3TG8A

Mutant ribosomal protein l1 lacking ala158 from thermus thermophilus
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
214
structure length
214
Chain Sequence
VDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title Structural analysis of interdomain mobility in ribosomal L1 proteins.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Ribosomal protein
total genus 66
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 3tg8A01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3tg8A02
3TG8A 3ZQJA 4QG3A 5DM70 5DM60 3UMYA 4F9TA 1I2AA 4QVIA 3QOYA 3U4MA 4REOA 4LQ4A 1U63A 1DWUA 1AD2A 2HW8A 4DFCB 1CJSA 3FPNA 4QGBA 1ZHOA 1MZPA 3U56A
chains in the Genus database with same CATH superfamily
1O8BA 1ESNA 3S0JA 5CFNA 2YRXA 4FT4A 4Y30A 3CX3A 1PWYE 4C6TA 4CV3A 1B3RA 2ZAMA 4UUPA 1ZL0A 3PC8A 2V7PA 4FEYA 4RGVA 4F8JA 3MGKA 1PJBA 1TZ2A 5LQKA 2D0IA 5I9BA 1DG3A 1PU2A 5FO0A 1QHFA 3RVRA 3GZJA 3X3HA 1KRXA 3KPYA 5GV8A 1MCZA 2CHEA 2P9YA 3HV2A 3HCWA 4HEA6 3AV3A 3R8CA 1L7BA 1QORA 2PUBA 1KZ1A 1AA6A 4TLAA 4OP2A 3JQ7B 2RC5A 3CXUA 3F0TA 2QTGA 1ZK3A 1IZZA 3E53A 3FIUA 4ZVQA 2IWRA 1Q6YA 3FYTA 2H7VA 3MQFA 2BI7A 2PRSA 1U7PA 3HP1A 4INJA 2FPWA 1DJLA 4QDXA 4WOJA 4YRBA 4DV5B 2H2IA 1QK4A 2YZ7A 3WK8A 4GE0A 3HCRA 1PG2A 4PSUA 5JXJA 3EMVA 1JWAB 3V5NA 5BO5A 5F1KA 3SX4A 5JXGA 2AF3C 2H3HA 4BJ6A 1UOQA 1A2BA 1OA0A 2ZANA 3EN0A 4FFBB 4PN3A 3E4CA 4GGOA 4MRSA 5CB4F 4GVXA 1GQRA 3TLYA 2CJFA 1K6JA 4DIDA 2HFKA 4IUCS 1ZOIA 4P4GA 1Z74A 1C81A 3UJ9A 1ZN8A 3UJDA 4DBVO 3DAYA 2BSQA 2G04A 2YX1A 4ZFNA 2OGZA 2GEUA 5TGDA 1QFMA 3VO9A 1P9WA 4L75A 3IDOA 3KKQA 4TYWA 4TLLB 4B81A 4X8OA 4O1MA 4D9EA 5DLQC 1ORIA 4A8JA 3O6VA 4X20B 4BNGA 1N92A 5IDXA 1C7RA 1PQPA 1WZEA 2FZVA 1XKQA 3W6UA 5GZ3A 1G9TA 2QEQA 1NW4A 1UDBA 2Q8NA 4F3RA 4KR3A 3TZBA 4UNRA 5B6JA 4NXMB 2VJPA 3OM8A 1DEHA 4GBED 4ZODA 2IIQA 3IIKA 1SXQA 2ONKA 1E94E 4JCCA 3FYDA 1XXLA 1IB6A 2XTZA 1T4DA 5IUKC 5FAKA 5JSHA 3OKFA 4TMKA 3HVUA 4OK3A 4ERXA 1PNVA 4C2AA 4QZVA 2FQ1A 1IN7A 1FS5A 3FJ1A 4GOJA 1D0SA 1XPUA 3CSUA 3BRQA 2W6ID 2YHIA 3OIFA 3R3WA 1GZ4A 3PGMA 3P0IA 1Z9BA 1Y5RA 2HV9A 3VPFA 2V7UA 2XADA 3GARA 4WY2A 1GSAA 3TSZA 3B1KA 5DTRA 5JHGB 5JPCA 2UVPA 5LQRA 3DWGA 5H81A 3ZK8A 1AZSC 2PD3A 2X8LA 3N1UA 5IBRA 4ZYWA 1L7XA 2P4QA 4NAUA 2WJWA 4KB5A 2ZAOA 3ZQ6A 3A3OA 1NJGA 3D9QX 5FPSA 1X1QA 1VYTA 3KHUA 3R7DA 4EFMA 2OSBA 1SVKA 1EEHA 4RTLA 5ELMA 3PKZA 2H2DA 3OD5A 2EJUA 1RYHA 3P96A 4PG8A 1SU6A 1L4KA 3ONVA 3NO4A 2FMKA 2FSIA 3UT5A 2QNIA 2NO6A 3MWEA 1JDVA 4HB0A 3B7GA 4K9LA 3W2IA 3E9MA 1DBPA 1O96B 2RONA 2PBLA 2P75A 1PUIA 3AB7A 3L05A 3D2BA 3PNKA 4F86A 5KNBD 3CJQA 5AW5A 3LQFA 1QV6A 2HSDA 4EB0A 2RI1A 4DYHA 1CY4A 4EF4A 3DFZA 3LW8A 4JJIA 1BS2A 3GEEA 4M46A 3BGOS 4NU5A 4ZRMA 3MCTA 1FFCA 1T13A 4KPYA 4MVJE 1Q44A 1V45E 3ET5A 2D2EA 4MQEB 4AKEA 1BA3A 4D9JA 4HO1X 1J25A 3HCAA 4L73A 1GY8A 1ZVMA 3CZAA 4BEWA 5K6RA 1JG1A 3PWZA 4C89A 1C8LA 1QDUA 3TAXA 4QQNA 2RGYA 1U6KA 4FM9A 3SR0A 3GW8A 3PC4A 5F7JA 3ZIAA 4EUKA 4CKXA 3NM4A 2JBWA 1QKIA 3OLWA 3ZPXA 5TQVA 5FI1B 3BYZA 4DANA 2HSGA 3DL7A 2O2XA 3K1TA 3B3JA 3JYLA 4GLLA 4X97A 4XVHA 1IXYA 2R6FA 5EUQB 4C0HA 2E5WA 4DMGA 2QJOA 3TD6A 2W6OA 3ZYCA 4GZ6A 4PG7A 5FWAA 3REOA 3WNBA 4PC7A 4PIVA 1P4GA 2QNRA 2IZ5A 3B7PA 1UPUA 4QOGA 5EFZA 3W90A 4BTEA 4QRHA 3ZX4A 2HUNA 4XGQA 4Z3OA 3EIEA 1NW5A 3ZEAA 5DO9A 1YR1A 1QGED 3RV4A 1E5VA 1LW7A 4WCFC 3LY7A 2WWGA 4YMIA 3CVUA 1JQLB 4WLEA 1THZA 4V0NA 3U13A 4XH9B 1BZYA 1SQSA 1YH3A 2V7XA 3W4JA 1K4KA 3ETNA 1ZIYA 2VQFB 3RTAA 3EG9A 4U9IS 3VZRA 4FIZA 2ZRLA 1Z2DA 3FCOA 4KN9S 3U3XA 5HJ5A 1PYGA 3BHNA 1J9EA 1H69A 1J22A 2VFAA 2XITA 1N36B 2YXDA 3KDSE 1E3IA 3HZHA 3NWOA 3QPAA 3QXJA 4GR5A 3ZY5A 2W90A 3PUHA 5J59A 3RTCA 4WBNA 5TS2A 3V8VA 4N3NA 2YINC 2CWWA 1IDN1 1RR6A 1V2HE 3ROQA 4D9NA 3RYFB 1YA6A 3Q3HA 1VHJA 4BNHA 2NZVG 2VDQB 5FLYA 5JD3A 3V8PA 4KH1A 2NZWA 2P40A 4LDZA 4RXTA 4XLLA 1UWCA 4AWBA 3K2IA 3NH6A 5IG2A 3VV3A 3TQHA 1TX4B 2JF0A 2R5FA 1MXFA 4ZDIA 1N2XA 3IE0A 2ZB2A 2C98A 4UU7A 4EUHA 2QN6A 2V7BA 5DZSA 5BMOA 1RE1A 3LKZA 3MWJA 3K71B 2NNLD 2DJ5A 2CLEB 2G07A 1TPYA 3T7SA 4JOBA 3FHCB 4IIVA 1QQ7A 1Y6FA 3PHLA 5C8YF 3O8OB 2XB9A 3DE3X 4ATNA 2C2ZA 1K5HA 3DE4X 2F1OA 4X94A 3T3EA 4MVJD 4LJ8A 1VIMA 2CFIA 1YS1X 3AC0A 3HKEA 2KBEA 3B5JA 1MKYA 2PV0A 2RHDA 1SUAA 4NH0A 4BQQA 4BLQA 2HWWA 3CB4A 1PNOA 3OFJA 2PM8A 2ZE6A 2O19A 2QT0A 1EZ1A 3V4VB 1PGOA 4WDQA 2AOTA 4AF8A 1M67A 4YREA 1V5WA 2VZ0A 1QWOA 1JT9A 3CB2A 2NUPB 2J87A 3ZWNA 3RVLA 4UTOA 3CONA 1BE8A 4YRMA 5L95A 4DADA 5CU7A 1YQWA 3JRXA 3ORRA 1XJQA 1PZHA 4CQMA 1BXZA 5KJ1A 1X0XA 1UMCA 3R9XA 1ZISA 3QLUC 1SG9A 4CJXA 4D3SA 5A71A 2R6HA 5M3BA 1JLLB 1U02A 4Y7CA 4N0QA 3OQIB 5BQ3A 2HO4A 2G7ZA 4J8PA 4GE3A 4XPIB 1E2IA 2ZSHA 5HX7A 3D8SA 1FUEA 1XWIA 1NHGA 2B1RA 3L6EA 4I55A 2VPXA 3PHJA 4ROSA 3C97A 4LMPA 2VAVA 3K53A 2AXNA 3ELBA 4KGZA 3U1VA 3O83A 2Z5GA 5DGHA 2WJAA 3PDHA 2X5XA 2GXUA 2D5CA 3DE6X 2PUJA 3A9CA 1X1TA 1JDZA 1EFLA 1RWXA 3VYTB 2CFCA 4U4AA 2Z2ZA 1MOSA 1J4AA 2J5QA 2XH8A 4IWXA 1PEYA 4WESB 5CD1A 1BHO1 2C99A 1WWKA 2B3TA 2I7DA 5E4TA 2AQHA 2G9QA 5AM3A 1USVA 1IDOA 4AZ0A 1W36D 4REOA 1DEXA 4JB8A 3DW1X 3ORHA 3UW1A 1JSZA 5C5EA 