3TGAA

Crystal structure of l130r mutant of nitrophorin 4 from rhodnius prolixus at ph 7.4
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
184
structure length
184
Chain Sequence
ACTKNAIAQTGFNKDKYFNGDVWYVTDYLDLEPDDVPKRYCAALAAGTASGKLKEALYHYDPKTQDTFYDVSELQVESLGKYTANFKKVDKNGNVKVAVTAGNYYTFTVMYADDSSALIHTCLHKGNKDRGDLYAVLNRNKDAAAGDKVKSAVSAATLEFSKFISTKENNCAYDNDSLKSLLTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrophorin-4
publication title Guanidine-Ferroheme Coordination in the Mutant Protein Nitrophorin 4(L130R).
pubmed doi rcsb
source organism Rhodnius prolixus
molecule tags Metal binding protein
total genus 52
structure length 184
sequence length 184
ec nomenclature ec 1.7.6.1: Nitrite dismutase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02087 Nitrophorin Nitrophorin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3tgaA00
4EXZA 1D3SA 3P6FA 2K62A 3APUA 3CMPA 4XMFA 2G79A 3APXA 3ZUOA 3G7XA 3K3LA 4MVLA 5F6ZA 3UEWA 3EYCA 3B2LA 1MX8A 1T8VA 2W2AA 2DM5A 5DPQA 3WJGA 1IFBA 1ERBA 1TW4A 4ZHDA 1ADLA 3TZSA 1SXXA 1AELA 1GX9A 3P6GA 1ACDA 4QZUA 4ES7A 1GKAA 3S26A 2JU8A 2W2FA 1IW2A 5LKEA 2WEXA 1DV9A 3TF6A 1ZNDA 1A57A 1A3YA 3C76X 1JYDA 4QYNA 1PEEA 1R0UA 3WJDA 3C77X 1FDQA 1YP7A 1LFOA 1G74A 4I9SA 2NNEA 5HTDA 1QY1A 1HBQA 3EMMA 4YGHA 5LJCA 1E5PA 4IMOA 1G85A 4RUUA 4ZCBA 5F58A 3HK1A 5EDBA 5EEEA 5H9LA 1UZ2X 1YWCA 4QGXA 3NPOA 1EXSA 1P6PA 2F73A 1I06A 4YFQA 2QO6A 4ZGUA 4BOEA 1MUPA 2A2GA 3FA6A 4ALBA 3WJCA 4YH0A 1HMTA 3TGAA 1B0OA 4ZH9A 3PP6A 2G78A 1GX8A 1KT5A 1KT6A 3NX1A 1EUOA 1U17A 3STNA 1FE3A 1VYGA 4R0BA 1AQBA 1X8PA 4QGVA 4Y0PA 4YCHA 3U03A 2A13A 1N0SA 1OEJA 1NP4A 1GGLA 5LJHA 4AZQA 5EDCA 1B8EA 4GETA 4EEJA 1EW3A 1DZKA 1DF3A 2E4JA 2HLVA 2RCQA 5FAZA 4AZMA 4YGGA 1HBPA 1S2PA 2RCTA 1BSYA 4GE1A 4I3CA 1ZNEA 1GKAB 2WWPA 1KGLA 2FT9A 3F9DA 4QAEA 1LKEA 3QKGA 1A2DA 2Q9SA 4QYPA 5LJGA 2L9CA 3BU9A 5HA1A 4TKBA 1DZMA 1LICA 4NLIA 4HFOA 5D48A 3APWA 2ASNX 2CBSA 5F1EA 3FMZA 1HN2A 3FR2A 1JZUA 2MM3A 1ML7A 1KT7A 1ZNGA 3PEDA 4ORWA 4BVMA 1BRPA 1I05A 1IKJA 1X8OA 5FENA 5K06A 2GTFX 4YBPA 5H9NA 2N93A 4ZHCA 4DQ4A 4XMHA 4M6SA 2JN3A 4WFUA 2L5PA 3CWKA 2AL0X 2WSJA 3FA7A 4LZUA 2R56A 4TLJA 1ERXA 4YFPA 2OFRX 5L8NA 4NYQA 2L68A 3WBGA 3L4RA 1KT4A 3B2JA 4OS0A 3D96A 1LF7A 2KTDA 4UU3A 1OBUA 3VG3A 5BVSA 1O1VA 1A18A 4NNTA 3EBWA 2CZUA 1G7NA 1OBQA 1EQDA 3WVMA 1PBOA 4TQ2A 5DG4A 2O62A 2Q4NA 1BJ7A 2WEWA 3P6DA 3WXQA 2WR6A 2AT8X 1FENA 1CBIA 2RQ0A 4RUNA 3STKA 2HNXA 1BSOA 2P8GA 4GNYA 1E02A 4XMGA 5LJBA 1YUPA 1Z24A 1X8NA 1QY2A 1EIIA 1OEKA 2CBRA 4BQUA 5HA0A 4A8ZA 3APVA 5HZ8A 1QFTA 1MDCA 4ZFXA 3HWGA 3FEKA 3BY0A 3BRNA 1SY0A 3PH5A 3VG2A 4ALOA 1OPAA 2X46A 5F7GA 3FW4A 2OFMX 3Q6LA 5D8JA 3TGCA 1BSQA 4GRJA 5IO5A 1ZRYA 2YG2A 5C0NA 3KFGA 4YBUA 4YMYA 5HAEA 5BVQA 3WJFA 1PM1X 1KQXA 4YKMA 1QQSA 3BDRA 4OMXA 1GT4A 1LIEA 1ICMA 3FR5A 3FR4A 4AZRA 3VG5A 3KZAA 4NP1A 2AH7X 4A60A 3WJEA 4QGWA 1RBPA 4Y0RA 1BEBA 1E00A 3O2YA 4I3BA 2EU7X 2A2UA 2LFOA 3HWEA 1YP6A 1XKIA 3TGBA 3B2IA 2OVAA 1JV4A 2Q39A 3ZQ3A 2RD7C 3FA8A 5HCEC 5BVTA 4Y0SA 2RA6A 3B2KA 1O1UA 4EFGA 1LIFA 1KZXA 3RSWA 1T68X 1TXLA 5FFHA 2LB6A 1IKEA 3FLLA 3AKNA 1ALBA 3GAQA 4A1YA 4YFRA 3T1DA 2AT0X 2BLGA 4AW8A 1IFCA 4IAWA 4IAXA 3C78X 3CBSA 1JJJA 5HBSA 3F8AA 3IFBA 4I3DA 4IMNA 5D45A 2OZQA 4LKTA 4NYRA 5EZ2A 3BLGA 1JYJA 4HPBA 1QY0A 5JR8A 3FELA 3NX2A 3EM0A 1BBPA 4ZHFA 2HZQA 3NP1A 2X45A 5AQ6A 3P6CA 3FIQA 2FWVA 2G7BA 2QO4A 3KQ0A 4UU2A 2HMBA 4D6BA 1U0XA 3HWFA 1QABE 1PMPA 3BX7A 1YIVA 2XSTA 3FA9A 4TKHA 3NQ9A 3NQ3A 5EEDA 1IIUA 1BM5A 1QWDA 3DSZA 1CBSA 4A1HA 5L8OA 1CBRA 2WUTA 1FEMA 1HQPA 1KQWA 3JS1A 4MVKA 4NNSA 1KXOA 4ARHA 3OJYC 4IB9A 5LJEA 5HZ9A 2FR3A 4YKOA 1I04A 1L6MA 2AT5X 5B27A 2IFBA 1CJ5A 3CQNA 2ACOA 3VG6A 4IBAA 4EDEA 3CR6A 4ODDA 1BLRA 1EPAA 3HWDA 5HCDC 2Q2PA 2FTBA 4TKJA 