA 1N4DA 2AFIA 1UEJA 2XDWA 2OENG 5LBIA 2KWIA 2WUFA 4C4PA 5FPKA 5LVAA 1WBBA 4QG3A 3OQNA 2ZQ5A 2KW5A 3B12A 4P5PA 3U81A 2BCEA 2CHUA 4RFSA 1O03A 2GH1A 3EVTA 5CXXA 3T5AA 3IDQA 4QXMA 2AI3A 3AHGA 2QR5A 2I8CA 2NTNA 5KYUA 4KYUA 5IULC 1EWQA 3LXUX 1T29A 2V6BA 1JQLB 1IDOA 2JEZA 1ZJZA 2FTKE 1LQUA 1Z6TA 3GEMA 3Q7RA 5DHUA 2P6PA 1ZD2P 2MYTA 3FKSA 4XXHA 2QG6A 4OK3A 4LZAA 1E0KA 4DLUA 4ROTA 5ESRA 3I61A 1KARA 3KUCA 1RABA 1T8TA 5JMOA 3O4JA 5JH7A 5K99A 2B3TA 3QELB 4NBTA 3OO0A 3N2EA 2H18A 3GGJA 3YASA 1CWUA 3UKJA 4QVIA 3GWZA 3KXIA 1EGHA 4JENA 5TC4A 3M5WA 5EXTA 3EVBA 4B4WA 4JLNA 5FOWA 3QOXA 3WK4A 4TZ0A 1USIA 2IEZA 5F5XA 4A0RA 3R7NA 2CV1A 3DHVA 2X2EA 5DCYA 3OP4A 4CM8B 1GNPA 4P5DA 1Y8AA 4Q4JA 3UW1A 3VR5H 5BR1A 4WPGA 1XI2A 4COKA 3IBCA 3LDFA 3FMPB 4YJ2F 4X44A 6PFKA 5F21A 3TCNA 3ZN2A 2WE7A 2FSHA 5FPHA 1ACJA 1H9BA 4Q34A 3SJBA 1WO8A 4CIVA 3VPCA 5JQGF 3PJRA 4YT8A 1GKKA 1W25A 1QTQA 4KR9A 3HB5X 2IGBA 1U2SA 2PZKA 4DRXA 3MJRA 1VIAA 2IIVA 5DHAA 4CGYA 2YH2A 1NUTA 3SMVA 4ZIRA 2IYAA 1FDVA 4WUVA 3OCVA 2PNFA 3OG9A 4G36A 1X74A 3FG9A 4GPAA 3EQ2A 1U65A 1RDFA 5I45A 3B5JA 3CTMA 3OLQA 1RR6A 4CLXA 4LQDA 3W7AA 1YR7A 1P74A 1G3RA 4IO0A 3W34A 3UPTA 4L76A 1DKPA 1YK1A 2VQEB 4KWTA 1G8PA 3TAXA 1HLPA 1IVNA 1EG7A 2ODAA 4FX2A 4UDYX 5FBLB 1KDZA 1UPCA 5FHQA 4YRJA 4JS0A 3WL8A 5DT2A 2GNOA 2KS6A 2JJ2A 2IHJA 5DV9A 1XVLA 4UU7A 4PLZA 5TR9A 2AOVA 2Q7XA 5ICFA 5JASA 3NOOA 1J7KA 3RWBA 3GFTA 3L0OA 1YBHA 2GXUA 3HB7A 4LMAA 3ELUA 3ZYCA 2Q4DA 3KCNA 2G40A 2WJZB 1NV9A 4C4RA 3BL5A 3CQ9A 1F38A 3CVOA 1UBOS 1T3TA 2IUYA 1TU0A 4E31A 3OJ0A 2XRFA 2YBDA 1OLOA 3C5VA 4O2AB 4OI4A 1BGVA 3IB3A 1VLJA 3ZHCA 3WMGA 4F0MB 3NEJA 3KXKA 2DFKB 2J3IA 3Q2KA 1QIDA 3MTQA 4MUXA 4NE2A 5FNVA 3SDZA 2BKVA 2VNAA 5H0IA 3T5BA 4LJ8A 3P2EA 4ABTA 1KDTA 3A36A 5TPZD 4WZ6A 1R0SA 1T3LA 4FC7A 4QKQA 3I45A 3LOUA 4W1QA 1KKUA 1WB4A 2O0LA 1ZNYA 2VDQB 3BE4A 4OUDB 5IK2A 5BW6B 4P4TA 1NT2A 2P9YA 2WWXA 5DTQA 3QTLA 3D7RA 1IAVA 1NG1A 3ONEA 1KRXA 2WVJA 3DL0A 5D5HA 1WTCA 2GPWA 2P4UA 1XDDA 3L7NA 1KHTA 4H1WA 3HFJA 4K9OA 2JLWA 2W2NA 