3TG8A

Mutant ribosomal protein l1 lacking ala158 from thermus thermophilus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
214
structure length
214
Chain Sequence
VDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Structural analysis of interdomain mobility in ribosomal L1 proteins.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 66
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 3tg8A01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tg8A02
1MZPA 3U56A 4REOA 1ZHOA 4DFCB 4QG3A 4QVIA 3FPNA 3QOYA 5DM60 2HW8A 1CJSA 5DM70 1U63A 4LQ4A 3UMYA 4QGBA 3TG8A 4F9TA 3ZQJA 3U4MA 1I2AA 1DWUA 1AD2A
chains in the Genus database with same CATH superfamily
3CW8X 5KDLA 3JVVA 2C5AA 2H54A 1V5WA 4IX9A 1PJLA 2CL6X 5HKKA 2DULA 2H2WA 3GQVA 1EVYA 4H16A 4X92A 4D3FA 1ETUA 3QX8A 4Y18A 4DPMA 3UV3A 1CUAA 3IVRA 5KSZA 2Z5GA 1FFWA 3KOUA 2IRWA 5BT9A 3ZWBA 4WUVA 5KDDA 2P1RA 5CFQA 1RKBA 3UKDA 2X8BA 3ZLJA 4UU0A 1GU1A 1O5TA 1VA4A 1E0JA 3IR6A 4RVGA 4R83A 3KHTA 1E2QA 4URVR 4N5IX 4MNTA 2VA8A 4G07A 1KFJB 1U5BB 1TYAE 1C4XA 4O8CA 5EKSA 4DUGD 4EF5A 1T2AA 1EWVA 2VA9A 3TZ6A 4NWIA 3DVSX 4TV9A 4M1SA 5JS1A 2JHGA 1YIDA 1UJBA 3BCSA 4GR9A 3LPLA 1DTEA 1YH3A 4X1KB 1KQPA 1H6AA 2EWWA 1BYIA 3DZCA 5CLJA 1S2LA 1LJ8A 1CY2A 3AM5A 3UQZA 1XAJA 2EHDA 4C0AC 3IIKA 2HR1A 2AFRA 3H11A 2MR6A 2VLIA 5DW3A 1CP2A 1BO6A 1MW8X 1L3BA 3EZXA 4C30A 1COWD 3R0IA 5SY4A 1MLDA 5HMMA 3EZNA 3ZHXA 2I4NA 4IFEA 1AQYA 1Y7IA 3MTGA 4EYSA 3U9LA 2ZUBA 5EXSA 5BUSA 2X5XA 1JQLB 3MJSA 1JKMA 1M8JA 1SG0A 4BFTA 2PO7A 4TS1A 1J49A 2X8LA 2ZIGA 4QEZA 3TZLA 1YZKA 2OECA 4NBTA 3SXUB 5IHPA 5ESRA 2CLEB 1EXWA 2ROQA 3N2GB 4DQVA 4LK2A 4ERNA 1I32A 4IG9A 5DSZA 2OBFA 1YZQA 3TEFA 1SBQA 2ZZKA 2QSZA 4W4TA 2Z2JA 4AXXA 3AIKA 3BJRA 3WNQA 3MD0A 2J07A 2Z6UA 2V1UA 1KMIY 5EWJA 1ZUD1 1IAVA 2H1WA 3L1KA 1M74A 2P69A 4IUCS 4PLGA 2PX2A 1LQUA 3CA8A 4QJ4A 5HSGA 4QODA 1NW7A 2FLKA 2WVJA 1LX7A 2OB2A 3G1UA 3L9XA 2PFSA 4Q3AA 4Z5XA 5E4JA 1WF3A 2X8JA 3C6QA 1ZBDA 1E3IA 2B0CA 2DE0X 5KQLA 2IYWA 1TYBE 3EXEA 3P20A 3HXTA 3VZSA 1HFKA 2F59A 4OGFA 3FGOA 2FDRA 2C5BA 4MQ5A 2C7BA 4IX1A 1IOZA 4CM4B 1QF6A 4ILEA 1E4YA 4QFDA 4ZO7A 4BLPA 4RTKA 5F2OA 3C45A 5EXXA 2GN8A 5HM8A 1IM8A 2O8VA 1G1AA 2D54A 4K7JA 4J0EA 1KK0A 3OPVA 4TKZA 1QQ7A 5K51A 3MUFA 3FNEA 3M70A 2OBMA 2FR0A 3MK31 4FGWA 4U3JA 2OCXA 2V5VA 1C3XA 3BWBA 5TMBA 4V3BA 3LKBA 4U0JA 1PD1A 1B8PA 1K6EA 1W6RA 4JAVC 5CNKA 3V4ZA 2WWYA 1A5ZA 4KAAA 2EATA 2NU7A 2DECA 1GSOA 3PJEA 1MHPA 4OHBA 4RTQA 5DTIA 1Y1QA 3E3LA 3GMSA 3TEJA 1UXJA 4HMOA 1WY5A 1E77A 2I55A 3QEJA 2V0NA 4YACA 3S1LA 1O8BA 2A1TS 3S55A 3KFXA 3DT9A 2Z95A 3BICA 5MGNA 3EUAA 2FOLA 3DZBA 4AF7A 4TUYF 2V7VA 4Z2AA 4ROSA 2EYQA 3GWGA 3GNTA 3ZXUB 4WZBB 1NPTO 1YQDA 3G7SA 1NE2A 4RZ3A 5M29A 3WP1B 4WZAA 4H1HA 4RK0A 4NG4A 1XMVA 3S29A 4Y9RA 2ATIA 4AZ0B 5KNDD 3KX2A 1AXRA 4TYYA 4OKNA 3A36A 2HQOA 2IHNA 3GGGA 4TWBA 2AN1A 3ZV6A 4YIHA 3GRAA 4YJGA 1YRWA 4IFIA 4ZAYA 2GARA 1UBNA 1WTAA 3B3FA 5LMNB 3T99A 1LVGA 5AI0A 4RZQA 5EJGA 1Z5GA 4QBTA 3JTEA 3RF6A 2XE8A 5G4KA 4JI5B 3M4JA 1N6LA 4EITA 2FJPA 4JCOA 3RVDA 5T67A 1XZGA 4IZ6A 4MQMA 1JVSA 4O4HB 4NYIQ 2UVQA 4L7VA 2JVJA 4DV1B 3JCZA 4DQUA 3DVAB 2IH2A 4L9AA 3F73A 4F1KA 3OEEA 4NX2A 2IW1A 2CE2X 4LXIA 2PUCA 3AY0A 3DM9B 4MYTA 3CMCO 3QXGA 4F12A 1LBIA 4I46A 3WWCA 5CCXA 5FNZA 1KGDA 3UF0A 1M2VB 2DFXI 1YF3A 4G09A 4GMHA 1L8XA 1UKEA 2NXJA 5T6BA 2NZ2A 2W6ZA 1PKXA 1FP4B 2PZMA 2Z09A 5CTAA 2Q1SA 3E22B 2V63I 3JR3A 2OGTA 3PL5A 4FS3A 3U44A 3IKJA 4G01B 5I8WA 1TEVA 3WOVA 3FHOA 1NVGA 1PHPA 1JMVA 1EFCA 2ZIAA 2WFMA 4LTNA 5F4BA 4E5YA 3PEWA 3VC7A 1B14A 3A0UA 3DH0A 4UQPA 3U2QA 3JRNA 4BLUA 1LRKA 4LSWA 1ULAA 4C2AA 2A4KA 2R85A 2YYZA 2VZ9A 5HIIA 3ZXYA 4AMYA 5CUQA 4F60A 4Z9YA 5DW0A 2FZGA 2OWEA 3FG9A 2AVDA 1WY7A 1X7ZB 2TMDA 4NPCA 1HA3A 3RT1A 5EJFA 1MC5A 1TU4A 2F8MA 2Q3MA 2D7DA 3RTEA 1I3KA 3CQ9A 1ZIOA 2C84A 2J4DA 3DFIA 2E0IA 4U8HA 2L18A 3E2MA 4LDNA 2A35A 2X1HA 4QQRA 3GRFA 5B53A 2HPHA 4B3CA 4EW3A 4Z7OB 3ORRA 3AI2A 4PV7A 2F00A 2YNMC 3P2EA 3ETLA 2PZFA 4D9GA 5JLAA 4EELA 1H2YA 1ZRMA 5FPTA 3WTCA 5T57A 1VC2A 4JI3B 3HXOA 4P4GA 3GFOA 1XTPA 1BQ4A 3LSYA 3LUPA 1Z08A 1YQEA 3O2QB 2QX6A 1G7RA 1ZD4A 4QUHA 3R7SA 3T5PA 2B9EA 2FN9A 3KKQA 2EKQA 2NYVA 4MRVA 4F92B 1V6AA 3GL9A 4M1KA 2J45A 3FVQA 2P2LA 3JALB 1B23P 1FMJA 3L84A 5CP8A 2A9PA 3H9CA 4BWVA 4UJ5A 2GM5A 4OHVA 3FTDA 4B6PA 3JSAA 1Q11A 2FK7A 1Y1RA 3HJGA 1HDZA 4NARA 2QM0A 1KIFA 3KV3O 4G1MB 4LTMA 1QKIA 2ANCA 2HRRA 1QANA 3IO5A 2XUAA 2Y0CA 1ZM7A 2Q1UA 4RACA 2NXEA 4FFLA 3B7WA 1PLKA 2QTVA 4ZYVA 5DSTA 2CLKB 4B4VA 4TVKA 4KP7A 3A1EA 1LBHA 3FCXA 2QN7A 3R5JA 1XZIA 3DJFA 4HK4A 4X93A 5T3YA 1NBIA 4IGAA 3NM4A 4UAVA 2WKWA 2NP6A 1GUBA 4OFWA 4ZP1A 1OT5A 1WLYA 2EOAA 3L41A 1L5FA 4PYRA 2C00A 2ZJYA 4HQ6A 4M8KA 4H59A 4D44A 2K4MA 1LRLA 4XKJA 2BP7B 2VJYA 1ZH0A 4PIPA 4LBWA 5KWSA 4X44A 4M1ZA 5GJCA 2V6FA 4J0CA 1TAUA 2VCYA 3W79A 3IE0A 2IL1A 1O8CA 2Y0PA 3FF4A 4D98A 3LVFO 3V32A 5KTPA 1TCUA 4UBKA 3SN6A 3AR3A 3W8DA 4ENSA 3I04A 2OEPA 1E61A 1UBMS 1RBLI 4YK7A 4IEIA 3LHKA 3M4ZA 3BE4A 1H6CA 1QIJA 3L4BC 4HSGA 2XQKA 2EDAA 2Q4DA 1F2DA 2AGVA 2DH5A 3CUUA 3PEVA 4R3NA 5KBYA 3WRYA 