1QFVA 2GJ5A 2QM9A 4WFVA 4ZH6A 1X89A 1X71A 1JJXA 1FTPA 4YDBA 3D95A 3UEVA 1MVGA 2OVDA 3CBCA 3ELXA 5LJDA 1GXAA 1LIBA 1YWAA 4Y0QA 1ZNKA 1ZNLA 1CRBA 2NP1A 3PPTA 5EPQA 5F6BA 4AZPA 2WQ9A 3BSZE 1U18A 5IO6A 1SXWA 1G5WA 1DZJA 3UEXA 3PH6A 2POAA 3FW5A 1VYFA 4ORYA 2LKKA 4LKPA 2ANSA 1YWDA 1SY1A 3BX8A 1NP1A 4ORSA 4IB8A 4AZNA 1EPBA 4M7MA 4D6AA 1SA8A 5HCCC 1TOWA 4ORUA 1XCAA 3UEUA 2R74A 1D2UA 4CK4A 2OVEA 2WQAE 2JU7A 5IO7A 1BRQA 4ORXA 1KZWA 3O22A 5D47A 3AKMA 1LPJA 5B29A 2A0AA 1QG5A 2NNQA 2L67A 4YDAA 1EALA 3KFFA 1EIOA 5H8TA 4IB6A 1DC9A 1O8VA 3NR3A 1NGLA 2FS7A 1MX7A 3I17A 1VPRA 2FR2A 1B4MA 1TOUA 1JBHA 5HWZA 2NNDA 2MO5A 2W2BA 4IB7A 3SAOA 2JOZA 3PECA 1SY3A 1AVGI 4TNNA 2ACPX 4GH7A 4XMEA 5CE4A 2GC9A 3IA8A 1LIDA 5KICA 1OPBA 5LKFA 1GT3A 2ALLX 1GT5A 1SY2A 4ORRA 4DQ3A 1LNMA 1UREA 3JSQA 2FS6A 2KT4B 3BU1A 1DZPA 3DTQA 4HPAA 4WBKA 4K19A 3P6HA 1S7DA 2CM4A 4OS3A 4PSQA 4TJZA 3VG7A 1HMSA 1ICNA 4GNWA 4ZR2A 4AZOA 3MVFA 2HYSA 1KT3A 4NLJA 1BWYA 1X8UA 1FELA 1SXYA 4AYHA 1I4UA 4N7DA 2LBAA 4ZHGA 1GM6A 3U9PC 4O9SA 1HMRA 2AT6X 5KHPA 4ZJ0A 1DFVA 2CZTA 5H9KA 4ZHHA 3D97A 1T0VA 3EBKA 4XMDA 5HZ6A 4HPCA 4QZTA 2LBVA 2CM9A 4GKCA 2AKQA 2Q2MA 1ZNHA 3FENA 1B56A 2R73A 3O19A 2HZRA 3FEPA 1X8QA 2AT3X 4YGZA 5HTEA 4LZVA 4YCEA 3KFHA 4KIIA 5LJKA 3NADA 1TVQA 3CQRA 4XMCA 2JU3A 2FLJA 2QO5A 2FRSA 5D4AA 3ZUIA 3P6EA 1AB0A 1RLBE 3I0AA 1S44A 4MVIA 3VG4A 4OMWA 3U0DA 3BS2A 4N7CA 5H9AA 1KOIA 2PY1A 3MBTA 3RZYA 3B2HA 2QOSC 1YWBA 2XKLA 1H91A 1SXUA 4HPDA 1CBQA 1OBPA 1OEEA 5L8IA 1E06A 5HZQA 3STMX 5HZ5A 2K23A 3WJBA 2MJIA 3ELZA 4I9RA 3KFIA 5KIDA 4OS8A 1GT1A 2AMMX 2A3FX
chains in the Genus database with same CATH superfamily
4EXZA 1D3SA 3P6FA 4WBKA 2K62A 1SLGB 3APUA 4FBRA 3CMPA 3LHNA 1VWNB 4XMFA 2G79A 4KC8A 3APXA 2RTMA 4BJ8A 4BX6B 3ZUOA 3G7XA 3K3LA 4MVLA 2IZBA 5F6ZA 3UEWA 3EYCA 2IZIA 2OY1O 3B2LA 4QNIA 1MX8A 1T8VA 2W2AA 2C1SA 2CAMA 4KCAA 4QRLA 2DM5A 3MX7A 5DPQA 3WJGA 1IFBA 5L3YA 4U46A 1ERBA 1TW4A 4ZHDA 4I6SA 4O4SA 1ADLA 2Y32A 4GZVA 3TZSA 1SXXA 2FKGA 1GX9A 1AELA 3P6GA 4BBOA 3N91A 1ACDA 4QZUA 4ES7A 1GKAA 1JQPA 3S26A 4BX7B 2JU8A 2W2FA 4CPFA 1IW2A 3RE5A 1SMPI 5LKEA 2WEXA 1DV9A 3TF6A 1ZNDA 3WYQA 1A57A 1A3YA 3C76X 1JYDA 4QYNA 3UAQA 1PEEA 1WUBA 1R0UA 3WJDA 3C77X 1FDQA 1I78A 5B10O 1YP7A 1LFOA 1G74A 1HXLA 4I9SA 2NNEA 5HTDA 1QY1A 3SZHA 1HBQA 3LV4A 3EMMA 4YGHA 4JO6A 4CPHB 5LJCA 1KL5A 1E5PA 2A5BA 4IMOA 1G85A 4RUUA 3VGWA 4ZCBA 2OYBO 2FHLA 3VHIA 1VWAB 5F58A 3HK1A 2IZGB 3SLTA 5EDBA 5EEEA 4U8UN 5H9LA 2JW1A 1UZ2X 2C1QA 1YWCA 4QGXA 3NPOA 2VDFA 1EXSA 2FKJA 3ZW0A 1P6PA 2F73A 1I06A 4YFQA 2QO6A 4ZGUA 4BOEA 3SOTA 2GTLM 5AEOA 1MUPA 4BX5B 2X8FA 3OD9A 1HXZA 2A2GA 1UYOX 3FA6A 3FDCA 4ALBA 3S60A 4BCSA 3WJCA 4YH0A 1HMTA 1I9HA 3TGAA 1B0OA 1VWBB 1K24A 2BT9A 2IZJA 3HOEA 3HPEA 3LTWA 4ZH9A 3PP6A 2G78A 1GX8A 1KT5A 1KT6A 3NX1A 1EUOA 1U17A 3STNA 1FE3A 1VYGA 4Z27A 3H3IA 1Y52X 4R0BA 4C5PA 1AQBA 1X8PA 4U8UO 4HWMA 1FJ1E 4QGVA 4Y0PA 4YCHA 3U03A 2A13A 1N0SA 3RDXA 1OEJA 1NP4A 1GGLA 1LCZA 5LJHA 4AZQA 4MEEA 1VWGB 1LDQA 1B8EA 4GETA 5EDCA 2F01A 4L3RA 4EEJA 1EW3A 1DZKA 3FYFA 3EW2A 1DF3A 2E4JA 2HLVA 2IZAA 2RCQA 5FAZA 4AZMA 4DCBA 4YGGA 4COTA 1HBPA 1LCVA 2C4IA 5IRAA 1NDJA 3P02A 1S2PA 2RCTA 1BSYA 1VWDB 2AF5A 4GE1A 1NQNA 4MVEA 4I3CA 3JQOA 1VWPB 2G8CO 1ZNEA 1GKAB 3PK2A 2WWPA 2VFCA 2ZSCA 1KGLA 2FT9A 3F9DA 3HOLA 1LKEA 3QKGA 4QAEA 4GJSA 1A2DA 1JIWI 1K3BA 2Q9SA 1SRFA 4QYPA 3VHMA 5LJGA 1VWOB 3RDSA 2L9CA 1HQQA 5AJBA 3BU9A 4JGLA 5HA1A 4TKBA 1DZMA 1LICA 4NLIA 4HFOA 1MOYA 5D48A 3APWA 3NBXX 4NW4A 2ASNX 2CBSA 5F1EA 1SWFA 3FMZA 1HN2A 3FR2A 1JZUA 2MM3A 1ML7A 2RTCB 1KT7A 3P24A 1ZNGA 3PEDA 5K68A 4ORWA 4GGRA 1BRPA 1I05A 4BVMA 1Y55X 1IKJA 2IZKA 1X8OA 5FENA 5K06A 2UYWA 2GTFX 4YBPA 1SRHA 4MISA 3V8UA 5H9NA 2N93A 3RDQA 4ZHCA 4DQ4A 4XMHA 4M6SA 2JN3A 4WFUA 3RKGA 4CDFA 4B55A 3T6FA 