5BOSB 1C1YA 2YASA 4ER0A 4AKGA 2RGEA 4HQ0A 5FJJA 3IC5A 5M2QA 1IPFA 1KXJA 2PXHA 2VJCA 3ETCA 2ICAA 3EXG2 3FCAA 3H9JA 3EFOB 3BIJA 2I7TA 1P2DA 3HB7A 3MOGA 3PNVA 3P9PA 3KYBA 2HFJA 2GAJA 5TQ0B 2HCTA 4YXFA 3NOVA 4PLWA 1T1EA 1XEWY 3A4VA 3DJFA 1VLZA 2VYVD 3ECAA 1PFQA 2O8EB 1K3UB 1VJDA 3WS7A 4RKRA 5AW7A 4QOIA 1QDEA 2XCUA 4G0PA 3UJ8A 4IKOA 3M6MD 5GGXA 5IN4A 1S2IA 4AQ7A 3WO0A 1EFHA 1WDWB 2J59A 2PK3A 2VHJA 3VC7A 5HW0A 2PQ0A 4UHEA 1RJ9A 5IHXA 3K09A 1OE0A 3O2QB 1HSZA 3QMVA 1XJ0A 3RJZA 3WIOA 1U65A 2WPDA 1MRSA 421PA 3NTVA 4D56A 1J5XA 2YBVB 5DHFA 4B3TB 1NQAO 2UAGA 3A2NA 2OWEA 1QIHA 3D6AA 4WY8A 4P0QB 1N8KA 2QV0A 3VHQA 3ONDA 1UR5A 3U48A 1Q22A 3H8SA 3ISJA 3TLKA 2WSIA 4O33A 1ZJYA 4Y0AA 3O1JC 3E3MA 4HGPA 2DUMA 3U09A 5B1SA 1TVKB 4RY0A 3UWMA 3N6RA 3BMOB 2JRLA 3JQFA 2OP0A 4H7PA 3H13A 1E18A 2ZYRA 2HGZA 5KX5A 1J0CA 3KPVA 1BQ3A 4L08A 5D1NA 4HUQA 4ZQIA 5AVKA 2FCRA 3JR7A 3UXMA 1DJNA 4ZO8A 2NZXA 3TYXA 5EHNA 3EGCA 3AFOA 4UE6A 5H68A 1TAGA 4AJ1A 4HDMB 1ZUD1 1L5KA 1U0RA 2Z9CA 1T9DA 5FTLA 2IH2A 1IHYA 1LDGA 2BY4A 4I5IA 2A0FA 1NW7A 2Z3VA 4KE6A 1U8UA 4M2LA 2PWBA 4B7ZA 4DC0A 5T67A 3H0CA 3JWHA 2VK1A 2YXPX 3HU2A 1J0BA 3REQA 4S05A 2Q3MA 2JLXA 1QYIA 2DLDA 3DD5A 3LWZA 1FIUA 1GLNA 2CDAA 1PN3A 4ZO6A 5AJZA 1XZKA 2BMFA 1VPVA 2ZSAA 4LDQA 1SBHA 4PGMA 3AIIA 1GXSA 5IMBA 2OUIA 3N7AA 3T12A 4EA6A 5BXQC 3B52X 5B7GA 2O2GA 1AGXA 1ISPA 1D5WA 3H2HA 1K1EA 1OYOA 3C8ZA 4AY2A 1MPTA 1QGDA 2SKCA 4GHWA 1XQVA 4XDGA 2IFTA 5CYFA 2Y4OA 3KZMA 4RWEA 1W75A 5HUJA 3ZV7A 1UBGA 2EDAA 2YUTA 4L9RA 4ZAZA 4A27A 1DRKA 4CKEA 2OCDA 3ZUPA 1TGVA 5A4JA 3G8AA 3SF8A 3A32A 1GTL1 1G6KA 4P58A 1CV2A 3UWDA 2XBUA 4CF3A 2RGAA 3R2JA 1QV9A 2P9ZA 4IGAA 4MQ6A 521PA 1QE5A 3D6VA 4EPWA 5JALA 1R4NB 4IJVA 3TX2A 3BTUA 1ULAA 4PQGA 3ZWBA 2I22A 4YI5A 1Z37A 2XZDA 2Q27A 3CO0S 4YDRA 3AFGA 5CDYA 5HZMA 5K99A 5KC8A 4DDMA 2Q2NA 1T8PA 2WJYA 4RJIA 1PNRA 3WJ2A 8AT1A 3RIHA 5KSOA 1JAYA 5J4KA 4D0RA 3SFZA 3GCXA 3SCZA 2CFTA 1Z88A 1OKKD 2Q8PA 3KZOA 1W30A 4H0CA 1HFWA 4Y9UA 3SJ7A 2C7RA 4TS1A 1H2AS 2LV8A 3H86A 2C1XA 5DSTA 5MGNA 4JL6A 3VRHA 5LLDA 4IDCA 4H59A 2OZVA 5AKYA 1XF9A 3LV8A 4OATA 1YC2A 3QY9A 3IB6A 2ILVA 2YWCA 3PQ2A 1MVOA 2P78A 1QLWA 2ZUTA 1IM8A 2VEOA 2XIJA 4D92A 2OHXA 2IYXA 2ZIWB 1UEJA 4GGPA 2AFVA 1GCOA 4GMDA 5ALXA 4BVHA 5ECGC 4K7JA 1J0DA 1ONSA 4NZ9A 5A2QA 3NQ41 2EKLA 2TRSB 1YOBA 2N42A 3KZNA 4MPTA 4QXRA 2PGJA 1AUQA 3MTQA 4WKGA 4AF6A 3MJRA 3T4EA 4BRWA 1Z47A 2AYXA 4YAGA 3AVWA 3DV2A 4WK2B 1L8AA 2W2MA 3V2IA 1R8YA 1BWPA 4LJ7A 4XSVA 1MRZA 3M3PA 2O3RA 1XJCA 4XB2A 5MDHA 5I7SA 4GOOD 1E79A 4Y2YA 2FTKE 5CMLA 1YSCA 1DXYA 1P0IA 3HY3A 4K5QA 1W34A 2Z3WA 3LO5A 1U9YA 2WKPA 2O5EA 1TADA 1WCWA 3BH7A 2ZT7A 4DLZA 4HATA 1DOAA 3EIWA 1WDKA 3FCEA 1YQGA 4EPTA 1P18A 2NACA 2RH4A 2AFIE 3AJDA 1MX1A 1SBQA 2H2HA 3LKDA 3HJFA 2FLKA 4RVOA 3T5PA 2QV7A 1U9CA 4DC1A 2VUSA 3HN2A 2WT8A 1VPWA 3OOSA 3EF1A 4P7JA 5HZKA 1DIGA 4BASA 5JDIC 1TI7A 2ZTUA 2ODEA 3ANXA 4UAUA 4BO8A 1XTVA 2XXAB 2W11A 3ROEA 3IUQA 1PL8A 3WNCA 3MCAA 1L4YA 1YVRA 5IULC 1JYEA 1PLKA 1Z63A 2RGNA 1RJWA 4UDOA 4L6CA 4YT5A 5B3AA 2CT8A 4QUBA 4TKZA 1XA0A 4M0UA 3WTBA 1MJFA 5EVJA 3RFUA 2BW0A 1IBRA 2OV3A 5CIQA 2PYIA 1JIXA 4PX3A 1IMJA 2BZ0A 1I4LD 3HCDA 1CY0A 4A03A 2PANA 3E48A 4YA6A 3WIBA 3SHTA 2JLZA 4KITB 1PZXA 2BKUA 2IPAB 5IM5A 3I0ZA 5HR5A 5KTNA 4RK5A 5J1TB 1O4WA 3KKMA 3ZXYA 2NT4A 2J09A 1ZCBA 5A5EA 1XG5A 3BZWA 1IOZA 4QEKA 1HRKA 1W49A 2W2VA 2VOJA 2JVKA 5KWIA 4HNRA 2PV7A 1XCJA 3FVWA 1A5SB 1VE9A 2PIDA 1JTVA 3M6FA 2Z6QA 4DCTA 1KETA 1ZCAA 2YIDA 3E3LA 3HGQA 2I3BA 4GL4A 4XX0B 4OKIA 1HLFA 5CK4A 4EBBA 3GU3A 4PVCA 3EIFA 5CT5A 5K6AC 4PX9A 2IUTA 4CM8B 4NZOA 4YUXA 2YMQA 2OFFA 3WMXA 3F5MA 3ZI4A 1VGQA 1XRJA 4N39A 3ZHZA 4B8YA 3AM5A 4Q4DA 1Y4DE 4CMAA 2VTDA 5K05A 4RHYA 1B7GO 3L1KA 2EGGA 4RVCA 3O4JA 1ZINA 5HKBA 1WDMA 2VDPB 4U5QA 3TIGA 4CV2A 4XIJA 4F04A 1N4DA 2FEPA 1MVLA 5K3DA 1CQWA 4H60A 2ZKLA 3WLTA 5SY6A 5REQB 5JISA 2VNKA 5FUWA 1IC6A 3R4CA 1LSOA 4ZMRA 4FCWA 3FH0A 4YAWA 5E0OA 4YX9A 4DREA 5C37A 3L9XA 4RGQA 4DLPA 2C4MA 4EUNA 1BGXT 4L2IB 3CH6A 4B6PA 4JK3A 1E3MA 4DCMA 3ZNPA 2HJWA 1I7NA 2A0YA 4HH1A 4DN6A 1ZONA 2JCXA 2P1DA 3TG8A 5K3FB 3GJTA 2GI4A 1QX3A 2C92A 3NRBA 3RBZA 4HN2A 5KQLA 5IJZA 4YAIA 4C87A 2FRVA 3G2LA 4NMHA 1WXFA 2AFIB 3GUHA 1SOVA 3C8UA 5DF1A 3TOVA 3UMFA 1SIWA 3PFBA 1G38A 3GLFA 4ZJPA 5B7NA 2O0HA 3KIPA 4MQFB 4LHZA 5ICEA 1KJ9A 1Z6GA 3LBNA 5JFOA 2YWFA 1Z17A 3NBYC 4PG5A 5FTNA 3PX2A 3EAGA 1QVAA 2BM0A 5F9MA 5ALSA 3Q7RA 4MYUA 2MU1A 3RG2A 3ZDYB 4CLRB 3HGMA 3NHMA 3NOXA 4KTVE 2B82A 2F1KA 2XRYA 1HZZA 2FMXA 2WA2A 3FSGD 1ONPA 3JY6A 3PHIA 4R69A 4B1FA 1W2HA 4AKHA 1V8FA 1DC5A 2BMEA 3M1LA 3NBZC 2EARA 4QU0A 5T64A 5BN3A 1KO4A 5I3CA 4HQFA 1T91A 1QGAA 3L0DA 1ESEA 4Q3KA 5BYJA 4JJ6A 2PPVA 2AD1A 4I36A 4Y18A 1I5RA 1Y5IA 3AVYA 1IL0A 1R5BA 3LUFA 4ZT6A 2KE5A 4FFSA 4OHZA 821PA 2R6R1 3C41J 3C48A 2VCEA 4G67A 4YAEA 1FMTA 1SC9A 5CA0A 3WJAA 3VR0A 4TYNA 3Q3GE 4M1WA 3M49A 5CA1B 2P9GA 2YZGA 3KJEA 2CHQA 2VSQA 3IUJA 2EFCB 5D00A 5D3KA 3LJKA 1J90A 3FNIA 1Z5UA 3OMXA 4R40A 1GPDG 2O8CA 3SEFA 2VDUE 2NU6A 3DAPA 2WUFA 3RS5A 1KMQA 3A9TA 4CMHA 3L1JA 5EMJA 4XIYA 1QE3A 1T36B 1OGYA 1D6SA 3MM4A 1GUYA 