3TGAA

Crystal structure of l130r mutant of nitrophorin 4 from rhodnius prolixus at ph 7.4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
184
structure length
184
Chain Sequence
ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDRGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Guanidine-Ferroheme Coordination in the Mutant Protein Nitrophorin 4(L130R).
pubmed doi rcsb
molecule keywords Nitrophorin-4
source organism Rhodnius prolixus
molecule tags Metal binding protein
total genus 52
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3tgaA00
3STMX 1X8QA 1KQXA 4GNWA 3CR6A 3I0AA 5HZ9A 3APWA 1BRPA 4QYPA 1EIOA 4TNNA 1JYJA 1KT4A 1KT5A 1LPJA 1BSYA 2RD7C 3HWDA 4LKTA 3ZUOA 3SAOA 1KT7A 1LIFA 2G7BA 1BEBA 3FA6A 3NX2A 1TW4A 5B27A 4YFRA 1NP4A 2KT4B 3MVFA 5D8JA 4O9SA 4QYNA 4A1YA 1O8VA 1QY2A 1S44A 2CM9A 2HLVA 3QKGA 2L68A 4EXZA 3PH6A 3BS2A 5F58A 2IFBA 1E02A 3C78X 1LIDA 3HWGA 2LKKA 4NYQA 3WJGA 1ICMA 4GKCA 3FEPA 1G7NA 3PPTA 2QO5A 1X89A 1X8PA 2AL0X 2YG2A 3WJDA 1EALA 1DFVA 1YP6A 2Q39A 3HK1A 3PH5A 4LKPA 2QO6A 4ARHA 4BQUA 1MX7A 2FRSA 4YBPA 3B2JA 1HMRA 2EU7X 3BU1A 1PM1X 4OMWA 3DTQA 2JN3A 1DV9A 3IFBA 1BSOA 4AZPA 3NADA 3TF6A 1OEKA 5BVTA 2O62A 1ERBA 1CBRA 1IKJA 4YGZA 5KHPA 2JU8A 3UEXA 1OBUA 1PEEA 3B2HA 4YFPA 1I06A 1LKEA 1HBPA 2CZUA 1ZNHA 4MVLA 3O22A 3KFGA 1T8VA 4QGVA 1QY0A 1HN2A 1P6PA 3O2YA 4WFVA 1JV4A 4QAEA 5LKFA 4QGXA 3B2IA 3EBWA 1IW2A 3BU9A 2F73A 3CMPA 4HPAA 3L4RA 3O19A 4YCEA 2LFOA 5IO5A 4Y0RA 2AH7X 3WJEA 2AT5X 3WVMA 3FA8A 1YP7A 2FT9A 5HZQA 4NP1A 4TKJA 5LJBA 4OS3A 4IAXA 1A2DA 3EYCA 1YIVA 4Y0SA 1EPAA 2RCTA 1S7DA 2WWPA 2NNQA 1YWDA 4RUNA 2NP1A 2W2FA 1OPAA 3NQ9A 4HPDA 1GGLA 1KQWA 1GT4A 5L8NA 1SXUA 2FS6A 5HCEC 3KFFA 4YBUA 3P6GA 3PEDA 3EMMA 5F6ZA 5K06A 3NPOA 1SY1A 3K3LA 4XMDA 5BVSA 1B56A 1HMTA 1UZ2X 4EDEA 2WQAE 1XCAA 2POAA 2FR2A 4M6SA 5FENA 2E4JA 2ACOA 4BOEA 4ZHCA 5LJEA 5LJHA 2DM5A 4WBKA 2CBRA 1I4UA 2Q4NA 2R56A 1T0VA 1KOIA 2GTFX 1G5WA 4I9SA 4NNTA 3JSQA 1FENA 2JU7A 5HBSA 2LB6A 4K19A 3OJYC 3FW4A 1B0OA 5D4AA 3BDRA 5IO6A 1TVQA 2WEXA 1D2UA 1LF7A 2PY1A 4IBAA 1ZNLA 1VPRA 4GH7A 1DZMA 1BM5A 2FLJA 4AZMA 4HFOA 3BRNA 5L8IA 4UU2A 2WQ9A 3U9PC 1HQPA 1QFTA 4ZH9A 1AVGI 2OFRX 3NQ3A 2FS7A 2GC9A 2JOZA 1DZKA 1G85A 5HWZA 3C77X 2XSTA 4XMCA 4ALOA 1EQDA 2CBSA 2KTDA 1R0UA 4MVIA 1FE3A 1NP1A 3NP1A 4YMYA 1KZWA 1G74A 5LKEA 4GE1A 5DG4A 1TOWA 4QZUA 3Q6LA 4ORYA 1EUOA 1YWAA 3RSWA 5HCDC 2ACPX 1E00A 5HZ5A 1JJXA 3VG7A 5DPQA 4WFUA 1JJJA 2AKQA 1H91A 5EEDA 3D96A 4ZHDA 2BLGA 1U18A 4N7DA 1PBOA 4YGHA 1SY0A 3APVA 3B2KA 3BLGA 3GAQA 3KZAA 2OVAA 3RZYA 2FR3A 3VG5A 1AB0A 2HYSA 4M7MA 1KT6A 3KFHA 3FA9A 3ZUIA 4I3BA 1GKAB 3WJCA 1OEJA 1NGLA 1SY3A 4GETA 4NNSA 3VG2A 1CBQA 4R0BA 1DZPA 1MVGA 5HTDA 4TLJA 2FWVA 5D48A 2HZQA 2WEWA 1VYGA 4IMOA 3BX7A 5KICA 3U03A 2WSJA 4A1HA 3P6FA 5H9AA 4IB6A 2P8GA 4XMHA 4YKOA 1MDCA 3VG6A 4XMEA 2MJIA 4YGGA 4AW8A 4ORSA 4A8ZA 4AZRA 1GT5A 2W2AA 2R74A 2X45A 1E5PA 1JYDA 1DZJA 2JU3A 5B29A 2ALLX 4ZR2A 4DQ3A 1X8NA 2X46A 4DQ4A 1LIEA 2NNEA 4ZJ0A 3UEWA 3DSZA 3FMZA 1IIUA 1IFCA 1QWDA 3AKMA 3JS1A 5F7GA 3G7XA 3FLLA 1HMSA 2AT6X 2RA6A 4GNYA 4I9RA 1O1UA 4ZCBA 1GT3A 5LJKA 4LZVA 1U17A 1N0SA 3ELZA 4HPBA 2Q9SA 3UEVA 3CWKA 3F8AA 4YDBA 1YWBA 1LFOA 5EDBA 5C0NA 1EW3A 1FEMA 1QG5A 2A2GA 2AMMX 2HZRA 1L6MA 3WJBA 1YUPA 5F6BA 5H9LA 1BJ7A 4BVMA 3STKA 2R73A 1X71A 2AT0X 4YFQA 5KIDA 3FEKA 1GXAA 5JR8A 4HPCA 1BWYA 5D47A 5H9KA 1DF3A 3HWEA 1QQSA 4AYHA 4D6BA 1FDQA 1GT1A 5HZ6A 4AZQA 4TJZA 3T1DA 3CQRA 4IB9A 3BX8A 1ZNDA 3ELXA 5HZ8A 1A18A 1D3SA 2WR6A 3KFIA 1SXWA 3KQ0A 1MX8A 3TGBA 4ORXA 1ALBA 3C76X 2XKLA 1ZRYA 1I04A 1OEEA 4N7CA 5BVQA 1YWCA 1BSQA 4NLIA 5EDCA 4A60A 1OBPA 3VG3A 1DC9A 3PECA 5LJGA 3FR2A 2LBAA 3MBTA 3FA7A 2N93A 4YKMA 4TKBA 3NX1A 4QGWA 1GX8A 1U0XA 3APXA 3D95A 3P6EA 1Z24A 4ZHGA 4EFGA 4TQ2A 2K23A 1A3YA 1BLRA 3HWFA 1CJ5A 1GX9A 3APUA 4D6AA 3FW5A 5AQ6A 1OBQA 2RQ0A 4OS0A 3CQNA 3FR4A 1S2PA 1EIIA 1CRBA 1OPBA 4OMXA 4YH0A 4ORWA 5FFHA 3EM0A 4XMGA 4Y0PA 5HAEA 1FELA 2OVDA 1X8UA 2L9CA 2AT8X 2OFMX 1HBQA 1QY1A 1SA8A 4ZHHA 2K62A 1ML7A 2ASNX 5LJDA 1ICNA 1SXYA 3P6CA 3FR5A 1EPBA 2G79A 3F9DA 5H9NA 1B8EA 5FAZA 3FIQA 4MVKA 3FENA 2MM3A 3VG4A 4YCHA 1GM6A 1ZNGA 2Q2MA 4AZOA 3WBGA 1VYFA 1TOUA 2W2BA 1XKIA 1ADLA 2MO5A 1X8OA 1B4MA 4ORUA 3CBCA 2NNDA 3UEUA 1ZNKA 2G78A 1TXLA 2A3FX 3CBSA 3TGCA 2FTBA 4ALBA 4IB8A 4XMFA 4YDAA 3D97A 1EXSA 5HA0A 5L8OA 1PMPA 3P6DA 4Y0QA 3I17A 1T68X 1KXOA 3AKNA 4NLJA 1JZUA 2CZTA 3FELA 1I05A 2RCQA 1BRQA 1RBPA 4QZTA 2GJ5A 1MUPA 4PSQA 2WUTA 2AT3X 1A57A 2QO4A 2A13A 2CM4A 2L67A 5LJCA 1O1VA 1ZNEA 4CK4A 4KIIA 2HNXA 4IAWA 4OS8A 2HMBA 4I3CA 4ZH6A 3U0DA 4AZNA 4ZFXA 1ERXA 1SY2A 3EBKA 1QFVA 1KT3A 3S26A 4ZGUA 1CBIA 4I3DA 1AQBA 3TGAA 3IA8A 5F1EA 2A2UA 3STNA 4TKHA 1CBSA 3WXQA 1RLBE 3WJFA 4ES7A 5HTEA 4GRJA 1QABE 3P6HA 1JBHA 1IFBA 3B2LA 1LIBA 5EPQA 1ACDA 1KZXA 4ODDA 5CE4A 5HA1A 4ORRA 3TZSA 4LZUA 2OZQA 5EZ2A 5H8TA 2LBVA 3BSZE 1IKEA 1LICA 4IMNA 2OVEA 3ZQ3A 4ZHFA 2ANSA 1BBPA 1UREA 4EEJA 1GKAA 2A0AA 1LNMA 3BY0A 1E06A 4IB7A 4UU3A 4NYRA 2L5PA 2QOSC 3PP6A 1KGLA 5HCCC 2QM9A 5EEEA 1FTPA 2Q2PA 3NR3A 1SXXA 1AELA 5D45A 5IO7A 4RUUA
chains in the Genus database with same CATH superfamily