3RHFA 3RIEA 3QG5A 3RS5A 3GLGE 1ZJ6A 3KHSA 3N76A 4FMCB 1BHQ1 4HLDA 3UPDA 3L9WA 3OC6A 3ZW9A 1DBWA 4BIIA 3QFCA 3NWJA 3MJHA 4UVHA 3ZVMA 3CR3C 1E58A 1UOQA 3PDCA 1R4ZA 4O1MA 5ERGB 5CDUA 1ZSVA 1DCMA 4FMDB 4QDOA 4AUMA 3RCBA 5ILOA 1VBNA 1E6UA 3TQTA 2DY1A 3HB1A 4MKRA 4PVCA 2YV1A 4PWYA 4HAOA 2IKSA 2HJGA 4BXOB 1QK4A 1Z13A 4NEQA 3F5SA 3N2GA 4Q00A 1E9CA 2YBEA 1ORVA 4REOA 1MT0A 3CEPB 3GPLA 4XWGA 1PR0A 2C78A 3HJHA 3GGGA 2R8OA 2VP4A 2XPCA 3RAJA 1ONSA 4D5EA 2W42A 2CXXA 5GGXA 3KIPA 3R5KA 2WP8J 3UJDA 2WZCA 2JGNA 3I09A 3VVMA 3ZG6A 1ORDA 3Q98A 4K5QA 3VKFA 1G20E 1WSDA 2YV3A 4IOLA 4CR8A 1CRWG 1OFUA 1G9SA 5LMCA 4PRYA 1C7RA 3TZQA 3TXYA 4DV0B 2IBMA 4ETMA 3T1HB 4QG7A 4GI3A 3RVJA 2AOUB 3UWPA 5CM8B 2J3DA 4HI0E 4ND1A 1XEAA 1YU9A 2W48A 3HFSA 3IP5A 1NC1A 4JB8A 2DM6A 1R4MA 1ZP6A 2HREA 1WV1A 4N03A 3OQBA 3WSVA 3CVJA 4R3UC 1U9JA 1L4HA 4QYTA 1YE5A 4BNHA 5HZHA 3EZ2A 3SYNA 3HP1A 2CLKB 3AHHA 1URPA 4NOKA 4PRLA 3ZZNA 5IN4A 3PL5A 4GQAA 1BGWA 5KX5F 1QNLA 3E58A 2W2LD 2YY6A 3HYCA 5ICCA 2RI0A 1UK9A 4KGVA 4IOJA 3E8MA 1AKWA 1IN4A 1JDTA 3IOCA 2ACKA 3ZH9B 1NVBA 1F2TA 3H84A 1Z7BA 4G5QA 2EC5A 2ZB4A 4NP6A 3WLTA 2J0QA 2O3TA 3OPYI 3CLSD 3IVRA 3N7UA 3PPXA 4QOFA 4DRXB 3N2GB 1W44A 4RHEA 1SVWA 2DTXA 5LQNA 5TPWA 3REQA 1GKUB 2UVPA 1T15A 4RIFA 1DGQA 5FPYA 1ULTA 1M33A 5LZ9A 1E5TA 3KB6A 4TQ9A 4B7AA 4YAWA 4HEQA 1U1EA 2PX3A 4EEZA 3OJOA 3VR2D 2HPHA 2K87A 4ND7A 1H1DA 4XLTA 3E9DA 1PEKE 5TS2A 3IRUA 4U4AA 4FFNA 4E2XA 5C5EA 5I7WA 1NQAO 2ZTSA 3KWFA 2ZR7A 2C2KA 4E2ZA 3BZWA 4CTJA 3TZBA 3WOHA 1GFSA 3B1YA 4TWZA 5EHZA 1FQWA 1MD9A 1T8RA 2DFPA 2O2JA 3J7TA 4JP5A 1S4MA 3R7DA 1IWBB 4RZIA 4XCVA 3V8MA 3OCCA 2ZYDA 2BBWA 2D0PB 1OI2A 1GTMA 4ZO8A 4PE5B 4MK4A 3UJAA 4LJ4A 3VR3D 2EATA 1Y9DA 4QOGA 4BMPB 2EW8A 1EP2B 2QQ0A 1NW4A 2B99A 5CUQA 4AJPA 4ZHQF 2BAGA 1JEYA 5ECGC 2HK8A 4MS1B 4TRJA 3PLRA 3AB8A 4R1PA 5D6OA 4GPTA 3HNPA 2ZR9A 4EPVA 3VU1A 4U2EA 4W82A 4RQTA 4TTQA 4ZI2A 3UQZA 2XZOA 3ZHYA 2NTJA 2PPVA 3Q3GE 3GBPA 3NV7A 5EHQA 2W6IA 3BWDD 2AJDA 3PNOA 3G0GA 2XVAA 4FXPA 1OROA 3OH8A 4OFBA 4BQPA 