4MLZA 3RT9A 1CVRA 3RAEC 5HCUA 1V9LA 4GI1A 1NJ5A 2FZ4A 1C4XA 2G7MC 2HCFA 3QFFA 4G8JA 3OAAD 1RZ3A 3PJRA 2QU7A 1H8HD 2VT7A 4BNTA 4Y6SA 1Q0PA 2DPYA 1JIJA 2G80A 3MWDA 3OQHA 2VHCA 4MXDA 1JKXA 5DULA 3WY9A 3ZK9A 3PA6A 4D0SA 2XQGA 4C4PA 2ERYA 4M6WA 3L77A 2CLLB 4FFPA 1TM4E 2FUG6 2QN7A 1K6MA 1NNLA 4N0DA 3LWBA 5GJWC 3Q6MA 2HTEA 4OIMA 5P21A 4QGFA 4A73A 3I2JA 1FX1A 1RBOC 4W5NA 3WGGA 4ZVVA 3A1FA 1X3LA 1VL8A 1HGXA 3AXSA 3W04A 1YB2A 2BZ1A 2NT3A 2PXXA 1B1AA 5D84A 5FRDA 4PBTA 4RTMA 4D25A 4UMEA 4GMGA 2WVAA 4DF3A 3OWXA 1B93A 3PNMA 4HB4A 3EJWA 4NU0A 4R1PA 1NMQA 1Y3HA 2YQ4A 4IDQA 3K8ZA 1TFRA 1ZG3A 3DV9A 3E3NA 5K8JB 4ZAXA 1HO3A 3HJAA 1IBLB 3WV5A 4LSZA 1P5ZB 1TT7A 3IDZA 3G49A 2XQKA 1LS1A 1HEIA 2C5FA 3FI0A 4MMZB 2EW2A 4CMJA 3C3BA 2PZMA 3L4EA 1VIYA 1B4DA 1RWVA 2R4UA 1GKKA 2EF0A 3CG0A 4PF1A 4G4JA 4ZVLA 4DC9A 1NUQA 1F9EA 5ER9A 4NKRA 5KSZA 3JQ7A 3QENA 3ZI7A 4E15A 1F8XA 3FOAA 3MUNA 1OFIA 3ISVA 5ILQA 1QZZA 1ZSYA 1NLMA 2HMVA 2G76A 3PNOA 4Q3CA 3U1BA 1AK2A 3HDHA 3DBVO 4XJTA 5GZ1A 3CVVA 1ZM2A 1Q95A 4I9GA 1M2KA 2R6CA 2Z4RA 3OI7A 4HAOA 3L0ZA 1R8JA 1YJQA 4NS4A 5DXJA 4FFBA 1AUOA 1PR1A 4MH0R 5JAQA 1MQ9A 1GQQA 3LKVA 2VNSA 4HPXB 4YJHB 4FDAA 4AN1A 2EFEB 3BH6A 2O8BA 3O4VA 1EZ4A 4KRGA 5EP3A 5LKRA 3KL2A 4HX5A 4R8KA 1Z6TA 6GPBA 3HO8A 4AS1A 3A0RB 3QXHA 5KX5F 4UXHA 5CVTA 2GK3A 3QFCA 2HQRA 1E2KA 3A4IA 3VYVA 1UDXA 2FQYA 4PZEA 4IW3B 3BAZA 4RVFA 3DBIA 1NF8A 1RE0A 2GUGA 4B73A 4Z53A 3BK1A 2ZLBA 4J0KA 4X20A 3LHDA 4J3FA 1MB9A 2W4MA 3WSVA 2VT2A 4US0R 4ZQBA 4IY1A 3F6BX 4IWNA 2ABWA 4ZI2A 2Z57A 2C9BA 1KMMA 4PR0A 1ECJA 1NUHA 2G9RA 5HK9A 3E2MA 4FK8A 3VNSA 3RJTA 2QLJA 3F7NA 4RNCA 4GSLA 3IDFA 2WIJA 3IR6A 5A0TA 3LVRE 4NOKA 2W6IA 1BRTA 5LP6B 1K7FB 1U0GA 4WUTA 3ZHRA 4ZDJA 5JQWA 3IDAA 4EF6A 2FPMA 2VSXA 4M1MA 4Q48A 4WGGA 2GTHA 4EJ2A 1K68A 1PFWA 1WXDA 5JNTA 3W5UA 4CG0A 3GUVA 1M8PA 1TF5A 3JD3A 4BY9E 4JBYA 4P93A 1EWQA 4ALNA 3MBIA 3K0CA 3VI4B 1GZDA 1DWQA 4C4XA 2EHJA 2OHGA 1RBQA 4UTRA 2VPWA 1QFYA 1SJ9A 5C31A 2D5BA 3K4HA 1XZIA 3NBXX 3OU7A 3C1OA 1UWKA 1OCEA 3U3OA 4OH7A 2WHXA 4J3JA 2XKKA 4POOA 1HM5A 1N57A 2Q3CA 2Q1UA 1A8IA 1BU5A 3AR6A 3MA0A 1BFDA 5TC4A 5CLFA 5EMHA 8ADHA 4I1UA 5HKOA 4YMWA 3LK7A 5HQ3A 4M0PA 4BIMA 2PMEA 1YQDA 1O96A 4D8TA 2JIZD 2O7VA 4GLFA 3BXGA 3GT4A 4LZPA 4OL9A 5JOQA 3K32A 3Q0TA 3E61A 1S3IA 2YRFA 3N53A 4EZBA 5KMGB 3IP6A 3BMCB 1NMXA 3HDJA 3D6TB 1HDCA 1VP9A 5JQGB 2R6JA 4MKVS 3WB9A 4CEIA 3E7PA 2V55B 3SN6A 2NM0A 2Y1EA 1TD9A 3I58A 1KAOA 2NZ8A 4BNLA 3TECE 4J6FA 2ZJ1A 4HLCA 5BORA 1XXHB 1STOA 4MQEA 4RDXA 3LDFA 3AF3A 4L8LA 1QB7A 1C29B 1KI7A 1OLUB 2EC5A 1H2FA 3EDQA 3L7JA 2G4VA 4H4DA 4MS4B 4PFSA 4W9MC 2J3IA 1PAUA 1YMUA 2D7DA 1MAHA 1U8CB 4OKSA 4YV1A 2ENUA 2GNPA 1NUAA 1EGVB 1JL3A 4X91A 4KXNA 3EIUA 3VZSA 3W8DA 4PN7A 4MIOA 3DOHA 3QW4B 3H1FA 4E88A 2F55A 1NC1A 2WFMA 3KJGA 1M10A 4HZUB 4C3OB 1C1XB 4PTYA 5BYBA 1A96A 3H5IA 3HN7A 1V48A 4AYWA 5EXPA 5IKMA 5ITZB 1Q0TA 1JH9A 2VK2A 4J1SA 5F33A 4C07A 1RAFA 3R5SA 1NX9A 1TCCA 2O6LA 3FSRA 1RM3A 4F8EA 5K0ZA 4KVFA 3WGNA 1NV9A 2GYYA 2XQVA 2YOHA 3BREA 3WB2A 3SJAA 3I4FA 1TTQB 4XJXA 1H66A 4TZKA 2A5LA 3I76A 3WZMA 1Y5LA 4KP7A 5HIKA 2QVYX 2YC2C 1RNLA 2YY7A 4HLUA 3UPDA 1J1ZA 2OHIA 2WM9B 3V80A 3IEVA 1C2TA 1FUYB 6PFKA 3SF0A 3N0XA 4CTJA 1X92A 2GBLC 3NM5A 2NAFA 1T0HB 3NHKA 2XVAA 3MTJA 1YDGA 4FDTA 2NZJA 3EVGA 1ZHFA 2PS0A 1VCOA 4GLBA 3SZRA 1GPH1 1DCMA 2HJVA 4M54A 2F3TA 2GETA 4IVNA 4MWTA 4LXXA 1E7QA 1M66A 4QM7A 3U0BA 2B4AA 4X00A 1JU3A 5AVRA 4RFLA 5JNVA 1IHUA 2N0SA 2IIBA 3E0QA 4E22A 2ZBPA 4C0SA 2ZTMA 3GGPA 2ZVDA 4CTNA 2H5JA 3VJKA 5EZYB 5JAPA 3W5DA 5H16A 3WGIA 3P9RA 3RYFA 5DIZA 1Y7TA 1IUPA 5HE8A 1KPHA 2XOXA 2RGUA 2I9PA 3OO0A 3HBMA 3C5HA 3I9NA 4G9EA 3JWJA 4HNAB 4NU8X 5CLHA 5CVEA 4E08A 1DC6A 4LZZA 2BRUC 2B1IA 2JNWA 4B4DA 5H80A 4MO2A 3RM3A 1SUEA 1Y63A 4ZAYA 5EJ7A 2ZVQX 1EXDA 4MGHA 2IZ0A 3LFUA 1OT3A 2VJMB 2X8AA 3H04A 3ICOA 2BEUB 3ACCA 2WBLC 3BFVA 4OHRA 1QU2A 1T9GR 4B2LA 4F2DA 1EU1A 3CLVA 1OIWA 5DGXA 1H0RA 3L93A 3O8OA 3NS7A 1SVWA 5CHEA 3EGXB 1A9PA 3W4KA 1XELA 4Y67A 4IPTA 5J43A 2EX4A 4MVJA 4CODB 3O1IC 1TKCA 1NVFA 4PS1A 4BPRA 1KO1A 4D5EA 4LYJA 4NESA 1SRRA 4MKRA 3THSA 3WKBA 1WSWA 1E5QA 1T8UA 2OUKA 3UCFA 2OECA 1KI3A 5GJBA 1VL0A 1K4MA 3MUFA 3CF0A 1P75A 4E4RA 1RCXC 2VVTA 3DVLA 1LF5A 3U26A 2P7HA 3C74A 1K5DA 2Q4EA 2NUPA 2ZCUA 1M7HA 1Q16A 3TJRA 2VWQA 3TVYA 1G2IA 2W22A 4GPBA 4LWOA 2XECA 2I2AA 3FFAA 2IU4A 3J7AC 1ICIA 3U4CA 2PUCA 2EWWA 4Q3LA 1GNLA 4P4SB 4Q7LA 4BL5A 3SHFA 2GZHA 3IEKA 2NPFA 3RUCA 1JLLA 3E8MA 2H8GA 1GL3A 3OQIA 1GRQA 3LIPA 3R5HA 4F3YA 3QPWA 2VATA 1T9HA 3TIVA 5FNZA 3CUSA 1LB1B 4XPIA 1Y1QA 3U3RA 2IA5A 1N0HA 1OROA 2XRFA 4NCIA 4EX7A 2QTHA 1ZUHA 3BH0A 3FUCA 3VSEA 4CN9A 1T43A 2QP3A 2WAOA 2YWDA 4D6PA 3WXBA 1KOJA 3ZY4A 4CT0A 4RD2A 1KNXA 1Y1TA 4H17A 3SOZA 3TRKA 1OAKA 1FMCA 2EWVA 1U4OA 5JDCC 3NTXA 5FTKA 4C3UA 3JQAD 2XE4A 3JQAB 3RKUA 4WESA 1LPNA 3BWEA 1Y9EA 3RRJA 4ZU6X 4XA8A 1GLGA 4W4TA 4Y1EA 2VRBA 1E3LA 1Q7RA 2ZUUA 2YIVX 1BKYA 3IBGA 3EYWA 2Y93A 4LF7B 3H75A 1JR2A 1OR8A 3O82A 4KXXA 5JG7A 1YWGO 4GT1A 5BOSA 3V8NA 3Q15C 4ALIA 4BVAA 3DEAA 1F7VA 2FRDA 1SY7A 3EFOA 3SXPA 2CHUA 5TQ0A 4B09A 5JD4A 5EEGA 5DM1A 