1VWFB 3STMX 1X8QA 1KQXA 4GNWA 3CR6A 2MHDA 3I0AA 5HZ9A 3APWA 4JHQA 1BRPA 4QYPA 1EIOA 4TNNA 4C5PA 1KL4A 1JYJA 1KT4A 1KT5A 1LPJA 1BSYA 2RD7C 3HWDA 4LKTA 2Y3EA 2RTBB 3ZUOA 4Z6JA 3SAOA 1KT7A 1LIFA 2G7BA 1BEBA 3FA6A 3NX2A 1TW4A 5B27A 4YFRA 1NP4A 2KT4B 3MVFA 3OD9A 5D8JA 4O9SA 4QYNA 4A1YA 1O8VA 1QY2A 1S44A 2CM9A 2FHLA 2HLVA 2L68A 3EW1A 3QKGA 1SWGA 3BS2A 3PH6A 5F58A 2IFBA 3HTYA 1E02A 3C78X 1LIDA 3HWGA 2LKKA 4NYQA 4QQ1A 1OSPO 3WJGA 3SZHA 5B2AO 1ICMA 4GKCA 2PI3O 4FBRA 2ZAGA 5AEOA 2X56A 3PK2A 4GZVA 3SLOA 3FEPA 1G7NA 5IRAA 1N7YA 1N9MA 1WUBA 1SWTA 4NV8A 1NBXA 2CAMA 3PPTA 1RSUB 1W5RA 1X89A 1X8PA 2AL0X 2C1QA 2QO5A 2YG2A 3SOTA 3WJDA 2WPUA 1EALA 4BX5A 1DFVA 1YP6A 2RTHB 3WYPA 2Q39A 3HK1A 3PH5A 4LKPA 1STSB 1SWSA 2QO6A 1I9HA 4ARHA 4BQUA 1MX7A 2FRSA 4YBPA 4GU8A 2BT9A 3B2JA 1HMRA 4O3WA 2EU7X 3BU1A 1JMXA 1PM1X 4OMWA 1Y9LA 3DTQA 2IZCB 2JN3A 1JQPA 4GD9A 3RDQA 5FQ7E 4KCAA 1AVDA 4BX7B 2VDFA 1DV9A 3IFBA 3VE1A 1BSOA 2RN4A 4AZPA 3NADA 4GJVA 3TF6A 1OEKA 5BVTA 2O62A 2RTMA 1VWOB 1VWGB 1N4JA 1ERBA 1E2TA 3D9WA 1CBRA 1IKJA 4YGZA 1SWAA 5KHPA 3RDMA 2MF6A 2JU8A 3UEXA 1OBUA 1PEEA 2VFCA 3B2HA 5CHKA 1PTSA 4YFPA 1I06A 1LKEA 1HQQA 1HBPA 2CZUA 2F09A 1ZNHA 2OY8A 4MVLA 2OVSA 3O22A 3KFGA 4CDDA 1T8VA 2ZSCA 4QGVA 1QY0A 1HN2A 3WOVA 1P6PA 2OL8O 1VWKB 3O2YA 4WFVA 3VHIA 5IXGA 3H3IA 3T2XA 1JV4A 3PDFA 1SREA 4U8UN 4ID2A 4QAEA 5LKFA 1VWAB 4QGXA 3B2IA 3JQOA 4GGZA 1SWJA 1IW2A 3EBWA 4KT5A 3BU9A 2F73A 3EW2A 3CMPA 3RDUA 3S60A 4HPAA 3L4RA 3O19A 4IABA 1IJ8A 1UYNX 2LFOA 4YCEA 4BJ8A 4Y0RA 2AH7X 1VYOA 3WJEA 5IO5A 1SRHA 2AT5X 3WVMA 3FA8A 1YP7A 1RXHA 2FT9A 2OY7A 5HZQA 4NP1A 4TKJA 5LJBA 4OS3A 4IAXA 4CPHB 1A2DA 3PQUA 3EYCA 1YIVA 1LCZA 1EPAA 4Y0SA 2RCTA 1S7DA 2WWPA 2NNQA 1YWDA 4RUNA 4Z28A 2NP1A 2W2FA 1OPAA 3NQ9A 4HPDA 1GGLA 1KQWA 1GT4A 4OELA 5L8NA 1SXUA 2FS6A 5HCEC 5FQ8E 3KFFA 4YBUA 3P6GA 4O4SA 3WYQA 3PEDA 4KC7A 3EMMA 5F6ZA 3UAQA 2RTLA 2X55A 4Y5DA 5IRUA 5K06A 3NPOA 1SY1A 1VWBB 2RTEB 1SWFA 3K3LA 4XMDA 1B56A 5AJBA 5BVSA 1HMTA 1MK5A 1UZ2X 3P02A 5FQ6E 4EDEA 2WQAE 1XCAA 2POAA 2FR2A 2F01A 3RBYA 4M6SA 5FENA 2E4JA 2ACOA 4BOEA 4ZHCA 5LJEA 5LJHA 2DM5A 4WBKA 1JMZA 1VWQB 2CBRA 1I4UA 2Q4NA 2R56A 1T0VA 4GGTA 1KOIA 2GTFX 1G5WA 4I9SA 1I78A 4NNTA 3JSQA 1FENA 2JU7A 2HKDA 5HBSA 2LB6A 3HOLA 4K19A 4NW4A 3OJYC 5IO7A 3FW4A 5CSEA 3WZPA 1B0OA 4O4XA 4U3QA 5D4AA 3BDRA 3VHMA 4MIRA 1TVQA 2WEXA 3EC5A 1D2UA 2G8CO 3N91A 3RY2A 5IO6A 1LF7A 2PY1A 1SWRA 2IZKA 4IBAA 1NC9A 1ZNLA 1VPRA 4GH7A 1DZMA 1BM5A 2FLJA 4AZMA 4U9CA 4HFOA 3BRNA 2KW1A 5L8IA 1Y0GA 1GX3A 1Y9TA 4UU2A 4OKAA 2WQ9A 3U9PC 1HQPA 1QFTA 4ZH9A 1AVGI 2OFRX 3NQ3A 2FS7A 1SRGA 2GC9A 2JOZA 3ZW0B 1DZKA 1G85A 5HWZA 3C77X 3OE3A 2XSTA 4KH8A 4MISA 2OY1O 1EQDA 4XMCA 3RDXA 3S5VA 2CBSA 3QQ2A 2KTDA 1R0UA 1SMPI 4MVIA 1FE3A 1STPA 1NP1A 3NP1A 4YMYA 2BHVA 1KZWA 5AJCA 2QCBA 1G74A 5LKEA 3HOEA 2Z4HA 4GE1A 5DG4A 1TOWA 3ZWEA 4HWMA 4QZUA 4FBVA 3Q6LA 4I95A 4ORYA 2GTLM 1EUOA 4JNJA 1YWAA 3RSWA 5HCDC 2ACPX 1E00A 5HZ5A 1JJXA 1LDQA 3LTWA 2X8SA 3VG7A 1Y55X 2RTGB 4WFUA 5DPQA 1JJJA 2AKQA 1H91A 5EEDA 3D96A 3ZZVA 4ZHDA 2BLGA 1U18A 4N7DA 1LELA 1PBOA 4YGHA 1SY0A 3APVA 3CKGA 3B2KA 1SLDB 3BLGA 3GAQA 3KZAA 4KC8A 2OVAA 3RZYA 2FR3A 3VG5A 1AB0A 2IZGB 3F6ZB 4CPHA 2HYSA 3T2WA 4M7MA 3RWXA 4BBOA 1KT6A 2OFAA 4FBOA 2IZAA 3KFHA 4EQAC 3FIDA 1KL5A 2I5VO 3FA9A 2X32A 4I3BA 3ZUIA 4DCBA 1GKAB 2RTCB 3WJCA 1OEJA 4CPEA 1NGLA 3Q34A 1SY3A 4GETA 4NNSA 3VG2A 1CBQA 4R0BA 1DZPA 1MVGA 1SWHA 1SLGB 2IZJA 4TLJA 5HTDA 2FWVA 5D48A 2HZQA 2WEWA 1VYGA 4IMOA 3BX7A 2MWHA 5KICA 3U03A 5K68A 2WSJA 4A1HA 3P6FA 1N9YA 5H9AA 4IB6A 5B11O 2RTJA 2VFBA 2P8GA 4MVEA 4XMHA 4YKOA 3MX7A 1MDCA 3VG6A 4XMEA 2MJIA 4YGGA 4COTA 4AW8A 4ORSA 2IZIA 4A8ZA 4PJ2A 4AZRA 1GT5A 2W2AA 2R74A 2X45A 4YVBA 2OFBA 1E5PA 1JYDA 4GGRA 2BS5A 2RTFB 1DZJA 2JU3A 1SWDA 5B29A 2ALLX 3MM0A 4FQBB 4ZR2A 1VWHB 2GH7A 4DQ3A 4Z2VA 1X8NA 2LA7A 2X46A 4GK9A 4DQ4A 1LIEA 2NNEA 4ZJ0A 3UEWA 1W6FA 2RTDB 3DSZA 3FMZA 1IIUA 5F2BA 2Y3FA 1IFCA 1QWDA 2RTPB 3AKMA 3JS1A 5F7GA 3G7XA 3FLLA 1HMSA 2AT6X 2RA6A 5IRWA 4GNYA 4O3ZA 4I9RA 2IZDB 5BYPA 1O1UA 4GJSA 1GT3A 4ZCBA 5LJKA 4LZVA 4I6SA 2DJFA 4LQZA 4U8UM 1U17A 2UYWA 2JW1A 1N0SA 1Y52X 3ELZA 4HPBA 2Q9SA 3UEVA 3CWKA 3F8AA 4YDBA 3RE5A 1YWBA 5B5GA 1LFOA 5EDBA 5C0NA 3FDCA 1EW3A 1FEMA 1QG5A 2A2GA 2AMMX 2HZRA 1L6MA 3NQKA 3WJBA 4CPIA 1YUPA 5F6BA 5H9LA 1BJ7A 1SWLA 4BVMA 3STKA 3LV4A 2R73A 1X71A 2DJGA 2AT0X 4YFQA 1VWPB 4WHIA 5KIDA 3FEKA 1GXAA 1VWJB 4HPCA 5JR8A 2FGSA 1BWYA 5D47A 3AUMO 5H9KA 1DF3A 3HWEA 1QQSA 4AYHA 4D6BA 1FDQA 1GT1A 5HZ6A 4AZQA 4TJZA 3T1DA 1STRB 3CQRA 4IB9A 1AVEA 3BX8A 1ZNDA 3ELXA 5HZ8A 1A18A 1D3SA 3D4RA 2WR6A 1NQMA 1SXWA 3KFIA 3SLJA 3ZW1B 3KQ0A 1MX8A 3TGBA 4ORXA 1ALBA 3C76X 2XKLA 1ZRYA 1I04A 1OEEA 4N7CA 5BVQA 1MM9A 1YWCA 1BSQA 4NLIA 5EDCA 4A60A 4CSBA 1OBPA 3VG3A 1DC9A 3PECA 5LJGA 4BX7A 4CDCA 3FR2A 3VU1A 2LBAA 3MBTA 3FA7A 2N93A 4YKMA 4TKBA 3NX1A 4B55A 4QGWA 1GX8A 3VE2A 2OF9A 1LDOA 1LCWA 3NBXX 4EXZA 1VWLB 1U0XA 2FKJA 3APXA 2FKGA 3D95A 4I60A 4Z2OA 3P6EA 1Z24A 4ZHGA 4EFGA 3CKFA 4TQ2A 1VWNB 5HAEA 3ZI8A 4Z27A 2K23A 1A3YA 1BLRA 3HWFA 1VWIB 5B10O 2A5CA 3VHHA 1CJ5A 1GX9A 3APUA 4O3XB 1PBYA 4D6AA 3FW5A 5AQ6A 1OBQA 2AVIA 1HXLA 2RQ0A 4OS0A 2GTLN 1HY2A 3CQNA 3FR4A 1S2PA 4JGLA 4ZGFA 1CRBA 1OPBA 3T6FA 1EIIA 2BSZA 4IRWA 4OMXA 4YH0A 4NV7A 4ORWA 5FFHA 3EM0A 4XMGA 1K24A 4Y0PA 2UZ2A 1FELA 2OVDA 2X8FA 1X8UA 1LCVA 2AT8X 1HBQA 1QY1A 1SA8A 2L9CA 2OFMX 4ZHHA 2K62A 1ML7A 3WZOA 2ASNX 5LJDA 1W4TA 1ICNA 1SLEB 1SXYA 1KL3A 3P6CA 1K3BA 3FR5A 3HPEA 1EPBA 4MEEA 2QOMA 2G79A 3F9DA 5H9NA 1B8EA 5FAZA 3FIQA 4MVKA 3FENA 3V8UA 1LUQA 2MM3A 3ZW2A 4CDEA 3VG4A 2OL7A 1RXKA 4GDZA 4YCHA 1JIWI 1GM6A 1ZNGA 2FHNX 2Z4IA 3PQSA 2Q2MA 2IZEB 2RTOB 1WBIA 4AZOA 3WBGA 1VYFA 1TOUA 1JJUA 4OEMA 1KFFA 4CV7A 1SLFB 2W2BA 2OYBO 4ML7B 2M4LA 1XKIA 1ADLA 2BS6A 4CPFA 2AF5A 5LJCA 1N43A 2MO5A 3RE6A 1FJ1E 1X8OA 4ON1A 1VWEB 3MG5A 4ORUA 3CBCA 3RDOA 1B4MA 2NNDA 1SWKA 3SLTA 1SWNA 3UEUA 