1Z18A 4TUYB 4Y9SA 3ZHYA 5BV1A 1M1XB 2Q5CA 4G0WA 3PFGA 3MBOA 4BVLA 2ZVQX 2ZIVB 4EMUA 2QROA 1RKVA 1CZUA 4BMZA 4K9LA 1SVSA 1TO1E 1EQUA 1M6NA 3GUZA 521PA 4B84A 5GVRA 2OZLB 2I87A 2YX1A 4GOND 5CW1A 2OXIA 2XYVA 3JQGB 3ZDRA 5BN3B 2PJRA 3CH6A 5EHIA 3K0AA 4HDOB 1CRPA 3B6IA 2O7QA 1GGFA 4DR7B 3DNMA 3EFBA 2O8CA 3VU3A 5FADA 3LXMA 1FLNA 4QE3A 1RHKA 4AJKA 2AD1A 2BFPA 2LBPA 2AC7A 4ND5A 3WLKX 2B9VA 4DBZA 2ZIUB 1JFFA 1I7PA 1S2GA 2G77B 3TAHA 1U80A 3WSVA 3ESDA 4O0LA 4KTVE 4WEOA 3E4DA 3UVEA 5ARBA 5F73A 4G0QA 4L8LA 1NYRA 1R8YA 1RACA 3KQSA 5LYYA 4Z4IA 3WLMA 5HK8A 3LGAA 2JI9A 3MWEB 4XSGA 1NJFA 1F7UA 3ZVMA 3VUFA 1EDEA 1UKAA 3LWNA 1U0BB 4R16A 3S2SA 3OY2A 5M5BA 1GAQA 3ORFA 2JATA 1LS1A 1EGAA 1PR0A 4GEKA 5KYVA 2JCXA 4BX8A 1KI6A 1MORA 5JQGF 1JHVA 1JEYB 3ESAA 2A3RA 1FX0A 3GT3A 4PHGA 4UZEA 4WZAE 4I50A 5ECYA 1ESCA 3OQOA 2WJGA 2EFHB 3NIDB 4M22A 1FA9A 1V1MA 4P33A 4WK0B 3TW8B 4CMAA 2J08A 6CHYA 2BGKA 2DT8A 4FZRA 3BJMA 3RANA 3ZIUA 4H1VA 1JXMA 2G70A 1CJUC 1ZI6A 1GZ3A 4P3OA 4EEKA 1T8RA 5FTLA 1J8FA 1BFDA 2JLYA 2FPUA 1JLKA 1QGUB 5IYZA 2BGLA 4RTRA 1NKSA 1Z83A 2JIRA 4BAZA 1UBOS 1QBKC 3RLIA 4FB5A 1RZRA 1T2NA 5T6MA 3TH5A 1OBOA 4XUEA 1IM5A 1UM8A 3LL4A 1YZGA 3PYXA 2CDRA 5HE8A 2WMOB 1NOJA 2OHOA 5CA1F 5EZYA 4G0YA 4UMDA 4DMLA 2NQ8A 5D2CA 3BH6A 5AK4A 1XEFA 3I9OA 1WPRA 2FPMA 2BY4A 2PX6A 4KUEA 4AULA 3DKIA 3KQHA 3ABIA 3TSCA 5CIWA 2DWUA 2OPHA 4FC7A 1JV2B 2F9FA 4K05A 1E96A 3IP9A 3QPAA 4RANA 2KI5A 2WUEA 4Q9KA 4Q02A 4I55B 4BV2A 5A03A 3JQ8A 3MHPA 1KJZA 4K9PA 3M9XA 3TYXA 3H4MA 3B6KA 1ZH4A 4NBLA 1RM4A 1Q5PA 3BK1A 1N78A 1EE2A 1UBSB 1VCNA 4G5QA 3KFVA 2ZJAA 4IFBA 4EFNA 3OZVA 4MUGA 3MWYW 4AN4A 2WTBA 5IT5A 4WVLA 1RXIA 5IDYA 2BFWA 2I2CA 2WAMA 2H0RA 3AVVA 1FJ2A 1O58A 2QRGA 2HGSA 4G36A 5CBPB 4B3TB 3SMVA 2CEAA 1G8GA 2FW1A 4K3VA 1D09A 2JIPA 3O92A 1C1HA 4UBOA 3K9HA 1M1NB 4O3FA 2WHRA 1DAMA 1SOUA 1BEUB 1H1TA 3NXKA 5I9LA 5IULC 4YN3A 1U11A 1K6MA 4H9GA 3RSFA 3AY3A 1KFCB 1ZK0A 1FDWA 2LE0A 2YCLA 4HADA 4K86A 3A7DA 1PNTA 4MCAA 4TTIA 5AW5A 3CFYA 3RIHA 1U2GC 3W5JA 3GH1A 3IQWA 1WOYA 2BEVA 5GP1A 3P7MA 2ECPA 2Z5FA 3MBIA 2O14A 1V4NA 1E9DA 5D5QA 5HGXA 4HAOA 2P2GA 3FYSA 2RG7A 4GR4A 1BDBA 3HH8A 3S3TA 4ZOLF 4BAGA 1V35A 1CVRA 4OM8A 4F6LA 1GT91 4XOIA 1FLVA 2PDAA 4GM4A 3IA2A 1B2RA 3WZMA 4CKXA 7ABPA 1MP0A 4XH9B 5ULLA 4EPXA 5DN6A 4LHZA 1RJDA 1VYVA 2NLOA 5HA5A 1RFGE 3B7PA 3GJ4A 4DXHA 5ADWA 3Q7QA 3S5JA 4PYNA 4MB0A 1LJLA 1BAPA 2XUHA 1E8DA 3F7MA 1Y9ZA 3EW7A 3JQFA 1T35A 4HC4A 3W5VA 1F38A 1RSCI 1BXGA 1KI9A 2LDBA 1E2NA 1AS3A 2IYEA 1XU7A 3F71A 2FY8A 3EGEA 3KLNA 4OSOA 1UZUA 2QJFA 2EJCA 1JRLA 1R5OA 2G07A 3KPUA 3OD1A 1Z5NA 3PU6A 3GAFA 3W4KA 4DM4A 5BW5A 4XIFA 1OLUB 1GR1A 3FNBA 2CNWD 5UKDA 1N0UA 1H1DA 1Q3TA 4MW0A 5AJYA 5DEOA 3RKUA 3F9IA 2WM8A 1JDJA 2WC1A 2CLSA 3RC1A 1CZLA 1A95A 1WMEA 2Z9DA 2AZXA 2A9JA 3JY6A 3UEOA 4KQEA 1X7XB 1CHNA 4IIBA 2AG8A 4QJ3A 4MGHA 1WCYA 1HC7A 2F1OA 1M10A 1ZKMA 4H7FA 5I9BA 1F3LA 1E5DA 4HAZA 3SF0A 1HEIA 1JHDA 1U8TA 4V1CA 1YA6A 1IZYA 3L1UA 4EW2A 1U7UA 3LDUA 4BNNA 4QWMA 1QX4A 2JJ8A 4JA0A 5H83A 1ZCZA 4L15A 3V5NA 3OH8A 4EAQA 2GBCA 3I5YA 3G9QA 2FHPA 1MAUA 3IEUA 4HJRA 4TKLA 2N0SA 1PDVA 5FXMA 3IOCA 2WNHA 1TU3A 3VOSA 4LXHA 1CT9A 1TCVA 1G16A 2NWQA 1KBOA 1XP5A 3MRXA 4RQAA 1P6QA 3AM4A 1GTJ1 1MT3A 3QA9A 4P53A 3HJRA 1SKYB 5JECA 4NU0A 2C4VA 2CT8A 3O3OB 3VH2A 1USVA 3N7TA 1VMKA 2HY7A 4KI7A 3DV9A 1UT5A 1XC7A 2VH5R 3DEZA 5FWNA 1Y6RA 1Z4LA 3OE5A 4KOAA 2UUBB 3L1JA 3PDJA 2CHVA 4FYPA 1J1UA 3CLSC 1RRKA 5TNXA 3KYDB 1J25A 1K6XA 1MX9A 5BV7A 4FS8A 1Y5NA 3K8OE 4HB4A 4P3PA 3Q3EA 3CIFA 2XGMA 3ND6A 2WT8A 3Q0IA 1VL6A 4A6DA 4PRKA 1FC0A 3LBFA 1L5OA 2P90A 4FSDA 4GYWA 4XVUA 2IWHA 1N3LA 1MX3A 3IAS1 5LP6B 4A27A 1KH2A 2VAMA 3LPCA 1XMPA 4Z4CA 1OA1A 5CA1B 5B1EA 3X1JA 5ALZA 3WFIA 2ZQ5A 4AO8A 2GFHA 2GBGA 3K70C 5J2UB 1YKGA 4KN9S 2IBMA 3B8HA 1G8SA 1N7JA 4UARA 3FFAA 3QEOA 4FBMA 4DAEA 3SC6A 2YN2A 1NMSA 1EUDA 1LLDA 3CURA 3ITNA 1IUNA 4BCCA 3SKYA 4F96A 3AF5A 2Q62A 5LA6F 4FVTA 3WGYA 2G9QA 4O5AA 3E8SA 2ENUA 4MYCA 5FR1A 5DK4A 4F5ZA 3WNVA 1LC3A 1BS1A 1HLDA 2J5QA 2XMCA 3AUKA 1T43A 4JLBA 2W2LD 1L4MA 2IITA 3ZU2A 1ZR4A 1XVIA 2P5YA 4URXR 5CXQA 1T5HX 1ONSA 1VSQA 5IKXA 5KNLA 3RC8A 3LY5A 4ZODA 4DMKA 2OAGA 2XITA 4OK3A 2H65A 1RABA 4LMRA 1E2PA 2ZR8A 3R3XA 4KQCA 3SXPA 3UJ7A 4B40A 1YB4A 4NCKA 3ONDA 2DTDA 2OHFA 1RJGA 1U5CA 4RDCA 1KK1A 5EHZA 2N3ZA 3ZK8A 1T8UA 4FMPA 2QRHA 4ENTA 1E2JA 3O0DA 2P9BA 1Z28A 2XEXA 1MAHA 3E6AA 1D3AA 1IB6A 4UAJA 1L3IA 3SLGA 4F56A 3QPWA 1VB3A 3GRYA 3N8NA 2HK8A 3EA0A 3R6TA 3DPSA 5K2MA 1T34A 5AKYA 2L19A 1AZSC 4YMHA 1SY7A 2JIOA 4OA5A 2XTZA 4BEWA 1KO8A 1E6MA 1KY3A 3FMGA 4FE4A 4RA6B 4CM7A 1NRJB 4BVBA 3TNJA 1D5CA 3T12A 2D0OB 2YJ6A 3CRVA 1ISJA 5E6RA 1XFDA 2IYOA 3SYNA 4CR7A 4DR4B 2CUTA 1ENZA 1UM9B 2BHTA 2VATA 2WTNA 2QZZA 4ZOLB 3I83A 4E6PA 2HMVA 3SD7A 3M5CA 4NU8X 4TTQA 1W29A 3STVA 2EP5A 3TR0A 1J8QA 1WXEA 1YVDA 3JRWA 4PS0A 4LJ8A 1SVLA 3S5UA 2QLLA 3UMCA 3URKA 1YDEA 4WIAA 4BMOB 5F1PA 1V6SA 4GNKA 4H6XA 2OXEA 3ON5A 3ACDA 3EOBI 4CM4A 2R5FA 4JXJA 4CDMA 3EASA 3IELA 4KPUB 1A9RA 3WQHA 2TS1A 3RC3A 3T34A 2C4WA 1JLMA 1U81A 3GMDA 3NTUA 4PEVA 1F4LA 3FLAA 1OC4A 3I3OA 4G23A 2GBFA 