4BFCA 3LU1A 1IN5A 1YRQA 3OCXA 5FUMA 2VDNB 3PHHA 2GZAA 3LHIA 4Z4QA 3R3HA 4B4VA 1ORWA 5H7XA 3IH5A 1EGQA 2XB9A 3I9KA 1TTHA 4WBNB 1VE3A 1PJ3A 4ND8A 5MGBA 1B6TA 4U7FA 1J9ZA 4EBFA 1DX6A 4QBTA 1OWLA 2NO9A 3F9CA 4O2BA 4F2GA 2JZOA 2CLSA 1OAOA 2X8AA 3L4BC 3WMWA 1C0KA 3CF4G 4XVCA 4A23A 4BCBA 1XDUA 4UVEA 4PQGA 5HIKA 3PGVA 1ENZA 4BGVA 2C59A 3HWSA 3DEYX 3MRTA 3NONA 2R4UA 2EQAA 2FN8A 2X8LA 3ASVA 2VRWA 3PUVA 3AIIA 3CF4A 1NZDA 2ZXUA 3C7CB 5J4VA 5KNBH 1OF1A 2FPSA 3B48A 2R97A 2WJYA 4YAGA 3WNQA 3AXSA 4MI6A 4EA9A 2R3SA 4IH9A 4JEIA 2X40A 4QHYA 1W1UA 3QVGA 4FCWA 3JZDA 1TIBA 1E7QA 4H4EA 2QAGA 1UPXA 3KAKA 2VQ3A 3CINA 3FWHA 1WUHS 3AUAA 2Z9CA 2J3EA 3KZXA 3VA7A 2BZSA 4N1AA 4M8KA 5F5NA 1R0CA 2FW0A 2E49A 2DKFA 2GJSA 3AG5A 3EE6A 2DYKA 3DF7A 3NWBA 4H6WA 1FYWA 4Q9JA 5SZJA 4HAIA 4YJ3A 5KPJA 3C3CA 3AY0A 3N1UA 2XAUA 4DZZA 1M9NA 3WXBA 4G84A 2HSZA 4OKIA 1U3FA 1DAHA 3LP8A 4AZTA 4CHTA 1NXSA 3AKEA 2W7TA 3FDIA 3LUFA 5JSYA 3ZK8A 2D7CA 4DLXA 1RCFA 1QZZA 1LX7A 2O2CA 2XIQA 3W6PA 2HA2A 1VIVA 1HSZA 3LT1A 2AJ8A 1D4AA 3LQFA 4M88A 5LB4A 3WNCA 4HDKA 1M2JA 4IGIA 2POCA 1C1XA 3M5CA 4ZO9A 1NBHA 4FCCA 4FZVA 2ZPTX 2F48A 5DM70 4Q3DA 3ZWCA 1P62B 4UXJA 1SKQA 2KBEA 3DS8A 3AQIA 3AW9A 2Q5JA 4RLHA 4JT2A 2G3YA 2BP7A 2E4WA 5LWQA 3Q3JB 1PFKA 3DQQA 3F74A 1RPZA 4Y2TA 5JDCA 4FYYA 3ZDRA 4N8SA 3AERB 1Q0TA 4L4XA 3W3AD 1QQTA 3QU9A 1J21A 3E3NA 1EDDA 3QOFA 5KTKA 4BZZA 4R1SA 2VK4A 3AUSA 3DE5X 4L7QA 4NE7A 3PD0A 4EUNA 4F5EA 4DY6A 3W4KA 5CG2A 3ZCUA 3FYHA 1LS6A 2IF0A 1C81A 3GJSA 4HQ6A 3ORYA 1M2GA 4P58A 2IYPA 3BVPA 2JIBA 1ZGGA 3UHJA 1QG4A 3GZNA 3LIIA 4MRMA 4XH9B 3T7AA 5JHGB 3IIEA 2OCAA 4NS4A 4P0PB 4EBBA 1UP6A 1W0KA 1NQOA 2P62A 1P0PA 1DC8A 5AYVA 3A05A 4D9NA 1G1MA 1U2RA 2YDYA 5D2CA 4IFTA 5LR6A 4QELA 2HK9A 5DCWA 4HWOA 2QAIA 2G83A 1FMLA 1DS6A 1FOEB 3HI6A 2FUG6 2FWBA 4RHFA 3P2YA 3T15A 3HKBA 2F9MA 3K9LA 3MGKA 3F2VA 4EKIA 1NX6A 2BZ0A 4H3KB 4BP1A 5BXYA 1VFPA 2JD2A 2JD0A 3LCCA 3LCVB 2QD2A 3TXXA 5HQ3A 2AK3A 3OZAA 1ZWLA 1DAEA 3SXUB 1ZU5A 3RK1A 1JAHA 2Y0PA 1GTJ1 4QLAA 4WECA 3ABIA 1QHXA 