3VGWA 1ZNKA 2G78A 1TXLA 2A3FX 3CBSA 4O3YA 2FTBA 4DNEA 3TGCA 4ALBA 4IB8A 4XMFA 1VWDB 4YDAA 3D97A 1EXSA 3SZIA 1SWBA 2RTQB 5HA0A 5L8OA 4O49A 1PMPA 3P6DA 4Y0QA 1EI5A 3I17A 2KTSA 5CYBA 1T68X 3S5XA 1SRJA 2IZFB 3WZQA 1KXOA 1VWMB 3AKNA 4NLJA 2CZTA 2OF8A 3FELA 1JZUA 2GTLO 3P24A 4BX6B 1I05A 3T6LA 3FYFA 3ZW1A 2RCQA 1BRQA 1RBPA 4QZTA 2GJ5A 1MUPA 2C4IA 4PSQA 2QMIA 2WUTA 4FGIB 2AT3X 3AEHA 1A57A 5B5FA 2QO4A 2A13A 1RAVA 2CM4A 2L67A 1O1VA 1ZNEA 4CK4A 4JO6A 4EKVA 5L3YA 2A5BA 4KIIA 2HNXA 1NDJA 3GE2A 1SWPA 4IAWA 4OS8A 3VPJE 1SWEA 2YMSA 2HMBA 4I3CA 4L1NA 4ZH6A 3U0DA 5B3MO 4AZNA 4U46A 2RTAA 4ZFXA 1ERXA 3ZW0A 1SY2A 2A8GA 4BX5B 3EBKA 1QFVA 1KT3A 1SWQA 3S26A 4ZGUA 2OL6O 1CBIA 4I3DA 4BX6A 1AQBA 3TGAA 1MEPA 3IA8A 5F1EA 2A2UA 1RSTB 2ZAIA 3STNA 4TKHA 1CBSA 3WXQA 1RLBE 1Y53X 3WJFA 4ES7A 2IZHB 4L3RA 2I5ZO 4GRJA 5HTEA 2JGSA 2RTKA 4BCSA 1QABE 1DF8A 4Z2PA 3P6HA 3X00A 1NQNA 3WZNA 1JBHA 1IFBA 3B2LA 3RKGA 1LIBA 5EPQA 1ACDA 5K67A 1SRIA 4ODDA 1KZXA 5JD2A 4ALOA 3RY1A 3RDSA 1UYOX 3E3CA 5CE4A 1SWUA 1VWCB 4ORRA 5HA1A 3TZSA 2IZBA 2IZLB 4GUZA 4LZUA 4QNIA 2OZQA 5EZ2A 2C1SA 5H8TA 1SWOA 1SWCA 2KD2A 2LBVA 3BSZE 1IKEA 1LICA 2BC3A 2OVEA 1MOYA 2RTNB 2X8TA 4IMNA 3ZQ3A 1SRFA 4O4UA 4ZHFA 2ANSA 1BBPA 2JMBA 1UREA 2RTIB 4EEJA 1HXZA 2RTRB 3LHNA 1GKAA 2OY5O 2A0AA 4GDAA 1LNMA 3BY0A 1E06A 2X4MA 3OBLA 4IB7A 4UU3A 4NYRA 2L5PA 2QOSC 3KVNA 4CDFA 3PP6A 3SZJA 2X34A 1KGLA 1RXJA 5HCCC 2QM9A 4QRLA 5EEEA 1FTPA 2Q2PA 3NR3A 1SXXA 4INNA 2Y32A 4O4OA 4BGFA 1AELA 4U8UO 5D45A 2G5LA 1VWRB 4Y59A 4RUUA
chains in the Genus database with same CATH topology
3STMX 1X8QA 1KQXA 4GNWA 3CR6A 2MHDA 3I0AA 5HZ9A 3APWA 1BRPA 4QYPA 1EIOA 4TNNA 1JYJA 1KT4A 1KT5A 1LPJA 1BSYA 2RD7C 3HWDA 4LKTA 3ZUOA 3SAOA 1KT7A 1LIFA 2G7BA 1BEBA 3FA6A 3NX2A 1TW4A 5B27A 4YFRA 1NP4A 2KT4B 3MVFA 3OD9A 5D8JA 4O9SA 4QYNA 4A1YA 1O8VA 1QY2A 1S44A 2CM9A 2HLVA 3QKGA 2L68A 4EXZA 3PH6A 3BS2A 5F58A 2IFBA 3HTYA 1E02A 3C78X 1LIDA 3HWGA 2LKKA 4NYQA 4QQ1A 3WJGA 1ICMA 4GKCA 4FBRA 2ZAGA 5AEOA 4GZVA 3FEPA 1G7NA 3PPTA 2QO5A 1X89A 1X8PA 2AL0X 2YG2A 3WJDA 3SOTA 1EALA 1DFVA 1YP6A 2Q39A 3HK1A 3PH5A 4LKPA 2QO6A 4ARHA 4BQUA 1MX7A 2FRSA 4YBPA 4GU8A 2BT9A 3B2JA 1HMRA 4O3WA 2EU7X 3BU1A 1PM1X 4OMWA 1Y9LA 3DTQA 2JN3A 5FQ7E 4KCAA 1DV9A 3IFBA 3VE1A 1BSOA 2RN4A 4AZPA 3NADA 3TF6A 1OEKA 5BVTA 2O62A 1ERBA 1CBRA 1IKJA 4YGZA 5KHPA 2JU8A 3UEXA 1OBUA 1PEEA 3B2HA 4YFPA 1I06A 1LKEA 1HBPA 2CZUA 2F09A 1ZNHA 4MVLA 2OVSA 3O22A 3KFGA 1T8VA 4QGVA 1QY0A 1HN2A 3WOVA 1P6PA 3O2YA 4WFVA 3H3IA 1JV4A 4U8UN 4ID2A 4QAEA 5LKFA 4QGXA 3B2IA 3JQOA 3EBWA 1IW2A 4KT5A 3BU9A 2F73A 3CMPA 3S60A 4HPAA 3L4RA 3O19A 4IABA 4YCEA 2LFOA 5IO5A 4Y0RA 2AH7X 3WJEA 2AT5X 3WVMA 3FA8A 1YP7A 2FT9A 5HZQA 4NP1A 4TKJA 5LJBA 4OS3A 4IAXA 1A2DA 3PQUA 3EYCA 1YIVA 4Y0SA 1EPAA 2RCTA 1S7DA 2WWPA 2NNQA 1YWDA 4RUNA 2NP1A 2W2FA 1OPAA 3NQ9A 4HPDA 1GGLA 1KQWA 1GT4A 5L8NA 1SXUA 2FS6A 5HCEC 5FQ8E 3KFFA 4YBUA 3P6GA 4O4SA 3PEDA 4KC7A 3EMMA 5F6ZA 3UAQA 5K06A 3NPOA 1SY1A 3K3LA 4XMDA 5BVSA 1B56A 5AJBA 1HMTA 1UZ2X 3P02A 5FQ6E 4EDEA 2WQAE 1XCAA 2POAA 2FR2A 3RBYA 4M6SA 5FENA 2E4JA 2ACOA 4BOEA 4ZHCA 5LJEA 5LJHA 2DM5A 4WBKA 2CBRA 1I4UA 2Q4NA 2R56A 1T0VA 1KOIA 2GTFX 1G5WA 4I9SA 4NNTA 3JSQA 1FENA 2JU7A 5HBSA 2LB6A 3HOLA 4K19A 4NW4A 3OJYC 3FW4A 1B0OA 4O4XA 4U3QA 5D4AA 3BDRA 5IO6A 4MIRA 1TVQA 2WEXA 3N91A 1D2UA 1LF7A 2PY1A 4IBAA 1ZNLA 1VPRA 4GH7A 1DZMA 1BM5A 2FLJA 4AZMA 4U9CA 4HFOA 3BRNA 2KW1A 5L8IA 1Y9TA 4UU2A 2WQ9A 3U9PC 1HQPA 1QFTA 4ZH9A 1AVGI 2OFRX 3NQ3A 2FS7A 2GC9A 2JOZA 3ZW0B 1DZKA 1G85A 5HWZA 3C77X 3OE3A 2XSTA 4KH8A 4MISA 4XMCA 1EQDA 3S5VA 4ALOA 2CBSA 2KTDA 1R0UA 1SMPI 4MVIA 1FE3A 1NP1A 3NP1A 4YMYA 2BHVA 1KZWA 5AJCA 1G74A 5LKEA 3HOEA 2Z4HA 4GE1A 5DG4A 1TOWA 3ZWEA 4HWMA 4QZUA 4FBVA 3Q6LA 4I95A 4ORYA 2GTLM 1EUOA 1YWAA 3RSWA 5HCDC 2ACPX 1E00A 5HZ5A 1JJXA 2X8SA 3VG7A 5DPQA 4WFUA 1JJJA 2AKQA 1H91A 5EEDA 3D96A 3ZZVA 4ZHDA 2BLGA 1U18A 4N7DA 1PBOA 4YGHA 1SY0A 3APVA 3B2KA 3BLGA 3GAQA 3KZAA 4KC8A 2OVAA 3RZYA 2FR3A 3VG5A 1AB0A 3F6ZB 2HYSA 4M7MA 3RWXA 1KT6A 4FBOA 3KFHA 4EQAC 3FA9A 3ZUIA 4I3BA 1GKAB 3WJCA 1OEJA 1NGLA 1SY3A 4GETA 4NNSA 3VG2A 1CBQA 4R0BA 1DZPA 1MVGA 5HTDA 4TLJA 2FWVA 5D48A 2HZQA 2WEWA 1VYGA 4IMOA 3BX7A 2MWHA 5KICA 3U03A 2WSJA 4A1HA 3P6FA 5H9AA 4IB6A 2P8GA 4MVEA 4XMHA 4YKOA 3MX7A 1MDCA 3VG6A 4XMEA 2MJIA 4YGGA 4COTA 4AW8A 4ORSA 4A8ZA 4PJ2A 4AZRA 1GT5A 2W2AA 2R74A 2X45A 1E5PA 1JYDA 2BS5A 1DZJA 2JU3A 5B29A 2ALLX 4FQBB 4ZR2A 4DQ3A 1X8NA 2LA7A 2X46A 4GK9A 4DQ4A 1LIEA 2NNEA 4ZJ0A 3UEWA 3DSZA 3FMZA 1IIUA 1IFCA 1QWDA 3AKMA 3JS1A 5F7GA 3G7XA 3FLLA 1HMSA 2AT6X 2RA6A 4GNYA 4O3ZA 4I9RA 5BYPA 1O1UA 4ZCBA 1GT3A 5LJKA 4LZVA 4I6SA 4LQZA 4U8UM 1U17A 2JW1A 1N0SA 3ELZA 4HPBA 2Q9SA 3UEVA 3CWKA 3F8AA 4YDBA 1YWBA 1LFOA 5EDBA 5C0NA 1EW3A 1FEMA 1QG5A 2A2GA 2AMMX 2HZRA 1L6MA 3NQKA 3WJBA 1YUPA 5F6BA 5H9LA 1BJ7A 4BVMA 3STKA 3LV4A 2R73A 1X71A 2AT0X 4YFQA 4WHIA 5KIDA 3FEKA 1GXAA 5JR8A 4HPCA 1BWYA 5D47A 5H9KA 1DF3A 3HWEA 1QQSA 4AYHA 4D6BA 1FDQA 1GT1A 5HZ6A 4AZQA 4TJZA 3T1DA 3CQRA 4IB9A 3BX8A 1ZNDA 3ELXA 5HZ8A 1A18A 1D3SA 3D4RA 2WR6A 3KFIA 1SXWA 3ZW1B 3KQ0A 1MX8A 3TGBA 4ORXA 1ALBA 3C76X 2XKLA 1ZRYA 1I04A 1OEEA 4N7CA 5BVQA 1YWCA 1BSQA 4NLIA 5EDCA 4A60A 4CSBA 1OBPA 3VG3A 1DC9A 3PECA 5LJGA 3FR2A 3VU1A 2LBAA 3MBTA 3FA7A 2N93A 4YKMA 4TKBA 3NX1A 4QGWA 1GX8A 3VE2A 3NBXX 1U0XA 3APXA 3D95A 3P6EA 1Z24A 4ZHGA 4EFGA 4TQ2A 2K23A 1A3YA 1BLRA 3HWFA 1CJ5A 1GX9A 3APUA 4O3XB 4D6AA 3FW5A 5AQ6A 1OBQA 2RQ0A 4OS0A 2GTLN 4ZGFA 3CQNA 3FR4A 1S2PA 4JGLA 1EIIA 1CRBA 1OPBA 4OMXA 4YH0A 4ORWA 5FFHA 