1JA9A 2ZYHA 3HL4A 4L8YA 4CHGA 2NU6B 3R6WA 2RAVA 3ROEA 4BB0A 3OX1A 4JEMA 3IVXA 1HO3A 2B83A 1MT0A 3TSAA 2F55A 2JAXA 1DAFA 3EVAA 4C2UA 4CZ2A 1N6OA 4OM7A 5DLEA 4B9EA 4EI8A 1G20B 1BXKA 1IB0A 1QMPA 2WJZB 1S7CA 2OV2A 1FJXA 3HXKA 1T8WA 1TM3E 3A2LA 1JP7A 3LLVA 1PVDA 3O95A 4G63A 1XWFA 1WL8A 1SIBE 4XWWA 3DDNA 4GOOD 4WZBA 3HFSA 2IV3A 1CY6A 3MG9A 4X64B 5ALXA 1OFHA 1NSFA 4OA8A 2YV5A 4LWOA 4LV8B 3S2GA 5ED0A 3AB8A 4BNMA 4MEBA 4DS3A 4NBVA 1UK8A 5GWXA 3A05A 3FBGA 3FNHA 4GXQA 2XVYA 3H1FA 4B2PA 4TLDA 5GGXA 1FDRA 4MPPA 4NP6A 4X94A 1G3IA 2Q3DA 1IBKB 2GF2A 2WKQA 4ZT3A 1DPFA 3IBYA 4ETWA 3HKBB 2AOVA 3KQLA 2I9KA 1K7YA 3SG0A 4OHPA 3D3QA 2CXXA 2HV8A 1ADCA 3O03A 3Q0TA 2ZQYA 3ZD6A 1TO6A 3E2IA 4QPCA 2CFRA 1OXTA 1H3EA 4KAXA 1A9XB 3RABA 1G42A 4IR7A 5B6IA 4JKIA 1OGJA 2H6EA 4FYYA 4KXUA 1RNLA 4QAJA 3ZZ1A 4G0XA 4V1CI 4JWTA 3ZHSA 2NUTB 2VPYA 1OKKA 3CRZA 3DEHA 1PG2A 3K5HA 1Y89A 1SM4A 3ADKA 3OOJA 4HEA1 4K9DA 4Y6QA 4CIYA 4W5TA 3MHTA 1SQSA 5B2FA 1AC5A 1U31A 4S1WA 4QO7A 1PUIA 2C0QA 2IYNA 5BNIA 1I3NA 2G88A 3G7UA 3Q7SA 1B8UA 4FKMA 4I9FA 4V24A 2AOWA 3OOSA 3ZOZA 1K8RA 1AQIA 3MIZA 1FJGB 3SX2A 1BC5A 4I2NA 4AO6A 4HWKA 1HE1C 1O94D 3CXUA 1OLXB 1U98A 1WSDA 3JWIA 5T4BA 3ES9A 5LYJF 1FP4A 2FEAA 2M9MA 4F0KB 4CL3A 5EHNA 3E22A 4YXFA 3JQ7B 3UKOA 1QGOA 1AF4A 3BMNB 4MICA 4IIYA 5KTTA 5CCDA 3K16A 3S4YA 4BN5A 2FWIA 1LV7A 5I5GA 1WW8A 2AIRA 1CBUA 2X2FA 1KR2A 5TGZA 5KTMA 2RGNA 3S70A 3OCJA 3DOJA 3GRVA 1JN0A 1RYHA 2IPXA 2J9RA 1Z4MA 3E7WA 3N8HA 5LA6B 1T5IA 2BUCA 2F7SA 1DOAA 3SJ7A 3AL2A 1A8PA 4LIPD 5C1BA 1V3UA 3TZBA 1X7ZA 2D4AA 3E15A 4M55A 2C57A 2VJNA 1E8NA 1QHHB 4UHEA 5LLTA 3EW9A 4B43A 1UZAA 4HLUC 1OFIA 1OW3B 4IIJF 1YVPA 1U2DA 3EDYA 1QH0A 3NM5A 2G5TA 1DBSA 4MYDA 4X0EA 3BC1A 5I9IA 1BJKA 1BWSA 4A8JC 2WWRA 1HURA 1VLZA 2FZKA 3DTVA 3PD1A 3BWEA 1NDHA 2C4TA 3BFJA 4TMKA 2PO5A 4D8VA 2JCBA 3NUQA 3A3OA 2C1ZA 3ITDA 4URWR 3EYAA 3Q3GE 4EPWA 2YC4C 3IXQA 5G1PA 3LBHA 1SQ6A 4XJXA 4UDOA 4YWHA 4N03A 2H17A 4HGYA 4Z7QB 3F67A 3ED5A 4KVZA 1P2BA 5JWRA 1XU9A 3OKPA 3RYCA 4C0KA 3U81A 2QMEA 3JALA 2RHDA 2HNAA 2PPVA 3IURA 3RRBA 1PD0A 3QMPA 3PUZA 1ECJA 3QVXA 4DJDC 5JRZA 4QLAA 1XRMA 1RYZA 1Z2PX 1YCDA 4M8IA 4F5EA 5KU1A 3VR3A 3HABA 2YZNA 1VJTA 2GD1O 3Q8XB 5F5NA 1BEZA 3DAOA 1RYFA 3LUKA 4TS9A 5FTJA 1D2GA 1D2EA 2J48A 1KYXA 1NNUA 3AWIA 4AB1A 4YP5A 3G8CA 2XCTB 2FP4B 2Y1WA 3M4XA 1KTVA 3QLVC 5U4XA 3R7AA 3PUVA 2BTEA 5B1DA 1WZEA 4JR2A 3RFCA 3K09C 3L8HA 4TZTA 1J97A 4TZ6A 5HCIA 2DMRA 1SXJB 3JQ9A 2CFOA 3HYNA 1PGQA 1FSFA 3W5CA 3C6KA 4OU5A 5K4AA 3HZHA 1AK9A 1PFVA 2OILA 4NBNA 1MQSA 2FN7A 2H92A 3OM8A 3Q41A 3A6GA 2NVWA 1OAOC 2OYCA 1C1XB 4DXAA 2OD7A 2XNHA 4EJ2A 1E20A 1OXUA 2ORVA 1A71A 1VRVA 2ERXA 2PGAA 2UZ1B 2VWGA 3QQ5A 4MWZA 4M54A 2V3WA 2YFQA 3BDIA 1Z12A 4D99A 3WAJA 1M1ZA 2IEDA 1E1YA 2IEZA 2GDZA 2O8NA 2OM2A 4HQFA 1CS4C 4MYRA 3H19A 2Q6OA 3P2YA 5ABPA 5BURA 2WZQA 3NHAA 4BGUA 4X5OA 1WXXA 2ZAYA 1W19A 3H05A 2V7TA 5E9WA 4TUYA 2VRCD 5SY6A 3ZJYA 4CR8A 4I5DA 3NJRA 1D8AA 3H5AA 2GRJA 1A5AB 4HS4A 4PZ9A 4Q7MB 5IBRA 2WIKA 3T54A 5IKMA 5CCBA 1BW9B 1QK4A 3F8WA 3BGVA 1MH1A 3SEFA 1RU3A 1G2PA 4W5QA 1UWCA 2GLXA 4QWWA 1EFLA 1LK0A 1O0BA 3RRFA 1DWPA 2OZLA 4PGGA 3JQGA 5A2GA 3S2YA 5AVJA 1V7ZA 1R8XA 1RKQA 3IIMA 3T3HA 3AP3A 4HGQA 5CDSA 5KC9A 1KVSA 1TK9A 5KVVA 3MPOA 4QXPA 6PFKA 5BW8A 3L1VA 3NOOA 4JD5A 4GF5A 3KOXA 4NBRA 1NF3A 5A4JA 1Q84A 3PA8A 3LAWA 1XGKA 3EZGA 1Y34E 5ELXA 4LY0A 4H3KB 1FRFS 2V45A 5KINB 1N2XA 2LCIA 4KXQA 3T7SA 3PX3A 1H1LB 1SC4A 3OLQA 5EJ8A 5GONA 3ADBA 3P8ZA 1NQUA 5EJMA 1DIHA 2Z3WA 4RIEA 3ESQA 3IP6A 2DR3A 4HUJA 1MTZA 1JNXX 3EFHA 1IY1A 1YL6A 3HYRA 1AX9A 3GAAA 1A8UA 4GS5A 4JASB 4E1BA 4YCAA 5B58C 3M6LA 3DULA 1EGVB 2FJUA 3PV0A 5CT4A 4F0HB 4YAFA 4ZQIA 3VGPA 4DSNA 1P5ZB 3AJAA 4M0KA 3FVVA 4JVLA 1GHTA 1K63A 1FFXB 1L8OA 1N5MA 2ZREA 3I73A 5EZSA 1Y3FE 2C3MA 4MQLA 1AGPA 1S1MA 1Y6JA 2RARA 5J3JA 3EUWA 4B33A 3FUXA 2AFIB 4ND6A 4QDOA 1OWMA 5FBZA 1JEYA 2VO1A 3JQAB 4JU9A 5GZ6A 5EKUA 5LYJB 5K3FA 2JAHA 1EE1A 4MOWA 1XDZA 1ESMA 1RI4A 2W6JD 1E3DA 1N9ZA 4GX1A 3U31A 2K2QB 2VCHA 1E6EA 5JNLA 1OROA 3FCCA 4H77A 1UDWA 5TSDA 4L02A 2IK8A 2H8GA 1G5TA 4QUGA 4M89A 2NQTA 4NEQA 1UKCA 1L4YA 3PNLA 1JEEA 3AT1A 1TKBA 3KQNA 2WJVA 1XELA 1ZCAA 2YUTA 5H59A 4BMPB 4JQYA 2ID9A 5A3RA 1PL7A 2XW6A 4XQGA 3UHFA 4EJSA 2VQ3A 2VYCA 3A70A 2FSHA 1H2XA 4J0FA 3PGA1 2EJWA 1NL3A 1T3TA 2JFPA 4ZMBA 1W581 1SUWA 2XYRA 2WUGA 4O3MA 3AI7A 3REOA 4JT4A 4FBGA 3OHPA 3KZNA 1NI4B 2P9QA 3P2OA 4ZO8A 1YGYA 5F21A 5IDQA 2UZ4A 1T2UA 3IT2A 1WP4A 2WA2A 2QLJA 1UBLS 2HBRA 4EYKA 1N6IA 2QJOA 4E5VA 4RPKA 2QQEA 1TI7A 2C9YA 3K73O 4BZPA 4G1BA 3REFA 1ODTC 2I6FA 3N7AA 1P91A 3BCHA 3UK7A 2DUMA 2JVIA 3GY0A 4TKVA 3EIEA 1VG8A 3ANTA 1ISIA 2OHJA 1GXSA 4B5LA 4V2UA 3WL3A 1T10A 1TQ8A 1LH0A 3PFCA 4U7DA 2H16A 4MTCA 4MS3B 2MINB 2DB3A 1ORRA 3LQ4A 3UMBA 1GTL1 2YMQA 5CBPA 1I5RA 2C7GA 5LQNA 3HKEB 3DD1A 4LECA 4COOA 1KBZA 4DT1B 4F93B 1D4FA 5I6DA 4Y1FA 4LF8B 5KVSA 1KMCA 5IJ0A 4NAVA 2WAAA 4I1OA 5IUNC 1JDSA 4J1TA 2XA1A 3NPMA 3NQ41 4OHUA 1OHHD 3O4VA 4X63A 1G8KA 4JUBA 4RW0A 3DFKA 3CVVA 2VBFA 2XOKA 3CCFA 1S4QA 4OBWA 2XIQA 4A73A 2DBVO 3HLKA 4G5RA 4II3A 2WWVD 3IUEA 4EIWA 