2L5PA 3CWKA 2AL0X 1MM9A 2WSJA 3FA7A 4LZUA 3ZI8A 2R56A 3CKFA 1ERXA 2RTNB 2OFRX 4TLJA 4WHIA 4YFPA 4NYQA 2L68A 3WBGA 5L8NA 3L4RA 1KT4A 3B2JA 4OS0A 3D96A 1LF7A 2KTDA 4UU3A 4DNEA 1Y0GA 1OBUA 3VG3A 5BVSA 1O1VA 1A18A 2X55A 4NNTA 3EBWA 4O4UA 4GUZA 2CZUA 3WZOA 1G7NA 1OBQA 4QQ1A 3RY2A 1EQDA 3WVMA 4FQBB 4CDEA 4O4XA 1PBOA 4TQ2A 5K67A 2RTPB 3SZIA 5DG4A 3EC5A 2G5LA 2O62A 2RTIB 2RTRB 5FQ8E 4GU8A 2Q4NA 1W6FA 1BJ7A 2WEWA 2OFAA 3P6DA 3QQ2A 3ZZVA 3WXQA 2WR6A 4OELA 2AT8X 1FENA 1LUQA 1CBIA 2RQ0A 4RUNA 3STKA 2I5VO 5IXGA 1NC9A 2HNXA 2X56A 5B5GA 1KL3A 1BSOA 1VWRB 2P8GA 4GNYA 2OF8A 3AEHA 1E02A 4XMGA 5LJBA 1YUPA 1Z24A 1VYOA 1X8NA 1QY2A 1EIIA 1OEKA 2CBRA 4JNJA 3EW1A 2BHVA 4BQUA 5HA0A 4IABA 4A8ZA 4Z2OA 3APVA 5HZ8A 1QFTA 1MDCA 4ZFXA 3HWGA 1IJ8A 3FEKA 3BY0A 3BRNA 1SY0A 3PH5A 3VG2A 4ALOA 1OPAA 4PJ2A 2X46A 5F7GA 1SWSA 3FW4A 2OFMX 3Q6LA 2ZAGA 5D8JA 3TGCA 2RTFB 1BSQA 4GRJA 4L1NA 5IO5A 1ZRYA 2X8TA 3CKGA 4KT5A 2YG2A 5C0NA 3KFGA 3SLJA 4YBUA 2BC3A 2QOMA 5F2BA 4YMYA 2IZHB 5IRWA 4I60A 5HAEA 5BVQA 3WJFA 1PM1X 1KQXA 4FBOA 4YKMA 1QQSA 3BDRA 1GX3A 1GT4A 1LIEA 2WPUA 4NV7A 4OMXA 2GH7A 1ICMA 5B2AO 3FR5A 1MEPA 1JMZA 3FR4A 4AZRA 3VG5A 1UYNX 3KZAA 4NP1A 2AH7X 4A60A 4ZGFA 3WJEA 4QGWA 1RBPA 4Y0RA 1BEBA 1E00A 3O2YA 4I3BA 5BYPA 2MHDA 2EU7X 2A2UA 1VWMB 2LFOA 2FGSA 3HWEA 4KC7A 1YP6A 1XKIA 2BS6A 3TGBA 3B2IA 2RTKA 2MF6A 2OVAA 4NV8A 1KFFA 1JV4A 2Q39A 3ZQ3A 2RD7C 1SWNA 3FA8A 5HCEC 3ZWEA 1SLEB 2A8GA 3VHHA 5BVTA 4Y0SA 3T2XA 2RA6A 5AJCA 3B2KA 1O1UA 4EFGA 1W4TA 1SLDB 1LIFA 1SWJA 1KZXA 3RSWA 1T68X 1STPA 1TXLA 5FFHA 2LB6A 2LA7A 1IKEA 3FLLA 2OL6O 3AKNA 1ALBA 3GAQA 4ID2A 4A1YA 4FGIB 4U8UM 4YFRA 3T1DA 2VFBA 2AT0X 2BLGA 1SWBA 2RN4A 2RTAA 4AW8A 2AVIA 1IFCA 3RY1A 1N9MA 4IAWA 4IAXA 3C78X 3CBSA 1SWQA 3GE2A 5HBSA 3RBYA 3F8AA 1JJJA 5FQ6E 2RTOB 3IFBA 4I3DA 4IMNA 3SLOA 3WOVA 5D45A 2OZQA 4LKTA 4NYRA 5EZ2A 4EQAC 2X4MA 3BLGA 1JYJA 2X32A 4U3QA 4HPBA 4Z28A 1QY0A 3E3CA 1VWFB 3FELA 3NX2A 5JR8A 2DJFA 3EM0A 1BBPA 3RDOA 3WZNA 4ZHFA 2HZQA 3NP1A 2X45A 5AQ6A 3P6CA 3FIQA 2UZ2A 2FWVA 2G7BA 2GTLO 2IZFB 2QO4A 3KQ0A 4UU2A 2HMBA 4D6BA 1U0XA 3HWFA 1QABE 1PMPA 3BX7A 5B5FA 2BSZA 2BS5A 5FQ7E 1YIVA 2XSTA 3FA9A 1SLFB 2OFBA 4TKHA 3NQ9A 1DF8A 3NQ3A 1IIUA 1SWPA 5EEDA 1QWDA 2RTJA 3DSZA 1BM5A 3T6LA 1CBSA 1SRJA 4A1HA 4U9CA 1LELA 1Y53X 5L8OA 1CBRA 1OSPO 2WUTA 3MG5A 1FEMA 1HQPA 1SWDA 2OY5O 1KQWA 3JS1A 4MVKA 1Y9LA 4NNSA 5CYBA 3ZW0B 1KXOA 1VWIB 4ARHA 4CV7A 3OJYC 4IB9A 5LJEA 5HZ9A 2FR3A 1VWEB 1I04A 1L6MA 2AT5X 4YKOA 5B27A 2IFBA 1CJ5A 3CQNA 2ACOA 3RWXA 3VG6A 2KTSA 1N9YA 4IBAA 3SZJA 3CR6A 4ODDA 4EDEA 1BLRA 1RXJA 4GD9A 4BX5A 4GDZA 1EPAA 3HWDA 1Y9TA 5HCDC 2FTBA 1SRIA 2Q2PA 4TKJA 1QFVA 2GJ5A 2QM9A 3Q34A 4WFVA 1N7YA 1X89A 2RTGB 4ZH6A 1X71A 3RDMA 3VE2A 1JJXA 1FTPA 2OF9A 4YDBA 3D95A 2M4LA 3UEVA 2Z4HA 1MVGA 3VPJE 1RAVA 1RSTB 2OVDA 2RTQB 4Z2VA 3CBCA 3ELXA 5LJDA 1GXAA 1LIBA 1YWAA 2FHNX 4Y0QA 1ZNKA 1ZNLA 1CRBA 2NP1A 3PPTA 5EPQA 5F6BA 4AZPA 1NQMA 1SWUA 2WQ9A 1SWGA 1U18A 1PTSA 3BSZE 3PQSA 5IO6A 1SXWA 1G5WA 3RDUA 4MIRA 1DZJA 3UEXA 4CSBA 3PH6A 1RXKA 1SWAA 2POAA 3FW5A 4GGZA 4BGFA 1VYFA 2IZLB 4ORYA 3VU1A 1E2TA 2GTLN 4IRWA 2LKKA 4LKPA 2ANSA 1YWDA 5B3MO 1SY1A 2YMSA 3BX8A 4Z2PA 1NP1A 3OE3A 4ORSA 4IB8A 3PQUA 4INNA 4O3XB 4AZNA 1EPBA 2KD2A 2MWHA 3HTYA 4M7MA 4Y5DA 1LDOA 3WYPA 1SA8A 4D6AA 5HCCC 1TOWA 1VWLB 3WZPA 3AUMO 4ORUA 1XCAA 1SWRA 3UEUA 2R74A 1D2UA 3PDFA 2Z4IA 4CK4A 3FIDA 2OVEA 2IZCB 2QCBA 2WQAE 4O3ZA 5JD2A 4Y59A 2JU7A 1N43A 1BRQA 4ORXA 3VE1A 5IO7A 3O22A 1KZWA 1STSB 4CDDA 5D47A 2Y3FA 3AKMA 1LPJA 5B29A 1SREA 2X34A 2A0AA 4I95A 1QG5A 2IZEB 2NNQA 2A5CA 2L67A 4YDAA 1EALA 3KFFA 1EIOA 5H8TA 4IB6A 1DC9A 1O8VA 3NR3A 1NGLA 3KVNA 2FS7A 2ZAIA 1MX7A 3I17A 1VPRA 3T2WA 2FR2A 1B4MA 1TOUA 2JMBA 3D4RA 1JBHA 5HWZA 1PBYA 2NNDA 3ZW1A 2MO5A 4Z6JA 3D9WA 2W2BA 4IB7A 5CHKA 3SAOA 