3EM0A 4XMGA 4Y0PA 5HAEA 1FELA 2OVDA 2X8FA 1X8UA 2L9CA 2AT8X 2OFMX 1HBQA 1QY1A 1SA8A 4ZHHA 2K62A 1ML7A 2ASNX 5LJDA 1ICNA 1SXYA 3P6CA 3FR5A 1EPBA 2G79A 3F9DA 5H9NA 1B8EA 5FAZA 3FIQA 4MVKA 3FENA 3V8UA 2MM3A 3ZW2A 3VG4A 4GDZA 4YCHA 1JIWI 1GM6A 1ZNGA 2Z4IA 3PQSA 2Q2MA 4AZOA 3WBGA 1VYFA 1TOUA 4CV7A 2W2BA 4ML7B 2M4LA 1XKIA 1ADLA 2BS6A 2MO5A 1X8OA 4ON1A 1B4MA 4ORUA 3CBCA 2NNDA 3UEUA 1ZNKA 2G78A 1TXLA 2A3FX 3CBSA 4O3YA 2FTBA 3TGCA 4ALBA 4IB8A 4XMFA 4YDAA 3D97A 1EXSA 5HA0A 5L8OA 4O49A 1PMPA 3P6DA 4Y0QA 1EI5A 3I17A 2KTSA 5CYBA 1T68X 3S5XA 1KXOA 3AKNA 4NLJA 1JZUA 2CZTA 3FELA 2GTLO 3P24A 1I05A 3FYFA 3ZW1A 2RCQA 1BRQA 1RBPA 4QZTA 2GJ5A 1MUPA 4PSQA 2QMIA 2WUTA 4FGIB 2AT3X 1A57A 2QO4A 2A13A 2CM4A 2L67A 5LJCA 1O1VA 1ZNEA 4CK4A 4KIIA 2HNXA 3GE2A 4IAWA 4OS8A 3VPJE 2YMSA 2HMBA 4I3CA 4L1NA 4ZH6A 3U0DA 4AZNA 4ZFXA 1ERXA 3ZW0A 1SY2A 3EBKA 1QFVA 1KT3A 3S26A 4ZGUA 1CBIA 4I3DA 1AQBA 3TGAA 3IA8A 5F1EA 2A2UA 2ZAIA 3STNA 4TKHA 1CBSA 3WXQA 1RLBE 3WJFA 4ES7A 4L3RA 5HTEA 4GRJA 1QABE 3P6HA 1JBHA 1IFBA 3B2LA 3RKGA 1LIBA 5EPQA 1ACDA 1KZXA 4ODDA 3E3CA 5CE4A 5HA1A 4ORRA 3TZSA 4LZUA 4QNIA 2OZQA 5EZ2A 5H8TA 2KD2A 3ZI8A 2LBVA 3BSZE 1IKEA 1LICA 2X8TA 2OVEA 4IMNA 3ZQ3A 4O4UA 4ZHFA 2ANSA 1BBPA 2JMBA 1UREA 4EEJA 3LHNA 1GKAA 2A0AA 1LNMA 3BY0A 1E06A 3OBLA 4IB7A 4UU3A 4NYRA 2L5PA 2QOSC 3PP6A 1KGLA 5HCCC 2QM9A 4QRLA 5EEEA 1FTPA 2Q2PA 3NR3A 1SXXA 4INNA 4O4OA 1AELA 4U8UO 5D45A 5IO7A 4RUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3STM X;  1X8Q A;  1KQX A;  4GNW A;  3CR6 A;  3I0A A;  5HZ9 A;  3APW A;  1BRP A;  4QYP A;  1EIO A;  4TNN A;  1JYJ A;  1KT4 A;  1KT5 A;  1LPJ A;  1BSY A;  2RD7 C;  3HWD A;  4LKT A;  3ZUO A;  3SAO A;  1KT7 A;  1LIF A;  2G7B A;  1BEB A;  3FA6 A;  3NX2 A;  1TW4 A;  5B27 A;  4YFR A;  1NP4 A;  2KT4 B;  3MVF A;  5D8J A;  4O9S A;  4QYN A;  4A1Y A;  1O8V A;  1QY2 A;  1S44 A;  2CM9 A;  2HLV A;  3QKG A;  2L68 A;  4EXZ A;  3PH6 A;  3BS2 A;  5F58 A;  2IFB A;  1E02 A;  3C78 X;  1LID A;  3HWG A;  2LKK A;  4NYQ A;  3WJG A;  1ICM A;  4GKC A;  3FEP A;  1G7N A;  3PPT A;  2QO5 A;  1X89 A;  1X8P A;  2AL0 X;  2YG2 A;  3WJD A;  1EAL A;  1DFV A;  1YP6 A;  2Q39 A;  3HK1 A;  3PH5 A;  4LKP A;  2QO6 A;  4ARH A;  4BQU A;  1MX7 A;  2FRS A;  4YBP A;  3B2J A;  1HMR A;  2EU7 X;  3BU1 A;  1PM1 X;  4OMW A;  3DTQ A;  2JN3 A;  1DV9 A;  3IFB A;  1BSO A;  4AZP A;  3NAD A;  3TF6 A;  1OEK A;  5BVT A;  2O62 A;  1ERB A;  1CBR A;  1IKJ A;  4YGZ A;  5KHP A;  2JU8 A;  3UEX A;  1OBU A;  1PEE A;  3B2H A;  4YFP A;  1I06 A;  1LKE A;  1HBP A;  2CZU A;  1ZNH A;  4MVL A;  3O22 A;  3KFG A;  1T8V A;  4QGV A;  1QY0 A;  1HN2 A;  1P6P A;  3O2Y A;  4WFV A;  1JV4 A;  4QAE A;  5LKF A;  4QGX A;  3B2I A;  3EBW A;  1IW2 A;  3BU9 A;  2F73 A;  3CMP A;  4HPA A;  3L4R A;  3O19 A;  4YCE A;  2LFO A;  5IO5 A;  4Y0R A;  2AH7 X;  3WJE A;  2AT5 X;  3WVM A;  3FA8 A;  1YP7 A;  2FT9 A;  5HZQ A;  4NP1 A;  4TKJ A;  5LJB A;  4OS3 A;  4IAX A;  1A2D A;  3EYC A;  1YIV A;  4Y0S A;  1EPA A;  2RCT A;  1S7D A;  2WWP A;  2NNQ A;  1YWD A;  4RUN A;  2NP1 A;  2W2F A;  1OPA A;  3NQ9 A;  4HPD A;  1GGL A;  1KQW A;  1GT4 A;  5L8N A;  1SXU A;  2FS6 A;  5HCE C;  3KFF A;  4YBU A;  3P6G A;  3PED A;  3EMM A;  5F6Z A;  5K06 A;  3NPO A;  1SY1 A;  3K3L A;  4XMD A;  5BVS A;  1B56 A;  1HMT A;  1UZ2 X;  4EDE A;  2WQA E;  1XCA A;  2POA A;  2FR2 A;  4M6S A;  5FEN A;  2E4J A;  2ACO A;  4BOE A;  4ZHC A;  5LJE A;  5LJH A;  2DM5 A;  4WBK A;  2CBR A;  1I4U A;  2Q4N A;  2R56 A;  1T0V A;  1KOI A;  2GTF X;  1G5W A;  4I9S A;  4NNT A;  3JSQ A;  1FEN A;  2JU7 A;  5HBS A;  2LB6 A;  4K19 A;  3OJY C;  3FW4 A;  1B0O A;  5D4A A;  3BDR A;  5IO6 A;  1TVQ A;  2WEX A;  1D2U A;  1LF7 A;  2PY1 A;  4IBA A;  1ZNL A;  1VPR A;  4GH7 A;  1DZM A;  1BM5 A;  2FLJ A;  4AZM A;  4HFO A;  3BRN A;  5L8I A;  4UU2 A;  2WQ9 A;  3U9P C;  1HQP A;  1QFT A;  4ZH9 A;  1AVG I;  2OFR X;  3NQ3 A;  2FS7 A;  2GC9 A;  2JOZ A;  1DZK A;  1G85 A;  5HWZ A;  3C77 X;  2XST A;  4XMC A;  4ALO A;  1EQD A;  2CBS A;  2KTD A;  1R0U A;  4MVI A;  1FE3 A;  1NP1 A;  3NP1 A;  4YMY A;  1KZW A;  1G74 A;  5LKE A;  4GE1 A;  5DG4 A;  1TOW A;  4QZU A;  3Q6L A;  4ORY A;  1EUO A;  1YWA A;  3RSW A;  5HCD C;  2ACP X;  1E00 A;  5HZ5 A;  1JJX A;  3VG7 A;  5DPQ A;  4WFU A;  1JJJ A;  2AKQ A;  1H91 A;  5EED A;  3D96 A;  4ZHD A;  2BLG A;  1U18 A;  4N7D A;  1PBO A;  4YGH A;  1SY0 A;  3APV A;  3B2K A;  3BLG A;  3GAQ A;  3KZA A;  2OVA A;  3RZY A;  2FR3 A;  3VG5 A;  1AB0 A;  2HYS A;  4M7M A;  1KT6 A;  3KFH A;  3FA9 A;  3ZUI A;  4I3B A;  1GKA B;  3WJC A;  1OEJ A;  1NGL A;  1SY3 A;  4GET A;  4NNS A;  3VG2 A;  1CBQ A;  4R0B A;  1DZP A;  1MVG A;  5HTD A;  4TLJ A;  2FWV A;  5D48 A;  2HZQ A;  2WEW A;  1VYG A;  4IMO A;  3BX7 A;  5KIC A;  3U03 A;  2WSJ A;  4A1H A;  3P6F A;  5H9A A;  4IB6 A;  2P8G A;  4XMH A;  4YKO A;  1MDC A;  3VG6 A;  4XME A;  2MJI A;  4YGG A;  4AW8 A;  4ORS A;  4A8Z A;  4AZR A;  1GT5 A;  2W2A A;  2R74 A;  2X45 A;  1E5P A;  1JYD A;  1DZJ A;  2JU3 A;  5B29 A;  2ALL X;  4ZR2 A;  4DQ3 A;  1X8N A;  2X46 A;  4DQ4 A;  1LIE A;  2NNE A;  4ZJ0 A;  3UEW A;  3DSZ A;  3FMZ A;  1IIU A;  1IFC A;  1QWD A;  3AKM A;  3JS1 A;  5F7G A;  3G7X A;  3FLL A;  1HMS A;  2AT6 X;  2RA6 A;  4GNY A;  4I9R A;  1O1U A;  4ZCB A;  1GT3 A;  5LJK A;  4LZV A;  1U17 A;  1N0S A;  3ELZ A;  4HPB A;  2Q9S A;  3UEV A;  3CWK A;  3F8A A;  4YDB A;  1YWB A;  1LFO A;  5EDB A;  5C0N A;  1EW3 A;  1FEM A;  1QG5 A;  2A2G A;  2AMM X;  2HZR A;  1L6M A;  3WJB A;  1YUP