1J2TA 2V54A 4NH0A 3TN7A 4BFCA 2ZJ2A 2W0SA 3TUJC 4AU1A 4C87A 4CLRB 1E69A 1WQ4A 4H4EA 4CKCA 4PSKA 2QAJA 4J9UE 2YWDA 4EO9A 2VDOB 3B85A 2GEFA 4BX0A 5EJ7A 4R8MA 3ZDXB 4AECA 3DQZA 5HF9A 4OP2A 4BN0A 2VEOA 4B35A 2XX3A 5D3MA 4WKCA 2WMDA 1TPYA 3I30X 1WVMA 4FLMA 2WYOA 1H3FA 2IZ5A 3I4FA 5CVVA 3ZY5A 4D4LA 3BD6A 2GHQA 3P4XA 3T5MA 1JE0A 4QU5A 4DM3A 2II6A 5KWJA 4CV2A 3RT7A 2HQSA 3QBVA 1KOGA 5JH7B 1DKPA 1GCOA 2VZEA 3SDBA 3CVYA 4YCSA 2I71A 5KTSA 4Y7CA 4C7BA 2N9UA 3MJHA 4TYPA 1OLUA 1NU6A 4HH3C 5HFJA 3AF4A 4PF1A 4BJHB 4KR6A 4NDNE 1JR4A 3KT3A 1JHAA 1PLLA 1VE9A 3E3MA 3NUZA 1GQYA 2AXEA 2FMUA 1NXTA 3R5XA 3CY6A 4Q15A 1JEJA 2ACVA 2CLOB 2Z0MA 1N2GA 2X6QA 3K8ZA 4ND3A 5A02A 1X7XA 3F78A 3GZ4A 1KHHA 4NPAA 3B9QA 4NG5A 2XNJA 1JSRA 3LP5A 2UYHA 1Y6GA 4YUWA 1HNZB 4UE3S 3GUYA 3PQCA 5EHGA 3U7HB 2GWRA 3DEYX 1Y82A 3NTLA 3BX1A 3EQZA 2H18A 2H1VA 3VJMA 2WHPA 4C0LA 4EWLA 1GYQA 1G7SA 2BMDA 2QY6A 3CUSA 5EN4A 3ROZA 3U4CA 3HN7A 4UUMA 5FT9A 2ZJFA 2C7PA 1PT5A 2PMBA 4HQKA 1UBJS 1ZICA 1IBMB 1FPQA 4QGBA 4P1ZA 4JZYA 5B64A 1DJQA 1BU5A 3UG6A 3UT0A 2HA5A 2PZJA 3AEYA 2GAJA 3JVDA 1P6UA 2J3IA 5B12A 3SQWA 4X45A 3SZLA 2CXRA 1IOVA 4OJTA 3SQMA 5ALHA 5E4TA 4REMA 3CRQA 4MJ7A 4WXRA 3H6GA 1QR6A 1F20A 5JQGA 5GJWC 3LC1O 5DI3A 5CDYA 4Z4FA 3FN4A 3HB4X 1UT8A 5C80A 4E70A 2JKYA 4YRTA 4N82A 3UYLA 1XDUA 3DCIA 3DHNA 4PNHA 3I1FA 2NZYA 3KDPA 1K27A 1OFUX 4F3YA 2GUWA 3H2GA 3GEMA 5TPWB 4KPYA 1DOHA 4MP3A 3RFXA 4ES6A 3UCFA 1TJNA 2Y1XA 4QPJC 1HYHA 3ORQA 1B8OA 4WESB 2YVKA 2O3JA 1KQNA 4O0MA 3ICQB 3PGKA 1FP1D 4N7JA 3CSDA 3CPHA 4DLSA 1CD5A 5D00A 1NX6A 4AXBA 2DSTA 2HXGA 5DGXA 2HUNA 3D59A 4PWZA 4LSMA 5CA1A 2A1TR 3M4NA 4PVDA 3STUA 1J06A 4L78A 4ZU3A 3VZDA 1QORA 4E5DA 1MCZA 1L6IA 5GINE 3MM4A 2R5NA 4FWBA 1E4VA 2MSNA 2P75A 3GBPA 3LVBA 2R8EA 3CX8A 4MKGA 5BSMA 2IP2A 2VJLA 5LZ7A 4EUFA 5EAIA 4IPTA 4WBXC 1E1QD 3OQBA 3GN1A 4AUKA 2J87A 1NULA 1WB5A 4WBSA 3VHXB 4ZQEA 1RE1A 2FWRA 3AB3A 1RJWA 2H4XA 1DO0A 3DNFA 4FFNA 2O2DA 2B8WA 2G5PA 3UMFA 2F4VB 3RQIA 2P62A 4XTCS 3PDIB 1GVHA 2CE7A 4UM8B 1DLJA 2OBNA 3MLEA 3VDRA 1DG1G 1KAMA 1W5BA 4UW9A 4HB3A 5IAEA 4NIMA 4Q4DA 5K5EA 1DC5A 4N48A 3WQQA 2WSBA 4UVHA 5L9AA 2GM3A 2OCIA 2YDXA 5I4IA 1JJFA 4BNZA 3TRKA 4CFZA 1AKNA 3T1YB 3E81A 3O26A 4FHEA 1AMOA 2H5LA 1Z06A 1K7SN 4YV1A 2FP3A 4A0RA 1O95D 1IYZA 4WRRA 4ZOEA 5AKHA 1FRZA 2FSSA 1CJSA 1GKUB 1P1CA 2HA6A 2NU9A 1J09A 3G0HA 1LSJA 1ENYA 1RW4A 1JWBB 4RF2A 3BWCA 1D1PA 1GTG1 5EE9A 3O6VA 1JLLA 4Z1MD 7YASA 1IHYA 2XYGA 3R3ZA 3C3JA 2B7LA 4JVNA 4UJ3A 3KB8A 3ZJ5A 4EHNA 3R7WA 4PLPA 4RA6A 5HVNA 3MB8A 5JEDA 2MYUA 4OI2A 1G4HA 1Y9JA 5JE8A 2BHRA 1VL5A 1GQSA 1RWVA 2LW7A 5TPZA 1BHSA 4CF3A 2ONKA 1C30A 1UM9A 4ZOLA 4JI7B 4S2EA 3ORHA 4BUZA 2A0XA 2HJGA 1RPJA 3WWOA 3K71B 3UMJA 3GMIA 3U1TA 3WRVA 5CLLA 5LOVF 4FN5A 4QXOA 3GP8A 1SXIA 4IIFA 4MV4A 3R9XA 1CY8A 2ZE7A 4PNPA 3NCTA 4WINA 3IKLA 3M4YA 5HKKD 3I9NA 3P32A 3CW2A 5T8KC 4Q1AA 4KPUA 3NWOA 4X7RA 3ETEA 3R5SA 1XLUA 3QXJA 1WR8A 4FYHA 3PGJA 4TRJA 221PA 2P40A 2IUTA 4MMZB 4B6SA 5IZ4A 1U3WA 3PXCX 4HTFB 1CETA 1PNQA 2CHEA 3GHYA 2NU6A 3PT9A 1PVVA 3IALA 1U4OA 4YJKA 2HHLA 3I9LA 1UC8A 3KEFA 1VB5A 4J4TA 2G72A 1J00A 1P19A 3KXLA 3HFRA 2R4TA 2QAIA 3AYXB 1M8GA 2Q8QA 3T5TA 3STWA 5ENDA 1Z4PX 2AJDA 4GWKA 2VHXA 3SEZA 2R97A 1NASA 2OV3A 3PS9A 1SVOA 1TXGA 4L4ZA 4L8VA 1PF7E 1M2JA 5FA6A 2XB4A 1Q57A 3AJRA 3QKTA 4PTZA 3F7NA 4FOOA 2VNIA 4B83A 2A5JA 3DLPX 5JH7F 2FSVC 1Q21A 3OQVA 3SHVA 2P6UA 4RYLA 3QUTA 1DVRA 1BKDR 1X2BA 3E7PA 3SVLA 1TIPA 4ZU6X 3RAPR 1JIIA 5FTNA 4IHJF 4HXFB 2LZ0A 4K8OA 4YA6A 3AHDA 1Z6XA 1V5GA 4R0VA 1Q7TA 2BJHA 1UXIA 5FPPA 1WUJS 1BSVA 1JEOA 4FEAA 4ZGGA 4QT4A 3OIWA 4PPQA 3RU7A 2H0QA 2FSPA 3HU2A 3U3ZA 1DX9A 5DM1A 1GTZA 3DAHA 3N86A 4GMXA 4UBMA 1JIVA 3HKBA 1NLYA 2VTVA 4MV0A 5E9JA 4LVUA 1GL3A 1PT7A 4MA5A 4RIGA 2O2SA 1RYNA 4IJUA 2KJQA 5BNWA 4CKWA 4EG7A 3G5AA 3IUJA 4UQLA 4WJLA 1QRRA 1RQRA 4G0NA 1Z2NX 1LLQA 2O0JA 4I3FA 2W6MA 1N32B 4BEVA 3WGUA 1ZSVA 4TTPA 4MCHA 2KWIA 2O23A 3HB7A 3AF1A 2NUTA 3MJVA 5HBRA 1QV6A 3H8JA 4JT9A 1TEHA 4DF3A 3IVCA 1TEZA 1N8NA 1THTA 5HGJA 5H3LA 1C5KA 3BH0A 2OQVA 4ECEA 2QM8A 5DTJA 1GZ7A 4DIEA 5JFGA 2YOGA 3GBVA 3PC4A 4MP8A 4HNSA 2HU8A 4LZJA 4XR4A 4GKAA 3X44A 5JDIC 4XM2A 5L4LA 2BFBB 5CM8B 4X66B 3AZQA 1KEZA 3MUNA 4B4DA 3OJFA 1E2UA 3AJ8A 2BBSA 3NKVA 4Y2TA 2CK3D 1UINA 4L22A 6GPBA 5HPYB 2I62A 4BB9A 4CXMA 4AJOA 4FYXA 3H5NA 4L3VA 4GI1A 1L5KA 2F3SA 2NN3C 2CNLA 1CTQA 2XOXA 1YS7A 4KUHA 1KA9H 3SZ3A 1TW2A 4HDKB 4AS2A 2JJ2D 1ZMRA 2BWJA 4NICA 1P3DA 1SCKA 2XDQB 1JJVA 1LTKA 1KVRA 3NHZA 1WMSA 5F76A 4CLOA 2LNDA 1G63A 2RGAA 2P6OA 2FK8A 4R4JA 3ZI4A 3C3CA 1RLCS 3LMKA 4E4YA 1A7JA 1U6KA 2J3KA 5F1YA 2IHKA 5LA6A 1W6UA 1XX6A 4QXAA 3TIXB 4ER5A 1WETA 3SX0A 1YK0A 2CNOA 2W2NA 1SKYE 4F71A 1QHHA 2E21A 1P8AA 1G3MA 2PT9A 2R62A 2WY2D 1T0UA 1NQAO 3LP8A 1TJ3A 3O8QB 4MCIA 3FVWA 1NBEA 3EGXA 3C8ZA 3PEUA 1MV5A 1ID1A 3RRNA 4E6EA 2CKMA 5IJ9A 4Q4HA 1G2QA 3IMEA 3V80A 3VRHA 5J58A 1T9ZA 2C5FA 5EMKA 5CEJA 5IASA 3CVXA 2JLBA 3ECAA 1UW9C 2HWUA 2VN8A 5DPMA 4BO5A 5KNDH 1PJ3A 3R5TA 4JVMA 1DV2A 1S8NA 3H42B 3IPYA 3D02A 2HJRA 3AVPA 1J8DA 4KDFA 5HBGA 1CQJB 2P79A 1OU4A 2D1TA 2J5XA 3W3AA 