3S5XA 1LCWA 1VWJB 2JOZA 3PECA 1SY3A 1RXHA 1KL4A 1AVGI 4GK9A 4TNNA 2ACPX 4GH7A 4XMEA 5CE4A 2GC9A 2RTDB 3IA8A 1LIDA 1JMXA 1NBXA 2I5ZO 5KICA 1OPBA 5LKFA 1GT3A 2ALLX 1GT5A 4BX6A 1SY2A 4ORRA 1N4JA 1AVDA 1SRGA 4JHQA 4DQ3A 2PI3O 2OL8O 1LNMA 1UREA 4KH8A 1VWQB 3JSQA 2FS6A 2KT4B 3BU1A 1DZPA 3DTQA 4HPAA 4OEMA 4GDAA 4K19A 3P6HA 1S7DA 2CM4A 3F6ZB 2HKDA 4OS3A 4PSQA 4TJZA 1HMSA 3RE6A 1ICNA 4GNWA 4OKAA 3VG7A 4ZR2A 4AZOA 3MVFA 2HYSA 1KT3A 1VWKB 4NLJA 1BWYA 1SWHA 1X8UA 1FELA 4O4OA 1SXYA 4CPIA 4AYHA 4ML7B 5B11O 1I4UA 1STRB 2RTHB 4N7DA 2LBAA 1SWLA 4ZHGA 1GM6A 3U9PC 4O9SA 1HMRA 1JJUA 2AT6X 4BX7A 1SWCA 5KHPA 1AVEA 4ZJ0A 1DFVA 2CZTA 5H9KA 4ZHHA 1VWCB 3D97A 1RSUB 1VWHB 1T0VA 4ON1A 3EBKA 4XMDA 5HZ6A 4HPCA 4QZTA 4YVBA 2JGSA 2CM9A 4GKCA 4O49A 4O3WA 2AKQA 2RTEB 2LBVA 2Q2MA 1SWTA 3MM0A 1ZNHA 3FENA 1B56A 2R73A 3O19A 2HZRA 3FEPA 1HY2A 2RTBB 2QMIA 1X8QA 2AT3X 4YGZA 5HTEA 3ZW2A 4LZVA 2F09A 4YCEA 3KFHA 4KIIA 5LJKA 3NADA 4CPHA 1TVQA 3CQRA 4GGTA 4GJVA 4XMCA 2JU3A 2FLJA 2QO5A 4O3YA 1WBIA 2FRSA 5D4AA 3ZUIA 3P6EA 3NQKA 1AB0A 1RLBE 2OVSA 3I0AA 4CPEA 1S44A 4MVIA 2X8SA 1SWKA 2KW1A 4OMWA 3VG4A 3U0DA 3BS2A 4N7CA 1EI5A 5H9AA 1KOIA 2PY1A 1W5RA 5CSEA 3MBTA 4FBVA 3B2HA 3RZYA 2DJGA 2QOSC 1YWBA 5IRUA 2XKLA 1H91A 4LQZA 1SXUA 4HPDA 1CBQA 1OBPA 1OEEA 2OL7A 5L8IA 4EKVA 1E06A 5HZQA 2IZDB 3STMX 3X00A 5HZ5A 1SWEA 2K23A 3WJBA 4CDCA 2MJIA 3ELZA 4I9RA 3WZQA 3ZW1B 2Y3EA 2RTLA 1MK5A 2OY7A 3OBLA 3S5VA 3KFIA 5KIDA 4OS8A 1GT1A 2AMMX 2OY8A 1SWOA 2A3FX
chains in the Genus database with same CATH topology
4EXZA 1D3SA 3P6FA 2K62A 3APUA 4FBRA 3CMPA 3LHNA 4XMFA 2G79A 4KC8A 3APXA 3ZUOA 3G7XA 3K3LA 4MVLA 5F6ZA 3UEWA 3EYCA 3B2LA 4QNIA 1MX8A 1T8VA 2W2AA 4KCAA 4QRLA 2DM5A 3MX7A 5DPQA 3WJGA 1IFBA 1ERBA 1TW4A 4ZHDA 4I6SA 4O4SA 1ADLA 3TZSA 4GZVA 1SXXA 1AELA 1GX9A 3P6GA 3N91A 1ACDA 4QZUA 4ES7A 1GKAA 3S26A 2JU8A 2W2FA 1IW2A 1SMPI 5LKEA 2WEXA 1DV9A 3TF6A 1ZNDA 1A57A 1A3YA 3C76X 1JYDA 4QYNA 3UAQA 1PEEA 1R0UA 3WJDA 3C77X 1FDQA 1YP7A 1LFOA 1G74A 4I9SA 2NNEA 5HTDA 1QY1A 1HBQA 3LV4A 3EMMA 4YGHA 5LJCA 1E5PA 4IMOA 1G85A 4RUUA 4ZCBA 5F58A 3HK1A 5EDBA 5EEEA 4U8UN 5H9LA 2JW1A 1UZ2X 1YWCA 4QGXA 3NPOA 1EXSA 3ZW0A 1P6PA 2F73A 1I06A 4YFQA 2QO6A 4ZGUA 4BOEA 3SOTA 2GTLM 5AEOA 1MUPA 2X8FA 3OD9A 2A2GA 3FA6A 4ALBA 3S60A 3WJCA 4YH0A 1HMTA 3TGAA 1B0OA 3HOEA 4ZH9A 2BT9A 3PP6A 2G78A 1GX8A 1KT5A 1KT6A 3NX1A 1EUOA 1U17A 3STNA 1FE3A 1VYGA 3H3IA 4R0BA 1AQBA 1X8PA 4U8UO 4HWMA 4QGVA 4Y0PA 4YCHA 3U03A 2A13A 1N0SA 1OEJA 1NP4A 1GGLA 5LJHA 4AZQA 5EDCA 1B8EA 4GETA 4L3RA 4EEJA 1EW3A 1DZKA 3FYFA 1DF3A 2E4JA 2HLVA 2RCQA 5FAZA 4AZMA 4YGGA 4COTA 1HBPA 3P02A 1S2PA 2RCTA 1BSYA 4GE1A 4MVEA 4I3CA 3JQOA 1ZNEA 1GKAB 2WWPA 1KGLA 2FT9A 3F9DA 3HOLA 1LKEA 3QKGA 4QAEA 1A2DA 1JIWI 2Q9SA 4QYPA 5LJGA 2L9CA 5AJBA 3BU9A 4JGLA 5HA1A 4TKBA 1DZMA 1LICA 4NLIA 4HFOA 5D48A 3APWA 3NBXX 4NW4A 2ASNX 2CBSA 5F1EA 3FMZA 1HN2A 3FR2A 1JZUA 2MM3A 1ML7A 1KT7A 3P24A 1ZNGA 3PEDA 4ORWA 4BVMA 1BRPA 1I05A 1IKJA 1X8OA 5FENA 5K06A 2GTFX 4YBPA 4MISA 3V8UA 5H9NA 2N93A 4ZHCA 4DQ4A 4XMHA 4M6SA 2JN3A 4WFUA 3RKGA 2L5PA 3CWKA 2AL0X 2WSJA 3FA7A 4LZUA 3ZI8A 2R56A 4TLJA 1ERXA 4WHIA 2OFRX 4YFPA 5L8NA 4NYQA 2L68A 3WBGA 3L4RA 1KT4A 3B2JA 4OS0A 3D96A 1LF7A 2KTDA 4UU3A 1OBUA 3VG3A 5BVSA 1O1VA 1A18A 4NNTA 3EBWA 4O4UA 2CZUA 1G7NA 1OBQA 4QQ1A 1EQDA 3WVMA 4FQBB 4O4XA 1PBOA 4TQ2A 5DG4A 2O62A 5FQ8E 4GU8A 2Q4NA 1BJ7A 2WEWA 3P6DA 3ZZVA 3WXQA 2WR6A 2AT8X 1FENA 1CBIA 2RQ0A 4RUNA 3STKA 2HNXA 1BSOA 2P8GA 4GNYA 1E02A 4XMGA 5LJBA 1YUPA 1Z24A 1X8NA 1QY2A 1EIIA 1OEKA 2CBRA 2BHVA 4BQUA 5HA0A 4IABA 4A8ZA 3APVA 5HZ8A 1QFTA 1MDCA 4ZFXA 3HWGA 3FEKA 3BY0A 3BRNA 1SY0A 3PH5A 3VG2A 4ALOA 1OPAA 4PJ2A 2X46A 5F7GA 3FW4A 2OFMX 3Q6LA 2ZAGA 5D8JA 3TGCA 1BSQA 4GRJA 4L1NA 5IO5A 1ZRYA 2X8TA 4KT5A 2YG2A 5C0NA 3KFGA 4YBUA 4YMYA 