A;  5F6B A;  5H9L A;  1BJ7 A;  4BVM A;  3STK A;  2R73 A;  1X71 A;  2AT0 X;  4YFQ A;  5KID A;  3FEK A;  1GXA A;  5JR8 A;  4HPC A;  1BWY A;  5D47 A;  5H9K A;  1DF3 A;  3HWE A;  1QQS A;  4AYH A;  4D6B A;  1FDQ A;  1GT1 A;  5HZ6 A;  4AZQ A;  4TJZ A;  3T1D A;  3CQR A;  4IB9 A;  3BX8 A;  1ZND A;  3ELX A;  5HZ8 A;  1A18 A;  1D3S A;  2WR6 A;  3KFI A;  1SXW A;  3KQ0 A;  1MX8 A;  3TGB A;  4ORX A;  1ALB A;  3C76 X;  2XKL A;  1ZRY A;  1I04 A;  1OEE A;  4N7C A;  5BVQ A;  1YWC A;  1BSQ A;  4NLI A;  5EDC A;  4A60 A;  1OBP A;  3VG3 A;  1DC9 A;  3PEC A;  5LJG A;  3FR2 A;  2LBA A;  3MBT A;  3FA7 A;  2N93 A;  4YKM A;  4TKB A;  3NX1 A;  4QGW A;  1GX8 A;  1U0X A;  3APX A;  3D95 A;  3P6E A;  1Z24 A;  4ZHG A;  4EFG A;  4TQ2 A;  2K23 A;  1A3Y A;  1BLR A;  3HWF A;  1CJ5 A;  1GX9 A;  3APU A;  4D6A A;  3FW5 A;  5AQ6 A;  1OBQ A;  2RQ0 A;  4OS0 A;  3CQN A;  3FR4 A;  1S2P A;  1EII A;  1CRB A;  1OPB A;  4OMX A;  4YH0 A;  4ORW A;  5FFH A;  3EM0 A;  4XMG A;  4Y0P A;  5HAE A;  1FEL A;  2OVD A;  1X8U A;  2L9C A;  2AT8 X;  2OFM X;  1HBQ A;  1QY1 A;  1SA8 A;  4ZHH A;  2K62 A;  1ML7 A;  2ASN X;  5LJD A;  1ICN A;  1SXY A;  3P6C A;  3FR5 A;  1EPB A;  2G79 A;  3F9D A;  5H9N A;  1B8E A;  5FAZ A;  3FIQ A;  4MVK A;  3FEN A;  2MM3 A;  3VG4 A;  4YCH A;  1GM6 A;  1ZNG A;  2Q2M A;  4AZO A;  3WBG A;  1VYF A;  1TOU A;  2W2B A;  1XKI A;  1ADL A;  2MO5 A;  1X8O A;  1B4M A;  4ORU A;  3CBC A;  2NND A;  3UEU A;  1ZNK A;  2G78 A;  1TXL A;  2A3F X;  3CBS A;  3TGC A;  2FTB A;  4ALB A;  4IB8 A;  4XMF A;  4YDA A;  3D97 A;  1EXS A;  5HA0 A;  5L8O A;  1PMP A;  3P6D A;  4Y0Q A;  3I17 A;  1T68 X;  1KXO A;  3AKN A;  4NLJ A;  1JZU A;  2CZT A;  3FEL A;  1I05 A;  2RCQ A;  1BRQ A;  1RBP A;  4QZT A;  2GJ5 A;  1MUP A;  4PSQ A;  2WUT A;  2AT3 X;  1A57 A;  2QO4 A;  2A13 A;  2CM4 A;  2L67 A;  5LJC A;  1O1V A;  1ZNE A;  4CK4 A;  4KII A;  2HNX A;  4IAW A;  4OS8 A;  2HMB A;  4I3C A;  4ZH6 A;  3U0D A;  4AZN A;  4ZFX A;  1ERX A;  1SY2 A;  3EBK A;  1QFV A;  1KT3 A;  3S26 A;  4ZGU A;  1CBI A;  4I3D A;  1AQB A;  3TGA A;  3IA8 A;  5F1E A;  2A2U A;  3STN A;  4TKH A;  1CBS A;  3WXQ A;  1RLB E;  3WJF A;  4ES7 A;  5HTE A;  4GRJ A;  1QAB E;  3P6H A;  1JBH A;  1IFB A;  3B2L A;  1LIB A;  5EPQ A;  1ACD A;  1KZX A;  4ODD A;  5CE4 A;  5HA1 A;  4ORR A;  3TZS A;  4LZU A;  2OZQ A;  5EZ2 A;  5H8T A;  2LBV A;  3BSZ E;  1IKE A;  1LIC A;  4IMN A;  2OVE A;  3ZQ3 A;  4ZHF A;  2ANS A;  1BBP A;  1URE A;  4EEJ A;  1GKA A;  2A0A A;  1LNM A;  3BY0 A;  1E06 A;  4IB7 A;  4UU3 A;  4NYR A;  2L5P A;  2QOS C;  3PP6 A;  1KGL A;  5HCC C;  2QM9 A;  5EEE A;  1FTP A;  2Q2P A;  3NR3 A;  1SXX A;  1AEL A;  5D45 A;  5IO7 A;  4RUU A; 
#chains in the Genus database with same CATH topology
 1VWF B;  3STM X;  1X8Q A;  1KQX A;  4GNW A;  3CR6 A;  2MHD A;  3I0A A;  5HZ9 A;  3APW A;  4JHQ A;  1BRP A;  4QYP A;  1EIO A;  4TNN A;  4C5P A;  1KL4 A;  1JYJ A;  1KT4 A;  1KT5 A;  1LPJ A;  1BSY A;  2RD7 C;  3HWD A;  4LKT A;  2Y3E A;  2RTB B;  3ZUO A;  4Z6J A;  3SAO A;  1KT7 A;  1LIF A;  2G7B A;  1BEB A;  3FA6 A;  3NX2 A;  1TW4 A;  5B27 A;  4YFR A;  1NP4 A;  2KT4 B;  3MVF A;  3OD9 A;  5D8J A;  4O9S A;  4QYN A;  4A1Y A;  1O8V A;  1QY2 A;  1S44 A;  2CM9 A;  2FHL A;  2HLV A;  2L68 A;  3EW1 A;  3QKG A;  1SWG A;  3BS2 A;  3PH6 A;  5F58 A;  2IFB A;  3HTY A;  1E02 A;  3C78 X;  1LID A;  3HWG A;  2LKK A;  4NYQ A;  4QQ1 A;  1OSP O;  3WJG A;  3SZH A;  5B2A O;  1ICM A;  4GKC A;  2PI3 O;  4FBR A;  2ZAG A;  5AEO A;  2X56 A;  3PK2 A;  4GZV A;  3SLO A;  3FEP A;  1G7N A;  5IRA A;  1N7Y A;  1N9M A;  1WUB A;  1SWT A;  4NV8 A;  1NBX A;  2CAM A;  3PPT A;  1RSU B;  1W5R A;  1X89 A;  1X8P A;  2AL0 X;  2C1Q A;  2QO5 A;  2YG2 A;  3SOT A;  3WJD A;  2WPU A;  1EAL A;  4BX5 A;  1DFV A;  1YP6 A;  2RTH B;  3WYP A;  2Q39 A;  3HK1 A;  3PH5 A;  4LKP A;  1STS B;  1SWS A;  2QO6 A;  1I9H A;  4ARH A;  4BQU A;  1MX7 A;  2FRS A;  4YBP A;  4GU8 A;  2BT9 A;  3B2J A;  1HMR A;  4O3W A;  2EU7 X;  3BU1 A;  1JMX A;  1PM1 X;  4OMW A;  1Y9L A;  3DTQ A;  2IZC B;  2JN3 A;  1JQP A;  4GD9 A;  3RDQ A;  5FQ7 E;  4KCA A;  1AVD A;  4BX7 B;  2VDF A;  1DV9 A;  3IFB A;  3VE1 A;  1BSO A;  2RN4 A;  4AZP A;  3NAD A;  4GJV A;  3TF6 A;  1OEK A;  5BVT A;  2O62 A;  2RTM A;  1VWO B;  1VWG B;  1N4J A;  1ERB A;  1E2T A;  3D9W A;  1CBR A;  1IKJ A;  4YGZ A;  1SWA A;  5KHP A;  3RDM A;  2MF6 A;  2JU8 A;  3UEX A;  1OBU A;  1PEE A;  2VFC A;  3B2H A;  5CHK A;  1PTS A;  4YFP A;  1I06 A;  1LKE A;  1HQQ A;  1HBP A;  2CZU A;  2F09 A;  1ZNH A;  2OY8 A;  4MVL A;  2OVS A;  3O22 A;  3KFG A;  4CDD A;  1T8V A;  2ZSC A;  4QGV A;  1QY0 A;  1HN2 A;  3WOV A;  1P6P A;  2OL8 O;  1VWK B;  3O2Y A;  4WFV A;  3VHI A;  5IXG A;  3H3I A;  3T2X A;  1JV4 A;  3PDF A;  1SRE A;  4U8U N;  4ID2 A;  4QAE A;  5LKF A;  1VWA B;  4QGX A;  3B2I A;  3JQO A;  4GGZ A;  1SWJ A;  1IW2 A;  3EBW A;  4KT5 A;  3BU9 A;  2F73 A;  3EW2 A;  3CMP A;  3RDU A;  3S60 A;  4HPA A;  3L4R A;  3O19 A;  4IAB A;  1IJ8 A;  1UYN X;  2LFO A;  4YCE A;  4BJ8 A;  4Y0R A;  2AH7 X;  1VYO A;  3WJE A;  5IO5 A;  1SRH A;  2AT5 X;  3WVM A;  3FA8 A;  1YP7 A;  1RXH A;  2FT9 A;  2OY7 A;  5HZQ A;  4NP1 A;  4TKJ A;  5LJB A;  4OS3 A;  4IAX A;  4CPH B;  1A2D A;  3PQU A;  3EYC A;  1YIV A;  1LCZ A;  1EPA A;  4Y0S A;  2RCT A;  1S7D A;  2WWP A;  2NNQ A;  1YWD A;  4RUN A;  4Z28 A;  2NP1 A;  2W2F A;  1OPA A;  3NQ9 A;  4HPD A;  1GGL A;  1KQW A;  1GT4 A;  4OEL A;  5L8N A;  1SXU A;  2FS6 A;  5HCE C;  5FQ8 E;  3KFF A;  