1ZUNB 5CIYA 1I6LA 2A33A 2IOYA 2XE8A 4LA4A 4PPFA 5C9ZA 4BQEA 5JY6A 4KUHA 2O8EA 3LBYA 1KP2A 1EUZA 3UKJA 1IZ0A 1Z7BA 1E3WB 2WAXA 2FZLA 5LWHA 3AUSA 1N2BA 1V5IA 2DTDA 3R77A 5LSAA 5KWJA 1O89A 3BEDA 2ZTSA 2BSAA 1C3LA 2MWMA 4Q4AB 2ZZMA 4QGGA 1P6UA 4C0XA 3ZWVA 4U0KA 3CPSA 4AI6A 3AY6A 2XV1A 1NT2A 1EDZA 3KEFA 4OREX 1DQSA 3H9UA 1ULZA 4U7HA 2ZYDA 4QXQA 1GTVA 2J3EA 1LV8A 2Q8QA 1ZRNA 2A59A 3LQQA 3TBKA 1I80A 3WLEA 3O5AA 1S8OA 5CDHA 1RBLI 1NBOA 4DSAA 1Z22A 1OYYA 4O2AB 4JX8A 3D3WB 5J63A 1KE1A 1B6GA 1TVKA 1MD9A 5KJEA 1NBIA 1XOIA 2PCLA 3BMOA 4LC1A 2WY2D 1KI8A 4RZ2A 1W9MA 2XHZA 3UXEA 5JMOA 2UDPA 3FWPA 4JVNA 2X40A 3W9SA 1QO9A 4JLUA 1IJFA 4J6EA 3TAUA 4LJ9A 2GX6A 2GZ3A 4QUKA 5B1EA 3MD9A 2IE0A 2JLUA 3TTVA 4RULA 5HFAA 2AC7A 1FB5A 4HDMA 5JLAA 1GGKA 2ZT8A 2YNMC 3FNFA 3Q72A 1UZLA 2OO5A 3PA8A 4EG0A 4A36A 2JFGA 1FX0B 4Z99A 1OFVA 2A9PA 1XAGA 4HGYA 1ZO8A 3OOYA 2VYCA 4ZEMA 1SOUA 5T4HA 1E5XA 1HKUA 3LLVA 3FAKA 4LDAA 2NLOA 4ND7A 4FSDA 1V35A 1VLLA 4R6WA 1NZDA 3EIXA 2VJLA 3VR6D 2WLSA 3RRYA 3QOYA 2IYAA 4KQEA 3TLZA 3W1VA 3O1HB 4NG4A 4XW2A 3V97A 3ELWA 1NXOA 4PZ9A 4JD5A 4BUCA 2WQ6A 4B83A 3OG9A 1JQ3A 5EUCA 3AR5A 4ECEA 3NGMA 1P61B 3CLUC 3O9ZA 3EXFB 2QTBA 4LXUA 5EPEA 1H93A 2O3TA 4NC9A 1CP2A 2IDMA 4JI4B 3EDOA 1YGYA 2CCJA 4WFIA 2G1UA 4F3KA 3X0DA 3B6ZA 2H4ZA 4YGYA 1RXEA 1DAMA 2LP4Y 2PNFA 3OEYA 4KIJA 4OQLA 2X22A 4ZT7A 1BN7A 3L46A 5FBQB 3EIHA 4XYGA 5JPDA 3LGAA 4JT2A 5MF6A 1DX4A 2AJ8A 3OCCA 3V7YA 3ZHYA 4TYPA 1PL6A 4RHEA 1R4NA 2FJ0A 1FDUA 5BNFA 1ZJZA 4WA7A 2EFGA 1XWFA 4XWGA 5CW1A 2ZBDA 1Q1AA 4CFYA 3UC9A 1QM5A 2OCXA 4DQDA 1LC3A 1IY1A 1GKYA 4JLWA 4PWYA 2EL9A 3MWFA 1RZUA 3BBLA 3NEYA 1B8PA 3OLXA 1A2QA 2IKSA 1Q21A 4B3HA 1T2AA 3GFTA 4M76B 3KZCA 4MV0A 4U2GA 5ENVA 5FYDA 4CMKA 1I13A 2ARKA 2F1RA 2IPNA 1CT9A 5TQ2A 1OKKA 4DLRA 1UXHA 3J81k 3CZPA 2ZSUA 5B36A 1G21B 1NX6A 4GL2A 3U3JA 1KYTA 2IPOA 4NK5A 3B48A 4XUGB 1EFRD 3D7NA 4R16A 4XVRA 1PL7A 4M0DA 4JYAB 5DW3A 5GZ6A 1QKJA 2QPLA 2OXIA 3RUEA 1T25A 1T2FA 4LOJA 2ATIA 4ODIA 3PEVA 4ZCQA 3QZUA 4DSOA 2OQRA 5J2UB 4M9UA 1TVEA 2AQ8A 4WEQA 1RXWA 3ZDAA 5I8PA 1P9OA 3L0BA 1DRWA 4EATA 4BKOA 3BDVA 1RTKA 2VI5A 1FFHA 3D02A 4FMBB 4IJQA 4RD4A 3SC4A 1GDTA 2TMGA 1TGYA 2DH5A 4R83A 5I5GA 3DBOB 1COZA 2I4RA 3LYAA 3OJ0A 2WU0A 1D0IA 5IVIA 3PQEA 4I8XA 1ORTA 4BNDB 2R11A 3JASB 4P82A 2IEZA 2OZLB 3UO8B 3G23A 5ALVA 3LRXA 4JVOA 2HU8A 2NSLA 5LYYA 1LBIA 3S7TA 13PKA 3QIAA 1OZAA 1NLZA 2AWOA 4KX3A 3WWEA 2PUGA 3FCXA 2I1WA 1F2DA 1PS0A 1X7ZB 1JDUA 1ZXBA 2CB0A 2PGOA 2Z98A 1EFCA 1GZUA 1NJ8A 3E7WA 1I7PA 3O3MB 5ELLA 1N33B 1XF1A 1V8ZA 1ECFA 1ETUA 1GKUB 1I1OA 3K16A 4JU9A 5F5LA 3UKDA 1BXNI 3OTQA 4EH1A 4JLPA 1MAUA 2C03A 4NY1A 4KMOA 5LP6A 2IYLD 4J90A 3R8FA 1AXRA 3RNLA 3D64A 3H1EA 5FOSA 1QUFA 1ZICA 4P5EA 5FD8A 2COEA 1W1WA 3O4FA 4CCSA 3I52A 1E4EB 1I7LA 1XMXA 2L69A 3ZZ1A 5BQPA 1G7SA 3D54D 1C7ZA 3P2IA 1OGJA 2JCVA 3NR2A 5L3ZA 3U2QA 1CKEA 4EW2A 2XXAA 2Y1CA 3VO1A 1N78A 3TTSA 7MHTA 2BCGY 4K2AA 3ROMA 3BJIC 2QX6A 4KKVA 3DVAB 2G9ZA 3LRPA 1PWHA 3H84A 5JAMA 4YJGB 2WJVA 4BKMA 3EPJA 2IBSA 3SD7A 1KEWA 4Q4HB 1SELA 2QXUA 2WPNA 2PZEA 2WD7B 4TMYA 2YDYA 3BWDD 2RGGA 1NOJA 1KC1A 3DXFA 4GX0A 5K0GA 1MIHA 5INTA 1N1MA 4MWCA 1FFWA 3L49A 1UPFA 4V38A 1V5FA 1T9CA 1DXQA 2P69A 5E7QA 4N5HX 2AOXA 2FZWA 1Y8QB 3PL5A 3CXRA 3ZXXA 3WX0A 2P3OA 2RGCA 3F4BA 4JKIA 4U5XA 4J0JA 4RA9B 2EFHB 1NA5A 2RKWA 2XQFA 4X6YA 4YDQA 2I55A 5FO1A 2AG6A 1WUIS 1S5PA 4XX0A 4ZDKA 1Q7CA 3DLAA 3I64A 4EVRA 4BU0A 3ZHSA 1PGNA 4XGNA 1FYWA 3G2KA 4CM8A 1LBHA 4RD0A 4B80A 1UOEA 1D3AA 1YZ3A 1CCWA 2VHQA 4DWOA 5GVSA 4WK4B 1COWD 2PAFA 1CY1A 4TQAA 1ZRHA 3FGNA 3D5TA 4NL4H 3FRHA 2X1MA 4QU5A 2YV1A 3NBKA 5EIOA 4MSUA 3EDMA 1G8GA 4HDOB 1KRHA 1ZK2A 2I2XB 4G0ZA 2CYCA 4WZBE 1OFTA 5REQA 4ETIA 3KHSA 4URHA 1JQ5A 3GQVA 1ESDA 1ORDA 1KF0A 3ORQA 3T7CA 1NTOA 3WKEA 1CP3A 1ZHHA 4NBLA 3UAYA 4DV3B 3Q7EA 2HHHB 3E9QA 2K2WA 3PFHA 2PL1A 2OR3A 4L2IA 4B3SB 3IO5A 3Q8LA 1TZMA 1O95C 3ULKA 3K9GA 1J07A 1UBMS 4OYYA 4P0PB 1ZGHA 1PYOA 3SICE 4EI9A 3C6MA 5KVQA 3HMQA 3BZBA 5K3FA 3FB1A 3JSAA 4I6GA 4R1LA 2HRDA 2OOSA 4YMTA 3KWMA 4I46A 2ZB4A 4AIIA 4E5DA 4LK3A 5BMVB 1O5OA 3VNQA 2AFIA 2KX7A 5KNBH 5KYKA 4B8WA 1M2EA 1YULA 2GKGA 4M1QA 4DEXA 2OCIA 3VGPA 2IXGA 2XCTB 1MOZA 1G5FA 1VHWA 2H85A 2ZJ5A 3DEZA 3MILA 5CAEB 1WS6A 2RAVA 4MQFA 5AHOA 1AS0A 1R6TA 4E5KA 5JJCA 1NAHA 1IEWA 1UQRA 2ECOA 3ERCA 2L17A 4DIKA 1R5NA 2RAFA 2AEJA 3VVCA 3R75A 1CQZA 1AN0A 4DRZA 4EW3A 3ZEIA 3EDYA 1NVMB 1BKSB 1GM5A 3GFBA 2WF5A 1EKXA 4MPDA 4P2BA 5L7TA 4CLRA 3M6XA 3JTMA 2C4NA 3AYZB 4HH4A 3DKRA 3FSGA 3VPSA 2FZCA 2AF4C 3EAQA 3A6PC 3W2EA 2OLJA 3JQPA 5FTMA 1XKTA 2Z6AA 3CW9A 3G7NA 3GRPA 2HWXA 2I3GA 1XTSA 2DT8A 3QJGA 4HAYA 4RAOA 2ONYA 2A30A 5AXCA 1QRSA 4Y2VA 2JPDA 5IF9A 3UPUA 1LX7A 2R1TB 3GHYA 2BD0A 1ZGCA 5TMEA 3NBQA 4LDPA 3PU6A 1RPTA 5FFFA 2ZU6A 1MEOA 5EWJB 1L4UA 2FSGA 4LZNA 1LK7A 4R05A 1ZGJA 3JAWB 4PLFA 3LUAA 2ATVA 3TL6A 2RK3A 4U7TB 1L4NA 1N2EA 3L0IB 4INOA 1NNSA 2YVUA 3K9WA 5CLLA 2NIPA 1L0BA 1CQXA 5DTIA 2C2WA 3E23A 2ZI4A 5COAA 3UCXA 4Q7MB 1KR2A 4UBKA 1NQTA 4JFRA 3RC2A 4E13A 1UBUS 2D0OB 1W4CA 3SYLA 4NBTA 2OPHA 4BS9A 2SHKA 5BQFA 5IZ4A 1KZ4A 3E9DA 3UY4A 1LSUA 