3TGAA

Crystal structure of l130r mutant of nitrophorin 4 from rhodnius prolixus at ph 7.4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
184
structure length
184
Chain Sequence
b'ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDRGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin-4
publication title Guanidine-Ferroheme Coordination in the Mutant Protein Nitrophorin 4(L130R).
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Metal binding protein
total genus 52
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3tgaA00
1BEBA 1B4MA 5JR8A 1D2UA 4M7MA 4YFPA 4Y0PA 1YUPA 1YP6A 4IMNA 4ZHGA 4RUUA 4NLIA 1ERXA 2A3FX 2CZTA 1XKIA 1GXAA 1SY1A 4NYQA 1X8NA 5C0NA 2R73A 3P6FA 5FAZA 3RZYA 4HFOA 3KFGA 5AQ6A 1FE3A 5DG4A 1VYFA 4XMEA 1AB0A 3CMPA 1O1UA 3P6EA 3PH6A 4XMHA 3FA8A 3KQ0A 4Y0RA 3BY0A 4GNWA 4HPBA 1ML7A 3HWFA 3NQ3A 5H9NA 1EW3A 4Y0QA 4HPAA 4NNTA 4NYRA 1FELA 1QFVA 4IB9A 1GT1A 3FW5A 1B0OA 1DC9A 1T0VA 3EBKA 4IB7A 1EIOA 3L4RA 3BU1A 1KGLA 4GNYA 1JZUA 2W2FA 3PPTA 3G7XA 3VG5A 1D3SA 4GRJA 4I3DA 5L8OA 3DTQA 2QO6A 3CBSA 1KZXA 1TVQA 5D4AA 1A18A 4TKHA 3TGCA 1KT3A 2MJIA 2X46A 4QYNA 5LKFA 4ZFXA 4ORWA 2QOSC 5HZQA 3WVMA 1ZNHA 4ZH6A 1OBUA 2CZUA 3WJBA 2HNXA 4WFVA 4BVMA 1FENA 5HBSA 2MM3A 4YMYA 1DFVA 2OZQA 3KFIA 2HZQA 1H91A 5HZ8A 3HK1A 4HPCA 4A1HA 1DZPA 5HA0A 1TOUA 2AT8X 2AMMX 2G79A 1KT4A 1N0SA 2CBSA 3B2JA 2AT0X 1HQPA 4GETA 1BSYA 3FA9A 4YGZA 5EEDA 1Z24A 1PBOA 5KICA 1IKEA 4ZR2A 3APXA 3FENA 1KT6A 1NGLA 4DQ3A 2RA6A 2HYSA 2OVAA 1MX8A 3D96A 4ES7A 1ZNKA 4LZVA 1UREA 2WUTA 1IFCA 4WBKA 1GM6A 3VG3A 3AKNA 3D97A 4EEJA 2WEXA 2E4JA 2G7BA 4ORSA 3ZUIA 1TXLA 2OFRX 1ZNDA 1SY3A 5H8TA 1G5WA 3T1DA 1YIVA 1HMRA 4TKBA 4YBPA 4YH0A 3VG6A 4OMXA 5KHPA 2GC9A 2A13A 1SY2A 1KQXA 2BLGA 4IB8A 2EU7X 1GT5A 1A3YA 1JJXA 3PH5A 1GX9A 3CBCA 1CBIA 1DV9A 4ORXA 4ORYA 4MVKA 1BRQA 4UU2A 1YWBA 3IFBA 4AYHA 1DZMA 4ZJ0A 3BX8A 3Q6LA 1LKEA 4MVIA 4YCHA 5F7GA 2QO4A 1MUPA 3VG7A 2G78A 3B2KA 4ORRA 4QGWA 3NPOA 4GH7A 3U0DA 5D47A 5HZ9A 4OMWA 4D6BA 3FR5A 1GT4A 1CBRA 2L5PA 3D95A 1I06A 2N93A 5LJEA 4AZRA 3FA6A 1TW4A 2CBRA 5BVTA 5LKEA 1X71A 3RSWA 3WXQA 4IB6A 4YDBA 3C76X 1L6MA 4YKMA 5H9AA 4LKPA 4ZHCA 1S44A 2RD7C 3CR6A 4YGGA 3FEPA 4AZOA 1JV4A 3FA7A 1YWCA 1LNMA 3KFHA 1E02A 5KIDA 1MDCA 3GAQA 3U9PC 2L9CA 3FR4A 1BJ7A 3EM0A 5LJHA 1BRPA 1UZ2X 1IFBA 3U03A 1KQWA 1E06A 2R74A 4EFGA 3FLLA 1LIEA 4QZUA 4I9SA 1HN2A 1ACDA 3O22A 2JU3A 2OFMX 4LZUA 4NNSA 3CQNA 2MO5A 1QWDA 2ACOA 2AT6X 3NR3A 2L68A 1EPAA 1ICNA 5L8IA 4I3CA 2LBVA 1LF7A 2Q9SA 5HZ6A 2KTDA 5IO6A 1OPBA 2O62A 2NNEA 3HWGA 3WJCA 1TOWA 4TKJA 3APWA 3BU9A 4EXZA 3BS2A 1RBPA 1CBSA 5LJDA 3ZQ3A 2JU7A 1QQSA 1QY0A 3UEUA 2RCQA 1JYDA 2QM9A 2KT4B 4TJZA 4ODDA 5F58A 4ALBA 1EIIA 1HBQA 2OVDA 3EMMA 4WFUA 1GT3A 3BDRA 2FLJA 4A1YA 1BBPA 4ZCBA 4YFQA 1EALA 3PP6A 1G85A 4PSQA 5H9LA 5HTEA 1FDQA 2K62A 5DPQA 2WR6A 3UEWA 1X8OA 1CBQA 3SAOA 2W2AA 5HAEA 4RUNA 2NNQA 2NNDA 2RCTA 1SY0A 1I4UA 4YDAA 1HMSA 4AW8A 1X8UA 1KZWA 3NADA 5F1EA 2X45A 3VG4A 1CRBA 2A2GA 1DF3A 2FR2A 1PM1X 5B29A 2WSJA 3BX7A 5EDBA 4ALOA 2AH7X 4ZHHA 2FS7A 5LJBA 1T68X 1NP4A 2FTBA 2WQ9A 3KFFA 3MBTA 2LFOA 4A60A 3FIQA 4IMOA 5LJGA 1GX8A 3F9DA 2XKLA 1LFOA 1BM5A 2CM4A 1NP1A 1A2DA 1VPRA 3DSZA 3NQ9A 4I3BA 4BOEA 1X8PA 5FFHA 1I04A 3WJFA 2A0AA 3P6DA 1LICA 4XMGA 4AZNA 2L67A 1XCAA 3BSZE 1EQDA 4UU3A 4ARHA 1JYJA 1E00A 3STKA 1U17A 3B2HA 1S7DA 1SXYA 2DM5A 3QKGA 1A57A 3NX1A 4TNNA 2GTFX 2XSTA 4ORUA 3CQRA 1X89A 4D6AA 3FEKA 1LIFA 3APUA 1MVGA 1AELA 5BVQA 4M6SA 1JJJA 4QYPA 3JS1A 1RLBE 2FS6A 1O1VA 3B2LA 4HPDA 2ASNX 1BSOA 1O8VA 2GJ5A 2LKKA 4O9SA 5L8NA 1IIUA 4IBAA 3STMX 3KZAA 4IAXA 2P8GA 4QGXA 4MVLA 4IAWA 3ELXA 1YWAA 1ADLA 4K19A 1HBPA 1P6PA 2IFBA 4EDEA 2PY1A 3P6GA 3O19A 5BVSA 4QGVA 4GE1A 4A8ZA 2NP1A 3ZUOA 4TQ2A 1YWDA 2JU8A 4KIIA 3S26A 2W2BA 4BQUA 1JBHA 2ANSA 1SXWA 1AQBA 4YGHA 2FR3A 5EDCA 2JN3A 1ZNEA 4YBUA 1SA8A 4XMDA 1QG5A 4YKOA 3WJEA 3F8AA 3ELZA 1EUOA 2AL0X 3TGAA 4ZHFA 3B2IA 3EYCA 1ERBA 4YCEA 2CM9A 4DQ4A 3WBGA 1LIBA 4AZPA 3BRNA 1KT7A 5D48A 1QY2A 1HMTA 4ZH9A 3OJYC 4QAEA 5EZ2A 1IKJA 5IO5A 2LBAA 1OEEA 1GKAB 3K3LA 2WQAE 3HWDA 3I17A 1EXSA 3CWKA 1DZJA 5F6BA 1GGLA 1OEJA 2OVEA 1DZKA 1QABE 2RQ0A 1X8QA 4QZTA 4OS8A 1AVGI 5FENA 2FWVA 3P6CA 1R0UA 1VYGA 4NP1A 5LJCA 2AT5X 1LPJA 3WJDA 1OBQA 1ZNGA 1BLRA 2QO5A 1BSQA 3UEVA 1OEKA 4ZHDA 1MX7A 1EPBA 3I0AA 1ZNLA 1FTPA 2ACPX 3PECA 3JSQA 2A2UA 4N7DA 5HZ5A 1S2PA 4I9RA 1CJ5A 2Q39A 1ALBA 4LKTA 2HLVA 5HCDC 3PEDA 3STNA 1FEMA 4OS0A 5HCEC 2LB6A 2AKQA 1IW2A 1KT5A 2F73A 1SXUA 1U18A 2YG2A 5CE4A 3NX2A 1KOIA 4N7CA 1PEEA 3HWEA 5EEEA 2Q4NA 3WJGA 4GKCA 1BWYA 3AKMA 1U0XA 1SXXA 1QFTA 2WWPA 2WEWA 2JOZA 2Q2PA 3BLGA 1OPAA 4R0BA 4XMFA 2ALLX 5F6ZA 1E5PA 2K23A 1ICMA 1ZRYA 5LJKA 3IA8A 3FELA 2AT3X 3APVA 3FMZA 2POAA 1GKAA 1B56A 1G74A 4XMCA 5HWZA 3C77X 1T8VA 1LIDA 5D45A 3FW4A 1G7NA 2FRSA 3O2YA 3C78X 3FR2A 1B8EA 1YP7A 4TLJA 4Y0SA 5HTDA 5H9KA 4CK4A 1KXOA 3P6HA 5B27A 5K06A 3EBWA 5HCCC 3TGBA 1I05A 4NLJA 4ZGUA 5IO7A 5D8JA 3VG2A 5HA1A 4OS3A 4AZQA 3TZSA 4AZMA 3MVFA 2R56A 1PMPA 3TF6A 3NP1A 5EPQA 4YFRA 2FT9A 2HMBA 3UEXA 2HZRA 1QY1A 1OBPA 2Q2MA
chains in the Genus database with same CATH superfamily