2Q6LA 3SZ3A 1NU6A 1QK5A 1FP2A 1XVVA 3O38A 3Q4GA 4DJJA 3NTQA 2IELA 4IVRA 2P2CA 3B7PA 2EYUA 3LDAA 3QUQA 3WYGA 4YUVA 4HMQA 3UB4A 1YA4A 5AUPB 4B09A 1J56A 1V0JA 3FFAA 4HSEA 4YMIA 5G3YA 4EAQA 1SXHA 4MWBA 2HWWA 2I7DA 4NARA 4Q4CA 5FAXA 3KAPA 3FNQA 5GVRA 1I4OA 4LSMA 4BNUA 4NBVA 4ARIA 1YUMA 2OCYC 3A4IA 1MH1A 3ACCA 1FE8A 3MJVA 3Q6NA 3QYJA 4K81B 4I46A 4L07A 1CIVA 1CZRA 1XXHE 3EQZA 1R7RA 1EUDA 3NEPX 3QWAA 4HGOA 4KB5A 4N40A 4Z0PA 3TR0A 1XALA 1KMQA 3DMDA 4GKJB 1K27A 1YA8A 3NJRA 1V1MB 5LQMA 4IDQA 4RA6A 1XZQA 4O5OA 1E9AA 3FGZA 3ITNA 3ODGA 2ZBEA 1GZUA 5IK2D 2H2HA 3U9TA 2AF4C 3ILHA 1GPMA 4MS3A 2BVNA 1UXKA 5H59A 5CM9C 4NV3A 2P5TB 2DLDA 5I9NA 1J06A 5PGMA 3NBYC 3IAS6 1T91A 2A9KA 3GUUA 4FN4A 4OQYA 4Y0NA 1A5AB 1G4HA 3L0SA 4LXHA 4HF7A 4L75A 2EFGA 2P35A 4Q93A 1G5PA 5K5EA 3EXEA 5L95A 1K98A 5ADWA 4KUEA 3VTAA 2ZSBA 1SVOA 1KYXA 2CYBA 1JVBA 3E5HA 5JD6A 4I4TA 4DBVO 4RJTA 1AKEA 4RLSA 1DRVA 3ZWVA 3WA7A 2VATA 3JAMA 5E8RA 1TEXA 2JAOA 3CNBA 4YJ3B 5IKXA 2XUAA 3OQJA 3OZEA 4O4LF 1AKVA 3H0CA 3HCBA 2J9GA 4IRMA 1W35A 1WZNA 4CQLA 2JAWA 2EFCB 2X5XA 1EJ6A 2NXCA 4G9EA 2HXGA 4JP1A 3ICEA 2BHTA 1ZGAA 1OIXA 1YDEA 3C3XA 3L0DA 2QGNA 4OSPA 1G8SA 1Z8FA 1V71A 2AI2A 2Z2YA 1XKQA 2REBA 4NDZA 3T9EA 4EATA 3UO8B 4YLYA 1JKIA 3O9MA 1Q77A 3FCXA 3E6AA 1TZMA 5HJ5A 2C92A 3O03A 1VHLA 1J8DA 5DYTA 3ZW7A 2V1UA 1F1JA 1AE1A 2GCOB 3OIWA 3T3EA 2AJCA 1TM4E 3R0QA 1AGYA 5EMNA 1KEKA 5J2UF 5GINE 1TOAA 4JU9A 1W7AA 4N48A 1ZD9A 4MMYB 2O8CB 1SHTX 2ZWMA 4UM8B 4BMCA 4ZVMA 3O8OA 4UCXA 1DCKA 3GXOA 4I14A 5GJVC 3ESCA 1BEZA 1GP2A 1RI3A 4OO3A 5IUKC 3IDFA 1RBZA 5IN5A 3GL9A 2CHQA 1JSRA 3GGPA 3NJ8A 1LC0A 5EWJB 2WHEA 3JD2A 3ZWDA 1W6RA 4FR2A 1ZH0A 3GA7A 5L4NA 1OB5A 1KETA 5MFZA 5IUNC 2XTZA 2P27A 3HL4A 1HTTA 3WJ1A 3CIFA 5J23A 2J5QA 3QX7A 4X9XA 3IJPA 2P9JA 3PL1A 3BSFA 4H59A 1DV1A 1U81A 2BMJA 2OBBA 4FDLA 3AFMA 3PXDA 4JL5A 1NFFA 5EVJA 1FDTA 2Q7OE 1HLFA 2AJBA 3RC9A 4E6EA 3H2HA 4OHBA 1QXSA 2IITA 4UQLA 1B74A 1BGXT 2WT9A 2JKVA 3T7IA 5CBPB 1O5IA 1YZGA 1FS4A 1RJDA 1SR8A 1LVHA 2HCTA 3NTOA 4L4YA 4MGEA 