2R9VA 2X5KO 3H6GA 1T36A 1SULA 2EJBA 1GQ2A 3ABOB 3H3JA 3SQOA 4E70A 2PRZA 3L8GA 1KJJA 2GPYA 3NIWA 3GLIE 3JPYA 3GLQA 3DLCA 3GA7A 3OJWA 3BWBA 2D8AA 4YYEA 1C1HA 4G0OA 3TGWA 3OAAA 4K03A 4GKKB 2JHGA 1L7DA 5ITSA 1H8HA 1A9SA 1FF9A 1SD1A 3DLTA 4FUTA 4AXXA 3C3XA 2OC9A 2PZBA 1OZHA 3D2LA 2VPTA 3FZQA 3T7TA 1L8OA 3NBFA 3TQTA 3P45A 4IEFB 3WRXA 4ALMA 10MHA 1DOZA 3C3DA 5LNK1 5AOAA 1NYRA 3IQZA 2GZAA 3KLNA 4GOXA 4UOEA 3EPLA 1S2NA 4MWDA 1V6AA 2CXRA 3QJ5A 4BTVA 4GICA 4CTOA 5MFPA 3BC1A 2IQIA 1EHYA 3T1OA 2D5LA 5KTOA 3WBJA 4DILA 5T7BA 4UVGA 5LDDC 3GJ3A 4PZAA 1ZN7A 4AJ9A 1C3XA 3IHLA 3RFVA 5IP5A 1VE5A 2KLBA 1TO2E 4F60A 1IVSA 1QIKA 3M6VA 2ZBGA 2IHZA 4RIFA 4CXMA 3QFRA 3DDNA 1O9GA 3EY4A 1ZI6A 1U7TA 1VMAA 2Q7OE 1W96A 2X7HA 4NCXA 4R9UC 1KVSA 4MW6A 3KZXA 3BQ9A 3K8QA 4LWPA 3D7SA 4EKIA 3OICA 2II6A 2LE0A 4K88A 3T06B 4ENUA 4FWTA 1TA9A 2R4TA 5HTOA 1RFGE 2DQZA 2A0XA 2PN1A 3DCNA 3Q7SA 4EEKA 1T2CA 5F2EA 3PF9A 1NBME 1RRPA 4TRJA 3HWRA 2R4QA 3T34A 2VJOA 3BIFA 3FUXA 3NMUF 3NGXA 5FOWA 2EV9A 1WXQA 4G97A 3K9NA 3IAUA 2IWHA 1RRMA 3V34A 2CLIB 2F48A 3DKPA 5HOQA 4NRDA 2EAUA 3PVSA 4ZOCA 3U4AA 1OB5A 2WG0A 2FA9A 5AP9A 3W3AH 3HUUA 4GMKA 1F4VA 1D04A 2EL7A 5F35A 1LI7A 2DFTA 3PVZA 4BZPA 1WP4A 1E2DA 3BCSA 4QOJA 4YJHA 1C9JA 1F0KA 2F62A 4TMWA 2H11A 2R1UA 4JA0A 1FDWA 2ZSKA 3EC1A 4LY6A 1P91A 4P38A 1RKVA 2VDNB 1IBSA 1Q83A 5H82A 4MICA 1UT6A 3KHKA 5TX7A 4QGAA 2J33A 3NIGB 4L3OA 4MQ5A 4D99A 1RZRA 1ZK0A 2OLKA 4YRLA 1SU8A 4HVLA 3ZVNA 1AQYA 4N8SA 4JLAA 4WA8A 2YYYA 4MUGA 4Q4LA 1PL0A 2I4TA 3GIWA 4R9RA 1XN4A 4M9QA 4JP3A 1N6LA 2OC4A 2WJGA 3K35A 1N2ZA 3BXPA 4KNWA 3G2HA 1PZEA 3SC3A 3W79A 4B47A 4DA0A 4K05A 2EBWA 2ZJAA 1R0KA 1C3EA 5AVYA 1DDIA 3PUZA 4JUIA 4MGYR 1P62B 4AU1A 4C4SA 3VKHA 4XWKA 3MUEA 3C5CA 4GKBA 4GWLA 4TUYB 3ORSA 3OPYI 4OCZA 3LYHA 3TW4A 1N32B 1XX6A 4AUMA 1V3VA 1CJTC 3SLKA 5AO9A 1L1EA 2JGIA 2V5AA 1P77A 3HYSA 4PLZA 2Y3IA 3GZNB 4R1NA 5DBGA 2ZS9A 4ID3A 5KAMA 4BBAA 2MJLA 4WDRA 2WMNB 3NNDA 3V1YA 1LI5A 1QQBA 3E9ZA 1OPRA 1WP9A 1ZYUA 3TXXA 3DL0A 4CM7A 1XK6A 721PA 2WU4A 2LKDA 2ZREA 3E7XA 4D1YA 2WINI 5DV9A 5GGYA 5SZHB 4X45A 1NXTA 1RIIA 1OU0A 1B8VA 4GMHA 4KBGA 1MVNA 5B4UA 2ILTA 3TZHA 2QTWB 3VSBA 4LJSA 1JHXA 2DBZA 2JANA 3OHMA 1BNCA 1FFGA 4JQYA 5FWDA 4P86A 3VSDA 1NBMD 3MJHA 4H7IA 1T10A 5K01A 2ZCJA 3F78A 1K2WA 4KQKA 2JIZA 2HW8A 1XZCA 2BMDA 3I1YA 3O0DA 5JS7A 1IM2A 3SIRA 5KMGA 3EW9A 5H4GA 1T3LA 3BMCA 3FFTA 3GPCA 1K9VF 4IQ4A 4M9CA 3S5UA 3WLFA 4EY3A 2JASA 5JQGA 4LHXA 4WPGA 3JWPA 4OI1A 3FUVA 1L6IA 4YMUA 2XYPA 3EDCA 5FPPA 4OSEA 4O4JB 4HQNA 5K3CA 1XXHA 1U7WA 3O0TA 1FSZA 2OZPA 4DSUA 3T38A 1OLUA 2CGEA 4F84A 1SPXA 4MS4A 5I8WA 1UJ6A 4ZOEA 3ZCPA 1G66A 3BE6A 1NIJA 4MW4A 1TIBA 5EKDA 4L6IA 4BNKA 2HWKA 3VR3D 3DLBA 4LFBB 2QRLA 3CLKA 1IPHA 2X2PA 1HC7A 4AKTA 1PBNA 2FP3A 3GP3A 3BK2A 3GXOA 4F46A 1B0AA 3ZY3A 2OMEA 1E69A 5F3WB 4HZUA 4LPSA 1M9NA 1C1XA 3HRHA 5AK5A 4FOLA 2DQSA 1Q7TA 2GRJA 1JVBA 3ORFA 4OX9B 1FTYA 3EVAA 4CKBB 3DEFA 1Q7BA 5ITZA 1SR8A 5J2TB 5DMHA 2IIVA 2AL7A 3WLIA 3O9VA 3RRZA 1GPKA 2NUTB 4M53A 3Q40A 2A1IA 1KZ9A 5AVUA 1V8BA 4OMFG 2ADOA 5IH7A 4LQCA 4JT8A 1U6JA 1EUYA 1X70A 3KTOA 2RHRA 3OEHD 2GJ9A 3R4VA 1LDMA 2BEJA 1DC7A 2C77A 2VDMB 4LXGA 4LGVA 4OXQA 1E7YA 1RABA 1VJGA 3AL0C 1C3JA 5ALIA 1ODLA 3MFQA 3RSGA 1P72A 1REQB 2CL5A 1DIBA 2NTEA 2BM9A 3IE2A 4LX0A 2H52A 4RTNA 5TGZA 3ZDZB 3IOMA 5FF9A 4MVCA 1H0SA 3RANA 4EMBA 2GOYA 2O0LA 3A7DA 2QBYB 5I9SA 5ECWA 2XNHA 3FUTA 3LBIA 3BSYA 2X41A 4QQ8A 4XIFA 5AUNB 3DMYA 3SHVA 1Y8ZA 1YFZA 4ZRDA 4Z9BA 1QUEA 3PEFA 4ZOLB 1JLMA 1VKHA 3HMKA 5C0OE 2WNSA 4RV5A 2A0WA 3T8YA 3N2ZB 3TE7A 4A6DA 5EZYA 3NU1A 5DM60 4IS2A 4W9NA 2ZRQA 4AJNA 2X0JA 1ZD1A 1P2TA 4EY8A 4HNAA 2IOHA 3CRMA 3T7IA 4ER5A 2X0DA 1C9YA 1KDPA 1LLUA 1ZU4A 4MITA 3GJYA 4G86A 5I7WA 3R6LA 5J4LA 3U44B 1W9HA 1ZRSA 3KQWA 1NT4A 4QLAA 4RSRA 4Q93A 2NVUB 5B6PA 3CWQA 5CDGA 2FHPA 3VJLA 1PSDA 2Q5HA 2A9OA 3HXMA 2ZUDA 4TV9B 5E1BA 3BMQB 2UYHA 2VJMA 3COVA 3FTEA 1QTIA 2BEUA 1W0CA 2CVQA 4TSRA 4X92A 4CHTA 5AW6A 5KDDA 4U2DA 3GNQA 2Z1MA 5I45A 1NJ1A 4QUAA 1ONOA 4HHHS 2ODNA 5IC4A 2YWJA 4UNNA 3UF0A 4YRFA 4OUDB 1RRVA 5HFNA 4KKXB 3EGXA 4DJDC 1M0WA 4A6EA 1ACMA 1SKYB 5C4IA 4NDAA 4QBIA 3TLBA 2XGJA 3E82A 1RRKA 3KSMA 2PMBA 4LCEA 1N9ZA 3BA1A 4UEOA 3WXMA 5KU7A 4KDRA 1G6OA 2JFZA 1ISHA 2Z1NA 1PJSA 3DVRX 3OEED 3WWCA 5LPNA 4Z4FA 4YV7A 1ZVQA 5F7OA 2OK8A 2F1IA 3C7AA 3JALB 2NZUG 1LGYA 2QMYA 1HFKA 4KK3A 4NENB 5I7VA 1CQIB 2H54A 1CF4A 5G2OA 1FNCA 2FN8A 2GBFA 1U0JA 2XVXA 3D7MA 4QPCA 1JFVA 3TDMA 1NGSA 3CGGA 4MKZA 2XPCA 1W581 2FEXA 1YE8A 4WWHA 5JXIA 1VCNA 1QHSA 1E5LA 1DEAA 4P4SA 4RHCA 1W8IA 3HNRA 3OSUA 3BIXA 1DX9A 1YNOA 1YS2X 4MDFA 4TWRA 4NCKA 2JA1A 4BJHB 3GLGE 5FP0A 3LPAA 1M2GA 1W52X 3AT1A 3TF5A 2MCFA 1JUDA 4IG9A 3QVOA 1NVWQ 2BN4A 4G0WA 3RARA 1JA0A 4S12A 1THGA 3UAGA 4K9DA 2AJTA 2YFYA 3EBPA 1SUSA 3QBTA 2DBYA 3LF1A 3VOTA 1N2JA 121PA 1CUAA 1TUBB 4TM8A 4H18A 3H2JA 3MC1A 4V0OA 3D5EA 5DX8A 1KJZA 5FWNA 5LJLA 3VNVA 2FLWA 1R10A 2WHPB 2AMYA 1NQ5A 2XYQA 1RXSA 1ECPA 4Q3DA 1QIDA 3NJ8A 3JQAA 4UM8B 3ASVA 3H9BA 2H4JA 2UU9B 4BEVA 4CKCB 3K1YA 2QMUA 1I6KA 2IYUA 1U4NA 4I4TF 1Y6GA 2UXCB 3DFIA 1QZ3A 3BB1A 3CE6A 1Q20A 