4IRWA 3HTYA 1BEBA 2AF5A 5JR8A 1D2UA 2G8CO 1B4MA 4M7MA 4YFPA 4Y0PA 4JO6A 1KL5A 4Y5DA 1YUPA 1YP6A 2RTOB 4IMNA 4ZHGA 4RUUA 4NLIA 1ERXA 2A3FX 2CZTA 1XKIA 3T2WA 1GXAA 1STSB 1SY1A 1X8NA 3NBXX 4NYQA 3WYQA 5CE4A 1SRIA 5C0NA 3T6FA 2R73A 3P6FA 5FAZA 3RZYA 4HFOA 3KFGA 5AQ6A 1FE3A 5DG4A 2IZAA 1VYFA 2OL6O 4XMEA 3S60A 1AB0A 2I5VO 3CMPA 1O1UA 3P6EA 3PH6A 1SRJA 4NV8A 4XMHA 3FA8A 4OELA 2LA7A 3KQ0A 4ON1A 4I6SA 4Y0RA 2PI3O 2IZHB 4BCSA 3BY0A 2BC3A 2X34A 4GNWA 4HPBA 4KT5A 1ML7A 3HWFA 3NQ3A 5H9NA 1EW3A 1STRB 3ZW1B 4L3RA 1Y55X 4HPAA 4Y0QA 5IRAA 4NNTA 4NYRA 1FELA 1QFVA 4O49A 4IB9A 1GT1A 3FW5A 4GJSA 1B0OA 1DC9A 1T0VA 2RTNB 1UYNX 1SWFA 3EBKA 4IB7A 1EIOA 3L4RA 4CPIA 3BU1A 3VHIA 1KGLA 4GNYA 1JZUA 2W2FA 3PPTA 3G7XA 3HOLA 3VG5A 1VWDB 3VU1A 1D3SA 3HPEA 1RXHA 4GRJA 4I3DA 5L8OA 3RY2A 3DTQA 2QO6A 1PBYA 2OYBO 3CBSA 1KZXA 2QOMA 3X00A 1TVQA 5D4AA 3WOVA 1A18A 4TKHA 3TGCA 1KT3A 2RTHB 2MJIA 2KW1A 2RTPB 2X46A 4QYNA 5LKFA 4ZFXA 5B5FA 4ORWA 2QOSC 5HZQA 3WVMA 3KVNA 2OF9A 4GDAA 1ZNHA 2Z4HA 4NW4A 1OBUA 2CZUA 4ZH6A 2HNXA 4WFVA 3WJBA 1FENA 5HBSA 4BVMA 2MM3A 4YMYA 1DFVA 1MK5A 2OZQA 3KFIA 4FBOA 1SWAA 1Y0GA 1H91A 2HZQA 4CV7A 5HZ8A 1LCVA 3HK1A 2A5CA 4HPCA 4A1HA 1DZPA 5HA0A 1TOUA 1VWKB 2AT8X 2RTLA 2BS5A 1GX3A 2RTQB 2AMMX 1RAVA 2G79A 1KT4A 1N0SA 2CBSA 3B2JA 2AT0X 1HQPA 2ZAIA 1W4TA 4GETA 4PJ2A 1BSYA 4U8UN 3FA9A 2QCBA 4YGZA 1Z24A 5EEDA 1PBOA 4YVBA 5KICA 1IKEA 4MISA 4ZR2A 1N9YA 3RDOA 3APXA 3FENA 1KT6A 1NGLA 4O3XB 1EI5A 2RA6A 4DQ3A 2HYSA 1UYOX 1MX8A 1SLGB 2OVAA 2DJFA 3D96A 2VDFA 1PTSA 4ES7A 2IZEB 1ZNKA 5FQ8E 1SWEA 4LZVA 5FQ6E 1UREA 2WUTA 2IZJA 4U8UO 1IFCA 2MWHA 1GM6A 3EC5A 3AKNA 3D97A 4WBKA 3VG3A 4EEJA 2WEXA 1LDOA 2OVSA 2E4JA 2X4MA 4I95A 1SWPA 2G7BA 4ORSA 5CSEA 3ZW1A 3VHMA 2JGSA 3RWXA 1NDJA 1TXLA 3ZUIA 3NQKA 2OFRX 3MM0A 1ZNDA 1OSPO 1SY3A 5H8TA 1G5WA 1N43A 3T1DA 1YIVA 1HMRA 4Z6JA 4MVEA 4QQ1A 4TKBA 3S5VA 4YBPA 3LHNA 4YH0A 3VG6A 4OMXA 5KHPA 2A13A 2GC9A 1SY2A 1KQXA 2BLGA 4IB8A 2EU7X 4CDFA 1GT5A 1A3YA 3VPJE 3RE6A 1JJXA 3PH5A 1GX9A 1Y52X 3CBCA 1CBIA 1DV9A 4ORXA 4ORYA 2DJGA 1VWFB 2BT9A 4MVKA 1HY2A 1BRQA 1SRFA 4UU2A 1YWBA 3RDXA 3IFBA 2MHDA 4AYHA 2BS6A 1DZMA 2GTLN 2UZ2A 2I5ZO 3BX8A 3Q6LA 4ZJ0A 1LKEA 4MVIA 1SWSA 4YCHA 5F7GA 2QO4A 4CDCA 1MUPA 3VG7A 4BX6A 2G78A 3B2KA 1SWLA 2OL8O 4NV7A 1JIWI 4ORRA 4QGWA 3NPOA 1JMZA 4GZVA 3HOEA 1SRHA 4O4XA 4GH7A 4FQBB 3U0DA 5D47A 5HZ9A 4OMWA 4D6BA 3H3IA 2GTLO 3V8UA 3FR5A 3SLOA 2IZBA 1GT4A 4BBOA 5L3YA 2RTIB 5AJCA 1SWNA 1CBRA 2L5PA 3D95A 1I06A 2N93A 5LJEA 1SWDA 4AZRA 3F6ZB 3FA6A 1TW4A 2CBRA 3FYFA 5AEOA 5BVTA 5LKEA 1X71A 3RSWA 2RTKA 3WXQA 2FKJA 4IB6A 3RDQA 4O3YA 4YDBA 2ZSCA 3C76X 4ID2A 1SWBA 1L6MA 2FHLA 4GGRA 4YKMA 5H9AA 5K68A 4LKPA 4BX5A 4ZHCA 1VWAB 1S44A 2IZKA 2RD7C 4GGTA 3CR6A 4YGGA 3FEPA 1Y9LA 1JV4A 4HWMA 3FA7A 2CAMA 1YWCA 4JGLA 4AZOA 2RTMA 1LNMA 3KFHA 1E02A 4FBVA 4U3QA 5KIDA 1MDCA 1RXJA 1JJUA 3GAQA 2L9CA 3FR4A 1BJ7A 3U9PC 3EM0A 5LJHA 1BRPA 1UZ2X 1VWOB 1IFBA 1AVEA 4Z2OA 3U03A 1KQWA 1E06A 1VWQB 2R74A 3FLLA 1LIEA 4EFGA 4QZUA 4I9SA 1JMXA 1ACDA 1HN2A 2JU3A 2OFMX 3O22A 3OBLA 4LZUA 4NNSA 3CQNA 2MO5A 1QWDA 2ACOA 2AT6X 2RTFB 2L68A 1EPAA 1ICNA 3NR3A 4I3CA 5B5GA 3EW1A 1LF7A 2FGSA 3SOTA 2Q9SA 4EKVA 5HZ6A 2KTDA 5IO6A 1OPBA 2O62A 2WPUA 3GE2A 2NNEA 4GUZA 3HWGA 3WJCA 1TOWA 4TKJA 4CSBA 3APWA 1SRGA 3BU9A 4EXZA 3BS2A 1RBPA 1CBSA 5LJDA 3ZQ3A 2JU7A 1QQSA 1QY0A 2RN4A 3UEUA 2RCQA 1JYDA 2QM9A 2KT4B 4O3WA 4ODDA 4TJZA 5F58A 4Z28A 4ALBA 1EIIA 4LQZA 1HBQA 2OVDA 3EMMA 4WFUA 1GT3A 3BDRA 2FLJA 4A1YA 1N7YA 1BBPA 2IZFB 2RTCB 3MG5A 4ZCBA 4BX6B 4O4OA 4YFQA 1EALA 3PP6A 1VYOA 1G85A 4EQAC 4PSQA 5H9LA 1VWBB 5HTEA 1FDQA 2K62A 5DPQA 2WR6A 2HKDA 2MF6A 1IJ8A 3UEWA 1X8OA 3ZW0A 1CBQA 3SAOA 2UYWA 2W2AA 5HAEA 1W6FA 4RUNA 2NNQA 2NNDA 1LDQA 1HXLA 2G5LA 4GU8A 2RCTA 4O3ZA 2ZAGA 1SY0A 1I4UA 3JQOA 4YDAA 1HMSA 1VWHB 4COTA 1SREA 1X8UA 4AW8A 3NADA 1KZWA 5F1EA 4I60A 2X45A 4BX7B 1I78A 3VG4A 1CRBA 2A2GA 2IZIA 1DF3A 2RTAA 2FR2A 1PM1X 4Z27A 5B29A 3VHHA 4BX5B 2WSJA 2OY5O 3BX7A 4U9CA 5EDBA 4Z2PA 4ALOA 2IZDB 1NQNA 2AH7X 4ZHHA 2FS7A 5LJBA 1T68X 1NP4A 2FTBA 2WQ9A 3KFFA 3MBTA 2LFOA 5AJBA 4A60A 3WZOA 3FIQA 4IMOA 5LJGA 1GX8A 3F9DA 2XKLA 1LFOA 1SWUA 2OY7A 1BM5A 2CM4A 1NP1A 1A2DA 1VPRA 2JW1A 3DSZA 3NQ9A 4I3BA 3T2XA 3SZIA 1X8PA 4BOEA 1MM9A 5FFHA 3ZI8A 2A5BA 1I04A 1K3BA 1K24A 3WJFA 1Y9TA 2A0AA 3P6DA 1LICA 4XMGA 2Y32A 4AZNA 2L67A 2IZGB 1XCAA 2BHVA 2OFAA 1EQDA 3BSZE 4UU3A 4ARHA 1JYJA 2M4LA 3P24A 1E00A 3RDUA 4C5PA 3STKA 1U17A 3B2HA 1S7DA 1SXYA 2DM5A 2VFCA 2Y3FA 3QKGA 3NX1A 1A57A 4TNNA 3AUMO 2GTFX 5FQ7E 2XSTA 1N4JA 4ORUA 5B10O 4Y59A 1AVDA 3AEHA 3CQRA 4DCBA 1X89A 4D6AA 3FEKA 2X8FA 1LIFA 2RTRB 3APUA 1MVGA 1AELA 3ZW2A 5BVQA 4M6SA 2Y3EA 4QYPA 1JJJA 3JS1A 1RLBE 2FS6A 2IZCB 5BYPA 1O1VA 3B2LA 2Z4IA 1HXZA 4HPDA 2ASNX 2OY8A 3FDCA 1FJ1E 1BSOA 1JQPA 2RTBB 3SZHA 2X8SA 4CDDA 3LV4A 1VWNB 2FKGA 1O8VA 1SWRA 3CKGA 2GJ5A 2LKKA 4O9SA 3SLTA 2X32A 5L8NA 1IIUA 4IBAA 4KC7A 3VE2A 1N9MA 3KZAA 3STMX 2X55A 4IAXA 2P8GA 4O4SA 4QGXA 3ZW0B 4MVLA 5IRWA 2BSZA 4IAWA 4BGFA 3ELXA 1YWAA 1ADLA 3PQUA 4K19A 1HBPA 4KC8A 2GH7A 1P6PA 2IFBA 4EDEA 2PY1A 3RE5A 3P6GA 4BX7A 1NQMA 3O19A 5BVSA 2F01A 4WHIA 4GE1A 4A8ZA 4QGVA 1MEPA 2NP1A 3T6LA 4B55A 3ZUOA 3ZWEA 4TQ2A 4DNEA 3EW2A 4FGIB 1YWDA 2JU8A 4IABA 4KIIA 4MIRA 3S26A 2W2BA 4BJ8A 4BQUA 4U46A 1KL3A 4INNA 3WZPA 2QMIA 4ZGFA 1JBHA 1I9HA 1SXWA 2ANSA 1AQBA 1NC9A 4YGHA 2FR3A 5EDCA 2JN3A 1ZNEA 4YBUA 4GDZA 4QNIA 3UAQA 1SA8A 4XMDA 1QG5A 4YKOA 3WJEA 3F8AA 3ELZA 1RXKA 1LUQA 1EUOA 2AL0X 2OL7A 4OEMA 3TGAA 4ZHFA 1SLFB 3B2IA 3D9WA 3EYCA 1MOYA 2LBVA 1ERBA 4YCEA 4ML7B 2CM9A 2X8TA 4DQ4A 3WBGA 1LIBA 1RSTB 4AZPA 4GD9A 1KL4A 3S5XA 3BRNA 3RKGA 1KT7A 2OY1O 1WUBA 5D48A 1QY2A 1HMTA 1VWCB 3OJYC 4KCAA 4QAEA 1LCZA 4ZH9A 2AVIA 4GJVA 5IRUA 5IXGA 2IZLB 5EZ2A 1IKJA 5IO5A 1VWRB 2LBAA 1OEEA 1GKAB 2RTEB 3N91A 4U8UM 1RSUB 3K3LA 2WQAE 3HWDA 3PQSA 4GK9A 3I17A 1SWQA 4MEEA 2X56A 2JMBA 1EXSA 2C1QA 3CWKA 1DZJA 1VWEB 2C4IA 2F09A 1GGLA 