5HAEA 5BVQA 3WJFA 1PM1X 1KQXA 4FBOA 4YKMA 1QQSA 3BDRA 4OMXA 1GT4A 1LIEA 1ICMA 3FR5A 3FR4A 4AZRA 3VG5A 3KZAA 4NP1A 4ZGFA 2AH7X 4A60A 3WJEA 4QGWA 1RBPA 4Y0RA 1BEBA 1E00A 3O2YA 4I3BA 5BYPA 2MHDA 2EU7X 2A2UA 2LFOA 4KC7A 3HWEA 1YP6A 1XKIA 2BS6A 3TGBA 3B2IA 2OVAA 1JV4A 2Q39A 3ZQ3A 2RD7C 3FA8A 5HCEC 3ZWEA 5BVTA 4Y0SA 2RA6A 5AJCA 3B2KA 1O1UA 4EFGA 1LIFA 1KZXA 3RSWA 1T68X 1TXLA 5FFHA 2LB6A 2LA7A 1IKEA 3FLLA 4ID2A 3AKNA 1ALBA 3GAQA 4A1YA 4FGIB 4U8UM 4YFRA 3T1DA 2AT0X 2BLGA 4AW8A 2RN4A 1IFCA 4IAWA 4IAXA 3C78X 3CBSA 3GE2A 5HBSA 1JJJA 3RBYA 3F8AA 5FQ6E 3IFBA 3WOVA 4I3DA 4IMNA 5D45A 2OZQA 4LKTA 4NYRA 5EZ2A 4EQAC 3BLGA 1JYJA 4U3QA 4HPBA 1QY0A 3E3CA 5JR8A 3FELA 3NX2A 3EM0A 1BBPA 4ZHFA 2HZQA 3NP1A 2X45A 5AQ6A 3P6CA 3FIQA 2FWVA 2G7BA 2GTLO 2QO4A 3KQ0A 4UU2A 2HMBA 4D6BA 1U0XA 3HWFA 1QABE 1PMPA 3BX7A 2BS5A 5FQ7E 1YIVA 2XSTA 3FA9A 4TKHA 3NQ9A 3NQ3A 5EEDA 1IIUA 1BM5A 1QWDA 3DSZA 1CBSA 4A1HA 4U9CA 5L8OA 1CBRA 2WUTA 1FEMA 1HQPA 1KQWA 3JS1A 4MVKA 1Y9LA 4NNSA 5CYBA 3ZW0B 1KXOA 4CV7A 4ARHA 3OJYC 4IB9A 5LJEA 5HZ9A 2FR3A 4YKOA 1I04A 1L6MA 2AT5X 5B27A 2IFBA 1CJ5A 3CQNA 2ACOA 3RWXA 3VG6A 2KTSA 4IBAA 4EDEA 3CR6A 4ODDA 1BLRA 4GDZA 1EPAA 3HWDA 1Y9TA 5HCDC 2FTBA 2Q2PA 4TKJA 1QFVA 2GJ5A 2QM9A 4WFVA 4ZH6A 1X89A 3VE2A 1X71A 1JJXA 1FTPA 4YDBA 3D95A 2M4LA 3UEVA 2Z4HA 1MVGA 3VPJE 2OVDA 3CBCA 3ELXA 5LJDA 1GXAA 1LIBA 1YWAA 4Y0QA 1ZNKA 1ZNLA 1CRBA 2NP1A 3PPTA 5EPQA 5F6BA 4AZPA 2WQ9A 3BSZE 1U18A 3PQSA 5IO6A 1SXWA 1G5WA 4MIRA 1DZJA 3UEXA 4CSBA 3PH6A 2POAA 3FW5A 1VYFA 4ORYA 3VU1A 2GTLN 2LKKA 4LKPA 2ANSA 1YWDA 1SY1A 2YMSA 3BX8A 1NP1A 3OE3A 4ORSA 4IB8A 3PQUA 4INNA 4O3XB 4AZNA 1EPBA 2KD2A 2MWHA 3HTYA 4M7MA 4D6AA 1SA8A 5HCCC 1TOWA 4ORUA 1XCAA 3UEUA 2R74A 1D2UA 2Z4IA 4CK4A 2OVEA 2WQAE 4O3ZA 2JU7A 3VE1A 1BRQA 4ORXA 5IO7A 1KZWA 3O22A 5D47A 3AKMA 1LPJA 5B29A 2A0AA 4I95A 1QG5A 2NNQA 2L67A 4YDAA 1EALA 3KFFA 1EIOA 5H8TA 4IB6A 1DC9A 1O8VA 3NR3A 1NGLA 2FS7A 2ZAIA 1MX7A 3I17A 1VPRA 2FR2A 1B4MA 1TOUA 2JMBA 3D4RA 1JBHA 5HWZA 2NNDA 3ZW1A 2MO5A 2W2BA 4IB7A 3SAOA 3S5XA 2JOZA 3PECA 1SY3A 1AVGI 4GK9A 4TNNA 2ACPX 4GH7A 4XMEA 5CE4A 2GC9A 3IA8A 1LIDA 5KICA 1OPBA 5LKFA 1GT3A 2ALLX 1GT5A 1SY2A 4ORRA 4DQ3A 1LNMA 1UREA 4KH8A 3JSQA 2FS6A 2KT4B 3BU1A 1DZPA 3DTQA 4HPAA 4WBKA 4K19A 3P6HA 1S7DA 2CM4A 3F6ZB 4OS3A 4PSQA 4TJZA 3VG7A 1HMSA 1ICNA 4GNWA 4ZR2A 4AZOA 3MVFA 2HYSA 1KT3A 4NLJA 1BWYA 1X8UA 1FELA 4O4OA 1SXYA 4AYHA 4ML7B 1I4UA 4N7DA 2LBAA 4ZHGA 1GM6A 3U9PC 4O9SA 1HMRA 2AT6X 5KHPA 4ZJ0A 1DFVA 2CZTA 5H9KA 4ZHHA 3D97A 4ON1A 1T0VA 3EBKA 4XMDA 5HZ6A 4HPCA 4QZTA 4O49A 2CM9A 4GKCA 4O3WA 2LBVA 2AKQA 2Q2MA 1ZNHA 3FENA 1B56A 2R73A 3O19A 2HZRA 3FEPA 2QMIA 1X8QA 2AT3X 4YGZA 5HTEA 3ZW2A 4LZVA 2F09A 4YCEA 3KFHA 4KIIA 5LJKA 3NADA 1TVQA 3CQRA 4XMCA 2JU3A 2FLJA 2QO5A 4O3YA 2FRSA 5D4AA 3ZUIA 3P6EA 3NQKA 1AB0A 1RLBE 2OVSA 3I0AA 1S44A 4MVIA 2X8SA 2KW1A 3VG4A 4OMWA 3U0DA 3BS2A 4N7CA 1EI5A 5H9AA 1KOIA 2PY1A 3MBTA 4FBVA 3B2HA 3RZYA 2QOSC 1YWBA 2XKLA 1H91A 4LQZA 1SXUA 4HPDA 1CBQA 1OBPA 1OEEA 5L8IA 1E06A 5HZQA 3STMX 5HZ5A 2K23A 3WJBA 2MJIA 3ELZA 4I9RA 3ZW1B 3S5VA 3OBLA 3KFIA 5KIDA 4OS8A 1GT1A 2AMMX 2A3FX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EXZ A;  1D3S A;  3P6F A;  2K62 A;  3APU A;  3CMP A;  4XMF A;  2G79 A;  3APX A;  3ZUO A;  3G7X A;  3K3L A;  4MVL A;  5F6Z A;  3UEW A;  3EYC A;  3B2L A;  1MX8 A;  1T8V A;  2W2A A;  2DM5 A;  5DPQ A;  3WJG A;  1IFB A;  1ERB A;  1TW4 A;  4ZHD A;  1ADL A;  3TZS A;  1SXX A;  1AEL A;  1GX9 A;  3P6G A;  1ACD A;  4QZU A;  4ES7 A;  1GKA A;  3S26 A;  2JU8 A;  2W2F A;  1IW2 A;  5LKE A;  2WEX A;  1DV9 A;  3TF6 A;  1ZND A;  1A57 A;  1A3Y A;  3C76 X;  1JYD A;  4QYN A;  1PEE A;  1R0U A;  3WJD A;  3C77 X;  1FDQ A;  1YP7 A;  1LFO A;  1G74 A;  4I9S A;  2NNE A;  5HTD A;  1QY1 A;  1HBQ A;  3EMM A;  4YGH A;  5LJC A;  1E5P A;  4IMO A;  1G85 A;  4RUU A;  4ZCB A;  5F58 A;  3HK1 A;  5EDB A;  5EEE A;  5H9L A;  1UZ2 X;  1YWC A;  4QGX A;  3NPO A;  1EXS A;  1P6P A;  2F73 A;  1I06 A;  4YFQ A;  2QO6 A;  4ZGU A;  4BOE A;  1MUP A;  2A2G A;  3FA6 A;  4ALB A;  3WJC A;  4YH0 A;  1HMT A;  3TGA A;  1B0O A;  4ZH9 A;  3PP6 A;  2G78 A;  1GX8 A;  1KT5 A;  1KT6 A;  3NX1 A;  1EUO A;  1U17 A;  3STN A;  1FE3 A;  1VYG A;  4R0B A;  1AQB A;  1X8P A;  4QGV A;  4Y0P A;  4YCH A;  3U03 A;  2A13 A;  1N0S A;  1OEJ A;  1NP4 A;  1GGL A;  5LJH A;  4AZQ A;  5EDC A;  1B8E A;  4GET A;  4EEJ A;  1EW3 A;  1DZK A;  1DF3 A;  2E4J A;  2HLV A;  2RCQ A;  5FAZ A;  4AZM A;  4YGG A;  1HBP A;  1S2P A;  2RCT A;  1BSY A;  4GE1 A;  4I3C A;  1ZNE A;  1GKA B;  2WWP A;  1KGL A;  2FT9 A;  3F9D A;  4QAE A;  1LKE A;  3QKG A;  1A2D A;  2Q9S A;  4QYP A;  5LJG A;  2L9C A;  3BU9 A;  5HA1 A;  4TKB A;  1DZM A;  1LIC A;  4NLI A;  4HFO A;  5D48 A;  3APW A;  2ASN X;  2CBS A;  5F1E A;  3FMZ A;  1HN2 A;  3FR2 A;  1JZU A;  2MM3 A;  1ML7 A;  1KT7 A;  1ZNG A;  3PED A;  4ORW A;  4BVM A;  1BRP A;  1I05 A;  1IKJ A;  1X8O A;  5FEN A;  5K06 A;  2GTF X;  4YBP A;  5H9N A;  2N93 A;  4ZHC A;  4DQ4 A;  4XMH A;  4M6S A;  2JN3 A;  4WFU A;  2L5P A;  3CWK A;  2AL0 X;  2WSJ A;  3FA7 A;  4LZU A;  2R56 A;  4TLJ A;  1ERX A;  4YFP A;  2OFR X;  5L8N A;  4NYQ A;  2L68 A;  3WBG A;  3L4R A;  1KT4 A;  3B2J A;  4OS0 A;  3D96 A;  1LF7 A;  2KTD A;  4UU3 A;  1OBU A;  3VG3 A;  5BVS A;  1O1V A;  1A18 A;  4NNT A;  3EBW A;  2CZU A;  1G7N A;  1OBQ A;  1EQD A;  3WVM A;  1PBO A;  4TQ2 A;  5DG4 A;  2O62 A;  2Q4N A;  1BJ7 A;  2WEW A;  3P6D A;  3WXQ A;  2WR6 A;  2AT8 X;  1FEN A;  1CBI A;  2RQ0 A;  4RUN A;  3STK A;  2HNX A;  1BSO A;  2P8G A;  4GNY A;  1E02 A;  4XMG A;  5LJB A;  1YUP A;  1Z24 A;  1X8N A;  1QY2 A;  1EII A;  1OEK A;  2CBR A;  4BQU A;  5HA0 A;  4A8Z A;  3APV A;  5HZ8 A;  1QFT A;  1MDC A;  4ZFX A;  3HWG A;  3FEK A;  3BY0 A;  3BRN A;  1SY0 A;  3PH5 A;  3VG2 A;  4ALO A;  1OPA A;  2X46 A;  5F7G A;  3FW4 A;  2OFM X;  3Q6L A;  5D8J A;  3TGC A;  1BSQ A;  4GRJ A;  5IO5 A;  1ZRY A;  2YG2 A;  5C0N A;  3KFG A;  4YBU A;  4YMY A;  5HAE A;  5BVQ A;  3WJF A;  1PM1 X;  1KQX A;  4YKM A;  1QQS A;  3BDR A;  4OMX A;  1GT4 A;  1LIE A;  1ICM A;  3FR5 A;  3FR4 A;  4AZR A;  3VG5 A;  3KZA A;  4NP1 A;  2AH7 X;  4A60 A;  3WJE A;  4QGW A;  1RBP A;  4Y0R A;  1BEB A;  1E00 A;  3O2Y A;  4I3B A;  2EU7 X;  2A2U A;  2LFO A;  3HWE A;  1YP6 A;  1XKI A;  3TGB A;  3B2I A;  2OVA A;  1JV4 A;  2Q39 A;  3ZQ3 A;  2RD7 C;  3FA8 A;  5HCE C;  5BVT A;  4Y0S A;  2RA6 A;  3B2K A;  1O1U A;  4EFG A;  1LIF A;  1KZX A;  3RSW A;  1T68 X;  1TXL A;  5FFH A;  2LB6 A;  1IKE A;  3FLL A;  3AKN A;  1ALB A;  3GAQ A;  4A1Y A;  4YFR A;  3T1D A;  2AT0 X;  2BLG A;  4AW8 A;  1IFC A;  4IAW A;  4IAX A;  3C78 X;  3CBS A;  1JJJ A;  5HBS A;  3F8A A;  3IFB A;  4I3D A;  4IMN A;  5D45 A;  2OZQ A;  4LKT A;  4NYR A;  5EZ2 A;  3BLG A;  1JYJ A;  4HPB A;  1QY0 A;  5JR8 A;  3FEL A;  3NX2 A;  3EM0 A;  1BBP A;  4ZHF A;  2HZQ A;  3NP1 A;  2X45 A;  5AQ6 A;  3P6C A;  3FIQ A;  2FWV A;  2G7B A;  2QO4 A;  3KQ0 A;  4UU2 A;  2HMB A;  4D6B A;  1U0X A;  3HWF A;  1QAB E;  1PMP A;  3BX7 A;  1YIV A;  2XST A;  3FA9 A;  4TKH A;  3NQ9 A;  3NQ3 A;  5EED A;  1IIU A;  1BM5 A;  1QWD A;  3DSZ A;  1CBS A;  4A1H A;  5L8O A;  1CBR A;  2WUT A;  1FEM A;  1HQP A;  1KQW A;  3JS1 A;  4MVK A;  4NNS A;  1KXO A;  4ARH A;  3OJY C;  4IB9 A;  5LJE A;  5HZ9 A;  2FR3 A;  4YKO A;  1I04 A;  1L6M A;  2AT5 X;  5B27 A;  2IFB A;  1CJ5 A;  3CQN A;  2ACO A;  3VG6 A;  4IBA A;  4EDE A;  3CR6 A;  4ODD A;  1BLR A;  1EPA A;  3HWD A;  5HCD C;  2Q2P A;  2FTB A;  4TKJ A;  1QFV A;  2GJ5 A;  2QM9 A;  4WFV A;  4ZH6 A;  1X89 A;  1X71 A;  1JJX A;  