2B3DA 3OHPA 1YS4A 1IXZA 1CIPA 1Z08A 2XNKA 3E84A 4KFCA 3DBHB 2DM6A 3IXMA 5FL7D 5DFAA 2AIRA 1Y82A 3KQVA 2CWDA 2CLDX 2YR0A 3H65A 1JSRA 4II7A 1OI2A 4YCJA 1ZUNA 3EEBA 5D87A 3UA4A 1W73A 2GQ0A 2O4CA 4RK4A 1Z75A 2FFAA 2G83A 1ZIXA 2X86A 5FWYB 2EGHA 1EI9A 2H2GA 4G4IA 1E3WA 1YIOA 5K2MA 4ZYUA 2B8EA 5CA1F 1L3BA 2AR9A 4I1PA 3HPQA 4FNGA 4RL4A 4REQB 2ORWA 3DFMA 3TR6A 3WP1B 5IUNC 1JG7A 4Q4AA 1YIAA 5EE3A 4WFQA 5LDGA 1X7YB 4CIYA 5JJKA 1I51A 1A9OA 3BN3A 3K70C 3FD8A 2IYTA 1QXSA 4J49A 5HZHA 4ZVNA 1UKVY 3IULA 4BO3A 4BVFA 1KOGA 1NAIA 2EATA 2WTEA 3P2KA 4EEZA 1JQBA 1O03A 3MMPA 4MCIA 4RIHA 1NLYA 4O2AA 4HDKB 1XA4A 3D3WA 5K3OA 4DRYA 3CLRC 3ZDBA 1BROA 3SSOA 4P54A 1KH1A 1GZ3A 2A0KA 2C5EA 3OCWA 1CR6A 1CEEA 3A36A 4FFDA 2WE7A 4ZVMA 2UUCB 4KXMA 2QP9X 1UBOS 3A3KA 1NHWA 3B60A 5AQEA 3WL4A 4DABA 1NP6A 3T3MB 1S6YA 3PWTA 2JFVA 3GD5A 4LFCB 1PVDA 4EDHA 3PC6A 1GGJA 4FXPA 3ZZMA 4X6XA 3TM5A 4DY6A 3CRZA 3R6DA 3RQSA 2CJYA 1ZITA 4R2IA 1CF2O 3NWJA 6ABPA 1FX0A 4MCAA 1Y34E 4KU4A 1YBFA 1VOTA 1JA9A 3AM3A 4Y6GB 5TT1A 3ZD8A 5TE9A 2WHQA 3PTAA 3PPYA 1QGYA 1C8KA 3PENA 4PYOA 3CT6A 3OCZA 4ZO9A 4LNUB 2WJ6A 1DJMA 2DPHA 1DV1A 1G7RA 2W4IA 3DKVA 1J42A 1Y1PA 1Y7LA 2XAUA 2ZT6A 3NDPA 3QYPA 4MEJA 3VR6A 5EG5A 3QHPA 1V37A 4FNAA 4JZYA 5F12A 4EB8A 2B4YA 4DLLA 4CIXA 3AIKA 2HSEA 4CM9D 4QPPA 5ALUA 3VKUA 1Z12A 4OHOA 4JWTA 3TEMA 2F59A 2D1FA 3HZOA 3EXFA 3OZWA 2YRWA 4WJZA 5JV5A 1R16A 3D4PA 3VKWA 1FY2A 1KORA 4O25A 5AHKA 1BOOA 4ZV9A 2HPAA 3VO2A 1TF7A 4WKNA 4UDNA 3NV9A 4RA6B 3QEBZ 2ONCA 5HDQA 2J30A 1NDQA 5KSWB 1SBCA 3KQLA 5DXAA 1F20A 3V55A 3B1FA 2JLRA 4YLEA 1FRZA 3HSKA 4G25A 3N2KB 2KM1A 2J6HA 5A62A 1QYWA 4FR0A 1C0LA 1TJYA 1ZGGA 4DLYA 5FA6A 4ENVA 1NPDA 4XCXA 2WICA 1XLUA 4AJIA 1A8SA 2B4TO 1KEUA 3TX6A 4TZ6A 1NR7A 4QOHA 2PGXA 4PAQA 4RM3A 3DO8A 1K08A 5JH7B 2E7ZA 3AVQA 3RHZA 3PXAA 4NQRA 4U8HA 1NATA 2ZVJA 1U2ZA 5J4VA 3NP9A 4Y2JA 1MEJA 3U31A 1IATA 3INTA 1UCFA 1QYDA 2C96A 1EB8A 3H11B 4GAEA 4IMRA 4R2JA 4J0FA 1G21A 4RYLA 4GYYA 3TFWA 3T1VA 4MWZA 1EFRA 5JCJA 1KZ7B 2BISA 3CPEA 2JLQA 1Y42X 4C6SA 3T7KA 3DM5A 1EFDN 5GMOA 3S2IA 1M6YA 1XI2A 3IILA 2EKBA 2J46A 3VPGA 1T3HA 4J16C 5J2UA 1GZSA 1ZH0A 1I8TA 2OCYC 2PS1A 1Z5PA 2ADMA 2YVAA 3BILA 4DL9A 5CYGA 1PZMA 4ZYTA 3IPAA 5EFOA 1LPOA 4AJ4A 2IHYA 3F9RA 2ZUBA 4XM1A 4DM4A 1WBBA 2QZZA 4NARA 3SYRA 1ORVA 1OAOC 1S3FA 5LZ7A 2IV3A 3HFJA 3V1MA 2G67A 2H92A 3GVPA 3U9TA 4KDFA 5EVCA 4KRXA 4NQZA 1GITA 1H2HA 2C4UA 2X9QA 4BNDA 5G0WA 5BR1A 4XCVA 3JASA 2XA2A 2OZLA 1DINA 2R7KA 5CFLA 2JGKA 3ADDA 3LBHA 3IYLW 2N9UA 4D43A 3GLUA 1A5ZA 1POWA 2B37A 1QOQB 1OTXA 1RWQA 4KGXA 1IOVA 4ZKEA 4C4ZA 2C8LA 4INPA 1X7ZA 2NXNA 2DR3A 3KS9A 4DWJA 1CZHA 3HSSA 3OCYA 3OPYB 3H0EA 1HTWA 1F5NA 4RHFA 4JXZA 4G0XA 4JJKA 1OWMA 4NEHB 1O6ZA 2CKMA 3N87A 1CQJB 3TB6A 4AKIA 1SD5A 1IUOA 1SEVA 3UPTA 3HH8A 2P0YA 1EG7A 1LX6A 4OXRA 2W2NA 4COOA 2R00C 3I01A 1W4LA 4EUFA 4Z7NB 3TZCA 2DECA 2ZDHA 3KB8A 3OZDA 4PGGA 1E4EA 2J07A 4Z7QB 1CS0B 3W2GA 1SXJC 1GRRA 3KB6A 3EFHA 2BGTA 4RUBS 1YBHA 2LW7A 4IGEA 1TYAE 3NW9A 4HYYA 5FBLB 4FFOA 1SNYA 3LT0A 6AT1A 2W8ZA 3DVAA 1KK2A 4DDWA 1GSHA 3SFTA 1NP3A 2HF9A 4YJGA 3NDBB 1OBHA 3VPCA 4NOJA 1XGKA 4Q4HA 2JJ2D 2WD7A 4V1CI 3ZGZA 2GZ1A 2P0EA 4M0EA 5HOEA 3C87A 5L3RA 1RPZA 1N5DA 3GDFA 3RYCB 3P26A 4CNBA 2J0QA 4LF8B 1QF7A 4OEHA 1IEVA 2X4GA 2HF2A 4L85A 1XUOA 4MVJG 4CM4B 2V68I 1Y8QA 1IG0A 5IF3A 5B2ZA 2G09A 3ONFA 2GFQA 4R2XA 1ZESA 2EGUA 3HZRA 1SBTA 1V1MB 4FGJA 1VIAA 1AT1A 1RJDA 1T29A 1ISMA 1E6WA 4RA9A 5HP4A 2TMKA 3GV0A 2NP7A 1K6IA 2ET6A 1KH3A 4GDMA 3C3CA 5C8ZA 4L8WB 5THKA 1RKXA 4Q1BA 4YRNA 2GD0A 3MMSA 4JDPA 3TSOA 1SK9A 1XQ1A 2RG7A 3MWKA 1GYQA 3I5AA 2A88A 3PXDA 3UK0A 4ALKA 4C78A 2F8SA 3G5AA 3DTYA 1YE3A 1X14A 1B42A 4RE5A 4CN8A 5EJIA 1R8QA 1U0OC 1V96A 2YNMD 3CZMA 5FNVF 5AI6A 1HDGO 1L4FA 4XRGA 1ZNQO 3MS7A 1COWA 1GU7A 4BZZA 2KHZA 3NC4A 2W2QA 4LY0A 1CDOA 3CCBA 3TSCA 1LF0A 3TLXA 4L4ZA 2GRAA 3CLSD 4UBLA 1E1KA 4AG6A 4DLXA 4UMDA 5DHTA 5GWXA 3UK1A 1IJBA 4Y9RA 5HJ7A 1PEAA 4PW0A 4QBFA 2ZRAA 4DIEA 3SZ3A 3ZE1B 4W5OA 3I6IA 1QB8A 4HSGA 4MO9A 5I4IA 2A3NA 2GHRA 3GRUA 3LQYA 2ZJ2A 1DL5A 4H6XA 1NMEA 2OBLA 3C6YA 3HJHA 1KQ3A 1X38A 1EWRA 2HA0A 2WJ3A 3FOBA 4KFSA 3VZBA 1N77A 4LVCA 4JC8A 5BMVA 1YRHA 2E9SA 3F7TA 4KAFA 1PP4A 4M1KA 3EDRA 5TMBA 3RC9A 4EPXA 5JSUA 5LJIA 4BLRA 4OF4A 1Z6PA 3GVIA 1EJ6A 1QIEA 2QENA 3NNSA 1FDOA 5C5IA 1P1HA 3AI7A 4KJZA 5DM2A 1OF1A 3GLRA 2AVDA 1XZMA 2YW9A 2VQ6A 5CAEA 1FU7A 1TO6A 4LMAA 1E0JA 221PA 5FUYA 2YW2A 4ZVOA 5IC5A 2OA0A 3WLKX 5C4MA 1VKJA 5KCZA 1YHYA 2ZSFA 1JECA 1R74A 1WPQA 4BEBA 4URWR 1FYVA 2FSHA 4DTCA 2P9JA 4EKYA 4CLDA 3UAVA 2C2YA 2OM2A 2C97A 2F6RA 2VAXA 2WTNA 2Y27A 5AUPB 1N2HA 1S0UA 2JGDB 3EQZA 3OJOA 5L4NA 4AO7A 4LJ5A 3L8HA 2HNAA 5F21A 3LQRA 2YBEA 1T26A 1TUGA 3PGKA 1UADA 2WQZA 2AMVA 4MGIR 4Y1GA 3D0KA 4XQGA 3L7IA 1VSQA 4OP3A 3UWOA 2R1TA 5TJ9A 4BNYA 3BD9A 5B57C 1JIIA 3A1WA 4JP1A 4WBSA 5EWJA 1FDVA 4EO7A 5HRUA 1DTEA 1GPMA 1R4ZA 3JAWA 1WB9A 1SD2A 4G5OA 1QHIA 4FKBA 4WE3A 1M1XB 2ZE5A 1ZW6A 3TDKA 2O2JA 2G6BA 1SHUX 4TKLA 5CVUA 3HM9A 3ER8A 2O3JA 4RGBA 4OVKA 4MB0A 1R7RA 4TS9A 1DEOA 2IYVA 1Z8HA 3M5WA 2FPPB 4EYOA 4G1VA 3U4IA 3DWIA 1E8DA 3PXXA 