5F2BA 1OEJA 4GGZA 5F6BA 5B2AO 2OVEA 4CPHA 1DZKA 3RDMA 4CDEA 1QABE 5CYBA 2RQ0A 1VWJB 1X8QA 4OS8A 1AVGI 4QZTA 2RTJA 5FENA 2FWVA 3P6CA 2VFBA 1VWIB 1R0UA 1KFFA 1W5RA 3LTWA 1HQQA 1SLDB 1VYGA 4NP1A 4O4UA 5LJCA 2AT5X 1LPJA 1E2TA 1SWCA 1OBQA 1SWHA 1ZNGA 2QO5A 1BSQA 3UEVA 3WJDA 1BLRA 1OEKA 4FBRA 1SWOA 4ZHDA 1MX7A 1EPBA 3ZZVA 3I0AA 1ZNLA 1FTPA 2ACPX 3PECA 4JNJA 4KH8A 3JSQA 1WBIA 2A2UA 4N7DA 1SMPI 5B11O 5HZ5A 1S2PA 4I9RA 1CJ5A 4OKAA 2Q39A 1ALBA 4LKTA 5L8IA 3SZJA 2HLVA 5HCDC 3PEDA 3STNA 1FEMA 2KD2A 4OS0A 1VWLB 5HCEC 3CKFA 2LB6A 3Q34A 1VWPB 2AKQA 5JD2A 1IW2A 3D4RA 1KT5A 2F73A 1SXUA 1U18A 2FHNX 2YG2A 1LCWA 3NX2A 1KOIA 3PDFA 4N7CA 3HWEA 1VWGB 5EEEA 1PEEA 2Q4NA 2KTSA 2GTLM 3WJGA 4GKCA 1BWYA 1STPA 3AKMA 4CPEA 1U0XA 1SXXA 1QFTA 2WWPA 2WEWA 2JOZA 3P02A 2Q2PA 3BLGA 1OPAA 4R0BA 5CHKA 3RDSA 4XMFA 3FIDA 1NBXA 2ALLX 5F6ZA 3VE1A 2YMSA 3WZNA 1E5PA 3PK2A 2K23A 4CPFA 1ICMA 1ZRYA 5LJKA 1SLEB 3IA8A 3FELA 2AT3X 3APVA 3FMZA 3VGWA 2POAA 1GKAA 1B56A 2OF8A 2OFBA 2RTDB 1G74A 4XMCA 1DF8A 1SWGA 1SWJA 5HWZA 3C77X 2A8GA 1T8VA 1LIDA 5D45A 3FW4A 1G7NA 4L1NA 4QRLA 3OD9A 2FRSA 1LELA 3O2YA 3SLJA 3WZQA 3C78X 3QQ2A 3FR2A 1B8EA 1SWKA 1SWTA 4Z2VA 5K67A 1YP7A 4TLJA 4Y0SA 5HTDA 5H9KA 4CK4A 4CPHB 1KXOA 3P6HA 5B27A 3RBYA 5K06A 1VWMB 3EBWA 5HCCC 3TGBA 1I05A 3RY1A 4NLJA 4ZGUA 5IO7A 5D8JA 1Y53X 3E3CA 3VG2A 3MX7A 4OS3A 5HA1A 4AZQA 3TZSA 5B3MO 4AZMA 3MVFA 2R56A 4JHQA 3WYPA 1PMPA 3TF6A 3NP1A 5EPQA 2RTGB 4YFRA 2FT9A 2HMBA 3UEXA 2HZRA 1QY1A 1OBPA 2Q2MA 2C1SA 3OE3A
chains in the Genus database with same CATH topology
3HTYA 1BEBA 1B4MA 5JR8A 1D2UA 4M7MA 4YFPA 4Y0PA 1YUPA 1YP6A 4IMNA 4ZHGA 4RUUA 4NLIA 1ERXA 2A3FX 2CZTA 1XKIA 5BYPA 1GXAA 1SY1A 4NYQA 1X8NA 3NBXX 5C0NA 2R73A 3P6FA 5FAZA 3RZYA 4HFOA 3KFGA 5AQ6A 1FE3A 5DG4A 1VYFA 3S60A 4XMEA 1AB0A 3CMPA 1O1UA 3P6EA 3PH6A 4XMHA 3FA8A 2LA7A 3KQ0A 4ON1A 4I6SA 4Y0RA 3BY0A 4GNWA 4HPBA 4KT5A 1ML7A 3HWFA 3NQ3A 5H9NA 1EW3A 3ZW1B 4L3RA 4HPAA 4Y0QA 4NNTA 4NYRA 1FELA 1QFVA 4O49A 4IB9A 1GT1A 3FW5A 1B0OA 1DC9A 1T0VA 3EBKA 4IB7A 1EIOA 3L4RA 3BU1A 1KGLA 4GNYA 1JZUA 2W2FA 3PPTA 3G7XA 3HOLA 3VG5A 3VU1A 1D3SA 4GRJA 4I3DA 5L8OA 3DTQA 2QO6A 3CBSA 1KZXA 1TVQA 5D4AA 3WOVA 1A18A 4TKHA 3TGCA 1KT3A 2MJIA 2KW1A 2X46A 4QYNA 5LKFA 4ZFXA 4ORWA 2QOSC 5HZQA 3WVMA 1ZNHA 2Z4HA 4NW4A 1OBUA 2CZUA 4ZH6A 2HNXA 4WFVA 3WJBA 1FENA 5HBSA 4BVMA 2MM3A 4YMYA 1DFVA 4FBOA 2OZQA 3KFIA 2HZQA 1H91A 4CV7A 5HZ8A 3HK1A 4HPCA 4A1HA 1DZPA 5HA0A 1TOUA 2AT8X 2BS5A 2AMMX 2G79A 1KT4A 1N0SA 2CBSA 3B2JA 2AT0X 1HQPA 2ZAIA 4GETA 4PJ2A 4U8UN 1BSYA 3FA9A 4YGZA 5EEDA 1Z24A 1PBOA 5KICA 1IKEA 4MISA 4ZR2A 3APXA 3FENA 1KT6A 1NGLA 4O3XB 1EI5A 2RA6A 4DQ3A 2HYSA 2OVAA 1MX8A 3D96A 4ES7A 1ZNKA 5FQ8E 5FQ6E 4LZVA 1UREA 2WUTA 4U8UO 1IFCA 2MWHA 1GM6A 4WBKA 3AKNA 3D97A 3VG3A 4EEJA 2WEXA 2OVSA 2E4JA 4I95A 2G7BA 3ZW1A 4ORSA 3ZUIA 3RWXA 1TXLA 3NQKA 2OFRX 1ZNDA 1SY3A 5H8TA 1G5WA 3T1DA 1YIVA 1HMRA 4MVEA 4QQ1A 4TKBA 3S5VA 4YBPA 3LHNA 4YH0A 3VG6A 4OMXA 5KHPA 2GC9A 2A13A 1SY2A 1KQXA 2BLGA 4IB8A 2EU7X 1GT5A 1A3YA 3VPJE 1JJXA 3PH5A 1GX9A 3CBCA 1CBIA 1DV9A 4ORXA 4ORYA 2BT9A 4MVKA 1BRQA 4UU2A 1YWBA 3IFBA 2MHDA 4AYHA 2BS6A 1DZMA 2GTLN 4ZJ0A 3BX8A 3Q6LA 1LKEA 4MVIA 4YCHA 5F7GA 2QO4A 1MUPA 3VG7A 2G78A 3B2KA 1JIWI 4ORRA 4QGWA 3NPOA 4GZVA 3HOEA 4O4XA 4GH7A 4FQBB 3U0DA 5D47A 5HZ9A 4OMWA 4D6BA 3H3IA 2GTLO 3V8UA 3FR5A 1GT4A 5AJCA 1CBRA 2L5PA 3D95A 1I06A 2N93A 5LJEA 4AZRA 3F6ZB 3FA6A 1TW4A 2CBRA 3FYFA 5AEOA 5BVTA 5LKEA 1X71A 3RSWA 3WXQA 4IB6A 4O3YA 4YDBA 3C76X 4ID2A 1L6MA 4YKMA 5H9AA 4LKPA 4ZHCA 1S44A 2RD7C 3CR6A 4YGGA 3FEPA 1Y9LA 1JV4A 4HWMA 3FA7A 4AZOA 1YWCA 4JGLA 1LNMA 3KFHA 1E02A 4FBVA 4U3QA 5KIDA 1MDCA 3GAQA 3U9PC 2L9CA 3FR4A 1BJ7A 3EM0A 5LJHA 1BRPA 1UZ2X 1IFBA 3U03A 1KQWA 1E06A 2R74A 4EFGA 3FLLA 1LIEA 4QZUA 4I9SA 1HN2A 1ACDA 3O22A 2JU3A 2OFMX 3OBLA 4LZUA 4NNSA 3CQNA 2MO5A 1QWDA 2ACOA 2AT6X 3NR3A 2L68A 1EPAA 1ICNA 5L8IA 4I3CA 2LBVA 1LF7A 3SOTA 2Q9SA 5HZ6A 2KTDA 5IO6A 1OPBA 2O62A 3GE2A 2NNEA 3HWGA 3WJCA 1TOWA 4TKJA 4CSBA 3APWA 3BU9A 4EXZA 3BS2A 1RBPA 1CBSA 5LJDA 3ZQ3A 2JU7A 1QQSA 1QY0A 2RN4A 3UEUA 2RCQA 1JYDA 2QM9A 2KT4B 4O3WA 4ODDA 4TJZA 5F58A 4ALBA 1EIIA 4LQZA 1HBQA 2OVDA 3EMMA 4WFUA 1GT3A 3BDRA 2FLJA 4A1YA 1BBPA 4ZCBA 4O4OA 4YFQA 1EALA 3PP6A 1G85A 4EQAC 4PSQA 5H9LA 5HTEA 1FDQA 2K62A 5DPQA 2WR6A 3UEWA 1X8OA 3ZW0A 1CBQA 3SAOA 2W2AA 5HAEA 4RUNA 2NNQA 2NNDA 4GU8A 2RCTA 4O3ZA 2ZAGA 1SY0A 1I4UA 3JQOA 4YDAA 1HMSA 4COTA 4AW8A 1X8UA 1KZWA 3NADA 5F1EA 2X45A 3VG4A 1CRBA 2A2GA 1DF3A 2FR2A 1PM1X 5B29A 2WSJA 3BX7A 4U9CA 5EDBA 4ALOA 2AH7X 4ZHHA 2FS7A 5LJBA 1T68X 1NP4A 2FTBA 2WQ9A 3KFFA 3MBTA 2LFOA 5AJBA 4A60A 3FIQA 4IMOA 5LJGA 1GX8A 3F9DA 2XKLA 1LFOA 1BM5A 2CM4A 1NP1A 1A2DA 1VPRA 2JW1A 3DSZA 3NQ9A 4I3BA 4BOEA 1X8PA 5FFHA 3ZI8A 1I04A 3WJFA 1Y9TA 2A0AA 3P6DA 1LICA 4XMGA 4AZNA 2L67A 1XCAA 2BHVA 3BSZE 1EQDA 4UU3A 4ARHA 1JYJA 2M4LA 3P24A 1E00A 3STKA 1U17A 3B2HA 1S7DA 1SXYA 2DM5A 3QKGA 1A57A 3NX1A 4TNNA 2GTFX 5FQ7E 2XSTA 4ORUA 3CQRA 1X89A 4D6AA 3FEKA 2X8FA 1LIFA 3APUA 1MVGA 1AELA 3ZW2A 5BVQA 4M6SA 1JJJA 4QYPA 3JS1A 1RLBE 2FS6A 1O1VA 3B2LA 2Z4IA 4HPDA 2ASNX 1BSOA 2X8SA 3LV4A 1O8VA 2GJ5A 2LKKA 4O9SA 5L8NA 1IIUA 4IBAA 4KC7A 3VE2A 3STMX 3KZAA 4IAXA 2P8GA 4O4SA 4QGXA 3ZW0B 4MVLA 4IAWA 3ELXA 1YWAA 1ADLA 3PQUA 4K19A 1HBPA 4KC8A 1P6PA 2IFBA 4EDEA 2PY1A 3P6GA 3O19A 5BVSA 4WHIA 4GE1A 4A8ZA 4QGVA 2NP1A 3ZUOA 3ZWEA 4TQ2A 4FGIB 1YWDA 2JU8A 4IABA 4KIIA 4MIRA 3S26A 2W2BA 4BQUA 4INNA 2QMIA 4ZGFA 1JBHA 2ANSA 1SXWA 1AQBA 4YGHA 2FR3A 5EDCA 2JN3A 1ZNEA 4YBUA 4GDZA 