4O4IF 3FTEA 4YYZA 3I92A 3NT4A 2X9VA 3D6TB 3GD5A 1P9LA 2I4TA 2JGRA 2YBEA 3PXEA 4HZUA 2A0FA 1I33A 1W9MA 2O05A 3BORA 1OFTA 2FPLA 3OIYA 3QF7A 2AR9A 4O08A 5FBKA 5JO9A 4AQ7A 4Y2VA 1MOQA 4KHZA 2I65A 2PKEA 4YX9A 4KHPB 4XYGA 3T3GA 4GPIB 2JFQA 2V7XA 4L2IA 2X22A 5FOUA 1ORIA 2CMFA 3LUDA 3UPUA 4IO1A 3D4LA 2PG3A 4RVUA 3G2KA 2PUFA 1SQ0A 1U99A 4L74A 2GSDA 4GQBA 4BKMA 2W6PA 1UZMA 2XUPA 1E6KA 2H5EA 5A4AA 5B3JC 1YB2A 3L02A 4XGIA 4X97A 2C03A 4L9WA 3R20A 1JDPA 1T2CA 4QD3A 3RKRA 2TRSB 4ZQBA 4YMGA 2IT1A 3O4IA 4Q4AB 4QQKA 1KI7A 4HDNB 1P5RA 3KHUA 4BKOA 1XAGA 5LOVB 1WB4A 2DJ5A 2REQB 5YASA 3VYUB 4CG2A 4C08A 4LY6A 4CVNA 1NBOA 3IBTA 2JBHA 1D7AA 2XDAA 2HIGA 2MU1A 3HA3A 4UULA 1DG3A 2ZI6A 6ADHA 4PN3A 3OHSX 3OPYB 4IRXA 4DN6A 3MTIA 3TBHA 1DO8A 4XYLA 4B44A 5EE5B 1H9AA 3AVQA 4FGUA 4CQMD 2VYVA 3QKSB 4ZOBA 3U7QB 1C4OA 1Z75A 5GJVC 1XI2A 3BB4A 3JQCA 1YQQA 3WLEA 3JAMA 1RRVA 2O4CA 3GJQA 1PGNA 1LI7A 2DZDA 1C1XA 1YDFA 2WG2A 1LK5A 4POAA 4ZTBA 3BZBA 3FTQA 3EXIA 2QY9A 4WA8A 1LPPA 1F06A 2AJ8A 4CIXA 2YV4A 2ZI7A 4MV1A 1IJBA 3FSRA 4DA6A 1CJVC 1VPTA 3QLUC 4LYFA 4QOJA 5KOHB 3WRXC 3L4JA 4XUCA 3KT6A 1DU4A 2X40A 3KJIA 4WOBA 4C20A 4ME6A 4PO9A 4CMIB 4JC5A 2EZ4A 1KDZA 1ODKA 5K0GA 2P65A 4TXMA 3RAJA 1I94B 3P94A 1ES9A 1IULA 2PX5A 2FQYA 3KQPA 2QUKA 1EUQA 3E5NA 3B9PA 3BTUA 3ZGNA 4QGSA 1E1KA 4RLSA 3THRA 2GM4A 4B7AA 5GM2A 4DA0A 3IAAA 3SJUA 1P4SA 4IHJB 5LB4A 3D4OA 5DM70 1NMZA 2GN6A 3OZFA 1XLTA 4HYTA 5LVAA 3CISA 1ZMXA 2WOJA 1ZD1A 4UQOA 1XNRB 4H0NA 4XB1A 2Y27A 3AFIA 3K9GA 4C5BA 3SR0A 2NO9A 3BJEA 2A7QA 1ZA2A 4QZVA 4LEIA 3O0TA 3K9LA 5JXWA 2QEQA 4Q7QA 3DAGA 1XR3A 2OCDA 3ABOB 4DBLC 1P7PA 1F8FA 1IWOA 1D2NA 1EP3B 2YXPX 3AEUB 3OOWA 4KVAA 3IBSA 3SQOA 2XCSB 3S2ZA 3ICWA 4CKBA 2WTMA 4DLWA 1V16A 4Q9JA 4M7RA 3L7MA 5D3KA 4DV5B 3BJIC 1URPA 2ECKA 5LDGA 3UNXA 4WCFA 5FPQA 2H7CA 3GDFA 1U28C 2I2WA 3VO8A 2VPTA 4WY5A 3WE7A 1G55A 1U2TA 1U8AA 3V4PB 2AEMA 4R1LA 3NORA 4QU9A 1RIFA 4OREX 4Q16A 3W6UA 4F9FA 4P4SB 3PC2A 1UJNA 3PPIA 2OZKA 3X1YA 3UJNA 4QULA 2QVCA 5FI3A 3U48A 4QJ5A 2AEJA 3JQAA 1J90A 1V1RA 1ZU5A 3MIIA 3ZXWB 5JISA 5LYJA 1YA4A 5FLXA 1G59A 3TM5A 2RFLA 5L6MB 3C8UA 3FLMA 3X2SA 1R2QA 4BNDA 2RHLA 2BF7A 4JJKA 2QRPA 3SICE 5JNSA 5F2KA 3CIOA 1KK2A 2X6RA 4P82A 2A86A 1B6GA 1TM5E 1FQWA 3CWZA 3DE2X 3R76A 3SKVA 5C5DA 2ZJBA 2I99A 3AERB 2XTAA 4JBHA 4BGEA 1QB7A 1TMGE 3IP7A 1QE3A 3DMPA 2PA3A 1U2GA 1JFRA 1F1JA 2C2YA 1D9XA 4XWGA 5FPYA 3EVBA 1C9MA 1Q50A 1UUFA 4DC0A 1COZA 4MV8A 1YASA 3FMPB 1NN3A 4QXQA 4PZLA 2QI9C 3KC2A 3AHJA 4IIJA 4XFDA 5K4GA 4BQNA 3T9AA 3UXEA 3AXTA 3A2KA 1E3SA 4ND8A 3LY9A 5BVHB 5HFAA 4AG6A 1U6JA 1X8LA 1Q0LA 1GKYA 2C2WA 2Q6KA 1M2OB 5FYQA 1P9RA 4M60A 5JW6A 4RV9A 3E23A 5EMMA 1JHQA 1RMQA 2C9OA 3OCWA 4X9XA 4OMUA 3D5EA 3KJXA 3TTXA 4S1PA 4XGRA 1VECA 3P9YA 1RLOA 5DIFA 1XV5A 3EG9A 3OEYA 4O4IB 3GIWA 3R0VA 2IODA 3IERA 5HOEA 3QXHA 1Z3IX 5DRTA 4CM8B 1I9CA 1B0UA 5JFTA 3FOAA 2HSZA 4GUDA 5CFPA 1QC5B 3GGOA 1QFSA 2QTHA 3TG2A 2F9LA 4ZZ1A 1I5EA 1X1CA 2O2GA 5JMWA 4FHGA 3PBKA 2C2BA 2R8YA 4M1TA 3N58A 2R96A 2FPWA 1AB5A 1L7PA 4F3NA 3IMGA 5F7XA 2VDLB 1X15A 3HKEA 3H16A 4II2A 1L4GA 1N1EA 2WOOA 4LW8A 1GARA 1STOA 1P0QA 2CDAA 3NEYA 5CLIA 3LFTA 4GGPA 3GPIA 4LRSB 4OP3A 3WGVA 3TFWA 4PTLA 3AI1A 4G97A 4JDPA 1VXOA 4J49A 4TL7A 1WZUA 2O5CA 2TMKA 1ZVKA 3ZX4A 3DFMA 5AI9A 4TYNA 1NV8A 3SIRA 4ZVSA 3ZHRA 5B57C 5GPBA 4HNQA 3B5IA 5DP2A 2D8AA 3OE7D 3LZ6A 3UWOA 1IATA 1SIUA 3NETA 3KJGA 4XWTA 5CLGA 2AE2A 1LGYA 2DF8A 1O96B 1JI3A 1P7YA 3QU5A 3PR1A 3AI3A 3OF2A 2YHSA 4Q7KA 2RJNA 2IXAA 5L3RA 4US0R 3D54D 3GGPA 4IO0A 4TQGA 5DTMA 4BUCA 1X7YB 1H22A 4G26A 4PZCA 4NDAA 4UVDA 4FFWA 3M6AA 3KKZA 4I3HA 1L5RA 5BWBA 2WSSA 1O5IA 1GNTA 4TMXA 3ZI7A 1XKTA 2CF6A 1O6ZA 4LRXA 3K2BA 1E32A 4D92A 1HWYA 1NFQA 4Q24A 1VE6A 3CZ4A 3VHLB 4D7AA 1JG4A 4U7JA 3UWPA 1DV1A 1BXZA 5JH7A 3SVZA 4CLXA 1XRSB 1RZRD 2G5CA 2WF7A 4U2DA 3VOBA 4R1TA 1HL3A 2CF5A 1J23A 4XUGB 1VLLA 3SJZA 4GECA 4L51A 1JU4A 2WIAA 1M34A 2YY7A 1MHTA 3V8RA 4GL4A 1DJNA 1GILA 1PGOA 2AH5A 4IDNA 4M1QA 3W0LB 1XDGA 1YZLA 1NT4A 2V97A 4K6OA 4ESEA 2EBHX 5C4MA 4I1UA 3QJ5A 3PFWO 4LHYA 5DTQA 1EGHA 1K6IA 1TT5B 2RG1A 4GRIA 4OK6A 3SOPA 2R751 4FEEA 2VPIA 1BN7A 1X19A 3C0KA 1ZK1A 2RH8A 2ODTX 4GM0A 3PNBA 3RM3A 2I33A 4C78A 1KDPA 1N4DA 4GX0A 3VDQA 5LIPA 5LU9A 1VCIA 3LZDA 4HLNA 1VJRA 3L1HA 1OVGA 1EK2A 2CXPA 5ALDA 3RUPA 2V3VA 3IPRA 4NZ9A 3K1AB 1RD4A 4KLZA 5KX5B 3C3KA 3MWDA 3S6JA 4DCSA 5JD6A 1POWA 3OQ1A 1KGSA 1WDMA 2YUIA 1AQUA 1BCSB 2GD0A 3ISVA 5E4YA 2PJZA 1NZDA 2YOFA 4OXNA 4Q05A 5KWVA 4DADA 4D26A 3ASVA 2N1MA 3PC7A 3N5CA 3NHRA 3BGWA 5HIAA 1QO0A 2DFNA 2YXBA 1I2MA 2YBVB 1DSSG 1CDEA 3UQYS 3VO1A 4EPYA 4ZJZA 1KRXA 4HNHA 2B3DA 2V7BA 1QFXA 2QZJA 2YJTD 1XB2A 3TQFA 3NRJA 2SKDA 1RTTA 4IOMA 4R7GA 1V9SA 1KVTA 2G06A 2RI6A 3EIXA 4M76B 1DC8A 3JQQA 1PJCA 1Y1TA 1Q7EA 4JLUA 2BGUA 2PX8A 3MOGA 2GPAA 5REQA 3TRIA 2OV6A 3RRMA 2NO6A 4W5OA 1X1DA 3LLCA 1VLQA 3N3BC 1CX9B 4KR9A 3ZU3A 3A9WA 3OQ6A 3DOFA 1UBEA 4V2IA 3ANXA 3MS7A 4LISA 4XCVA 4MVYA 5TPWA 3TNYA 3DXXA 2JLVA 4WKOA 1A9SA 1V2GA 2VSQA 4MEJA 4GPAA 3KLPX 3A04A 4QDKA 1RBYA 1LBTA 2JFOA 1NY5A 2NO4A 3GN2A 4J2HA 4H7EA 5D01A 4OOEA 1CEXA 2H48A 