4XB1A 2R1VB 2Y0BA 2PWYA 5H9VA 2ZM6B 4C7MA 1EWYA 4JUFA 2QROA 1EE2A 5JI2E 2QTFA 5ALDA 4YUWA 1MPXA 2JFNA 3C6XA 5B55A 4ALJA 9ATCA 1GARA 1X7XB 4C4RA 4OLHA 2BKAA 5K3SA 2I2DA 5B4TA 1YR7A 2BKLA 2O2YA 3OZFA 5TMDA 4Q9IA 5JZ9A 5DN6D 4LY9A 2H17A 1FTSA 1KDRA 2V7QA 5FLXA 1DOHA 4BYMA 1L7MA 1UC8A 3AESB 4C6RA 3VC1A 4J1TC 2G72A 5JWOA 2H59A 1MT3A 3RBAA 2HSWA 4LXYA 4AT1A 3OMWA 4IDNA 2QQ0A 1G16A 3QUBA 4IIJF 2C84A 3MRSA 2HXYA 3K0KA 4N0EA 2Q1YA 5JVDF 2FHZA 2Q99A 3P9IA 3DMHA 4JLNA 4CDMA 1SVMA 1X86B 2PFKA 8LDHA 1OFUX 1SZDA 5LXTB 4YDSA 4RQUA 1X9HA 1IUKA 1E66A 1F4LA 3S3TA 2LRHA 1U7OA 1VRWA 3OZGA 4LOLA 4TVOA 1JNYA 2OT3B 3SZGA 3N86A 5F4ZA 1PFKA 3AWIA 5LIRA 3THXB 4OJTA 4A6XA 5I51A 4RTPA 3O74A 3HL4A 4OYRA 5SY4A 1USUA 5E6SB 3TLGB 4AUNA 4DHEA 5BVHB 1GL6A 1TCUA 3LE8A 5E1MA 4G84A 2GFHA 3F6CA 3RUHA 1TOAA 4YUZA 4A0QA 3BOSA 3M33A 3OTGA 1VLJA 1N2IA 2ZR7A 3C4VA 1OQAA 4LNAA 1Y81A 3PYXA 4OKNA 4QUEA 5AKZA 3X43A 4BO5A 1XZHA 2CJXA 1MNAA 1PG0A 3CUKA 4DIBA 3GGSA 4DVJA 3F6YA 3GRYA 4EI2A 3LYUA 2BFBB 2I54A 3X2SA 2UXDB 1JMVA 5D3QA 4Q01A 3CISA 3PNSA 5FORA 1DAEA 1R5OA 1JHZA 1EVQA 2B0JA 4NIMA 1HDOA 1FFYA 1SKMA 4BP9A 1SG6A 3VJRA 1W2GA 4MZXA 3MLEA 3CF2A 1Y6RA 1YAJA 4BU1A 4CR7A 2V1XA 4UZFA 5L4SA 3BEOA 4QRDA 4JR2A 3PJDA 4OJYA 4RESA 5LQDA 1DUIA 2PZAA 3AF4A 1BH2A 4UHFA 5JRDS 1C0PA 3PLRA 4R68A 4Z6KA 2PX3A 3MXTA 4ND8B 3RVQA 4PRKA 2QY6A 1GZ5A 1CNFA 4AG5A 2ZPAA 1DXOA 3NM6B 2ZRDA 3AXKS 3LGSA 4FC6A 3OOHA 3GN2A 3IQWA 4MAFA 5DT9A 4CL3A 3MJDA 1A3CA 2QT1A 5EJ5A 2EFYA 4U7DA 4X8LA 1H2EA 4OV6B 4PHGA 2FQQA 2GT1A 5CT4A 4B7UA 1HDYA 4F0JA 1R1DA 1GDHA 3R0QA 1EE9A 5I4CA 1MQAA 1Q3HA 3ZGOA 4TSKA 1DQPA 4DLWA 2NVWA 3AI2A 1FXUA 1O95D 2G77B 4LOKA 3UWSA 3GLIA 1DQNA 1NZJA 2P6RA 4XD2A 2AG1A 3K0FB 4IZ6A 1FP1D 1T2EA 2IKQA 3FOZA 1EXNA 2HADA 1SCBA 2O50A 4L0DA 3TTXA 3P4XA 2CW5A 1XVLA 1Z7YA 1DCTA 3G0GA 2AYYA 5CVDA 4HTAA 4TUYA 3EE6A 4DV4B 1HDIA 2QOEA 3BWYA 3H5WA 2C57A 4U1RA 3TKAA 1AKMA 4JI7B 2HI0A 5G0UA 1F2UB 5FOXA 5LLSA 1JHMA 1HEYA 3MCUA 4BJ3A 3GZNA 3MNFA 3AYXB 2QSZA 1TAUA 3F8SA 4FKMA 3ZX5A 5CFZA 3RWOA 2B9VA 3PQDA 4WJKB 1Q19A 3WA7A 1L1QA 4IRXA 2MYTA 2ES4A 4RF5A 1AB5A 4NG5A 1Z35A 2FKAA 4WGFA 2PLNA 1ORWA 1LPAB 4KE8A 4UJ3A 2P6NA 4F0MB 3Q7PA 2FXIA 2MSEB 5COBA 4QYSA 3Q4GA 5FEUA 5ITVA 3VZCA 5KTSA 3AJEA 2IXDA 1JRLA 2O3UA 1KAHA 1V3QE 2XGOA 4Y1RB 4BV9A 4DMHA 5CDSA 1B26A 1FCJA 2I67A 5FBHA 1WOYA 5HRAA 4W1SA 5LQCA 4GNRA 5CFMA 5COQA 3R3VA 2LPMA 1DX6A 1FQWA 1XV5A 3N2LA 1RSZA 2Q1TA 5BW8A 3JRNA 5B3KA 4RDHA 3IE1A 1VG9B 4A0GA 3FLBA 1QHNA 1XL1A 1VA4A 1X42A 3U7IA 5CNJA 4HD8A 3ROXA 4XUDA 1WNFA 3EBLA 3HABA 4NVRA 3WQBA 4Q12A 5M5BA 1ZM9A 3EGDB 4UZSA 1CE8B 3L0PA 4TTQA 1N0IA 1I5EA 2ZKIA 2QTLA 4UASA 1QMGA 3KT3A 3N59A 3SK0A 4XGKA 1WX1A 4R1UA 4O4JA 1DSSG 5EZ5A 5J2UF 3IHTA 1W93A 2HJSA 1NV8A 2P5SA 2X77A 4JLJA 4DQKA 1WY7A 3KLMX 3K5HA 5JNWA 3E05A 3M89A 1AKVA 1PJQA 1G7CA 2I65A 3IPXA 1HLPA 3NHJA 1WB5A 3OUUA 4LHVA 1NXSA 1A9ZA 4WMLA 5IU6A 2P4HX 1E9DA 3EVNA 2JD0A 1ML4A 3K30A 2AR7A 3VR3A 3ZKAA 2YJ5A 4ZJZA 3OF5A 4Q9KA 3ZE2B 2PUWA 1XP8A 2WT4A 3HBLA 3ZLVA 3KYCB 4OFZA 3BQMB 4BTLA 1ECCA 1SKAA 4FDVA 4UTZA 3FY4A 4M98A 4CKBA 3EHDA 4ASUD 1CJCA 5J2TA 4GDFA 1FYFA 4ZEWA 2NUTA 3TW8A 2H1CA 4R0VA 1BMFD 2DHEA 5CPFA 5FHRA 2BHNA 1VMIA 4UKDA 4ERNA 1Q7GA 4FN4A 1O08A 3CRRA 5DNVA 1Y8RB 3N5KA 2ZYVX 2IZ7A 1UF9A 4ISBA 2QAGC 1BQEA 1REQA 1XRNA 1ZBQA 2FE4A 3I05A 4YRCA 1DO0A 4HQLA 3V8QA 4S35A 4DHWA 2QBYA 2JHCA 3D59A 3V8BA 1JHUA 1SQ6A 1VPEA 4AX8A 2ZJ6A 4GPTA 3LBAA 3AY0A 2HDOA 2Q7DA 5CJPA 2FAXA 2HK6A 2WJHA 2AK3A 4ZOLA 4BB0A 5JXWA 2RCYA 3QG1A 3V6LA 3ZBTA 1Z6YA 2MSKA 4PNHA 1ZSNA 1QRRA 3WDMA 2X9LA 4C2BA 2HT6A 5CDUA 2J3DA 1W46A 4QBHA 5FUBA 2XHEA 1UBHS 5E0KB 3IURA 1Z5OA 2IK8A 2WWYA 1Q0HA 3MJTA 3GWZA 2JHPA 1D2EA 3I9OA 4IF6A 4G37A 2VP4A 1P4JA 2M6SA 3R0XA 5FA8A 5C51B 4F6CA 2YMPA 2NVUA 3EJ6A 3U44A 2EZ4A 4XTCS 3MT0A 1EXVA 1CY2A 1EFUA 3FYUC 4F9FA 1N9GB 1QONA 1E8NA 3C14C 4P4LA 4TV9A 3BMQA 4FZJA 3R7NA 4BNJA 1PV2A 2WIAA 4RQAA 4MUIA 5LVAA 2DKOA 4I1RA 4DXHA 2VG8A 2ONZA 2XNDD 2WG2A 1J0XO 1IH8A 2EZTA 4O4LB 1ZR4A 1U2DC 4FW9A 4OUDA 5A4MS 4OYHA 3EXHB 5E3JA 5EJ2A 4GXQA 4NV3A 4GM1A 1CG6A 2YN4A 5FPKA 2HU7A 5DM4A 3V2HA 4J9VA 4EJ0A 3MZ0A 1KC3A 2P2NA 4EENA 2R0QC 3IMCA 3MIIA 3IDSA 4MKHA 3WLNA 4LCBA 3OEEA 4OHXA 3KG2A 3FMPB 2Z58A 2VF5X 3B2EA 1MHPA 2VSFA 4MA0A 3R0VA 3VDMA 3TK1A 5KS2A 3B1ZA 1WTCA 4NFLA 1RIFA 3JALA 4FYWA 3C5EA 4NENA 3BWVA 4Z1MD 5L3SB 1YJ5A 1CQIA 2DQKA 2I4OA 4PIMA 5AESA 2P9FA 4DA4A 4JI2B 1A5TA 3S28A 4LFAB 1Z3CA 4QGSA 1N0VC 2R48A 1E0SA 1XZEA 2BGLA 2NZ2A 2DQYA 2Q4BA 1C3VA 4HWOA 3V8EA 5ALMA 1PUXA 4G5HA 4MDHA 3ESYA 3IOYA 4RMJA 2D3WA 5IKEA 3C3AA 2YWGA 5DNDA 3M5DA 3OP1A 1JDNA 4YJ3B 1P0MA 4ZI3A 2HPVA 4AZ3B 4ZQEA 3A37A 5B37A 4KN5A 5BMVF 2F1HA 5KTTA 2ZBFA 1UKAA 3FTPA 2WJJA 4M0FA 1XJWA 5LCXA 4EB6B 1Z73A 4OBWA 4YP9A 4K46A 4TV8A 4GLJA 3OP4A 5ULLA 1JNXX 1TUBA 3L8YA 1ISRA 2GYWA 1CDEA 3TNJA 1WA5A 1UUFA 2WHPA 3SE0A 4D82A 4Z9FA 4YXWD 1H2ZA 3QNWA 5CTAA 1E9EA 4D6YA 4DPMA 1IOLA 1HYBA 3TQIA 1CLEA 4C9BA 3P2JA 4D8VA 4DKXA 1NUSA 1RSCI 4CKCA 4E2ZA 4RH3A 4BMZA 1AA9A 3LSTA 2ZBQA 4H0NA 4BN0A 3OJXA 5JMPA 5EJ4A 2QLLA 4IICA 1YJBA 