4QNIA 3UAQA 1SA8A 4XMDA 1QG5A 4YKOA 3WJEA 3F8AA 3ELZA 1EUOA 2AL0X 3TGAA 4ZHFA 3B2IA 3EYCA 1ERBA 4YCEA 4ML7B 2CM9A 2X8TA 4DQ4A 3WBGA 1LIBA 4AZPA 3S5XA 3BRNA 3RKGA 1KT7A 5D48A 1QY2A 1HMTA 4KCAA 3OJYC 4QAEA 4ZH9A 5EZ2A 1IKJA 5IO5A 2LBAA 1OEEA 1GKAB 3N91A 4U8UM 3K3LA 2WQAE 3HWDA 3PQSA 4GK9A 3I17A 2JMBA 1EXSA 3CWKA 1DZJA 5F6BA 2F09A 1GGLA 1OEJA 2OVEA 1DZKA 1QABE 5CYBA 2RQ0A 1X8QA 4QZTA 4OS8A 1AVGI 5FENA 2FWVA 3P6CA 1R0UA 1VYGA 4NP1A 4O4UA 5LJCA 2AT5X 1LPJA 3WJDA 1OBQA 1ZNGA 1BLRA 2QO5A 1BSQA 3UEVA 1OEKA 4FBRA 4ZHDA 1MX7A 1EPBA 3ZZVA 3I0AA 1ZNLA 1FTPA 2ACPX 3PECA 4KH8A 3JSQA 2A2UA 4N7DA 1SMPI 5HZ5A 1S2PA 4I9RA 1CJ5A 2Q39A 1ALBA 4LKTA 2HLVA 5HCDC 3PEDA 3STNA 1FEMA 2KD2A 4OS0A 5HCEC 2LB6A 2AKQA 1IW2A 3D4RA 1KT5A 2F73A 1SXUA 1U18A 2YG2A 5CE4A 3NX2A 1KOIA 4N7CA 1PEEA 3HWEA 5EEEA 2Q4NA 2KTSA 2GTLM 3WJGA 4GKCA 1BWYA 3AKMA 1U0XA 1SXXA 1QFTA 2WWPA 2WEWA 2JOZA 3P02A 2Q2PA 3BLGA 1OPAA 4R0BA 4XMFA 2ALLX 5F6ZA 3VE1A 2YMSA 1E5PA 2K23A 1ICMA 1ZRYA 5LJKA 3IA8A 3FELA 2AT3X 3APVA 3FMZA 2POAA 1GKAA 1B56A 1G74A 4XMCA 5HWZA 3C77X 1T8VA 1LIDA 5D45A 3FW4A 1G7NA 4L1NA 4QRLA 3OD9A 2FRSA 3O2YA 3C78X 3FR2A 1B8EA 1YP7A 4TLJA 4Y0SA 5HTDA 5H9KA 4CK4A 1KXOA 3P6HA 5B27A 3RBYA 5K06A 3EBWA 5HCCC 3TGBA 1I05A 4NLJA 4ZGUA 5IO7A 5D8JA 3E3CA 3VG2A 3MX7A 4OS3A 5HA1A 4AZQA 3TZSA 4AZMA 3MVFA 2R56A 1PMPA 3TF6A 3NP1A 5EPQA 4YFRA 2FT9A 2HMBA 3UEXA 2HZRA 1QY1A 1OBPA 2Q2MA 3OE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BEB A;  1B4M A;  5JR8 A;  1D2U A;  4M7M A;  4YFP A;  4Y0P A;  1YUP A;  1YP6 A;  4IMN A;  4ZHG A;  4RUU A;  4NLI A;  1ERX A;  2A3F X;  2CZT A;  1XKI A;  1GXA A;  1SY1 A;  4NYQ A;  1X8N A;  5C0N A;  2R73 A;  3P6F A;  5FAZ A;  3RZY A;  4HFO A;  3KFG A;  5AQ6 A;  1FE3 A;  5DG4 A;  1VYF A;  4XME A;  1AB0 A;  3CMP A;  1O1U A;  3P6E A;  3PH6 A;  4XMH A;  3FA8 A;  3KQ0 A;  4Y0R A;  3BY0 A;  4GNW A;  4HPB A;  1ML7 A;  3HWF A;  3NQ3 A;  5H9N A;  1EW3 A;  4Y0Q A;  4HPA A;  4NNT A;  4NYR A;  1FEL A;  1QFV A;  4IB9 A;  1GT1 A;  3FW5 A;  1B0O A;  1DC9 A;  1T0V A;  3EBK A;  4IB7 A;  1EIO A;  3L4R A;  3BU1 A;  1KGL A;  4GNY A;  1JZU A;  2W2F A;  3PPT A;  3G7X A;  3VG5 A;  1D3S A;  4GRJ A;  4I3D A;  5L8O A;  3DTQ A;  2QO6 A;  3CBS A;  1KZX A;  1TVQ A;  5D4A A;  1A18 A;  4TKH A;  3TGC A;  1KT3 A;  2MJI A;  2X46 A;  4QYN A;  5LKF A;  4ZFX A;  4ORW A;  2QOS C;  5HZQ A;  3WVM A;  1ZNH A;  4ZH6 A;  1OBU A;  2CZU A;  3WJB A;  2HNX A;  4WFV A;  4BVM A;  1FEN A;  5HBS A;  2MM3 A;  4YMY A;  1DFV A;  2OZQ A;  3KFI A;  2HZQ A;  1H91 A;  5HZ8 A;  3HK1 A;  4HPC A;  4A1H A;  1DZP A;  5HA0 A;  1TOU A;  2AT8 X;  2AMM X;  2G79 A;  1KT4 A;  1N0S A;  2CBS A;  3B2J A;  2AT0 X;  1HQP A;  4GET A;  1BSY A;  3FA9 A;  4YGZ A;  5EED A;  1Z24 A;  1PBO A;  5KIC A;  1IKE A;  4ZR2 A;  3APX A;  3FEN A;  1KT6 A;  1NGL A;  4DQ3 A;  2RA6 A;  2HYS A;  2OVA A;  1MX8 A;  3D96 A;  4ES7 A;  1ZNK A;  4LZV A;  1URE A;  2WUT A;  1IFC A;  4WBK A;  1GM6 A;  3VG3 A;  3AKN A;  3D97 A;  4EEJ A;  2WEX A;  2E4J A;  2G7B A;  4ORS A;  3ZUI A;  1TXL A;  2OFR X;  1ZND A;  1SY3 A;  5H8T A;  1G5W A;  3T1D A;  1YIV A;  1HMR A;  4TKB A;  4YBP A;  4YH0 A;  3VG6 A;  4OMX A;  5KHP A;  2GC9 A;  2A13 A;  1SY2 A;  1KQX A;  2BLG A;  4IB8 A;  2EU7 X;  1GT5 A;  1A3Y A;  1JJX A;  3PH5 A;  1GX9 A;  3CBC A;  1CBI A;  1DV9 A;  4ORX A;  4ORY A;  4MVK A;  1BRQ A;  4UU2 A;  1YWB A;  3IFB A;  4AYH A;  1DZM A;  4ZJ0 A;  3BX8 A;  3Q6L A;  1LKE A;  4MVI A;  4YCH A;  5F7G A;  2QO4 A;  1MUP A;  3VG7 A;  2G78 A;  3B2K A;  4ORR A;  4QGW A;  3NPO A;  4GH7 A;  3U0D A;  5D47 A;  5HZ9 A;  4OMW A;  4D6B A;  3FR5 A;  1GT4 A;  1CBR A;  2L5P A;  3D95 A;  1I06 A;  2N93 A;  5LJE A;  4AZR A;  3FA6 A;  1TW4 A;  2CBR A;  5BVT A;  5LKE A;  1X71 A;  3RSW A;  3WXQ A;  4IB6 A;  4YDB A;  3C76 X;  1L6M A;  4YKM A;  5H9A A;  4LKP A;  4ZHC A;  1S44 A;  2RD7 C;  3CR6 A;  4YGG A;  3FEP A;  4AZO A;  1JV4 A;  3FA7 A;  1YWC A;  1LNM A;  3KFH A;  1E02 A;  5KID A;  1MDC A;  3GAQ A;  3U9P C;  2L9C A;  3FR4 A;  1BJ7 A;  3EM0 A;  5LJH A;  1BRP A;  1UZ2 X;  1IFB A;  3U03 A;  1KQW A;  1E06 A;  2R74 A;  4EFG A;  3FLL A;  1LIE A;  4QZU A;  4I9S A;  1HN2 A;  1ACD A;  3O22 A;  2JU3 A;  2OFM X;  4LZU A;  4NNS A;  3CQN A;  2MO5 A;  1QWD A;  2ACO A;  2AT6 X;  3NR3 A;  2L68 A;  1EPA A;  1ICN A;  5L8I A;  4I3C A;  2LBV A;  1LF7 A;  2Q9S A;  5HZ6 A;  2KTD A;  5IO6 A;  1OPB A;  2O62 A;  2NNE A;  3HWG A;  3WJC A;  1TOW A;  4TKJ A;  3APW A;  3BU9 A;  4EXZ A;  3BS2 A;  1RBP A;  1CBS A;  5LJD A;  3ZQ3 A;  2JU7 A;  1QQS A;  1QY0 A;  3UEU A;  2RCQ A;  1JYD A;  2QM9 A;  2KT4 B;  4TJZ A;  4ODD A;  5F58 A;  4ALB A;  1EII A;  1HBQ A;  2OVD A;  3EMM A;  4WFU A;  1GT3 A;  3BDR A;  2FLJ A;  4A1Y A;  1BBP A;  4ZCB A;  4YFQ A;  1EAL A;  3PP6 A;  1G85 A;  4PSQ A;  5H9L A;  5HTE A;  1FDQ A;  2K62 A;  5DPQ A;  2WR6 A;  3UEW A;  1X8O A;  1CBQ A;  3SAO A;  2W2A A;  5HAE A;  4RUN A;  2NNQ A;  2NND A;  2RCT A;  1SY0 A;  1I4U A;  4YDA A;  1HMS A;  4AW8 A;  1X8U A;  1KZW A;  3NAD A;  5F1E A;  2X45 A;  3VG4 A;  1CRB A;  2A2G A;  1DF3 A;  2FR2 A;  1PM1 X;  5B29 A;  2WSJ A;  3BX7 A;  5EDB A;  4ALO A;  2AH7 X;  4ZHH A;  2FS7 A;  5LJB A;  1T68 X;  1NP4 A;  2FTB A;  2WQ9 A;  3KFF A;  3MBT A;  2LFO A;  4A60 A;  3FIQ A;  4IMO A;  5LJG A;  1GX8 A;  3F9D A;  2XKL A;  1LFO A;  1BM5 A;  2CM4 A;  1NP1 A;  1A2D A;  1VPR A;  3DSZ A;  3NQ9 A;  4I3B A;  4BOE A;  1X8P A;  5FFH A;  1I04 A;  3WJF A;  2A0A A;  3P6D A;  1LIC