4YBU A;  3P6G A;  4O4S A;  3WYQ A;  3PED A;  4KC7 A;  3EMM A;  5F6Z A;  3UAQ A;  2RTL A;  2X55 A;  4Y5D A;  5IRU A;  5K06 A;  3NPO A;  1SY1 A;  1VWB B;  2RTE B;  1SWF A;  3K3L A;  4XMD A;  1B56 A;  5AJB A;  5BVS A;  1HMT A;  1MK5 A;  1UZ2 X;  3P02 A;  5FQ6 E;  4EDE A;  2WQA E;  1XCA A;  2POA A;  2FR2 A;  2F01 A;  3RBY A;  4M6S A;  5FEN A;  2E4J A;  2ACO A;  4BOE A;  4ZHC A;  5LJE A;  5LJH A;  2DM5 A;  4WBK A;  1JMZ A;  1VWQ B;  2CBR A;  1I4U A;  2Q4N A;  2R56 A;  1T0V A;  4GGT A;  1KOI A;  2GTF X;  1G5W A;  4I9S A;  1I78 A;  4NNT A;  3JSQ A;  1FEN A;  2JU7 A;  2HKD A;  5HBS A;  2LB6 A;  3HOL A;  4K19 A;  4NW4 A;  3OJY C;  5IO7 A;  3FW4 A;  5CSE A;  3WZP A;  1B0O A;  4O4X A;  4U3Q A;  5D4A A;  3BDR A;  3VHM A;  4MIR A;  1TVQ A;  2WEX A;  3EC5 A;  1D2U A;  2G8C O;  3N91 A;  3RY2 A;  5IO6 A;  1LF7 A;  2PY1 A;  1SWR A;  2IZK A;  4IBA A;  1NC9 A;  1ZNL A;  1VPR A;  4GH7 A;  1DZM A;  1BM5 A;  2FLJ A;  4AZM A;  4U9C A;  4HFO A;  3BRN A;  2KW1 A;  5L8I A;  1Y0G A;  1GX3 A;  1Y9T A;  4UU2 A;  4OKA A;  2WQ9 A;  3U9P C;  1HQP A;  1QFT A;  4ZH9 A;  1AVG I;  2OFR X;  3NQ3 A;  2FS7 A;  1SRG A;  2GC9 A;  2JOZ A;  3ZW0 B;  1DZK A;  1G85 A;  5HWZ A;  3C77 X;  3OE3 A;  2XST A;  4KH8 A;  4MIS A;  2OY1 O;  1EQD A;  4XMC A;  3RDX A;  3S5V A;  2CBS A;  3QQ2 A;  2KTD A;  1R0U A;  1SMP I;  4MVI A;  1FE3 A;  1STP A;  1NP1 A;  3NP1 A;  4YMY A;  2BHV A;  1KZW A;  5AJC A;  2QCB A;  1G74 A;  5LKE A;  3HOE A;  2Z4H A;  4GE1 A;  5DG4 A;  1TOW A;  3ZWE A;  4HWM A;  4QZU A;  4FBV A;  3Q6L A;  4I95 A;  4ORY A;  2GTL M;  1EUO A;  4JNJ A;  1YWA A;  3RSW A;  5HCD C;  2ACP X;  1E00 A;  5HZ5 A;  1JJX A;  1LDQ A;  3LTW A;  2X8S A;  3VG7 A;  1Y55 X;  2RTG B;  4WFU A;  5DPQ A;  1JJJ A;  2AKQ A;  1H91 A;  5EED A;  3D96 A;  3ZZV A;  4ZHD A;  2BLG A;  1U18 A;  4N7D A;  1LEL A;  1PBO A;  4YGH A;  1SY0 A;  3APV A;  3CKG A;  3B2K A;  1SLD B;  3BLG A;  3GAQ A;  3KZA A;  4KC8 A;  2OVA A;  3RZY A;  2FR3 A;  3VG5 A;  1AB0 A;  2IZG B;  3F6Z B;  4CPH A;  2HYS A;  3T2W A;  4M7M A;  3RWX A;  4BBO A;  1KT6 A;  2OFA A;  4FBO A;  2IZA A;  3KFH A;  4EQA C;  3FID A;  1KL5 A;  2I5V O;  3FA9 A;  2X32 A;  4I3B A;  3ZUI A;  4DCB A;  1GKA B;  2RTC B;  3WJC A;  1OEJ A;  4CPE A;  1NGL A;  3Q34 A;  1SY3 A;  4GET A;  4NNS A;  3VG2 A;  1CBQ A;  4R0B A;  1DZP A;  1MVG A;  1SWH A;  1SLG B;  2IZJ A;  4TLJ A;  5HTD A;  2FWV A;  5D48 A;  2HZQ A;  2WEW A;  1VYG A;  4IMO A;  3BX7 A;  2MWH A;  5KIC A;  3U03 A;  5K68 A;  2WSJ A;  4A1H A;  3P6F A;  1N9Y A;  5H9A A;  4IB6 A;  5B11 O;  2RTJ A;  2VFB A;  2P8G A;  4MVE A;  4XMH A;  4YKO A;  3MX7 A;  1MDC A;  3VG6 A;  4XME A;  2MJI A;  4YGG A;  4COT A;  4AW8 A;  4ORS A;  2IZI A;  4A8Z A;  4PJ2 A;  4AZR A;  1GT5 A;  2W2A A;  2R74 A;  2X45 A;  4YVB A;  2OFB A;  1E5P A;  1JYD A;  4GGR A;  2BS5 A;  2RTF B;  1DZJ A;  2JU3 A;  1SWD A;  5B29 A;  2ALL X;  3MM0 A;  4FQB B;  4ZR2 A;  1VWH B;  2GH7 A;  4DQ3 A;  4Z2V A;  1X8N A;  2LA7 A;  2X46 A;  4GK9 A;  4DQ4 A;  1LIE A;  2NNE A;  4ZJ0 A;  3UEW A;  1W6F A;  2RTD B;  3DSZ A;  3FMZ A;  1IIU A;  5F2B A;  2Y3F A;  1IFC A;  1QWD A;  2RTP B;  3AKM A;  3JS1 A;  5F7G A;  3G7X A;  3FLL A;  1HMS A;  2AT6 X;  2RA6 A;  5IRW A;  4GNY A;  4O3Z A;  4I9R A;  2IZD B;  5BYP A;  1O1U A;  4GJS A;  1GT3 A;  4ZCB A;  5LJK A;  4LZV A;  4I6S A;  2DJF A;  4LQZ A;  4U8U M;  1U17 A;  2UYW A;  2JW1 A;  1N0S A;  1Y52 X;  3ELZ A;  4HPB A;  2Q9S A;  3UEV A;  3CWK A;  3F8A A;  4YDB A;  3RE5 A;  1YWB A;  5B5G A;  1LFO A;  5EDB A;  5C0N A;  3FDC A;  1EW3 A;  1FEM A;  1QG5 A;  2A2G A;  2AMM X;  2HZR A;  1L6M A;  3NQK A;  3WJB A;  4CPI A;  1YUP A;  5F6B A;  5H9L A;  1BJ7 A;  1SWL A;  4BVM A;  3STK A;  3LV4 A;  2R73 A;  1X71 A;  2DJG A;  2AT0 X;  4YFQ A;  1VWP B;  4WHI A;  5KID A;  3FEK A;  1GXA A;  1VWJ B;  4HPC A;  5JR8 A;  2FGS A;  1BWY A;  5D47 A;  3AUM O;  5H9K A;  1DF3 A;  3HWE A;  1QQS A;  4AYH A;  4D6B A;  1FDQ A;  1GT1 A;  5HZ6 A;  4AZQ A;  4TJZ A;  3T1D A;  1STR B;  3CQR A;  4IB9 A;  1AVE A;  3BX8 A;  1ZND A;  3ELX A;  5HZ8 A;  1A18 A;  1D3S A;  3D4R A;  2WR6 A;  1NQM A;  1SXW A;  3KFI A;  3SLJ A;  3ZW1 B;  3KQ0 A;  1MX8 A;  3TGB A;  4ORX A;  1ALB A;  3C76 X;  2XKL A;  1ZRY A;  1I04 A;  1OEE A;  4N7C A;  5BVQ A;  1MM9 A;  1YWC A;  1BSQ A;  4NLI A;  5EDC A;  4A60 A;  4CSB A;  1OBP A;  3VG3 A;  1DC9 A;  3PEC A;  5LJG A;  4BX7 A;  4CDC A;  3FR2 A;  3VU1 A;  2LBA A;  3MBT A;  3FA7 A;  2N93 A;  4YKM A;  4TKB A;  3NX1 A;  4B55 A;  4QGW A;  1GX8 A;  3VE2 A;  2OF9 A;  1LDO A;  1LCW A;  3NBX X;  4EXZ A;  1VWL B;  1U0X A;  2FKJ A;  3APX A;  2FKG A;  3D95 A;  4I60 A;  4Z2O A;  3P6E A;  1Z24 A;  4ZHG A;  4EFG A;  3CKF A;  4TQ2 A;  1VWN B;  5HAE A;  3ZI8 A;  4Z27 A;  2K23 A;  1A3Y A;  1BLR A;  3HWF A;  1VWI B;  5B10 O;  2A5C A;  3VHH A;  1CJ5 A;  1GX9 A;  3APU A;  4O3X B;  1PBY A;  4D6A A;  3FW5 A;  5AQ6 A;  1OBQ A;  2AVI A;  1HXL A;  2RQ0 A;  4OS0 A;  2GTL N;  1HY2 A;  3CQN A;  3FR4 A;  1S2P A;  4JGL A;  4ZGF A;  1CRB A;  1OPB A;  3T6F A;  1EII A;  2BSZ A;  4IRW A;  4OMX A;  4YH0 A;  4NV7 A;  4ORW A;  5FFH A;  3EM0 A;  4XMG A;  1K24 A;  4Y0P A;  2UZ2 A;  1FEL A;  2OVD A;  2X8F A;  1X8U A;  1LCV A;  2AT8 X;  1HBQ A;  1QY1 A;  1SA8 A;  2L9C A;  2OFM X;  4ZHH A;  2K62 A;  1ML7 A;  3WZO A;  2ASN X;  5LJD A;  1W4T A;  1ICN A;  1SLE B;  1SXY A;  1KL3 A;  3P6C A;  1K3B A;  3FR5 A;  3HPE A;  1EPB A;  4MEE A;  2QOM A;  2G79 A;  3F9D A;  5H9N A;  1B8E A;  5FAZ A;  3FIQ A;  4MVK A;  3FEN A;  3V8U A;  1LUQ A;  2MM3 A;  3ZW2 A;  4CDE A;  3VG4 A;  2OL7 A;  1RXK A;  4GDZ A;  4YCH A;  1JIW I;  1GM6 A;  1ZNG A;  2FHN X;  2Z4I A;  3PQS A;  2Q2M A;  2IZE B;  2RTO B;  1WBI A;  4AZO A;  3WBG A;  1VYF A;  1TOU A;  1JJU A;  4OEM A;  1KFF A;  4CV7 A;  1SLF B;  2W2B A;  2OYB O;  4ML7 B;  2M4L A;  1XKI A;  1ADL A;  2BS6 A;  4CPF A;  2AF5 A;  5LJC A;  1N43 A;  2MO5 A;  3RE6 A;  1FJ1 E;  1X8O A;  4ON1 A;  1VWE B;  3MG5 A;  4ORU A;  3CBC A;  3RDO A;  1B4M A;  2NND A;  1SWK A;  3SLT A;  1SWN A;  3UEU A;  3VGW A;  1ZNK A;  2G78 A;  1TXL A;  2A3F X;  3CBS A;  4O3Y A;  2FTB A;  4DNE A;  3TGC A;  4ALB A;  4IB8 A;  4XMF A;  1VWD B;  4YDA A;  3D97 A;  1EXS A;  3SZI A;  1SWB A;  2RTQ B;  5HA0 A;  5L8O A;  4O49 A;  1PMP A;  3P6D A;  4Y0Q A;  1EI5 A;  3I17 A;  2KTS A;  5CYB A;  1T68 X;  3S5X A;  1SRJ A;  2IZF B;  3WZQ A;  1KXO A;  1VWM B;  3AKN A;  4NLJ A;  2CZT A;  2OF8 A;  3FEL A;  1JZU A;  2GTL O;  3P24 A;  4BX6 B;  1I05 A;  3T6L A;  3FYF A;  3ZW1 A;  2RCQ A;  1BRQ A;  1RBP A;  4QZT A;  2GJ5 A;  1MUP A;  2C4I A;  4PSQ A;  2QMI A;  2WUT A;  4FGI B;  2AT3 X;  3AEH A;  1A57 A;  5B5F A;  2QO4 A;  2A13 A;  1RAV A;  2CM4 A;  2L67 A;  1O1V A;  1ZNE A;  4CK4 A;  4JO6 A;  4EKV A;  5L3Y A;  2A5B A;  4KII A;  2HNX A;  1NDJ A;  3GE2 A;  1SWP A;  4IAW A;  4OS8 A;  3VPJ E;  1SWE A;  2YMS A;  2HMB A;  4I3C A;  4L1N A;  4ZH6 A;  3U0D A;  5B3M O;  4AZN A;  4U46 A;  2RTA A;  4ZFX A;  1ERX A;  3ZW0 A;  1SY2 A;  2A8G A;  4BX5 B;  3EBK A;  1QFV A;  1KT3 A;  1SWQ A;  3S26 A;  4ZGU A;  2OL6 O;  1CBI A;  4I3D A;  4BX6 A;  1AQB A;  3TGA A;  1MEP A;  3IA8 A;  5F1E A;  2A2U A;  1RST B;  2ZAI A;  3STN A;  4TKH A;  1CBS A;  3WXQ A;  1RLB E;  1Y53 X;  3WJF A;  4ES7 A;  2IZH B;  4L3R A;  2I5Z O;  4GRJ A;  5HTE A;  2JGS A;  2RTK A;  4BCS A;  1QAB E;  1DF8 A;  4Z2P A;  3P6H A;  3X00 A;  1NQN A;  3WZN A;  1JBH A;  1IFB A;  3B2L A;  3RKG A;  1LIB A;  5EPQ A;  1ACD A;  5K67 A;  1SRI A;  4ODD A;  1KZX A;  5JD2 A;  4ALO A;  3RY1 A;  3RDS A;  1UYO X;  3E3C A;  5CE4 A;  1SWU A;  1VWC B;  4ORR A;  5HA1 A;  3TZS A;  2IZB A;  2IZL B;  4GUZ A;  4LZU A;  4QNI A;  2OZQ A;  5EZ2 A;  2C1S A;  5H8T A;  1SWO A;  1SWC A;  2KD2 A;  2LBV A;  3BSZ E;  1IKE A;  1LIC A;  2BC3 A;  2OVE A;  1MOY A;  2RTN B;  2X8T A;  4IMN A;  3ZQ3 A;  1SRF A;  4O4U A;  4ZHF A;  2ANS A;  1BBP A;  2JMB A;  1URE A;  2RTI B;  4EEJ A;  1HXZ A;  2RTR B;  3LHN A;  1GKA A;  2OY5 O;  2A0A A;  4GDA A;  1LNM A;  3BY0 A;  1E06 A;  2X4M A;  3OBL A;  4IB7 A;  4UU3 A;  4NYR A;  2L5P A;  2QOS C;  3KVN A;  4CDF A;  3PP6 A;  3SZJ A;  2X34 A;  1KGL A;  1RXJ A;  5HCC C;  2QM9 A;  4QRL A;  5EEE A;  1FTP A;  2Q2P A;  3NR3 A;  1SXX A;  4INN A;  2Y32 A;  4O4O A;  4BGF A;  1AEL A;  4U8U O;  5D45 A;  2G5L A;  1VWR B;  4Y59 A;  4RUU A; 
#chains in the Genus database with same CATH homology
 3STM X;  1X8Q A;  1KQX A;  4GNW A;  3CR6 A;  2MHD A;  3I0A A;  5HZ9 A;  3APW A;  1BRP A;  4QYP A;  1EIO A;  4TNN A;  1JYJ A;  1KT4 A;  1KT5 A;  1LPJ A;  1BSY A;  2RD7 C;  3HWD A;  4LKT A;  3ZUO A;  3SAO A;  1KT7 A;  1LIF A;  2G7B A;  1BEB A;  3FA6 A;  3NX2 A;  1TW4 A;  5B27 A;  4YFR A;  1NP4 A;  2KT4 B;  3MVF A;  3OD9 A;  5D8J A;  4O9S A;  4QYN A;  4A1Y A;  1O8V A;  1QY2 A;  1S44 A;  2CM9 A;  2HLV A;  3QKG A;  2L68 A;  4EXZ A;  3PH6 A;  3BS2 A;  5F58 A;  2IFB A;  3HTY A;  1E02 A;  3C78 X;  1LID A;  3HWG A;  2LKK A;  4NYQ A;  4QQ1 A;  3WJG A;  1ICM A;  4GKC A;  4FBR A;  2ZAG A;  5AEO A;  4GZV A;  3FEP A;  1G7N A;  3PPT A;  2QO5 A;  1X89 A;  1X8P A;  2AL0 X;  2YG2 A;  3WJD A;  3SOT A;  1EAL A;  1DFV A;  1YP6 A;  2Q39 A;  3HK1 A;  3PH5 A;  4LKP A;  2QO6 A;  4ARH A;  4BQU A;  1MX7 A;  2FRS A;  4YBP A;  4GU8 A;  2BT9 A;  3B2J A;  1HMR A;  4O3W A;  2EU7 X;  3BU1 A;  1PM1 X;  4OMW A;  1Y9L A;  3DTQ A;  2JN3 A;  5FQ7 E;  4KCA A;  1DV9 A;  3IFB A;  3VE1 A;  1BSO A;  2RN4 A;  4AZP A;  3NAD A;  3TF6 A;  1OEK A;  5BVT A;  2O62 A;  1ERB A;  1CBR A;  1IKJ A;  4YGZ A;  5KHP A;  2JU8 A;  3UEX A;  1OBU A;  1PEE A;  3B2H A;  4YFP A;  1I06 A;  1LKE A;  1HBP A;  2CZU A;  2F09 A;  1ZNH A;  4MVL A;  2OVS A;  3O22 A;  3KFG A;  1T8V A;  4QGV A;  1QY0 A;  1HN2 A;  3WOV A;  1P6P A;  3O2Y A;  4WFV A;  3H3I A;  1JV4 A;  4U8U N;  4ID2 A;  4QAE A;  5LKF A;  4QGX A;  3B2I A;  3JQO A;  3EBW A;  1IW2 A;  4KT5 A;  3BU9 A;  2F73 A;  3CMP A;  3S60 A;  4HPA A;  3L4R A;  3O19 A;  4IAB A;  4YCE A;  2LFO A;  5IO5 A;  4Y0R A;  2AH7 X;  3WJE A;  2AT5 X;  3WVM A;  3FA8 A;  1YP7 A;  2FT9 A;  5HZQ A;  4NP1 A;  4TKJ A;  5LJB A;  4OS3 A;  4IAX A;  1A2D A;  3PQU A;  3EYC A;  1YIV A;  4Y0S A;  1EPA A;  2RCT A;  1S7D A;  2WWP A;  2NNQ A;  1YWD A;  4RUN A;  2NP1 A;  2W2F A;  1OPA A;  3NQ9 A;  4HPD A;  1GGL A;  1KQW A;  1GT4 A;  5L8N A;  1SXU A;  2FS6 A;  5HCE C;  5FQ8 E;  3KFF A;  4YBU A;  3P6G A;  4O4S A;  3PED A;  4KC7 A;  3EMM A;  5F6Z A;  3UAQ A;  5K06 A;  3NPO A;  1SY1 A;  3K3L A;  4XMD A;  5BVS A;  1B56 A;  5AJB A;  1HMT A;  1UZ2 X;  3P02 A;  5FQ6 E;  4EDE A;  2WQA E;  1XCA A;  2POA A;  2FR2 A;  3RBY A;  4M6S A;  5FEN A;  2E4J A;  2ACO A;  4BOE A;  4ZHC A;  5LJE A;  5LJH A;  2DM5 A;  4WBK A;  2CBR A;  1I4U A;  2Q4N A;  2R56 A;  1T0V A;  1KOI A;  2GTF X;  1G5W A;  4I9S A;  4NNT A;  3JSQ A;  1FEN A;  2JU7 A;  5HBS A;  2LB6 A;  3HOL A;  4K19 A;  4NW4 A;  3OJY C;  3FW4 A;  1B0O A;  4O4X A;  4U3Q A;  5D4A A;  3BDR A;  5IO6 A;  4MIR A;  1TVQ A;  2WEX A;  3N91 A;  