1FTP A;  4YDB A;  3D95 A;  3UEV A;  1MVG A;  2OVD A;  3CBC A;  3ELX A;  5LJD A;  1GXA A;  1LIB A;  1YWA A;  4Y0Q A;  1ZNK A;  1ZNL A;  1CRB A;  2NP1 A;  3PPT A;  5EPQ A;  5F6B A;  4AZP A;  2WQ9 A;  3BSZ E;  1U18 A;  5IO6 A;  1SXW A;  1G5W A;  1DZJ A;  3UEX A;  3PH6 A;  2POA A;  3FW5 A;  1VYF A;  4ORY A;  2LKK A;  4LKP A;  2ANS A;  1YWD A;  1SY1 A;  3BX8 A;  1NP1 A;  4ORS A;  4IB8 A;  4AZN A;  1EPB A;  4M7M A;  4D6A A;  1SA8 A;  5HCC C;  1TOW A;  4ORU A;  1XCA A;  3UEU A;  2R74 A;  1D2U A;  4CK4 A;  2OVE A;  2WQA E;  2JU7 A;  5IO7 A;  1BRQ A;  4ORX A;  1KZW A;  3O22 A;  5D47 A;  3AKM A;  1LPJ A;  5B29 A;  2A0A A;  1QG5 A;  2NNQ A;  2L67 A;  4YDA A;  1EAL A;  3KFF A;  1EIO A;  5H8T A;  4IB6 A;  1DC9 A;  1O8V A;  3NR3 A;  1NGL A;  2FS7 A;  1MX7 A;  3I17 A;  1VPR A;  2FR2 A;  1B4M A;  1TOU A;  1JBH A;  5HWZ A;  2NND A;  2MO5 A;  2W2B A;  4IB7 A;  3SAO A;  2JOZ A;  3PEC A;  1SY3 A;  1AVG I;  4TNN A;  2ACP X;  4GH7 A;  4XME A;  5CE4 A;  2GC9 A;  3IA8 A;  1LID A;  5KIC A;  1OPB A;  5LKF A;  1GT3 A;  2ALL X;  1GT5 A;  1SY2 A;  4ORR A;  4DQ3 A;  1LNM A;  1URE A;  3JSQ A;  2FS6 A;  2KT4 B;  3BU1 A;  1DZP A;  3DTQ A;  4HPA A;  4WBK A;  4K19 A;  3P6H A;  1S7D A;  2CM4 A;  4OS3 A;  4PSQ A;  4TJZ A;  3VG7 A;  1HMS A;  1ICN A;  4GNW A;  4ZR2 A;  4AZO A;  3MVF A;  2HYS A;  1KT3 A;  4NLJ A;  1BWY A;  1X8U A;  1FEL A;  1SXY A;  4AYH A;  1I4U A;  4N7D A;  2LBA A;  4ZHG A;  1GM6 A;  3U9P C;  4O9S A;  1HMR A;  2AT6 X;  5KHP A;  4ZJ0 A;  1DFV A;  2CZT A;  5H9K A;  4ZHH A;  3D97 A;  1T0V A;  3EBK A;  4XMD A;  5HZ6 A;  4HPC A;  4QZT A;  2LBV A;  2CM9 A;  4GKC A;  2AKQ A;  2Q2M A;  1ZNH A;  3FEN A;  1B56 A;  2R73 A;  3O19 A;  2HZR A;  3FEP A;  1X8Q A;  2AT3 X;  4YGZ A;  5HTE A;  4LZV A;  4YCE A;  3KFH A;  4KII A;  5LJK A;  3NAD A;  1TVQ A;  3CQR A;  4XMC A;  2JU3 A;  2FLJ A;  2QO5 A;  2FRS A;  5D4A A;  3ZUI A;  3P6E A;  1AB0 A;  1RLB E;  3I0A A;  1S44 A;  4MVI A;  3VG4 A;  4OMW A;  3U0D A;  3BS2 A;  4N7C A;  5H9A A;  1KOI A;  2PY1 A;  3MBT A;  3RZY A;  3B2H A;  2QOS C;  1YWB A;  2XKL A;  1H91 A;  1SXU A;  4HPD A;  1CBQ A;  1OBP A;  1OEE A;  5L8I A;  1E06 A;  5HZQ A;  3STM X;  5HZ5 A;  2K23 A;  3WJB A;  2MJI A;  3ELZ A;  4I9R A;  3KFI A;  5KID A;  4OS8 A;  1GT1 A;  2AMM X;  2A3F X; 
#chains in the Genus database with same CATH topology
 4EXZ A;  1D3S A;  3P6F A;  4WBK A;  2K62 A;  1SLG B;  3APU A;  4FBR A;  3CMP A;  3LHN A;  1VWN B;  4XMF A;  2G79 A;  4KC8 A;  3APX A;  2RTM A;  4BJ8 A;  4BX6 B;  3ZUO A;  3G7X A;  3K3L A;  4MVL A;  2IZB A;  5F6Z A;  3UEW A;  3EYC A;  2IZI A;  2OY1 O;  3B2L A;  4QNI A;  1MX8 A;  1T8V A;  2W2A A;  2C1S A;  2CAM A;  4KCA A;  4QRL A;  2DM5 A;  3MX7 A;  5DPQ A;  3WJG A;  1IFB A;  5L3Y A;  4U46 A;  1ERB A;  1TW4 A;  4ZHD A;  4I6S A;  4O4S A;  1ADL A;  2Y32 A;  4GZV A;  3TZS A;  1SXX A;  2FKG A;  1GX9 A;  1AEL A;  3P6G A;  4BBO A;  3N91 A;  1ACD A;  4QZU A;  4ES7 A;  1GKA A;  1JQP A;  3S26 A;  4BX7 B;  2JU8 A;  2W2F A;  4CPF A;  1IW2 A;  3RE5 A;  1SMP I;  5LKE A;  2WEX A;  1DV9 A;  3TF6 A;  1ZND A;  3WYQ A;  1A57 A;  1A3Y A;  3C76 X;  1JYD A;  4QYN A;  3UAQ A;  1PEE A;  1WUB A;  1R0U A;  3WJD A;  3C77 X;  1FDQ A;  1I78 A;  5B10 O;  1YP7 A;  1LFO A;  1G74 A;  1HXL A;  4I9S A;  2NNE A;  5HTD A;  1QY1 A;  3SZH A;  1HBQ A;  3LV4 A;  3EMM A;  4YGH A;  4JO6 A;  4CPH B;  5LJC A;  1KL5 A;  1E5P A;  2A5B A;  4IMO A;  1G85 A;  4RUU A;  3VGW A;  4ZCB A;  2OYB O;  2FHL A;  3VHI A;  1VWA B;  5F58 A;  3HK1 A;  2IZG B;  3SLT A;  5EDB A;  5EEE A;  4U8U N;  5H9L A;  2JW1 A;  1UZ2 X;  2C1Q A;  1YWC A;  4QGX A;  3NPO A;  2VDF A;  1EXS A;  2FKJ A;  3ZW0 A;  1P6P A;  2F73 A;  1I06 A;  4YFQ A;  2QO6 A;  4ZGU A;  4BOE A;  3SOT A;  2GTL M;  5AEO