A;  4XMG A;  4AZN A;  2L67 A;  1XCA A;  3BSZ E;  1EQD A;  4UU3 A;  4ARH A;  1JYJ A;  1E00 A;  3STK A;  1U17 A;  3B2H A;  1S7D A;  1SXY A;  2DM5 A;  3QKG A;  1A57 A;  3NX1 A;  4TNN A;  2GTF X;  2XST A;  4ORU A;  3CQR A;  1X89 A;  4D6A A;  3FEK A;  1LIF A;  3APU A;  1MVG A;  1AEL A;  5BVQ A;  4M6S A;  1JJJ A;  4QYP A;  3JS1 A;  1RLB E;  2FS6 A;  1O1V A;  3B2L A;  4HPD A;  2ASN X;  1BSO A;  1O8V A;  2GJ5 A;  2LKK A;  4O9S A;  5L8N A;  1IIU A;  4IBA A;  3STM X;  3KZA A;  4IAX A;  2P8G A;  4QGX A;  4MVL A;  4IAW A;  3ELX A;  1YWA A;  1ADL A;  4K19 A;  1HBP A;  1P6P A;  2IFB A;  4EDE A;  2PY1 A;  3P6G A;  3O19 A;  5BVS A;  4QGV A;  4GE1 A;  4A8Z A;  2NP1 A;  3ZUO A;  4TQ2 A;  1YWD A;  2JU8 A;  4KII A;  3S26 A;  2W2B A;  4BQU A;  1JBH A;  2ANS A;  1SXW A;  1AQB A;  4YGH A;  2FR3 A;  5EDC A;  2JN3 A;  1ZNE A;  4YBU A;  1SA8 A;  4XMD A;  1QG5 A;  4YKO A;  3WJE A;  3F8A A;  3ELZ A;  1EUO A;  2AL0 X;  3TGA A;  4ZHF A;  3B2I A;  3EYC A;  1ERB A;  4YCE A;  2CM9 A;  4DQ4 A;  3WBG A;  1LIB A;  4AZP A;  3BRN A;  1KT7 A;  5D48 A;  1QY2 A;  1HMT A;  4ZH9 A;  3OJY C;  4QAE A;  5EZ2 A;  1IKJ A;  5IO5 A;  2LBA A;  1OEE A;  1GKA B;  3K3L A;  2WQA E;  3HWD A;  3I17 A;  1EXS A;  3CWK A;  1DZJ A;  5F6B A;  1GGL A;  1OEJ A;  2OVE A;  1DZK A;  1QAB E;  2RQ0 A;  1X8Q A;  4QZT A;  4OS8 A;  1AVG I;  5FEN A;  2FWV A;  3P6C A;  1R0U A;  1VYG A;  4NP1 A;  5LJC A;  2AT5 X;  1LPJ A;  3WJD A;  1OBQ A;  1ZNG A;  1BLR A;  2QO5 A;  1BSQ A;  3UEV A;  1OEK A;  4ZHD A;  1MX7 A;  1EPB A;  3I0A A;  1ZNL A;  1FTP A;  2ACP X;  3PEC A;  3JSQ A;  2A2U A;  4N7D A;  5HZ5 A;  1S2P A;  4I9R A;  1CJ5 A;  2Q39 A;  1ALB A;  4LKT A;  2HLV A;  5HCD C;  3PED A;  3STN A;  1FEM A;  4OS0 A;  5HCE C;  2LB6 A;  2AKQ A;  1IW2 A;  1KT5 A;  2F73 A;  1SXU A;  1U18 A;  2YG2 A;  5CE4 A;  3NX2 A;  1KOI A;  4N7C A;  1PEE A;  3HWE A;  5EEE A;  2Q4N A;  3WJG A;  4GKC A;  1BWY A;  3AKM A;  1U0X A;  1SXX A;  1QFT A;  2WWP A;  2WEW A;  2JOZ A;  2Q2P A;  3BLG A;  1OPA A;  4R0B A;  4XMF A;  2ALL X;  5F6Z A;  1E5P A;  2K23 A;  1ICM A;  1ZRY A;  5LJK A;  3IA8 A;  3FEL A;  2AT3 X;  3APV A;  3FMZ A;  2POA A;  1GKA A;  1B56 A;  1G74 A;  4XMC A;  5HWZ A;  3C77 X;  1T8V A;  1LID A;  5D45 A;  3FW4 A;  1G7N A;  2FRS A;  3O2Y A;  3C78 X;  3FR2 A;  1B8E A;  1YP7 A;  4TLJ A;  4Y0S A;  5HTD A;  5H9K A;  4CK4 A;  1KXO A;  3P6H A;  5B27 A;  5K06 A;  3EBW A;  5HCC C;  3TGB A;  1I05 A;  4NLJ A;  4ZGU A;  5IO7 A;  5D8J A;  3VG2 A;  5HA1 A;  4OS3 A;  4AZQ A;  3TZS A;  4AZM A;  3MVF A;  2R56 A;  1PMP A;  3TF6 A;  3NP1 A;  5EPQ A;  4YFR A;  2FT9 A;  2HMB A;  3UEX A;  2HZR A;  1QY1 A;  1OBP A;  2Q2M A; 
#chains in the Genus database with same CATH topology
 4IRW A;  3HTY A;  1BEB A;  2AF5 A;  5JR8 A;  1D2U A;  2G8C O;  1B4M A;  4M7M A;  4YFP A;  4Y0P A;  4JO6 A;  1KL5 A;  4Y5D A;  1YUP A;  1YP6 A;  2RTO B;  4IMN A;  4ZHG A;  4RUU A;  4NLI A;  1ERX A;  2A3F X;  2CZT A;  1XKI A;  3T2W A;  1GXA A;  1STS B;  1SY1 A;  1X8N A;  3NBX X;  4NYQ A;  3WYQ A;  5CE4 A;  1SRI A;  5C0N A;  3T6F A;  2R73 A;  3P6F A;  5FAZ A;  3RZY A;  4HFO A;  3KFG A;  5AQ6 A;  1FE3 A;  5DG4 A;  2IZA A;  1VYF A;  2OL6 O;  4XME A;  3S60 A;  1AB0 A;  2I5V O;  3CMP A;  1O1U A;  3P6E A;  3PH6 A;  1SRJ A;  4NV8 A;  4XMH A;  3FA8 A;  4OEL A;  2LA7 A;  3KQ0 A;  4ON1 A;  4I6S A;  4Y0R A;  2PI3 O;  2IZH B;  4BCS A;  3BY0 A;  2BC3 A;  2X34 A;  4GNW A;  4HPB A;  4KT5 A;  1ML7 A;  3HWF A;  3NQ3 A;  5H9N A;  1EW3 A;  1STR B;  3ZW1 B;  4L3R A;  1Y55 X;  4HPA A;  4Y0Q A;  5IRA A;  4NNT A;  4NYR A;  1FEL A;  1QFV A;  4O49 A;  4IB9 A;  1GT1 A;  3FW5 A;  4GJS A;  1B0O A;  1DC9 A;  1T0V A;  2RTN B;  1UYN X;  1SWF A;  3EBK A;  4IB7 A;  1EIO A;  3L4R A;  4CPI A;  3BU1 A;  3VHI A;  1KGL A;  4GNY A;  1JZU A;  2W2F A;  3PPT A;  3G7X A;  3HOL A;  3VG5 A;  1VWD B;  3VU1 A;  1D3S A;  3HPE A;  1RXH A;  4GRJ A;  4I3D A;  5L8O A;  3RY2 A;  3DTQ A;  2QO6 A;  1PBY A;  2OYB O;  3CBS A;  1KZX A;  2QOM A;  3X00 A;  1TVQ A;  5D4A A;  3WOV A;  1A18 A;  4TKH A;  3TGC A;  1KT3 A;  2RTH B;  2MJI A;  2KW1 A;  2RTP B;  2X46 A;  4QYN A;  5LKF A;  4ZFX A;  5B5F A;  4ORW A;  2QOS C;  5HZQ A;  3WVM A;  3KVN A;  2OF9 A;  4GDA A;  1ZNH A;  2Z4H A;  4NW4 A;  1OBU A;  2CZU A;  4ZH6 A;  2HNX A;  4WFV A;  3WJB A;  1FEN A;  5HBS A;  4BVM A;  2MM3 A;  4YMY A;  1DFV A;  1MK5 A;  2OZQ A;  3KFI A;  4FBO A;  1SWA A;  1Y0G A;  1H91 A;  2HZQ A;  4CV7 A;  5HZ8 A;  1LCV A;  3HK1 A;  2A5C A;  4HPC A;  4A1H A;  1DZP A;  5HA0 A;  1TOU A;  1VWK B;  2AT8 X;  2RTL A;  2BS5 A;  1GX3 A;  2RTQ B;  2AMM X;  1RAV A;  2G79 A;  1KT4 A;  1N0S A;  2CBS A;  3B2J A;  2AT0 X;  1HQP A;  2ZAI A;  1W4T A;  4GET A;  4PJ2 A;  1BSY A;  4U8U N;  3FA9 A;  2QCB A;  4YGZ A;  1Z24 A;  5EED A;  1PBO A;  4YVB A;  5KIC A;  1IKE A;  4MIS A;  4ZR2 A;  1N9Y A;  3RDO A;  3APX A;  3FEN A;  1KT6 A;  1NGL A;  4O3X B;  1EI5 A;  2RA6 A;  4DQ3 A;  2HYS A;  1UYO X;  1MX8 A;  1SLG B;  2OVA A;  2DJF A;  3D96 A;  2VDF A;  1PTS A;  4ES7 A;  2IZE B;  1ZNK A;  5FQ8 E;  1SWE A;  4LZV A;  5FQ6 E;  1URE A;  2WUT A;  2IZJ A;  4U8U O;  1IFC A;  2MWH A;  1GM6 A;  3EC5 A;  3AKN A;  3D97 A;  4WBK A;  3VG3 A;  4EEJ A;  2WEX A;  1LDO A;  2OVS A;  2E4J A;  2X4M A;  4I95 A;  1SWP A;  2G7B A;  4ORS A;  5CSE A;  3ZW1 A;  3VHM A;  2JGS A;  3RWX A;  1NDJ A;  1TXL A;  3ZUI A;  3NQK A;  2OFR X;  3MM0 A;  1ZND A;  1OSP O;  1SY3 A;  5H8T A;  1G5W A;  1N43 A;  3T1D A;  1YIV A;  