1D2U A;  1LF7 A;  2PY1 A;  4IBA A;  1ZNL A;  1VPR A;  4GH7 A;  1DZM A;  1BM5 A;  2FLJ A;  4AZM A;  4U9C A;  4HFO A;  3BRN A;  2KW1 A;  5L8I A;  1Y9T A;  4UU2 A;  2WQ9 A;  3U9P C;  1HQP A;  1QFT A;  4ZH9 A;  1AVG I;  2OFR X;  3NQ3 A;  2FS7 A;  2GC9 A;  2JOZ A;  3ZW0 B;  1DZK A;  1G85 A;  5HWZ A;  3C77 X;  3OE3 A;  2XST A;  4KH8 A;  4MIS A;  4XMC A;  1EQD A;  3S5V A;  4ALO A;  2CBS A;  2KTD A;  1R0U A;  1SMP I;  4MVI A;  1FE3 A;  1NP1 A;  3NP1 A;  4YMY A;  2BHV A;  1KZW A;  5AJC A;  1G74 A;  5LKE A;  3HOE A;  2Z4H A;  4GE1 A;  5DG4 A;  1TOW A;  3ZWE A;  4HWM A;  4QZU A;  4FBV A;  3Q6L A;  4I95 A;  4ORY A;  2GTL M;  1EUO A;  1YWA A;  3RSW A;  5HCD C;  2ACP X;  1E00 A;  5HZ5 A;  1JJX A;  2X8S A;  3VG7 A;  5DPQ A;  4WFU A;  1JJJ A;  2AKQ A;  1H91 A;  5EED A;  3D96 A;  3ZZV A;  4ZHD A;  2BLG A;  1U18 A;  4N7D A;  1PBO A;  4YGH A;  1SY0 A;  3APV A;  3B2K A;  3BLG A;  3GAQ A;  3KZA A;  4KC8 A;  2OVA A;  3RZY A;  2FR3 A;  3VG5 A;  1AB0 A;  3F6Z B;  2HYS A;  4M7M A;  3RWX A;  1KT6 A;  4FBO A;  3KFH A;  4EQA C;  3FA9 A;  3ZUI A;  4I3B A;  1GKA B;  3WJC A;  1OEJ A;  1NGL A;  1SY3 A;  4GET A;  4NNS A;  3VG2 A;  1CBQ A;  4R0B A;  1DZP A;  1MVG A;  5HTD A;  4TLJ A;  2FWV A;  5D48 A;  2HZQ A;  2WEW A;  1VYG A;  4IMO A;  3BX7 A;  2MWH A;  5KIC A;  3U03 A;  2WSJ A;  4A1H A;  3P6F A;  5H9A A;  4IB6 A;  2P8G A;  4MVE A;  4XMH A;  4YKO A;  3MX7 A;  1MDC A;  3VG6 A;  4XME A;  2MJI A;  4YGG A;  4COT A;  4AW8 A;  4ORS A;  4A8Z A;  4PJ2 A;  4AZR A;  1GT5 A;  2W2A A;  2R74 A;  2X45 A;  1E5P A;  1JYD A;  2BS5 A;  1DZJ A;  2JU3 A;  5B29 A;  2ALL X;  4FQB B;  4ZR2 A;  4DQ3 A;  1X8N A;  2LA7 A;  2X46 A;  4GK9 A;  4DQ4 A;  1LIE A;  2NNE A;  4ZJ0 A;  3UEW A;  3DSZ A;  3FMZ A;  1IIU A;  1IFC A;  1QWD A;  3AKM A;  3JS1 A;  5F7G A;  3G7X A;  3FLL A;  1HMS A;  2AT6 X;  2RA6 A;  4GNY A;  4O3Z A;  4I9R A;  5BYP A;  1O1U A;  4ZCB A;  1GT3 A;  5LJK A;  4LZV A;  4I6S A;  4LQZ A;  4U8U M;  1U17 A;  2JW1 A;  1N0S A;  3ELZ A;  4HPB A;  2Q9S A;  3UEV A;  3CWK A;  3F8A A;  4YDB A;  1YWB A;  1LFO A;  5EDB A;  5C0N A;  1EW3 A;  1FEM A;  1QG5 A;  2A2G A;  2AMM X;  2HZR A;  1L6M A;  3NQK A;  3WJB A;  1YUP A;  5F6B A;  5H9L A;  1BJ7 A;  4BVM A;  3STK A;  3LV4 A;  2R73 A;  1X71 A;  2AT0 X;  4YFQ A;  4WHI A;  5KID A;  3FEK A;  1GXA A;  5JR8 A;  4HPC A;  1BWY A;  5D47 A;  5H9K A;  1DF3 A;  3HWE A;  1QQS A;  4AYH A;  4D6B A;  1FDQ A;  1GT1 A;  5HZ6 A;  4AZQ A;  4TJZ A;  3T1D A;  3CQR A;  4IB9 A;  3BX8 A;  1ZND A;  3ELX A;  5HZ8 A;  1A18 A;  1D3S A;  3D4R A;  2WR6 A;  3KFI A;  1SXW A;  3ZW1 B;  3KQ0 A;  1MX8 A;  3TGB A;  4ORX A;  1ALB A;  3C76 X;  2XKL A;  1ZRY A;  1I04 A;  1OEE A;  4N7C A;  5BVQ A;  1YWC A;  1BSQ A;  4NLI A;  5EDC A;  4A60 A;  4CSB A;  1OBP A;  3VG3 A;  1DC9 A;  3PEC A;  5LJG A;  3FR2 A;  3VU1 A;  2LBA A;  3MBT A;  3FA7 A;  2N93 A;  4YKM A;  4TKB A;  3NX1 A;  4QGW A;  1GX8 A;  3VE2 A;  3NBX X;  1U0X A;  3APX A;  3D95 A;  3P6E A;  1Z24 A;  4ZHG A;  4EFG A;  4TQ2 A;  2K23 A;  1A3Y A;  1BLR A;  3HWF A;  1CJ5 A;  1GX9 A;  3APU A;  4O3X B;  4D6A A;  3FW5 A;  5AQ6 A;  1OBQ A;  2RQ0 A;  4OS0 A;  2GTL N;  4ZGF A;  3CQN A;  3FR4 A;  1S2P A;  4JGL A;  1EII A;  1CRB A;  1OPB A;  4OMX A;  4YH0 A;  4ORW A;  5FFH A;  3EM0 A;  4XMG A;  4Y0P A;  5HAE A;  1FEL A;  2OVD A;  2X8F A;  1X8U A;  2L9C A;  2AT8 X;  2OFM X;  1HBQ A;  1QY1 A;  1SA8 A;  4ZHH A;  2K62 A;  1ML7 A;  2ASN X;  5LJD A;  1ICN A;  1SXY A;  3P6C A;  3FR5 A;  1EPB A;  2G79 A;  3F9D A;  5H9N A;  1B8E A;  5FAZ A;  3FIQ A;  4MVK A;  3FEN A;  3V8U A;  2MM3 A;  3ZW2 A;  3VG4 A;  4GDZ A;  4YCH A;  1JIW I;  1GM6 A;  1ZNG A;  2Z4I A;  3PQS A;  2Q2M A;  4AZO A;  3WBG A;  1VYF A;  1TOU A;  4CV7 A;  2W2B A;  4ML7 B;  2M4L A;  1XKI A;  1ADL A;  2BS6 A;  2MO5 A;  1X8O A;  4ON1 A;  1B4M A;  4ORU A;  3CBC A;  2NND A;  3UEU A;  1ZNK A;  2G78 A;  1TXL A;  2A3F X;  3CBS A;  4O3Y A;  2FTB A;  3TGC A;  4ALB A;  4IB8 A;  4XMF A;  4YDA A;  3D97 A;  1EXS A;  5HA0 A;  5L8O A;  4O49 A;  1PMP A;  3P6D A;  4Y0Q A;  1EI5 A;  3I17 A;  2KTS A;  5CYB A;  1T68 X;  3S5X A;  1KXO A;  3AKN A;  4NLJ A;  1JZU A;  2CZT A;  3FEL A;  2GTL O;  3P24 A;  1I05 A;  3FYF A;  3ZW1 A;  2RCQ A;  1BRQ A;  1RBP A;  4QZT A;  2GJ5 A;  1MUP A;  4PSQ A;  2QMI A;  2WUT A;  4FGI B;  2AT3 X;  1A57 A;  2QO4 A;  2A13 A;  2CM4 A;  2L67 A;  5LJC A;  1O1V A;  1ZNE A;  4CK4 A;  4KII A;  2HNX A;  3GE2 A;  4IAW A;  4OS8 A;  3VPJ E;  2YMS A;  2HMB A;  4I3C A;  4L1N A;  4ZH6 A;  3U0D A;  4AZN A;  4ZFX A;  1ERX A;  3ZW0 A;  1SY2 A;  3EBK A;  1QFV A;  1KT3 A;  3S26 A;  4ZGU A;  1CBI A;  4I3D A;  1AQB A;  3TGA A;  3IA8 A;  5F1E A;  2A2U A;  2ZAI A;  3STN A;  4TKH A;  1CBS A;  3WXQ A;  1RLB E;  3WJF A;  4ES7 A;  4L3R A;  5HTE A;  4GRJ A;  1QAB E;  3P6H A;  1JBH A;  1IFB A;  3B2L A;  3RKG A;  1LIB A;  5EPQ A;  1ACD A;  1KZX A;  4ODD A;  3E3C A;  5CE4 A;  5HA1 A;  4ORR A;  3TZS A;  4LZU A;  4QNI A;  2OZQ A;  5EZ2 A;  5H8T A;  2KD2 A;  3ZI8 A;  2LBV A;  3BSZ E;  1IKE A;  1LIC A;  2X8T A;  2OVE A;  4IMN A;  3ZQ3 A;  4O4U A;  4ZHF A;  2ANS A;  1BBP A;  2JMB A;  1URE A;  4EEJ A;  3LHN A;  1GKA A;  2A0A A;  1LNM A;  3BY0 A;  1E06 A;  3OBL A;  4IB7 A;  4UU3 A;  4NYR A;  2L5P A;  2QOS C;  3PP6 A;  1KGL A;  5HCC C;  2QM9 A;  4QRL A;  5EEE A;  1FTP A;  2Q2P A;  3NR3 A;  1SXX A;  4INN A;  4O4O A;  1AEL A;  4U8U O;  5D45 A;  5IO7 A;  4RUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...