4ENQA 1SCJA 1YAHA 1M6NA 1PW7A 2IUEA 5AK6A 3QM1A 5FOTA 4DZZA 4YMGA 1PEDA 3DBHA 2PY6A 2VQDA 5FL7A 2OBFA 1JDTA 1WG8A 3RNOA 4M22A 3RT1A 2FN7A 2GF9A 1ULTA 1P1RA 2GD2A 2HAEA 4N6NA 5JJIA 2SKDA 4KWIA 4UPEA 2RHGB 1HORA 4LYFA 3ZHBA 5FQOA 4RELA 1YI1A 4W8OA 2R66A 1RLIA 2CD9A 2A9KA 3D3KA 1NRJB 2V6MA 3OQBA 1L4BA 4C01A 2DWOA 2CEKA 2XDQB 1CEXA 3IVXA 3OZUA 4HC4A 4JVLA 2ZJ0A 4NNJA 3UB4A 2IU6A 3R44A 2CSXA 3WGYA 1M5RA 3DL4A 4REQA 1THTA 1CLUA 4CZ2A 3GJ4A 2J5BA 3IQHX 3HYCA 1A8QA 2J6CA 5FUMA 3D6NB 3WRYA 3BJRA 1YRQA 5AKLA 2C5GA 3VAAA 4AUEA 1KZ6A 1V41E 1X7YA 1Y7HA 3E3OA 5EJ6A 1E98A 1T0BA 2A4KA 4I9NA 2PZKA 4RIEA 1OD6A 1UDWA 1XRLA 4E94A 1Z56C 2UZIR 4RUKA 1T8TA 3F7OA 3BWMA 4DV7B 1N1EA 2REBA 4QICA 5G3YA 4PX2A 1JXMA 4TKMA 1ZAKA 2FR1A 1Q0ZA 4GG1A 2C9OA 2REXB 1DO2A 3I6YA 4HDKA 4NZNA 4V0KA 2B25A 1KFCB 3BD8A 4HGZA 4D3DA 1G5HA 3CVWA 4XUEA 1ESCA 5SZJA 2BUAA 4H3KB 2BONA 4UQPA 2YIMA 3HFRA 5ENZA 5LUBA 2V65A 3SZLA 5CXQA 2BR4A 2AXPA 5FLEX 3B9RA 4GP9A 1UWVA 3AVOA 2H48A 1QP4A 4JCOA 1CXZA 1RI2A 1FUKA 3OTIA 1UBJS 3KT0A 2WTMA 4Q34A 1HT0A 2QN8A 2XCQA 4AL4A 3GLGA 2G36A 1CJMA 3KQOA 4N3CA 5D51S 5DASA 3ZDEA 1KQGA 1U7UA 3I5UA 1PZGA 3TO5A 2HREA 4KXWA 4PPQA 1Z45A 4QOFA 4GVPA 3CJTA 2E4YA 3I04M 1GAJA 4YUYA 4BO1A 3FROA 4FQ7A 4LNUA 3RI3A 4E5PA 3ZQJA 2ZYUX 3A4LA 3QYJA 3AB8A 2JLWA 3L0CA 3QWFA 1FUUA 4NU6A 2IS1A 2Y67A 5F7XA 1PFVA 1NDHA 3QPBA 3RVDA 2KJQA 4RKWA 5FYQA 5GONB 1GG9A 1YK0A 1UFOA 3VKVA 1P0CA 3PL1A 5FIUA 1V11B 5AKGA 4UARA 2VZEA 1KNQA 2OILA 4IFEA 4KMMA 4G07A 1YL6A 1F14A 4IZOA 3JWIA 1R3UA 1HE2A 1HRDA 2YZNA 4HFRA 4KQJA 2IOFK 1G2PA 3IP5A 2KLHA 3DYVA 1UINA 3ASUA 4POAA 4HBGA 4KR0A 5ALRA 3QJYA 2Z4SA 3GDWA 4RA6A 1OXKB 4PYRA 1GQSA 5JJBA 2QR2A 3ZV6A 2PMCA 4YWHA 2FEKA 1M73E 1WJGA 2WIGA 2JEOA 3KZKA 2LD4A 3M5PA 4RM2A 2B2XA 2AMFA 3KVOA 5KTRA 3NH9A 3WICA 1TLFA 1K8YB 2BEVB 4MI9A 3TIIA 5CCEA 1P1KA 1OX4B 3PUXA 4N3BA 1KOFA 4L76A 1M54A 3N2KA 2B4QA 2RH5A 1KIMA 4BMOB 1D5CA 4H35A 1E96A 5TDHA 3T4UA 1RYEA 1KI6B 1FFXB 2IPLA 2ZWAA 5FWYA 3EODA 1TTHA 2JK0A 3IPLA 1GRCA 2GM4A 1YZHA 1PJZA 1XLTA 3HXKA 5BR7A 4YBRA 5JH7A 3KSAC 1RQGA 1EA5A 1WHSB 2OY0A 4OB8A 1GFZA 4AECA 1UFVA 2QYSA 3ON5A 3TNYA 5H83A 3AOEC 1IN4A 1A9YA 1J8QA 1EWTA 2FEAA 2PJRA 1DIOB 3M6IA 3QEOA 4UM7A 3H11A 3I6ZA 5KIAA 8RUCI 3R74A 5ESRA 3KZVA 3R3UA 2X76A 3KEQA 2P91A 3X1XA 4US1R 1UJ5A 4O4HB 3NBAA 3FPLA 1SMKA 6CHYA 3QXGA 4PLPA 1FFSA 4U6QA 1KWKA 4JYMA 2WVGA 5EHXA 4X7MA 3I1IA 4FD2A 3FBGA 4BN4A 3BM5A 1X19A 3N74A 3L7CA 4D9MA 3HDGA 2QHXA 1D2CA 4HGRA 3IFSA 4RHUA 5ECDA 2QSUA 5FI5A 2R1ZA 3WOVA 1JHOA 5K0BA 1OBFO 3T3NA 3PPXA 3QVGB 2MR5A 5DBEX 4F5YA 5A5FA 4BLOA 3QBDA 3GRKA 2QRGA 4EW1A 2Z43A 3ET4A 4IQ0A 3Q2IA 5G53C 4A23A 3Q88A 3TL3A 1Y7IA 2WTUA 4D4JA 5DW0A 4EJSB 1YFLA 3ZW7A 4KBYA 1P7YA 4KWTA 3P20A 2QK4A 5ALJA 4TL9A 1SG0A 1GRVA 2YXBA 5CVVA 1UMDB 4AKSA 3OPYA 2B5WA 4PQRA 1YD7A 3AHCA 2IELA 2NTJA 2FG6C 2SBTA 1U1FA 3PPIA 4ZJUA 1NOIA 4D46A 3KLPX 1LTKA 1FJXA 4NJMA 1CQJA 5GADl 1Y1LA 1Y4SA 3PIRA 1LRLA 2CKDA 4PINA 5CVCA 3P7MA 4U7WA 1IHDA 4UOZA 4DLUA 4OGKA 4KN6A 3ABZA 4Z4GA 1P7ZA 1CS0A 3PDUA 5BUSA 5HFJA 4DR4B 4I50B 1ZMOA 3ZN2A 2EFJA 3RHTA 5BWBA 3WYBA 4QEZA 3PWSA 4M88A 4KQMA 1PJAA 4QARA 2OL4A 3C43A 5F4BA 4BKUA 2JDID 4EHBA 4JODA 1AQ6A 1VKRA 3N07A 4K6KA 2P9HA 4JYZA 3NOQA 2QDXA 1R0SA 1I3LA 3FRJA 1ST2A 2CVHA 5CG1A 1S2OA 3TFOA 2JJ2A 2JZCA 3NPAA 4IOMA 4X95A 3DC2A 2DHDA 3NUZA 4DBLC 1MAAA 3RYCA 1H2WA 2K2QB 2A0UA 3CNNA 2DTEA 3DDWA 3KLBA 3ND8A 4GZ3A 1HFJA 2W2LA 4US2R 5FJIA 2XKBA 3D43A 5KOJB 4OGLA 3SXUB 4CM4A 3EAFA 4O1IA 5BWMA 2JC3A 1OXTA 1DG9A 1U3UA 2UUOA 2DFLA 2WABA 3DZHA 1V1MA 4R7GA 3WIEA 4EVSA 3T0GA 1IXSB 3SVTA 3VPXA 1BS1A 1MEEA 4FOTA 1ETHA 2BUCA 2I6FA 2Q7XA 4NLLA 1H1DA 4MJLA 1TKRA 4OM7A 4V2IA 3UUEA 1Q3KA 2PSJA 3L3BA 2QPOA 4IH9A 4NBSA 5FFMA 2EG9A 1BE6A 3B85A 3FCUB 3KYJB 3ICQB 2C04A 1EB9A 3MSCA 3EVFA 4B3IA 5JD6A 3TGPA 4L07A 5DNUA 3ADCA 4FHFA 2B98A 4DIUA 2ANCA 3DHWC 4NCHA 4AULA 3IP7A 2ZDQA 4C06A 5EIBD 5AH0A 1VLVA 5AVZA 2B36A 3HLTA 1ZQ9A 3R9IA 3G0HA 4P4TA 1T6BY 3GH3A 3GRFA 5I7EA 5EJGA 4C7VA 1RP7A 5LIPA 2FW9A 2H51A 1DEKA 4B9AA 1X1RA 3PHGA 3OCVA 5B6IA 2XQJA 3TD2A 3I8OA 2PH5A 3JYOA 1I0ZA 1LRKA 1UZHC 2B83A 3AR7A 4MWBA 4PY2A 1AUSS 4PAGA 4XDZA 3TOZA 1EXWA 4JC5A 1JU9A 2JI4A 4LNHA 4MRMB 1AC5A 4LYDA 3ETLA 3I9KA 3QTTA 4K1XA 5KNDH 3DOIA 1IYZA 3P5SA 1XTKA 1VHDA 1P80A 1OMOA 3UMSA 1EUCB 3WZ2A 4A6PA 4EZEA 2RGRA 3KSBC 3UIEA 5I5EA 2HRCA 4NYJQ 1XPJA 1OBOA 5TB5A 1U0BB 1R0WA 3IP9A 3I62A 1SBZA 3L5KA 3NWBA 3HV0A 4BMNA 2XWSA 2Y76A 1U28C 1X13A 5CT8A 4DM7A 4TV9F 3GFGA 4JC4A 5AHWA 1F2VA 1IQ0A 3MOSA 3EMDA 3QBJA 2JGDA 5A05A 1V71A 1BCRB 1FVOA 4RZUA 1VKOA 4D79A 5C8VA 1K4YA 5EE9A 3EPHA 1ZAYA 3ROFA 3DP7A 5A3VA 2BGUA 4H16A 2PH3A 3I30X 4E5SA 3NKVA 4KVZA 3C98A 1ZOPA 4PXAA 3H2IA 4K3UA 4R6XA 5BQXA 5C2JB 3PE4A 1A72A 4TT3D 4AX4A 1Q0QA 5BYKA 5LBUA 3L0OA 1MQSA 1VG1A 1JXQA 1ZU5A 4GD3Q 1PQWA 1ZVJA 1SH7A 2FWJA 2NPIA 2O5VA 3AEYA 3H9CA 4XEHA 4P84A 4E2YA 1TK2A 2YHAA 1ENOA 1QP7A 4MAMA 3L8EA 4JVSB 4G0QA 4KLNA 5KB3A 4IHJB 1VYUA 2PG3A 2QYTA 2WTAA 3DKIA 3T15A 2VRCA 2YH2A 3Q5DA 1EVJA 2P62A 1JAXA 2BM1A 3G2MA 5E1DA 1ACLA 4IJWA 2YQZA 3FTFA