5DN6D 3OIDA 3T1VA 5JS8A 3E7DA 4MWTA 3MCWA 3H5WA 4I4TB 1B8VA 1L4LA 2WPDA 3CUKA 3V46A 1A2QA 3K0KA 2BDUA 2CBGA 3CLTD 3DMRA 3L40A 1AS0A 1EX1A 3QHQA 4WGGA 1H8HD 2XCQA 1L5GB 3SR3A 4YT2A 3IDQA 2OKCA 3DP7A 3PVSA 1FU4A 4OYYA 5ICSA 2QZ9A 1S3FA 3C5EA 3E0XA 1ZS9A 2IZ0A 4ZO4A 3FGZA 3UUWA 1NWCA 2KE5A 1G5HA 2AOUA 3C7TA 4PNEA 3VHXA 4L27A 1AKQA 3ZDDA 1K2VN 3NWEA 4MYUA 3M1IA 4G0VA 4DYDA 3PUIA 3BB1A 3D2AA 3LX8A 3ZH2A 2XZTA 2P4QA 3PDIA 5FOQA 1BTOA 4L5CA 4YECA 3QVSA 4S2UA 2OESA 1PK7A 2AWNA 2QN1A 4PCLA 5A9TA 1MB2A 4HVCA 1L5NA 3O4GA 4RZIA 1KIAA 1PQ4A 2COUA 4DTIA 1N2OA 1E2GA 3TMKA 5DNUA 3KTAB 3FZQA 2AB0A 1SVKA 4TLMB 1NJGA 5J5AA 2F4NA 4WK4B 3SBXA 1PS0A 1SQFA 1TA9A 2YXDA 1R0WA 3MC1A 4NU6A 1E4EA 2P5UA 3VV2A 4D9CA 1KQGA 1V9LA 1U8CB 2I8CA 1L1EA 3EIWA 5EYPA 5EPUA 3IRUA 2XSZD 3JAWA 3N07A 4Q6BA 5K8UA 3ET5A 2FFRA 1ZHFA 3T61A 1TW3A 3TD6A 4DG5A 3FPGA 4HJXA 1QH1A 3AONB 2J0UB 1R8QA 2X3YA 3HJCA 5F64A 1QIFA 1RI1A 3UHAA 2JJMA 1XL1A 1EDZA 1YBFA 1P60A 1ZN7A 3R77A 3OMLA 1I01A 2VJMA 1N7HA 4B8WA 3FWPA 4RNDB 4OLBA 1A0OA 4XX1A 3R4VA 1O6CA 1GG5A 2HDNB 4V0MA 2B99A 2VP4A 2YHIB 1VCOA 5EKXA 5F52A 2JLSA 2C3YA 4IGKA 1C8LA 5AKKA 4D9HA 4P38A 5GZ3A 1P7ZA 2YVLA 2ZIXB 2J3MA 3PGVA 4UU8A 1Z6ZA 2ABWA 3MLBA 3GCGA 1L7BA 5CM2Z 3GFTA 4WHMA 5JANA 2FYTA 1UXKA 1ZGCA 4GO1A 5JY1A 1G3QA 1C0KA 2NYRA 2PH3A 2FWJA 3Q7RA 4UEJA 2O8BA 4R1QA 2Q7DA 2QD2A 1QZTA 2F3QA 4GLJA 5DF1A 2I2DA 1IRXA 1F17A 3VPGA 2H52A 4DJTA 1NXWA 4RTLA 2PUHA 4ZVVA 3VR1A 1I3LA 2P3QA 4ZVUA 5LFAA 3MB5A 4LDZA 4IFTA 1IDOA 1F1BA 2GCOB 2ZUFA 3ICPA 5FV4A 2HPAA 3KZVA 4LWZA 4ZYLA 1ZA1A 2XWSA 3VPFA 4RS3A 1K4MA 4M8LA 1KJJA 1OSNA 2I2AA 2OZPA 1ZC3A 2QN8A 4MS1B 1KMMA 4OGLA 5IVDA 4EDFA 2QS9A 1XTBA 1IN6A 1HFWA 2CLFB 3GT7A 4MRMB 3VVLA 1XHEA 3WZ2A 5IKPA 3H6HA 1Y5RA 2D3WA 5IUJC 1ZIPA 1VE3A 4ZCIA 3G13A 1I0ZA 1NF2A 1RAEA 4JA2A 2QVYX 1RQXA 2HFJA 3Q3HA 3TJZA 3W5AA 2P6RA 4II7A 3I9V1 2H4FA 1SHZA 1M2WA 2IDMA 1ZX1A 5HQTA 1G17A 3KKMA 1WHSA 2OP0A 1CR2A 2W8BB 3KOMA 4GYYA 2HBYA 5ANRB 4OHWA 1M5RA 1H94A 4DIFA 2JGEA 2W2KB 4L08A 2NO0A 2RHBA 4FCTA 2XWQA 4DUYB 1N2CE 1CIVA 1X38A 3IAEA 2QI9F 1Z5VA 4HYEA 4BMXA 3WXBA 2HMWA 1LDNA 2WMYA 3E5RA 1NC3A 5I7OA 3S1AA 1QXSA 4LX8A 3MCUA 5EZQA 3KJEA 4A8JA 3WQBA 3RUFA 3JR7A 4EFMA 3A1UA 3GELA 1YNOA 1PZMA 3AILA 1N3YA 5IJWA 1P0MA 2F67A 3FPCA 4M8NE 4OL0A 4TS4A 1M34E 3D3EA 1G4AE 4FW8A 5GOTA 2EDCA 5KOJA 3W6PA 5BR4A 2GBLC 3U4QB 3ORSA 4RK4A 4WNAB 4ZCRA 2R8BA 2VUUA 3U6KA 1IVYA 2O7NA 1EK0A 1B73A 3RARA 1MAAA 1OASA 1BKYA 4AP5A 1AO0A 1X1BA 1VHJA 4JYBA 5AD1A 4DB2A 2BFBA 4MVCA 1YE8A 2BGMA 2EP7A 2P4HX 1TYZA 2PEZA 2ZBDA 4UCQA 3UHPA 3NRCA 5JS7A 1Z0IA 3ZNPA 4HQRA 4W5RA 4DZTA 5AUNB 1K4KA 4EJMA 1NDQA 2SHKA 1BE0A 1RTKA 3DOOA 3GP3A 4HDKA 4IDOA 2PUBA 2NVUA 4L4XA 2JZCA 3O7WA 4BZXA 3FH0A 4B09A 3CEJA 2GJ4A 2Y4NA 1G2OA 2CD7A 2Q41A 4CMKA 5ALOA 3UMMA 5DT2A 1CUIA 2WR8A 3S8MA 4EW6A 2HA4A 1XQ9A 2HQBA 1PU2A 5B36A 3H9QA 3QLVA 2UAGA 4IBOA 3RJMA 1ZK3A 1NT2A 3VC1A 2DHEA 1TF5A 4FOLA 4CF6A 2XIJA 4I5FA 3MNFA 1QHXA 3H75A 5JTUA 4NEHB 3IT1A 3ZWMA 3EQ9A 1IEXA 3I2GA 4NABA 4N6OA 4G6ZA 1G8HA 1GQ2A 1KJNA 2EBFX 2OXFA 2W6OA 4HDRB 4NE9A 4Y6GB 3ILSA 2E87A 3WAKA 1MDBA 4MYHA 1J7JA 2IY9A 2BFMA 1QK3A 2WFZA 1PJ8A 4C7MA 3CNBA 1DHTA 5JXIA 4DJ5X 3A4VA 3I1YA 4O2BB 1VKZA 1WULS 3M3DA 3PFFA 1CQPA 4Y7DA 5K8VA 1UMBA 1XMSA 3EFEA 3TD9A 1CQJA 4BQQA 2YN0A 1CS0A 1KZ6A 5EA2A 5F98A 2HKIA 3Q85A 4P5EA 1M2EA 5FEMA 4C03A 3DDSA 4LVOA 1E5XA 5AW3A 1XT6A 3COJA 3EGCA 2H07A 3FJOA 2VRBA 1IPEA 4AN0A 5LKAA 1XTJA 2XH8A 2PIAA 2A67A 2V7UA 4DCVA 1KP2A 1K3FA 1DKLA 1OBCA 1PNOA 1UOQA 2PX3A 3LRPA 3LHIA 3VTFA 3WGNA 2C7QA 2O48X 4Z4GA 4DDHA 2VDJA 1KS9A 2JFBA 4R8LA 3U9SA 1ZRHA 3X43A 1NG9A 3LBNA 2R3SA 2W4IA 4BWYA 3WYEA 2ZBQA 3NHLA 1ZIYA 4UVIA 3ESRA 4V02A 1ETHA 1OKKD 2GKOA 2WUWE 4QDXA 1UJ5A 5DGCA 1E2LA 4AMGA 5LZ4A 2BM0A 2Q3EA 5EC8A 1EA5A 2GWHA 2RDMA 4HDNA 4U9IS 4RXMA 2WWIA 1OYVA 1TJYA 2Q6LA 4MR9B 4U5XA 5LOVA 3J7AC 1LBEA 5CAEB 1JAIA 3WO1A 4DNPA 1YI8A 3NASA 1OC2A 3ZDFA 4OLAA 3F3SA 5AK6A 2H2DA 1ULBA 3LQRA 3OPYA 3TLMA 3PIDA 2ZT8A 4FFBA 3VYWA 4TYMA 3KJFA 5U4QA 1YUMA 1ABEA 2YVAA 3QKSA 3U7QA 5TS2A 2RONA 1NUHA 2LKDA 1AHIA 1UK7A 3GARA 3QVMA 4JY7A 5DCUA 4CKZA 1EFRA 1P7CA 4MTLA 3Q7PA 2BZSA 4ALLA 5IF3A 2C2KA 1HE8B 4AKEA 5DCWA 2CLHB 3A58B 3NBMA 2CYCA 2HSDA 5BQ5A 2X0EA 3TD2A 4D46A 2YXNA 5IC5A 1S8FA 10MHA 2QQGA 3U49A 5BYBA 5KOHA 5DWVA 1KYYA 4H6WA 1BMFD 1Z38A 2Y93A 1GGNA 4IHAA 1PV4A 3HI4A 3KOYA 4GMGA 1R0ZA 2AYZA 3N74A 3A4IA 1HG0A 2D74A 2OB1A 3E03A 4V0ME 4C4OA 2C54A 3TLZA 1U0HC 2CLLB 5EIEA 2CZGA 2I1LA 3AUAA 4BATA 1XN1A 4C3VA 4WLVA 3EE6A 5CPBA 2VDMB 2R6GA 3TOZA 2CB0A 4BVAA 2XBLA 4BVEA 2YZGA 1P2FA 4IHJA 3RC7A 4FYVA 1Q0QA 2M6RA 3PR2B 2FGJA 3HC7A 4MI6A 1DXHA 2NVOA 4YDHB 4QICA 4R2KA 1O97D 1AZLA 2XT0A 3THWB 1CUUA 2CV0A 1OZAA 4FEGA 5COAA 3MT7A 2QRLA 4U2BA 1S8AA 2A5DA 5ALFA 5TQ0A 2ZYRA 3UJ3X 3WOHA 1K7CA 3GFRA 4JGGA 3QE9Y 1IN5A 1CNFA 3SC2B 4H1WA 4G25A 5LP1A 2I22A 3AGQA 1XEXA 4KRGA 2ZUCA 4IINA 1WIWA 3RU3A 2E37A 3LY7A 1D6MA 3RIMA 1I3CA 3K2EA 1SWWA 3F9CA 2ERCA 1AA1C 1EWYA 2PMCA 4BFVA 4U4AA 2V7WA 2XMDA 1PQPA 3AUUA 4G65A 4NYMR 4WA7A 3WB0A 3VR3D 4X8HA 2Q3BA 