1HMR A;  4Z6J A;  4MVE A;  4QQ1 A;  4TKB A;  3S5V A;  4YBP A;  3LHN A;  4YH0 A;  3VG6 A;  4OMX A;  5KHP A;  2A13 A;  2GC9 A;  1SY2 A;  1KQX A;  2BLG A;  4IB8 A;  2EU7 X;  4CDF A;  1GT5 A;  1A3Y A;  3VPJ E;  3RE6 A;  1JJX A;  3PH5 A;  1GX9 A;  1Y52 X;  3CBC A;  1CBI A;  1DV9 A;  4ORX A;  4ORY A;  2DJG A;  1VWF B;  2BT9 A;  4MVK A;  1HY2 A;  1BRQ A;  1SRF A;  4UU2 A;  1YWB A;  3RDX A;  3IFB A;  2MHD A;  4AYH A;  2BS6 A;  1DZM A;  2GTL N;  2UZ2 A;  2I5Z O;  3BX8 A;  3Q6L A;  4ZJ0 A;  1LKE A;  4MVI A;  1SWS A;  4YCH A;  5F7G A;  2QO4 A;  4CDC A;  1MUP A;  3VG7 A;  4BX6 A;  2G78 A;  3B2K A;  1SWL A;  2OL8 O;  4NV7 A;  1JIW I;  4ORR A;  4QGW A;  3NPO A;  1JMZ A;  4GZV A;  3HOE A;  1SRH A;  4O4X A;  4GH7 A;  4FQB B;  3U0D A;  5D47 A;  5HZ9 A;  4OMW A;  4D6B A;  3H3I A;  2GTL O;  3V8U A;  3FR5 A;  3SLO A;  2IZB A;  1GT4 A;  4BBO A;  5L3Y A;  2RTI B;  5AJC A;  1SWN A;  1CBR A;  2L5P A;  3D95 A;  1I06 A;  2N93 A;  5LJE A;  1SWD A;  4AZR A;  3F6Z B;  3FA6 A;  1TW4 A;  2CBR A;  3FYF A;  5AEO A;  5BVT A;  5LKE A;  1X71 A;  3RSW A;  2RTK A;  3WXQ A;  2FKJ A;  4IB6 A;  3RDQ A;  4O3Y A;  4YDB A;  2ZSC A;  3C76 X;  4ID2 A;  1SWB A;  1L6M A;  2FHL A;  4GGR A;  4YKM A;  5H9A A;  5K68 A;  4LKP A;  4BX5 A;  4ZHC A;  1VWA B;  1S44 A;  2IZK A;  2RD7 C;  4GGT A;  3CR6 A;  4YGG A;  3FEP A;  1Y9L A;  1JV4 A;  4HWM A;  3FA7 A;  2CAM A;  1YWC A;  4JGL A;  4AZO A;  2RTM A;  1LNM A;  3KFH A;  1E02 A;  4FBV A;  4U3Q A;  5KID A;  1MDC A;  1RXJ A;  1JJU A;  3GAQ A;  2L9C A;  3FR4 A;  1BJ7 A;  3U9P C;  3EM0 A;  5LJH A;  1BRP A;  1UZ2 X;  1VWO B;  1IFB A;  1AVE A;  4Z2O A;  3U03 A;  1KQW A;  1E06 A;  1VWQ B;  2R74 A;  3FLL A;  1LIE A;  4EFG A;  4QZU A;  4I9S A;  1JMX A;  1ACD A;  1HN2 A;  2JU3 A;  2OFM X;  3O22 A;  3OBL A;  4LZU A;  4NNS A;  3CQN A;  2MO5 A;  1QWD A;  2ACO A;  2AT6 X;  2RTF B;  2L68 A;  1EPA A;  1ICN A;  3NR3 A;  4I3C A;  5B5G A;  3EW1 A;  1LF7 A;  2FGS A;  3SOT A;  2Q9S A;  4EKV A;  5HZ6 A;  2KTD A;  5IO6 A;  1OPB A;  2O62 A;  2WPU A;  3GE2 A;  2NNE A;  4GUZ A;  3HWG A;  3WJC A;  1TOW A;  4TKJ A;  4CSB A;  3APW A;  1SRG A;  3BU9 A;  4EXZ A;  3BS2 A;  1RBP A;  1CBS A;  5LJD A;  3ZQ3 A;  2JU7 A;  1QQS A;  1QY0 A;  2RN4 A;  3UEU A;  2RCQ A;  1JYD A;  2QM9 A;  2KT4 B;  4O3W A;  4ODD A;  4TJZ A;  5F58 A;  4Z28 A;  4ALB A;  1EII A;  4LQZ A;  1HBQ A;  2OVD A;  3EMM A;  4WFU A;  1GT3 A;  3BDR A;  2FLJ A;  4A1Y A;  1N7Y A;  1BBP A;  2IZF B;  2RTC B;  3MG5 A;  4ZCB A;  4BX6 B;  4O4O A;  4YFQ A;  1EAL A;  3PP6 A;  1VYO A;  1G85 A;  4EQA C;  4PSQ A;  5H9L A;  1VWB B;  5HTE A;  1FDQ A;  2K62 A;  5DPQ A;  2WR6 A;  2HKD A;  2MF6 A;  1IJ8 A;  3UEW A;  1X8O A;  3ZW0 A;  1CBQ A;  3SAO A;  2UYW A;  2W2A A;  5HAE A;  1W6F A;  4RUN A;  2NNQ A;  2NND A;  1LDQ A;  1HXL A;  2G5L A;  4GU8 A;  2RCT A;  4O3Z A;  2ZAG A;  1SY0 A;  1I4U A;  3JQO A;  4YDA A;  1HMS A;  1VWH B;  4COT A;  1SRE A;  1X8U A;  4AW8 A;  3NAD A;  1KZW A;  5F1E A;  4I60 A;  2X45 A;  4BX7 B;  1I78 A;  3VG4 A;  1CRB A;  2A2G A;  2IZI A;  1DF3 A;  2RTA A;  2FR2 A;  1PM1 X;  4Z27 A;  5B29 A;  3VHH A;  4BX5 B;  2WSJ A;  2OY5 O;  3BX7 A;  4U9C A;  5EDB A;  4Z2P A;  4ALO A;  2IZD B;  1NQN A;  2AH7 X;  4ZHH A;  2FS7 A;  5LJB A;  1T68 X;  1NP4 A;  2FTB A;  2WQ9 A;  3KFF A;  3MBT A;  2LFO A;  5AJB A;  4A60 A;  3WZO A;  3FIQ A;  4IMO A;  5LJG A;  1GX8 A;  3F9D A;  2XKL A;  1LFO A;  1SWU A;  2OY7 A;  1BM5 A;  2CM4 A;  1NP1 A;  1A2D A;  1VPR A;  2JW1 A;  3DSZ A;  3NQ9 A;  4I3B A;  3T2X A;  3SZI A;  1X8P A;  4BOE A;  1MM9 A;  5FFH A;  3ZI8 A;  2A5B A;  1I04 A;  1K3B A;  1K24 A;  3WJF A;  1Y9T A;  2A0A A;  3P6D A;  1LIC A;  4XMG A;  2Y32 A;  4AZN A;  2L67 A;  2IZG B;  1XCA A;  2BHV A;  2OFA A;  1EQD A;  3BSZ E;  4UU3 A;  4ARH A;  1JYJ A;  2M4L A;  3P24 A;  1E00 A;  3RDU A;  4C5P A;  3STK A;  1U17 A;  3B2H A;  1S7D A;  1SXY A;  2DM5 A;  2VFC A;  2Y3F A;  3QKG A;  3NX1 A;  1A57 A;  4TNN A;  3AUM O;  2GTF X;  5FQ7 E;  2XST A;  1N4J A;  4ORU A;  5B10 O;  4Y59 A;  1AVD A;  3AEH A;  3CQR A;  4DCB A;  1X89 A;  4D6A A;  3FEK A;  2X8F A;  1LIF A;  2RTR B;  3APU A;  1MVG A;  1AEL A;  3ZW2 A;  5BVQ A;  4M6S A;  2Y3E A;  4QYP A;  1JJJ A;  3JS1 A;  1RLB E;  2FS6 A;  2IZC B;  5BYP A;  1O1V A;  3B2L A;  2Z4I A;  1HXZ A;  4HPD A;  2ASN X;  2OY8 A;  3FDC A;  1FJ1 E;  1BSO A;  1JQP A;  2RTB B;  3SZH A;  2X8S A;  4CDD A;  3LV4 A;  1VWN B;  2FKG A;  1O8V A;  1SWR A;  3CKG A;  2GJ5 A;  2LKK A;  4O9S A;  3SLT A;  2X32 A;  5L8N A;  1IIU A;  4IBA A;  4KC7 A;  3VE2 A;  1N9M A;  3KZA A;  3STM X;  2X55 A;  4IAX A;  2P8G A;  4O4S A;  4QGX A;  3ZW0 B;  4MVL A;  5IRW A;  2BSZ A;  4IAW A;  4BGF A;  3ELX A;  1YWA A;  1ADL A;  3PQU A;  4K19 A;  1HBP A;  4KC8 A;  2GH7 A;  1P6P A;  2IFB A;  4EDE A;  2PY1 A;  3RE5 A;  3P6G A;  4BX7 A;  1NQM A;  3O19 A;  5BVS A;  2F01 A;  4WHI A;  4GE1 A;  4A8Z A;  4QGV A;  1MEP A;  2NP1 A;  3T6L A;  4B55 A;  3ZUO A;  3ZWE A;  4TQ2 A;  4DNE A;  3EW2 A;  4FGI B;  1YWD A;  2JU8 A;  4IAB A;  4KII A;  4MIR A;  3S26 A;  2W2B A;  4BJ8 A;  4BQU A;  4U46 A;  1KL3 A;  4INN A;  3WZP A;  2QMI A;  4ZGF A;  1JBH A;  1I9H A;  1SXW A;  2ANS A;  1AQB A;  1NC9 A;  4YGH A;  2FR3 A;  5EDC A;  2JN3 A;  1ZNE A;  4YBU A;  4GDZ A;  4QNI A;  3UAQ A;  1SA8 A;  4XMD A;  1QG5 A;  4YKO A;  3WJE A;  3F8A A;  3ELZ A;  1RXK A;  1LUQ A;  1EUO A;  2AL0 X;  2OL7 A;  4OEM A;  3TGA A;  4ZHF A;  1SLF B;  3B2I A;  3D9W A;  3EYC A;  1MOY A;  