4P2GA 4M99A 4PNHA 5TT1A 1GA4A 4ZMSA 3MT0A 4I9HA 2YY7A 4GM0A 4INZA 4PNPA 4CM7A 1BG6A 1D6MA 2JIDA 4I7EA 3V3TA 4ZJYA 1GU7A 4DL9A 3BICA 5CXQA 2C2HA 2XYPA 1GEGA 3WBJA 3X1DA 4MI1A 2CV2A 2YTZA 2B1QA 4BLTA 2A30A 1WA5A 2P6UA 1ZCAA 1VYUA 1OZ0A 3EB9A 1OFTA 1RXCA 3MFQA 1LF0A 3QMVA 1OLUB 2E55A 3L02A 5FFFA 4CKYA 3MT7A 4DCSA 2OFOA 4HPWA 5A71A 2UXBB 3RAPR 2W8BA 5AHKA 3O75A 1B6GA 2P5YA 1MA0A 1NWHA 1QGOA 4HNHA 1HG0A 2FPPB 4M55A 2JZCA 4UOQA 3UTCA 2ZPUA 4YJ2B 4OI1A 3L49A 4LJYA 4QWWA 3IAFA 1YQEA 1QHHB 4D44A 4IJUA 3JQRA 3E3MA 1KI2A 4Y2QA 3LT2A 3WLFA 1QFSA 2JG3A 4DNPA 4D97A 4QTZA 5KTRA 1IN7A 1A9TA 2OBXA 3FZQA 3GCXA 2XDQA 3JQFC 4JX9A 1OAAA 4JUAA 4FYPA 1QM5A 4BO6A 8LDHA 2A1IA 5JBNA 3FHJA 5A9SA 4XD7A 5ALIA 2VBIA 4FKZA 3UF0A 1ZR2A 3TS1A 3FGPA 4CDMA 3MGGA 1CP3A 1U7UA 2X14A 2J6CA 2JJYA 3PYMA 3V4SA 2WR8A 4AXXA 4DSTA 2PAAA 1IUNA 1CJCA 5BV8A 4KJXA 1X77A 1SURA 2VTDA 4R54A 3CVUA 2AKYA 2WG0A 1EM6A 3C6KA 3JTMA 4GOKA 1OBOA 1JKJB 1NUQA 1PT9A 1UWLA 4OHVA 1L5KA 1KAGA 2QJRA 1M6NA 2PMDA 1KU0A 2IOFK 1QFJA 3I6ZA 2PWAA 4P36A 1ZA1A 3ZE9A 1EVJA 2PGDA 5KSYA 3OVMA 5K4GA 1U94A 1DSSG 1JG6A 3R7SA 2WP0A 3ZY2A 1PSWA 2CK3A 2BH2A 4KQMA 3Q8LA 3MJFA 3EDCA 1JQKA 2C5GA 2TSYB 4C2UA 1KJIA 1XA3A 2B4QA 3A1FA 4FEYA 3KWJA 4KDFA 5A5FA 5GVSA 3CPHA 4J8PA 1L4YA 1N2JA 2I9PA 1BE0A 4CTMA 4TKLA 3I42A 2GYWA 2W6PA 2I29A 3I32A 1JEJA 4EHKA 1P39A 2SKEA 1JV2B 3KLMX 4MS4B 2P7HA 5P21A 3N53A 4JXZA 2QD3A 2V7GA 4A26A 2C7VA 5KWVA 3FH0A 1ZK4A 3NHBA 5FTKA 1FMFA 1Q57A 4KQ9A 4TLCA 3RJ5A 3E7XA 2O8FB 2ZI6A 4D9BA 2R7LA 4BEVA 3BWBA 2Z8ZA 3G2MA 2YWDA 5AVUA 1I3KA 1SUWA 1V9CA 3WKBA 1MB2A 3GRYA 5B3JA 5KSZA 2QMYA 3V4RA 2OO5C 4JJ6A 4AC9A 1OBVA 2W2TA 1G5RA 1MPTA 2AE1A 1P2FA 5DBHX 5DSZA 3E18A 1EDEA 3BGOS 3GLKA 2Q6VA 1E2HA 2B8JA 1MJNA 3JYQA 2DHEA 5CT8A 1A1VA 3L1IA 3K6SB 3V1UA 3PQ5A 4WL0A 3VR2A 3ND6A 3BA6A 5LM3A 5KTTA 1ADGA 3K1JA 4KLNA 4B87A 3G85A 1G21B 1ZPDA 4PPNA 1XLWA 4JC0A 2P5UA 3HK2A 2O8NA 2O3SA 4Q1BA 1SKYB 2ZBVA 5DRTA 1PUXA 4YDQA 3RTBA 4XQEA 1TK9A 4KITB 4KI0A 2ID4A 4HTAA 4GAEA 4MW1A 4J6FA 