3MFYA 5H9VA 1OAAA 1JR2A 5WRFA 2IF2A 3EX7C 3WLAA 2QIPA 1LFDB 3CE6A 4A16A 1I7DA 2KW5A 2GN2A 5LMZA 4TTVA 1JYSA 1OX4B 2HU7A 3FCUB 4R2LA 4AS1A 1PR1A 2CJYA 3GP5A 3PL1A 2R8RA 5ALNA 1WDDS 1MB0A 5LQMA 3HCBA 2PQ0A 3OU7A 4UVGA 1RI2A 4GGMX 3LK6A 3BT7A 3GJYA 4JJFA 5A4MS 5IFLA 3I05A 2VL7A 2ZGVA 3N8IA 4AG5A 3L4SO 3PC3A 4I8IA 3HM2A 4LF7B 1GV0A 2YL2A 4M88A 4DC9A 2W5UA 3HN6A 4FMDF 4LA4A 2GVNA 3Q7IA 4MJLA 4QNRA 3UICA 4JCCA 2RGUA 4IGFA 3VYVA 5IF9A 1CUXA 4N0PA 5G0WA 3LWDA 3HVIA 3LOQA 2V8BA 3DZJA 4H7IA 5THXA 2PMEA 5G0SA 4IP0A 2UZ3A 1J2RA 1D6JA 1DCFA 1JSCA 1V8DA 1RLTA 3KKLA 4RNCA 5JASA 2BI8A 5LBUA 1IWAB 1GFWA 3IGFA 4PSVA 2RIPA 3ZBQA 4XWOA 4D5GA 5AYVA 4D8TA 5SZIA 3E9CA 4OQ4A 4E12A 3STTA 4RHUA 2F2TA 4B6QA 2JFZA 1GRVA 1C3OB 2X58A 4WI1A 2F64A 1M2OA 1EWKA 4NCNA 4U0KA 4U1RA 4OHXA 3EZ2A 4FW9A 4OHRA 4OJNA 4U2KA 2R8ZA 3KLOA 4YCDA 4KXXA 3D7LA 3EPPA 3JASA 3VVCA 2OPBA 4AICA 1W88A 3FBWA 4YASA 3Q8MA 3Q3CA 3QX7A 1FFDA 3CYFA 3D3WB 5AOAA 4PSAA 1ZXXA 4GLLA 3MVEA 2ATEA 3LLMA 2AZTA 3TIVA 2PTHA 3CR3C 4O4IA 3KKEA 2GAOA 1QS0B 1RKXA 2R6CA 5AMXA 3U4HA 5B6PA 3PENA 1VSVA 3EXFB 4CM8A 2O2EA 1M6YA 1QHSA 1VI2A 3G89A 3LC2O 4O2LA 4DMGA 4P54A 3HL0A 2XDYA 5BT8A 4EG3A 4XM1A 4WFIA 3BHNA 1SO8A 4OQNA 1Y8ZA 3QVJA 1GWNA 5LNK6 1YUBA 2QN2A 3AR4A 4LJLA 4OHMA 4P7GA 4PSUA 1LSUA 1JZSA 1TZJA 1X6VA 4PLCA 1LNZA 3EF0A 3O82A 5EIBC 1ZR2A 1S7GA 2PLAA 2PWBA 3HCOA 5C4GB 4CKEB 5C51B 4KUGA 1OXVA 3KPWA 4QVIA 1E3LA 3H2SA 3PC8C 3QXCA 1AUXA 2ORIA 1DQSA 1CEEA 2EFEB 3P26A 2AFVA 1E2BA 2VXBA 2QXYA 1E64A 1SUEA 3FHCB 3WK4A 3OJLA 2B5OA 2BHSA 1RBMA 3NIGB 3I39X 3INRA 3V9AA 1QF9A 2RI1A 5CLQA 1QE0A 1MC4A 1NNLA 2FZCA 3K2QA 5FPSA 4BNHA 2DETA 4RKFA 5J5CA 4DGSA 4KN8A 3N2IA 5FAXA 3AFMA 1ZGBA 1VJ5A 3RIGA 2OCPA 2ZKLA 1QNFA 1WCIB 3WYFA 5ADVA 3ZJTA 3FYCA 3ROGA 1I51A 1IUOA 3LZCA 1ZGGA 1L1RA 2RSLA 4TT3A 2EQAA 3VZPA 4BNKA 4U2EA 1Z88A 4GE0A 2QYHA 1L7OA 1ZU4A 2IDJA 4ZT2A 1Z47A 2JFHA 5KVCA 3KWFA 3LW8A 3F5QA 4IZOA 1H4TA 2ZLBA 4WFJA 3LGXA 3TFQA 4EO7A 1E0SA 2ZI3A 1FRNA 3HUEA 5E1OA 1C7FA 1NJSA 5KAMA 1RYMA 2FX2A 2NU8B 1MB4A 3F3MA 4C1NA 4GYJA 2WD7B 4MV5A 3VU8A 4O4JA 4K9NA 3DWFA 1SZPA 4OY3A 1EBFA 5AH0A 1GGJA 5AUOB 4HDQB 1FUKA 4OSPA 3CSSA 1VL8A 2I34A 2RCNA 1G6OA 2A0UA 2EERA 3GFPA 4IUBS 4P5PA 1K1EA 2JGDB 2WABA 5BWCA 1SBYA 2R7AA 4ZI7B 3G0IA 4V03A 1VI5A 3TZQA 5EMLA 3DEIA 1M2GA 3TTSA 2HJVA 4NXNB 1WPXA 1S2IA 4RTSA 4J7UA 3EOAI 3HI6A 1XJCA 4BX2A 4Z4QA 4F04A 1B74A 5AP9A 4FJ1A 1O9HA 3DBOB 3JWGA 3TOVA 5F1OA 8LDHA 2HNBA 4RMHA 1GG9A 3K1AA 1AM4D 5K0LA 3WB9A 2ZPTX 3AR6A 3RUEA 1PSWA 2AXNA 4IUYA 5JSZA 4M21A 5BR8B 3EPLA 1FPMA 1O9BA 2XRMA 5AUQA 1Z6YA 3HA2A 1KK3A 4EUEA 1I3OA 1YCFA 2WAOA 2EKBA 5J1SB 4FPXA 3UV7A 2ZRLA 3T7KA 1F0PA 3PXBA 4NI5A 5G4LA 1AN9A 1MU0A 1TA4A 3NC0C 1P1HA 2FF7A 3TDKA 4F6RB 4RTOA 3S0JA 5E7MA 5KOYA 1ZUHA 4WKPA 3SI7A 2Q5JA 1UMKA 2R47A 3J7TA 3VFDA 4EZEA 4L9RA 3O8QA 5IH3A 3MCZA 4LZLA 1Y7TA 3HG7A 4XB2A 1SOAA 4TZKA 1U63A 1G7TA 1Q92A 4I1SA 1QF7A 5DGTA 3RWBA 1JVNA 2VHTA 3FPJA 3M1LA 3ODPA 5EQTA 3L7OA 1Q1ZA 3CF6R 4JP8A 3H3JA 5IEJA 1WXWA 3T38A 3GX1A 4HEHA 1GADO 3ZE9A 2BKVA 5CD9A 3USZA 2CFCA 2BGIA 1KJIA 4FMDB 2WE8A 3M9WA 4FR0A 1MQAA 4KVGA 1Q3KA 4NV0A 4HRVA 3INYA 5E7JA 4ZI2A 3C1UA 4RS4A 1H8ED 4EFKA 3VO9A 5C8VA 3D8BA 4MUMA 3TVTA 2DPGA 4ZYZA 5A9SA 3O31A 2RK4A 4IWXA 1UK9A 2OYSA 4LYHA 3V1UA 1E9AA 1BS9A 4R9SA 1SEVA 4W7IA 3QNWA 4UUOA 4BRWA 3BRQA 4FK8A 2OR3A 4Q9NA 4TQ9A 4AJIA 1II8A 1L4BA 3RSSA 2CB9A 3V4VB 4AMZA 4Y2JA 3JZIA 4ZZ3A 4TVBA 2D06A 4YJHA 3RT9A 3T3OA 3FOZA 4YJFB 1TRHA 1JMYA 1W36D 2LCQA 2PL5A 3PQEA 5IBCA 2CXUA 3BXHA 3Q2KA 4MXDA 3CBGA 4HN2A 3EEOA 4DWOA 3QFRA 3K3PA 4BE7B 2BVNA 2ZJZA 3DO8A 5CH3A 5T8KA 5HCUA 3V8PA 3KPYA 2DLCX 3AQ4A 3RUAA 1CW2B 2D13A 2ZZMA 1NF8A 2MIIA 5CVEA 5IANA 4W5NA 3CZCA 5DEIA 7REQB 1YE3A 2E82A 4U8GA 3BMQA 2ZR0A 4IQ4A 3THOA 5JJ5A 5LZ5A 4ACAA 2HADA 4HN4B 4HUQB 4B3GA 2DHQA 4KXMA 3KTAA 1F51E 3CNHA 2H85A 5HNKA 2ZSKA 3ZDAA 4G4JA 1DRJA 5D5PA 1WXDA 3Q3VA 4DUGA 4E14A 4KXWA 4D96A 2WILA 2OENG 2AXPA 4M36A 4NFLA 5ECDA 3UHOA 3V00A 2QXTA 1GM5A 2EIXA 1DBRA 1EM6A 3MMNA 5KAPA 5K8TA 1JPUA 2X1LA 4GSKA 3VNSA 1MJGA 4DLPA 2GZMA 4GU5A 3H2ZA 3THSA 1ZC4A 2JJ1D 3OUZA 4IJWA 3ZCRA 4CG0A 4BZQA 5CFMA 1YJAA 1EG2A 3P9XA 2BW0A 3OZUA 3FFBA 3LSTA 1KZHA 3U40A 1VJ1A 4GZMA 5BWNA 5IK2D 1EXNA 4ENWA 1XQ6A 3B8EA 4LJ6A 1SXQA 4ND7A 1G21B 4AKSA 4C76A 1E2FA 4BECA 4PHTA 4EHIA 1KMHB 1KMNA 5K09A 1F4VA 3ANLA 1RYYA 3KT8A 3P2IA 3HKCB 4OUDB 4UU1A 4E21A 1ZXLA 4L73A 4DNQA 3LOPA 1IMOA 3GI1A 1DDGA 3HUFA 4FZ5A 3DE3X 2FEMA 4KGDA 3ANNA 1KPIA 2QDKA 3V4OA 3FI0A 4NYMQ 2ZTVA 4QGAA 4ZKEA 3BRSA 3ZWPA 3IV7A 3E9NA 2BI7A 1DL5A 5C8YF 5C3UA 3AP1A 1L5VA 2ZJ0A 2INGX 2X4LA 3QUBA 4YXWA 3ZD9A 3NYIA 2IP4A 3O8RA 2CJXA 1P9WA 3ILYA 1GLGA 2BFDB 2Q5IA 2J59A 3GOHA 1HX7A 3MGCA 3HKDB 3UWKA 4MAAA 2GNOA 2NO1A 2XKBA 4CODB 1MMFB 2ISSD 2QD5A 1LA2A 4KXNA 4IVNA 4ZA2A 4RH1A 3W2FA 2G9ZA 3QVGA 3VR4A 3DBLB 3QOFA 3VH4A 4DLTA 4JXZA 1Z8HA 2FE1A 1FSPA 2VZ8A 4CCYB 3HO8A 3LA8A 4HGPA 4MITA 4XASA 5BN4B 5JMPA 4GDMA 1QOQB 1VPEA 3E9YA 5ELMA 4MRMA 2B30A 3NHWA 4B7ZA 1HH4A 5A6VA 2G7MC 5AO9A 1BXRB 3I6IA 5AW4A 1N6RA 1NUSA 3I01A 1CUCA 2J3QA 