2LBV A;  1ERB A;  4YCE A;  4ML7 B;  2CM9 A;  2X8T A;  4DQ4 A;  3WBG A;  1LIB A;  1RST B;  4AZP A;  4GD9 A;  1KL4 A;  3S5X A;  3BRN A;  3RKG A;  1KT7 A;  2OY1 O;  1WUB A;  5D48 A;  1QY2 A;  1HMT A;  1VWC B;  3OJY C;  4KCA A;  4QAE A;  1LCZ A;  4ZH9 A;  2AVI A;  4GJV A;  5IRU A;  5IXG A;  2IZL B;  5EZ2 A;  1IKJ A;  5IO5 A;  1VWR B;  2LBA A;  1OEE A;  1GKA B;  2RTE B;  3N91 A;  4U8U M;  1RSU B;  3K3L A;  2WQA E;  3HWD A;  3PQS A;  4GK9 A;  3I17 A;  1SWQ A;  4MEE A;  2X56 A;  2JMB A;  1EXS A;  2C1Q A;  3CWK A;  1DZJ A;  1VWE B;  2C4I A;  2F09 A;  1GGL A;  5F2B A;  1OEJ A;  4GGZ A;  5F6B A;  5B2A O;  2OVE A;  4CPH A;  1DZK A;  3RDM A;  4CDE A;  1QAB E;  5CYB A;  2RQ0 A;  1VWJ B;  1X8Q A;  4OS8 A;  1AVG I;  4QZT A;  2RTJ A;  5FEN A;  2FWV A;  3P6C A;  2VFB A;  1VWI B;  1R0U A;  1KFF A;  1W5R A;  3LTW A;  1HQQ A;  1SLD B;  1VYG A;  4NP1 A;  4O4U A;  5LJC A;  2AT5 X;  1LPJ A;  1E2T A;  1SWC A;  1OBQ A;  1SWH A;  1ZNG A;  2QO5 A;  1BSQ A;  3UEV A;  3WJD A;  1BLR A;  1OEK A;  4FBR A;  1SWO A;  4ZHD A;  1MX7 A;  1EPB A;  3ZZV A;  3I0A A;  1ZNL A;  1FTP A;  2ACP X;  3PEC A;  4JNJ A;  4KH8 A;  3JSQ A;  1WBI A;  2A2U A;  4N7D A;  1SMP I;  5B11 O;  5HZ5 A;  1S2P A;  4I9R A;  1CJ5 A;  4OKA A;  2Q39 A;  1ALB A;  4LKT A;  5L8I A;  3SZJ A;  2HLV A;  5HCD C;  3PED A;  3STN A;  1FEM A;  2KD2 A;  4OS0 A;  1VWL B;  5HCE C;  3CKF A;  2LB6 A;  3Q34 A;  1VWP B;  2AKQ A;  5JD2 A;  1IW2 A;  3D4R A;  1KT5 A;  2F73 A;  1SXU A;  1U18 A;  2FHN X;  2YG2 A;  1LCW A;  3NX2 A;  1KOI A;  3PDF A;  4N7C A;  3HWE A;  1VWG B;  5EEE A;  1PEE A;  2Q4N A;  2KTS A;  2GTL M;  3WJG A;  4GKC A;  1BWY A;  1STP A;  3AKM A;  4CPE A;  1U0X A;  1SXX A;  1QFT A;  2WWP A;  2WEW A;  2JOZ A;  3P02 A;  2Q2P A;  3BLG A;  1OPA A;  4R0B A;  5CHK A;  3RDS A;  4XMF A;  3FID A;  1NBX A;  2ALL X;  5F6Z A;  3VE1 A;  2YMS A;  3WZN A;  1E5P A;  3PK2 A;  2K23 A;  4CPF A;  1ICM A;  1ZRY A;  5LJK A;  1SLE B;  3IA8 A;  3FEL A;  2AT3 X;  3APV A;  3FMZ A;  3VGW A;  2POA A;  1GKA A;  1B56 A;  2OF8 A;  2OFB A;  2RTD B;  1G74 A;  4XMC A;  1DF8 A;  1SWG A;  1SWJ A;  5HWZ A;  3C77 X;  2A8G A;  1T8V A;  1LID A;  5D45 A;  3FW4 A;  1G7N A;  4L1N A;  4QRL A;  3OD9 A;  2FRS A;  1LEL A;  3O2Y A;  3SLJ A;  3WZQ A;  3C78 X;  3QQ2 A;  3FR2 A;  1B8E A;  1SWK A;  1SWT A;  4Z2V A;  5K67 A;  1YP7 A;  4TLJ A;  4Y0S A;  5HTD A;  5H9K A;  4CK4 A;  4CPH B;  1KXO A;  3P6H A;  5B27 A;  3RBY A;  5K06 A;  1VWM B;  3EBW A;  5HCC C;  3TGB A;  1I05 A;  3RY1 A;  4NLJ A;  4ZGU A;  5IO7 A;  5D8J A;  1Y53 X;  3E3C A;  3VG2 A;  3MX7 A;  4OS3 A;  5HA1 A;  4AZQ A;  3TZS A;  5B3M O;  4AZM A;  3MVF A;  2R56 A;  4JHQ A;  3WYP A;  1PMP A;  3TF6 A;  3NP1 A;  5EPQ A;  2RTG B;  4YFR A;  2FT9 A;  2HMB A;  3UEX A;  2HZR A;  1QY1 A;  1OBP A;  2Q2M A;  2C1S A;  3OE3 A; 
#chains in the Genus database with same CATH homology
 3HTY A;  1BEB A;  1B4M A;  5JR8 A;  1D2U A;  4M7M A;  4YFP A;  4Y0P A;  1YUP A;  1YP6 A;  4IMN A;  4ZHG A;  4RUU A;  4NLI A;  1ERX A;  2A3F X;  2CZT A;  1XKI A;  5BYP A;  1GXA A;  1SY1 A;  4NYQ A;  1X8N A;  3NBX X;  5C0N A;  2R73 A;  3P6F A;  5FAZ A;  3RZY A;  4HFO A;  3KFG A;  5AQ6 A;  1FE3 A;  5DG4 A;  1VYF A;  3S60 A;  4XME A;  1AB0 A;  3CMP A;  1O1U A;  3P6E A;  3PH6 A;  4XMH A;  3FA8 A;  2LA7 A;  3KQ0 A;  4ON1 A;  4I6S A;  4Y0R A;  3BY0 A;  4GNW A;  4HPB A;  4KT5 A;  1ML7 A;  3HWF A;  3NQ3 A;  5H9N A;  1EW3 A;  3ZW1 B;  4L3R A;  4HPA A;  4Y0Q A;  4NNT A;  4NYR A;  1FEL A;  1QFV A;  4O49 A;  4IB9 A;  1GT1 A;  3FW5 A;  1B0O A;  1DC9 A;  1T0V A;  3EBK A;  4IB7 A;  1EIO A;  3L4R A;  3BU1 A;  1KGL A;  4GNY A;  1JZU A;  2W2F A;  3PPT A;  3G7X A;  3HOL A;  3VG5 A;  3VU1 A;  1D3S A;  4GRJ A;  4I3D A;  5L8O A;  3DTQ A;  2QO6 A;  3CBS A;  1KZX A;  1TVQ A;  5D4A A;  3WOV A;  1A18 A;  4TKH A;  3TGC A;  1KT3 A;  2MJI A;  2KW1 A;  2X46 A;  4QYN A;  5LKF A;  4ZFX A;  4ORW A;  2QOS C;  5HZQ A;  3WVM A;  1ZNH A;  2Z4H A;  4NW4 A;  1OBU A;  2CZU A;  4ZH6 A;  2HNX A;  4WFV A;  3WJB A;  1FEN A;  5HBS A;  4BVM A;  2MM3 A;  4YMY A;  1DFV A;  4FBO A;  2OZQ A;  3KFI A;  2HZQ A;  1H91 A;  4CV7 A;  5HZ8 A;  3HK1 A;  4HPC A;  4A1H A;  1DZP A;  5HA0 A;  1TOU A;  2AT8 X;  2BS5 A;  2AMM X;  2G79 A;  1KT4 A;  1N0S A;  2CBS A;  3B2J A;  2AT0 X;  1HQP A;  2ZAI A;  4GET A;  4PJ2 A;  4U8U N;  1BSY A;  3FA9 A;  4YGZ A;  5EED A;  1Z24 A;  1PBO A;  5KIC A;  1IKE A;  4MIS A;  4ZR2 A;  3APX A;  3FEN A;  1KT6 A;  1NGL A;  4O3X B;  1EI5 A;  2RA6 A;  4DQ3 A;  2HYS A;  2OVA A;  1MX8 A;  3D96 A;  4ES7 A;  1ZNK A;  5FQ8 E;  5FQ6 E;  4LZV A;  1URE A;  2WUT A;  4U8U O;  1IFC A;  2MWH A;  1GM6 A;  4WBK A;  3AKN A;  3D97 A;  3VG3 A;  4EEJ A;  2WEX A;  2OVS A;  2E4J A;  4I95 A;  2G7B A;  3ZW1 A;  4ORS A;  3ZUI A;  3RWX A;  1TXL A;  3NQK A;  2OFR X;  1ZND A;  1SY3 A;  5H8T A;  1G5W A;  3T1D A;  1YIV A;  1HMR A;  4MVE A;  4QQ1 A;  4TKB A;  3S5V A;  4YBP A;  3LHN A;  4YH0 A;  3VG6 A;  4OMX A;  5KHP A;  2GC9 A;  2A13 A;  1SY2 A;  1KQX A;  2BLG A;  4IB8 A;  2EU7 X;  1GT5 A;  1A3Y A;  3VPJ E;  1JJX A;  3PH5 A;  1GX9 A;  3CBC A;  1CBI A;  1DV9 A;  4ORX A;  4ORY A;  2BT9 A;  4MVK A;  1BRQ A;  4UU2 A;  1YWB A;  3IFB A;  2MHD A;  4AYH A;  2BS6 A;  1DZM A;  2GTL N;  4ZJ0 A;  3BX8 A;  3Q6L A;  1LKE A;  4MVI A;  4YCH A;  5F7G A;  2QO4 A;  1MUP A;  3VG7 A;  2G78 A;  3B2K A;  1JIW I;  4ORR A;  4QGW A;  3NPO A;  4GZV A;  3HOE A;  4O4X A;  4GH7 A;  4FQB B;  3U0D A;  5D47 A;  