1SB9A 5E8JA 3RYFA 1KPGA 2JFHA 3DZBA 2C3MA 1VSBA 1ZN8A 2VJOA 3LMKA 5CJ2A 4C30A 9ABPA 5I6DA 2DXIA 2V6AI 4XYLA 3CNOA 1E64A 2IEIA 3VYRB 5KOJA 3UMRA 2GHRA 1S7CA 2VTVA 3F3SA 5B58C 5JWOA 3FIUA 4DSOA 1YFZA 1WLSA 1XNGA 3GCZA 3GCWA 4YGYA 4EEXA 2GZRA 4KDEA 4EFNA 5KHOC 5CA1A 3BHNA 1L5HA 3G82C 1H9AA 1LBQA 2W6ID 3L0BA 3ABQB 2I6TA 3K4QA 1F8FA 1FDWA 3WP0A 5BN5A 2CFIA 2ECKA 4L02A 2FU5C 3ICCA 3PE4A 5IAJA 1RLCS 5LQSA 2PGXA 3RD5A 3L84A 2ZB8A 3NALA 3AHFA 3CW9A 3PUWA 1EA5A 1ZCZA 1EGMB 1QHGA 4A10A 1ZBQA 1I4DD 3DO8A 1JZTA 4D4MA 4TXHA 1J42A 5DW3A 2C5LA 3H3JA 3L4KA 2OCIA 1N1GA 3P97A 2EAUA 1RHMA 3DMYA 4JI1B 4LJKA 4D25A 1OAOC 4H3HB 1NVUQ 5FLYA 4F5ZA 5L3SB 3I2HA 1GEEA 1ST3A 2QRZA 3OPMA 1RYEA 1PJRA 1L9XA 3L7IA 4LRYA 3AVQA 5EJIA 3GVXA 1RADA 2G04A 4QHTA 1WB9A 3VR1A 1T0HB 3IV9A 3BFXA 3GAZA 4JB3A 4A82A 1JYSA 1ULBA 2EVWX 2PL5A 1VG1A 3ABRB 3B2NA 2VYND 3P19A 5DTEA 5FTMA 3IQFA 1W0JA 2HJ9A 2XZDA 2VAVA 3L0YA 3TSZA 2A92A 3C6BA 5I01A 2KLBA 3DDNA 4XX0A 3T3MB 1UWKA 5DW0A 4TLLB 1MQAA 2J7PD 4TVOA 3TINA 5DSXA 2B6HA 3GFVA 4WMLA 4NMMA 3N87A 2G1KA 3OSUA 3BWVA 3V1LA 1U0JA 4CTKA 1F3OA 1I32A 3M82A 1TKCA 2EW1A 2W00A 1YZ3A 5JZMA 5L51A 1U0OC 2GPAA 4RMNA 3G02A 4K40A 3SR0A 4ED9A 3ID6C 3HN2A 1PV4A 5J4YA 1G2OA 3IIMA 4WEQA 3LCJA 1AQLA 1YVRA 2B7BA 4UHEA 4ZTBA 1Y1QA 1JLLB 1HYQA 2H1FA 2PX2A 3HADA 3IFSA 5EEHA 5KOYA 1M72A 2PVPA 1G4AE 4GM4A 1W36C 1CR6A 4GMHA 2P0EA 1PJCA 2RHHA 3LBIA 4ND6A 2C83A 1KR5A 4ZPXA 4LJAA 4RTRA 2Q3EA 3WMEA 3ZKWB 1BD3A 1G38A 2AB0A 4NKRA 3CWCA 4HDNA 2PIAA 4M53A 3PIRA 2JCBA 5A7FA 5KU7A 1IN1A 2F1JA 2PDAA 2W71A 2XE4A 4IMJB 4PYNA 4F7WA 1XTUA 3P4XA 4P6VF 3VVLA 4CKWA 4ZXFA 3G8YA 1RRGA 2FW6A 4F3YA 3OFKA 4I4NA 3OFSA 4QJ5A 2QR2A 1PG0A 4FLFA 1DJLA 4XIFA 1KGDA 1VBMA 3GDFA 3MLBA 5JSUA 1ORIA 2OAEA 2QN6A 1BQ4A 4B3JA 4ZZIA 5L6LB 3H1BA 1BFDA 1KEUA 3P52A 1KZHA 2PO7A 2QM0A 3JAWA 4WOBA 1Z88A 1CZNA 1PZXA 2ZB2A 2P7IA 2GF0A 2QLBA 2WV7A 4OKNA 1YT5A 4RKRA 2IZ7A 1QB7A 5CXSA 2J45A 1BH2A 2ECFA 2W0MA 3ETDA 3GFQA 4Z4CA 4AWAA 3D6TB 2PSSA 1H05A 2G6BA 4BNKA 1D0IA 1UDAA 2PX5A 