3LG2A 1GFSA 4GVLA 4ZAVA 1U7WA 2V6BA 1VLMA 3GRRA 4C0QC 1DRKA 4J0IA 2B6HA 5TB5A 1Z26A 3QITA 3LD9A 3LYUA 3P97A 4Y2GA 5ALLA 1QCYA 3RS7A 2LRHA 5EY5B 1GSHA 5FFMA 4GR5A 4RD6A 1NR7A 2OQ2A 1QRTA 2R1TB 4KIWA 4MRSA 4QGGA 2OWDA 5HS6A 2IEAA 2XMPA 3NHFA 1WZ2A 1X86B 4NESA 4IJQA 4ZT4A 4JNCA 4C0JA 3MJFA 4LJ5A 1PS9A 3ZZNA 1JJBA 1UOOA 2DTEA 1MW9X 1ZEJA 3IUYA 1L7XA 3O94A 4FI3C 2D2IA 2DFDA 4P08A 5DGDA 3HVKA 4QATA 1QR2A 1PE0A 4CLDA 1BN6A 1TL7C 2GTPA 3K5WA 2LPMA 5J47A 3MRVA 1FQJA 1P73A 2OV4A 1H2RS 3AL3A 1CRWG 1EEHA 3AJEA 1C7JA 2GK4A 2J8ZA 3KU1A 2V6AI 4JT2A 3ZDQA 5K05A 2CMHA 4RK1A 2JZNA 2XT9A 3IL2A 4RE5A 2HEIA 3A31A 3PQ8A 4MSUA 2PK3A 2WU8A 3DXFA 2PVSA 4LOAA 1ZI8A 1YOVB 2COKA 5EMNA 1SAYA 4MDYA 1MIHA 1NFRA 4NJOA 3B13B 2QIOA 3TMYA 1EFVB 2XRFA 4OH7A 3LECA 5P21A 3TXXA 3ZEAA 2UYCA 5DX8A 1KQ3A 4W8OA 5CYOA 2AN9A 2FCRA 5A3SA 5LWHA 3K2IA 2AFHA 4JC4A 3WR5A 3L0CA 3SHFA 2Y1FA 4W6ZA 4COKA 4ENPA 2BDEA 1TVKB 3DR5A 4NF2A 3ABRB 5B3JA 4U6QA 4RJ2A 1KYQA 4BNVA 5I47A 4HMPA 1B0ZA 3QW2A 1YI1A 3N0XA 3GLHB 3WHPA 3PJRA 1GITA 2UXDB 2XGSA 3GJ5A 3Q8KA 1GCGA 4DFCB 2J4CA 1VHDA 2P2ZA 3LQKA 4N8EA 5AOBA 4KRXA 5IM4F 3ZCTA 3N87A 3UENA 4G0ZA 5JBIA 1WBDA 3QELB 4YI3A 4V0QA 5I7SA 2Q0XA 3CXRA 1J0XO 3DYIA 1IJEA 1M2FA 3SIXA 4BX3A 1FLDA 4I8XA 5FOSA 1NGSA 3G2PA 4TLBA 1QJCA 4EBBA 5I9SA 2JC3A 3GROA 2AXQA 2TMYA 2HIAA 3ER8A 2NTNA 4FLEA 2H1CA 2O8EB 2C2GA 4HDCA 3B1WA 3QLUA 1A27A 3MTEA 3WRXA 3G0BA 4MR7B 5H3CA 2AOTA 1IHXA 3W1EA 4IJMA 4AYTA 5KREA 2EG5A 2VPQA 4L6AA 1TMYA 2QG9A 1Y33E 3OMXA 1PJZA 1ND6A 2Y66A 1H5UA 2A7XA 3QBEA 4M8SA 9ABPA 5K9ZA 3LHFA 1Q1QA 1YKFA 2DHDA 2MMCA 1C29B 3P0HA 4Y2HA 1W0JD 3VX4A 3ZS8A 4CJXA 3DTYA 2QW8A 3HB0A 5C7LO 1PIWA 1E60A 3JZFA 4H2DA 1P45A 1I1OA 2R1ZA 3I52A 3KPVA 2JH3A 2GHTA 2WG1A 2Y8EA 3NDPA 5H8WA 4TL9A 4JB3A 2YNMD 2RHMA 2IOQA 2Z56A 3LT2A 4TLLB 4X7MA 5DHRA 4PRYA 1E1RA 5EJAA 2EEZA 2P4SA 1XTQA 4BMNA 5TDHA 2DX7A 3BOSA 1Z73A 4A0HA 2DXIA 1QB8A 2A9VA 2ZCJA 2WF6A 3ICEA 4MR9A 3D8SA 4OKIA 5JXGA 3HB1A 5CAEA 2XZPA 2D8MA 5C8YB 3G2HA 5LQUA 3KFLA 1LPAB 1PX2A 4B4OA 3HFJA 5LR6A 1AGXA 3WNZA 2VQEB 4Z2YA 4EJFA 3BFXA 1B16A 2Q46A 5KSYA 1NUTA 1YRAA 2C7VA 2EWMA 5KVAA 1MABB 5JWHA 1GAJA 1PT6A 1BQEA 4M1WA 5HQJA 5BN1A 1U28A 4JOCA 1C9EA 5CURA 3BEDA 2FPIB 4LY3A 3O8BA 4Q4LA 2JARA 1SK8A 2ZBUA 1SG6A 1X1RA 1V11B 1SHUX 4BNWA 1TRKA 4GPBA 2MYPA 1R6BX 3JPYA 1P5FA 2AJBA 5HR5A 1FVFA 4KJXA 4MO9A 4BCBA 2XB6A 4NE2A 3GEPA 3Q9SA 3BAFA 3DTNA 1VG0B 3Q0EA 3EOZA 2FRXA 2VQ6A 2O3TA 2PAAA 2IV7A 3JATA 4KMOA 4FDVA 1RPNA 2DWQA 2ZK7A 1YS6A 1Y4AE 4BB6A 3U7JA 1BHQ1 1UFQA 3O91A 2OC9A 1HE2A 1LW7A 3NAGA 3QWFA 4IOJA 4MW4A 2EU8A 2GGSA 2O2YA 1GA6A 3NM6B 3WK9A 3ICCA 4JT8A 2VRWA 4EGSA 3UV6A 3F0TA 3E48A 4H0CA 4NBWA 4M53A 5ITSA 1R4MB 4A1FA 1XYYA 4YFYA 3IQZA 4LJ9A 2BCJQ 4REQB 1YFJA 2ETVA 1G0NA 5I7UA 3THWA 1CE8B 2ZTSA 3ADOA 1XXHB 4GP7A 5CVDA 3S28A 4HMQA 3BF7A 5L3QA 5AW7A 2WV9A 2JCVA 4XWAA 3L8DA 2R4UA 1CY1A 2WJYA 4A91A 1UP6A 3ZQ4A 3DJYA 1LC0A 2D5AA 3H17A 3HCWA 3NTRA 4DIOA 4U7HA 2XGOA 3KOWA 3ABQB 1VGQA 1Q0ZA 4JR1A 3VM6A 2Q6TA 1SD2A 4UFNA 2Q5EA 1ZJZA 3IFSA 4J16C 1KJYA 4MI1A 4CMCA 1UXOA 3B51X 3W1WA 121PA 3EQ2A 1TAGA 3REQA 3NALA 2GX6A 3C3YA 4UBNA 3I6YA 3D2BA 1CYEA 1SK9A 2QRVA 3GFQA 2ZANA 3VUEA 2GF9A 1I5OA 2X7JA 3CMMA 3B53X 3OHMA 4HDMB 4BRSA 2GEVA 4D0LB 2O8FA 3EJWA 5ESWA 1HMYA 3WISA 3DKPA 1XTSA 3FJYA 1UC4B 1XJ5A 3QOWA 5DOZA 3WBFA 4BKRA 1VMEA 3JQBC 2FEOA 1KBQA 4FD2A 2BFFB 3HR7A 2ZTMA 5HTOA 4X1YA 4G1FA 2FQXA 1RXVA 3WWDA 3N3AC 1NQXA 1I6LA 3IILA 4Y9TA 2EGGA 1KETA 2AA3A 1U7HA 4V0OA 3TQCA 1ZH6A 5J4HA 2GYWA 3ER9A 2GK3A 1LSSA 3T6KA 1QFMA 1QDLB 2ZSAA 2YTZA 2A59A 3LQFA 2VYVD 4KLCA 1E1NA 1YZNA 5CM9C 5D51S 4GVPA 3T5BA 3W5BA 3BSWA 1EFKA 2I6QA 2FEKA 3BERA 1NBMA 2YS6A 2C97A 3LS2A 4A2QA 1KP9A 5EGSA 1YGPA 1LW6E 1N2HA 1NFFA 4MYSA 1MX5A 4F85A 1IC6A 3U7RA 2XVXA 1K5DA 3MZ0A 3CVUA 2WZDA 1CUZA 1WUYA 4M0PA 3VZQA 4U6SA 1QIDA 2JEOA 4IGIA 2B2NA 1P39A 1LPBB 5DNDA 3WL7A 3V1YA 4E5PA 4G8CA 2IIQA 1YQ9A 1TZKA 3ZY4A 4FZJA 3FYUB 4RKWA 1M6WA 3A3PA 2CCKA 1BX0A 4JQZA 1O87A 4WNYA 1SHLA 2LIVA 1NTOA 3DL7A 4V0SA 4KLRA 4KV7A 1MV8A 2J33A 2O06A 4JJGA 2PWZA 2RHJA 4DOMA 1DKNA 2NUAB 2AFHE 2JRCA 5EIOA 4LYDA 1YBMA 4EARA 4UUAA 4Q9LA 2VUIB 1MOPA 2OD9A 3TB6A 4PG5A 2VP5A 3O8NA 5FOVA 4NRDA 5BQOA 1K97A 3HCFA 3N7UA 5IT4A 2HGZA 2AUNA 1PJ4A 2P2DA 3UUFA 4RHTA 3T9BA 5I3ZA 1S3GA 2I4LA 3KUXA 5DK6A 2R6AA 4EKGA 3VX3A 3FROA 3O8CA 2QVGA 5LD2B 3FSGD 5KHOC 1P18A 3IDSA 3QKWA 4MWEA 3A4NA 1EQAA 4X95A 4RETA 4E03A 1TO2E 5MF6A 5EINA 3ZBUA 2G71A 1EBUA 1WEHA 1XO1A 1XZPA 2XNDD 4XEHA 1KO4A 5AXAA 1NZFA 3TIGA 1QH9A 5BRJA 2AN4A 4UHCA 5BSUA 1NQ5A 1SPBS 3M6UA 5K6AC 7MHTA 1JIKA 2M32A 3KSMA 1Z8FA 2G4LA 3AG6A 1T4DA 1DCMA 3OPMA 2Z04A 4G1EB 1E58A 1P1BA 1KI8A 4KODA 5J1TB 4E15A 2A30A 4IYJA 2P1ZA 4EQ6B 3C8DA 4MKIA 4TMTA 4UXJA 1OXKB 2BSXA 1AHNA 3A2NA 1X80B 4PAOA 1J5XA 4XIJA 1NPDA 5I7HA 2EW2A 1U1CA 2LVBA 2H9AA 3UMGA 1R4NB 4EG1A 1SU6A 1RXOC 1WCIA 5KQSA 5TGDA 3SHWA 2JLXA 3EXAA 4K6KA 3V4SA 1Z0JA 4FI3F 4GL2A 2FZEA 4RDHA 3GG9A 1C50A 3CM0A 1Z36A 1SD1A 1YI0A 2PCLA 3PEFA 1X7HA 2DFLA 1YB1A 2YHAA 4IGEA 4OXKA 3ADCA 2VZLA 4PFJA 2PFGA 4BJ3A 3AW8A 2JEZA