5HZ9 A;  4OMW A;  4D6B A;  3H3I A;  2GTL O;  3V8U A;  3FR5 A;  1GT4 A;  5AJC A;  1CBR A;  2L5P A;  3D95 A;  1I06 A;  2N93 A;  5LJE A;  4AZR A;  3F6Z B;  3FA6 A;  1TW4 A;  2CBR A;  3FYF A;  5AEO A;  5BVT A;  5LKE A;  1X71 A;  3RSW A;  3WXQ A;  4IB6 A;  4O3Y A;  4YDB A;  3C76 X;  4ID2 A;  1L6M A;  4YKM A;  5H9A A;  4LKP A;  4ZHC A;  1S44 A;  2RD7 C;  3CR6 A;  4YGG A;  3FEP A;  1Y9L A;  1JV4 A;  4HWM A;  3FA7 A;  4AZO A;  1YWC A;  4JGL A;  1LNM A;  3KFH A;  1E02 A;  4FBV A;  4U3Q A;  5KID A;  1MDC A;  3GAQ A;  3U9P C;  2L9C A;  3FR4 A;  1BJ7 A;  3EM0 A;  5LJH A;  1BRP A;  1UZ2 X;  1IFB A;  3U03 A;  1KQW A;  1E06 A;  2R74 A;  4EFG A;  3FLL A;  1LIE A;  4QZU A;  4I9S A;  1HN2 A;  1ACD A;  3O22 A;  2JU3 A;  2OFM X;  3OBL A;  4LZU A;  4NNS A;  3CQN A;  2MO5 A;  1QWD A;  2ACO A;  2AT6 X;  3NR3 A;  2L68 A;  1EPA A;  1ICN A;  5L8I A;  4I3C A;  2LBV A;  1LF7 A;  3SOT A;  2Q9S A;  5HZ6 A;  2KTD A;  5IO6 A;  1OPB A;  2O62 A;  3GE2 A;  2NNE A;  3HWG A;  3WJC A;  1TOW A;  4TKJ A;  4CSB A;  3APW A;  3BU9 A;  4EXZ A;  3BS2 A;  1RBP A;  1CBS A;  5LJD A;  3ZQ3 A;  2JU7 A;  1QQS A;  1QY0 A;  2RN4 A;  3UEU A;  2RCQ A;  1JYD A;  2QM9 A;  2KT4 B;  4O3W A;  4ODD A;  4TJZ A;  5F58 A;  4ALB A;  1EII A;  4LQZ A;  1HBQ A;  2OVD A;  3EMM A;  4WFU A;  1GT3 A;  3BDR A;  2FLJ A;  4A1Y A;  1BBP A;  4ZCB A;  4O4O A;  4YFQ A;  1EAL A;  3PP6 A;  1G85 A;  4EQA C;  4PSQ A;  5H9L A;  5HTE A;  1FDQ A;  2K62 A;  5DPQ A;  2WR6 A;  3UEW A;  1X8O A;  3ZW0 A;  1CBQ A;  3SAO A;  2W2A A;  5HAE A;  4RUN A;  2NNQ A;  2NND A;  4GU8 A;  2RCT A;  4O3Z A;  2ZAG A;  1SY0 A;  1I4U A;  3JQO A;  4YDA A;  1HMS A;  4COT A;  4AW8 A;  1X8U A;  1KZW A;  3NAD A;  5F1E A;  2X45 A;  3VG4 A;  1CRB A;  2A2G A;  1DF3 A;  2FR2 A;  1PM1 X;  5B29 A;  2WSJ A;  3BX7 A;  4U9C A;  5EDB A;  4ALO A;  2AH7 X;  4ZHH A;  2FS7 A;  5LJB A;  1T68 X;  1NP4 A;  2FTB A;  2WQ9 A;  3KFF A;  3MBT A;  2LFO A;  5AJB A;  4A60 A;  3FIQ A;  4IMO A;  5LJG A;  1GX8 A;  3F9D A;  2XKL A;  1LFO A;  1BM5 A;  2CM4 A;  1NP1 A;  1A2D A;  1VPR A;  2JW1 A;  3DSZ A;  3NQ9 A;  4I3B A;  4BOE A;  1X8P A;  5FFH A;  3ZI8 A;  1I04 A;  3WJF A;  1Y9T A;  2A0A A;  3P6D A;  1LIC A;  4XMG A;  4AZN A;  2L67 A;  1XCA A;  2BHV A;  3BSZ E;  1EQD A;  4UU3 A;  4ARH A;  1JYJ A;  2M4L A;  3P24 A;  1E00 A;  3STK A;  1U17 A;  3B2H A;  1S7D A;  1SXY A;  2DM5 A;  3QKG A;  1A57 A;  3NX1 A;  4TNN A;  2GTF X;  5FQ7 E;  2XST A;  4ORU A;  3CQR A;  1X89 A;  4D6A A;  3FEK A;  2X8F A;  1LIF A;  3APU A;  1MVG A;  1AEL A;  3ZW2 A;  5BVQ A;  4M6S A;  1JJJ A;  4QYP A;  3JS1 A;  1RLB E;  2FS6 A;  1O1V A;  3B2L A;  2Z4I A;  4HPD A;  2ASN X;  1BSO A;  2X8S A;  3LV4 A;  1O8V A;  2GJ5 A;  2LKK A;  4O9S A;  5L8N A;  1IIU A;  4IBA A;  4KC7 A;  3VE2 A;  3STM X;  3KZA A;  4IAX A;  2P8G A;  4O4S A;  4QGX A;  3ZW0 B;  4MVL A;  4IAW A;  3ELX A;  1YWA A;  1ADL A;  3PQU A;  4K19 A;  1HBP A;  4KC8 A;  1P6P A;  2IFB A;  4EDE A;  2PY1 A;  3P6G A;  3O19 A;  5BVS A;  4WHI A;  4GE1 A;  4A8Z A;  4QGV A;  2NP1 A;  3ZUO A;  3ZWE A;  4TQ2 A;  4FGI B;  1YWD A;  2JU8 A;  4IAB A;  4KII A;  4MIR A;  3S26 A;  2W2B A;  4BQU A;  4INN A;  2QMI A;  4ZGF A;  1JBH A;  2ANS A;  1SXW A;  1AQB A;  4YGH A;  2FR3 A;  5EDC A;  2JN3 A;  1ZNE A;  4YBU A;  4GDZ A;  4QNI A;  3UAQ A;  1SA8 A;  4XMD A;  1QG5 A;  4YKO A;  3WJE A;  3F8A A;  3ELZ A;  1EUO A;  2AL0 X;  3TGA A;  4ZHF A;  3B2I A;  3EYC A;  1ERB A;  4YCE A;  4ML7 B;  2CM9 A;  2X8T A;  4DQ4 A;  3WBG A;  1LIB A;  4AZP A;  3S5X A;  3BRN A;  3RKG A;  1KT7 A;  5D48 A;  1QY2 A;  1HMT A;  4KCA A;  3OJY C;  4QAE A;  4ZH9 A;  5EZ2 A;  1IKJ A;  5IO5 A;  2LBA A;  1OEE A;  1GKA B;  3N91 A;  4U8U M;  3K3L A;  2WQA E;  3HWD A;  3PQS A;  4GK9 A;  3I17 A;  2JMB A;  1EXS A;  3CWK A;  1DZJ A;  5F6B A;  2F09 A;  1GGL A;  1OEJ A;  2OVE A;  1DZK A;  1QAB E;  5CYB A;  2RQ0 A;  1X8Q A;  4QZT A;  4OS8 A;  1AVG I;  5FEN A;  2FWV A;  3P6C A;  1R0U A;  1VYG A;  4NP1 A;  4O4U A;  5LJC A;  2AT5 X;  1LPJ A;  3WJD A;  1OBQ A;  1ZNG A;  1BLR A;  2QO5 A;  1BSQ A;  3UEV A;  1OEK A;  4FBR A;  4ZHD A;  1MX7 A;  1EPB A;  3ZZV A;  3I0A A;  1ZNL A;  1FTP A;  2ACP X;  3PEC A;  4KH8 A;  3JSQ A;  2A2U A;  4N7D A;  1SMP I;  5HZ5 A;  1S2P A;  4I9R A;  1CJ5 A;  2Q39 A;  1ALB A;  4LKT A;  2HLV A;  5HCD C;  3PED A;  3STN A;  1FEM A;  2KD2 A;  4OS0 A;  5HCE C;  2LB6 A;  2AKQ A;  1IW2 A;  3D4R A;  1KT5 A;  2F73 A;  1SXU A;  1U18 A;  2YG2 A;  5CE4 A;  3NX2 A;  1KOI A;  4N7C A;  1PEE A;  3HWE A;  5EEE A;  2Q4N A;  2KTS A;  2GTL M;  3WJG A;  4GKC A;  1BWY A;  3AKM A;  1U0X A;  1SXX A;  1QFT A;  2WWP A;  2WEW A;  2JOZ A;  3P02 A;  2Q2P A;  3BLG A;  1OPA A;  4R0B A;  4XMF A;  2ALL X;  5F6Z A;  3VE1 A;  2YMS A;  1E5P A;  2K23 A;  1ICM A;  1ZRY A;  5LJK A;  3IA8 A;  3FEL A;  2AT3 X;  3APV A;  3FMZ A;  2POA A;  1GKA A;  1B56 A;  1G74 A;  4XMC A;  5HWZ A;  3C77 X;  1T8V A;  1LID A;  5D45 A;  3FW4 A;  1G7N A;  4L1N A;  4QRL A;  3OD9 A;  2FRS A;  3O2Y A;  3C78 X;  3FR2 A;  1B8E A;  1YP7 A;  4TLJ A;  4Y0S A;  5HTD A;  5H9K A;  4CK4 A;  1KXO A;  3P6H A;  5B27 A;  3RBY A;  5K06 A;  3EBW A;  5HCC C;  3TGB A;  1I05 A;  4NLJ A;  4ZGU A;  5IO7 A;  5D8J A;  3E3C A;  3VG2 A;  3MX7 A;  4OS3 A;  5HA1 A;  4AZQ A;  3TZS A;  4AZM A;  3MVF A;  2R56 A;  1PMP A;  3TF6 A;  3NP1 A;  5EPQ A;  4YFR A;  2FT9 A;  2HMB A;  3UEX A;  2HZR A;  1QY1 A;  1OBP A;  2Q2M A;  3OE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...