1SCAA 2YIJA 3QUBA 4DLNA 3I04A 4JOCA 5D85A 3CXUA 2ZYWX 4X1YB 1PW5A 1L7NA 2VSNA 4NENB 4PZUA 4A8JB 3HO6A 5IH7A 3I2JA 3DFUA 4OREX 4P35A 4BNTA 1P29A 1ZM3A 2F17A 4H6XA 5TARA 1EKXA 4OHOA 4WCFA 3F2IA 3T5PA 5KNLA 3S8EA 5GADl 3QW2A 4KODA 4PTZA 3L01A 1DINA 1CTQA 1L1RA 2SHKA 3C1OA 2IYVA 3CNQS 1G2PA 3EGXA 4UXIA 2GEBA 2N0SA 2Y0CA 1NC3A 2AFIE 2GUWA 3H19A 4QYMA 4ZEVA 2JVJA 4GYYA 1E6KA 1GPAA 4KXVA 2IW3A 4DHEA 4HUTA 4TV9F 3SQDA 3TSYA 3ZU2A 1L4FA 1F7VA 1FSZA 2AQHA 2OILA 4DM4A 4DY4A 4B3SB 5F4BA 3LCUA 3R9WA 3NWEA 2Z43A 4DR5B 3V1YA 1SY7A 1VG0B 1CE8B 4L8VA 2ZUTA 4L9SA 3GVHA 2RHBA 4OSEA 1X7XA 1GSIA 1DEAA 2QLTA 3LT5A 3FFTA 3SVTA 1NOKA 4PGMA 1QSGA 1VMIA 2H2WA 2JHPA 3C1TA 4FFDA 1BD4A 1N5LA 4NNOA 3MWEA 4S1NA 1GM5A 1EFAA 1V16A 3AG6A 2JJ1A 3DTYA 3OKCA 5KKAA 1L8OA 1XWIA 3LSTA 2JDIA 5TF4A 3H1PA 1AO3A 4KBYA 2RI1A 1V41E 1VB5A 3DZ8A 3IAUA 4PS0A 4BGIA 3U4MA 3UJNA 5CX1B 4BQSA 2BHLA 1UFKA 3PD7A 4X8HA 4F6CA 2HNBA 3C7TA 2C3YA 3ZJ4A 4GG1A 1OC4A 5J4HA 3CJTA 4CI0B 5BSGA 5BQ3A 3Q7QA 2YNMA 5IJ9B 2H4WA 3EIEA 1ZBDA 5BSRA 3IYLW 3DKRA 4MSUA 3ZDAA 5BOVA 3ASYA 4LJ6A 2B69A 4RKFA 3BWYA 4U7HA 4F97A 1E1RA 1XEXB 4FDVA 3HE3A 1RLMA 2G7MC 4C4SA 1OIVA 4L51A 3JYLA 3U2QA 2PT9A 3QLVC 4UOZA 1NUSA 1K6JA 1SVUA 3KSDO 5TY0A 5E9AA 3ZY4A 4CLRA 1MO4A 3UXMA 1U1DA 3GIDA 1P0CA 3PPVA 1IBLB 4K6OA 2IPOA 3JATA 2NWQA 3PFCA 2FY8A 1G55A 3Q0EA 2Q5HA 4PYLA 1R50A 2R7KA 3P1JA 3TKAA 3VPAA 1PP4A 1WV0A 4LTNA 3FMGA 1RRPA 4V03A 4LJSA 1A9YA 4C21A 3E03A 3PA8A 4IW3B 3DE3X 3NC0C 1XZNA 4TVBA 4A27A 2AOTB 2REQB 1Y33E 3G17A 4EG5A 3F7OA 3GVIA 4J0JA 4UOEA 4ZJUA 3RAEC 3FMOB 2C3OA 3WFZA 4DA7A 2X3FA 3GJQA 1KH2A 1MNQA 2BGNA 4RD4A 2V67I 1Q50A 2W2KB 1CY7A 4R8LA 1LDGA 1AA1C 1XKXA 4IH1A 1VL0A 4C6TB 1N78A 1ZJ5A 4G0ZA 4DCUA 3DXXA 1U80A 1PNQA 1GO2A 4R51A 2R8YA 2BISA 2YHUA 3KPVA 4B4UA 3A2NA 1USKA 2PWZA 2Z56A 1NTOA 1M1YA 1DFHA 5M04A 2B1GA 1FTSA 3B13B 5EJFA 5U1PA 5TMEA 3H18A 1D03A 5L3QB 5KI6A 5GZ3A 2WNHA 1L4UA 4JJ7A 2WM9B 3MJEA 3DT8A 2BPOA 4GX0A 1D2RA 3H87A 4FWBA 1YR8A 1E2MA 2QVLA 1AX9A 5EQJB 3WLMA 2PSDA 3LWBA 1A69A 3NRJA 4PLVA 2DVMA 3G89A 1VYTA 1P1CA 4B75A 3K0AB 1B6RA 3ML1A 1K7XB 3MLAA 2PUEA 2AA3A 1WUTA 3PRYA 4HRVA 2HTEA 2J08A 4O6VA 3IUNA 2OBNA 4G0XA 4B40A 5COBA 1FK8A 1GG5A 1LSOA 1YDHA 4UDOA 4UULA 3WYCA 5J2TA 1SOUA 1RQRA 2HA7A 1IHYA 2ZXFA 2ZW9A 2Y77A 1QIKA 1T5OA 1V8OA 1JB1A 2BF7A 2G6TA 2G9UA 1RM4A 2PSEA 3BKWA 5AI6A 5IMSA 4BNFA 2AVDA 3UXYA 4CM9D 3LHFA 4G5RA 3L82B 4J49A 1XMQB 2JB9A 4YT2A 4V0NA 5BV7A 3R3YA 1FLVA 4M1KA 1LD3A 4ZT4A 5C5CA 1OA1A 4IZIA 1NWCA 2RBGA 1U5BB 4A1FA 4RY0A 4Y6LA 4BC0A 1N2SA 4PZYA 3L8ZA 2FJUA 4XGKA 5L3QA 1HRKA 1TVKB 4JVNA 3FTNA 4Q7KA 4O4IF 1HE1C 2GD6A 3WHLA 4YI3A 4OIMA 4RY9A 2QM7A 4M36A 2UUCB 2ZGVA 5CTJA 4ZT3A 1I0ZA 2BP7B 2F1RA 4EHNA 3ZCPA 5JOQA 2ZIAA 3TDKA 2DHQA 3TKYA 2CNWA 2RK6A 2Z4TA 1ND6A 1R6VA 2YHIB 1QKIA 3I5MA 2GETA 3N5KA 3LX5A 4LDZA 1Q7BA 1VPDA 3T0FA 2AZXA 2OV8A 5LQJA 4PC6A 2QX7A 1JKFA 4GYKA 5IDQA 4R8KA 4O8ZA 2F6RA 1N6RA 1TQ8A 2C8LA 1RJEA 5EP2A 4M8NE 1BOFA 2NNLD 4R84A 5K3DA 2QV0A 1V6AA 2EX4A 2FGKA 2FNAA 4DM3A 3SZMA 5BR4A 1TX4B 3OEYA 4LYJA 1HEIA 5UKDA 3WRWA 1PL7A 3AV0B 1OLSA 2AHRA 3LFTA 5JZSA 5JTUA 1M2WA 2PKXA 5C35A 3CZ9A 4FEEA 5DCLA 5IKMA 4UEOA 3EA0A 3O3CA 5HHTA 1XIVA 2ZBDA 3B8HA 3OPYA 4KXMA 4C04A 3KAQA 1SBQA 1TZJA 1HM5A 1U1IA 1ZGBA 2ESRA 3IAHA 3CWQA 1JL3A 2I4IA 3K9WA 2ZANA 1HDIA 4FHZA 1ZOIA 1CVRA 1G5IA 4YRBA 4OI0A 1PDVA 4OAOA 5E0OA 1GGJA 3LL4A 4K9NA 6REQA 2P78A 4F60A 1VA5A 1A5BB 1FP4A 3RVQA 2E4ZA 2OCXA 3K8ZA 2OA0A 4DR6B 2F62A 3COJA 4JLOA 1D0VA 7YASA 3C43A 1RRKA 2NT4A 2A9OA 3U44B 3E2MA 4ZTUB 1IUPA 1C5KA 3F46A 1DXQA 4PNEA 1AGXA 3CX4A 1Z2DA 3WJ7A 2R2AA 2CNOA 5CLLA 2XOKD 1SUDA 3PK0A 4JL8A 4US1R 2L2QA 4S2EA 1TJ4A 3DTNA 1P6XA 4IHJA 4RIEA 5T4HA 3GLHA 4XB6B 4EPYA 4JEUA 4K0RA 3TYXA 5HYVA 4FE4A 1PGJA 2P2SA 3EVCA 4DE5A 2JIZA 4MPRA 4ZDIA 1JFRA 2RJOA 4P81A 2BFAA 1J9GA 2UVPB 3JZAA 3R7FA 4ARAA 3NVAA 3EXG1 3TTYA 4LE2A 3WNBA 4ZI7B 3GBSA 1ZSNA 3IQHX 5ITZA 3TZ6A 2FQYA 3QELA 5EYPB 3A6LA 4C14A 1J33A 2WIAA 4H15A 4IQ8A 1TADA 5F23A 1EBUA 1ZD8A 1PG5A 3ZV5A 2BRUC 2A5YB 5ITWA 1PDWA 5JU6A 1WM1A