A;  1MUP A;  4BX5 B;  2X8F A;  3OD9 A;  1HXZ A;  2A2G A;  1UYO X;  3FA6 A;  3FDC A;  4ALB A;  3S60 A;  4BCS A;  3WJC A;  4YH0 A;  1HMT A;  1I9H A;  3TGA A;  1B0O A;  1VWB B;  1K24 A;  2BT9 A;  2IZJ A;  3HOE A;  3HPE A;  3LTW A;  4ZH9 A;  3PP6 A;  2G78 A;  1GX8 A;  1KT5 A;  1KT6 A;  3NX1 A;  1EUO A;  1U17 A;  3STN A;  1FE3 A;  1VYG A;  4Z27 A;  3H3I A;  1Y52 X;  4R0B A;  4C5P A;  1AQB A;  1X8P A;  4U8U O;  4HWM A;  1FJ1 E;  4QGV A;  4Y0P A;  4YCH A;  3U03 A;  2A13 A;  1N0S A;  3RDX A;  1OEJ A;  1NP4 A;  1GGL A;  1LCZ A;  5LJH A;  4AZQ A;  4MEE A;  1VWG B;  1LDQ A;  1B8E A;  4GET A;  5EDC A;  2F01 A;  4L3R A;  4EEJ A;  1EW3 A;  1DZK A;  3FYF A;  3EW2 A;  1DF3 A;  2E4J A;  2HLV A;  2IZA A;  2RCQ A;  5FAZ A;  4AZM A;  4DCB A;  4YGG A;  4COT A;  1HBP A;  1LCV A;  2C4I A;  5IRA A;  1NDJ A;  3P02 A;  1S2P A;  2RCT A;  1BSY A;  1VWD B;  2AF5 A;  4GE1 A;  1NQN A;  4MVE A;  4I3C A;  3JQO A;  1VWP B;  2G8C O;  1ZNE A;  1GKA B;  3PK2 A;  2WWP A;  2VFC A;  2ZSC A;  1KGL A;  2FT9 A;  3F9D A;  3HOL A;  1LKE A;  3QKG A;  4QAE A;  4GJS A;  1A2D A;  1JIW I;  1K3B A;  2Q9S A;  1SRF A;  4QYP A;  3VHM A;  5LJG A;  1VWO B;  3RDS A;  2L9C A;  1HQQ A;  5AJB A;  3BU9 A;  4JGL A;  5HA1 A;  4TKB A;  1DZM A;  1LIC A;  4NLI A;  4HFO A;  1MOY A;  5D48 A;  3APW A;  3NBX X;  4NW4 A;  2ASN X;  2CBS A;  5F1E A;  1SWF A;  3FMZ A;  1HN2 A;  3FR2 A;  1JZU A;  2MM3 A;  1ML7 A;  2RTC B;  1KT7 A;  3P24 A;  1ZNG A;  3PED A;  5K68 A;  4ORW A;  4GGR A;  1BRP A;  1I05 A;  4BVM A;  1Y55 X;  1IKJ A;  2IZK A;  1X8O A;  5FEN A;  5K06 A;  2UYW A;  2GTF X;  4YBP A;  1SRH A;  4MIS A;  3V8U A;  5H9N A;  2N93 A;  3RDQ A;  4ZHC A;  4DQ4 A;  4XMH A;  4M6S A;  2JN3 A;  4WFU A;  3RKG A;  4CDF A;  4B55 A;  3T6F A;  2L5P A;  3CWK A;  2AL0 X;  1MM9 A;  2WSJ A;  3FA7 A;  4LZU A;  3ZI8 A;  2R56 A;  3CKF A;  1ERX A;  2RTN B;  2OFR X;  4TLJ A;  4WHI A;  4YFP A;  4NYQ A;  2L68 A;  3WBG A;  5L8N A;  3L4R A;  1KT4 A;  3B2J A;  4OS0 A;  3D96 A;  1LF7 A;  2KTD A;  4UU3 A;  4DNE A;  1Y0G A;  1OBU A;  3VG3 A;  5BVS A;  1O1V A;  1A18 A;  2X55 A;  4NNT A;  3EBW A;  4O4U A;  4GUZ A;  2CZU A;  3WZO A;  1G7N A;  1OBQ A;  4QQ1 A;  3RY2 A;  1EQD A;  3WVM A;  4FQB B;  4CDE A;  4O4X A;  1PBO A;  4TQ2 A;  5K67 A;  2RTP B;  3SZI A;  5DG4 A;  3EC5 A;  2G5L A;  2O62 A;  2RTI B;  2RTR B;  5FQ8 E;  4GU8 A;  2Q4N A;  1W6F A;  1BJ7 A;  2WEW A;  2OFA A;  3P6D A;  3QQ2 A;  3ZZV A;  3WXQ A;  2WR6 A;  4OEL A;  2AT8 X;  1FEN A;  1LUQ A;  1CBI A;  2RQ0 A;  4RUN A;  3STK A;  2I5V O;  5IXG A;  1NC9 A;  2HNX A;  2X56 A;  5B5G A;  1KL3 A;  1BSO A;  1VWR B;  2P8G A;  4GNY A;  2OF8 A;  3AEH A;  1E02 A;  4XMG A;  5LJB A;  1YUP A;  1Z24 A;  1VYO A;  1X8N A;  1QY2 A;  1EII A;  1OEK A;  2CBR A;  4JNJ A;  3EW1 A;  2BHV A;  4BQU A;  5HA0 A;  4IAB A;  4A8Z A;  4Z2O A;  3APV A;  5HZ8 A;  1QFT A;  1MDC A;  4ZFX A;  3HWG A;  1IJ8 A;  3FEK A;  3BY0 A;  3BRN A;  1SY0 A;  3PH5 A;  3VG2 A;  4ALO A;  1OPA A;  4PJ2 A;  2X46 A;  5F7G A;  1SWS A;  3FW4 A;  2OFM X;  3Q6L A;  2ZAG A;  5D8J A;  3TGC A;  2RTF B;  1BSQ A;  4GRJ A;  4L1N A;  5IO5 A;  1ZRY A;  2X8T A;  3CKG A;  4KT5 A;  2YG2 A;  5C0N A;  3KFG A;  3SLJ A;  4YBU A;  2BC3 A;  2QOM A;  5F2B A;  4YMY A;  2IZH B;  5IRW A;  4I60 A;  5HAE A;  5BVQ A;  3WJF A;  1PM1 X;  1KQX A;  4FBO A;  4YKM A;  1QQS A;  3BDR A;  1GX3 A;  1GT4 A;  1LIE A;  2WPU A;  4NV7 A;  4OMX A;  2GH7 A;  1ICM A;  5B2A O;  3FR5 A;  1MEP A;  1JMZ A;  3FR4 A;  4AZR A;  3VG5 A;  1UYN X;  3KZA A;  4NP1 A;  2AH7 X;  4A60 A;  4ZGF A;  3WJE A;  4QGW A;  1RBP A;  4Y0R A;  1BEB A;  1E00 A;  3O2Y A;  4I3B A;  5BYP A;  2MHD A;  2EU7 X;  2A2U A;  1VWM B;  2LFO A;  2FGS A;  3HWE A;  4KC7 A;  1YP6 A;  1XKI A;  2BS6 A;  3TGB A;  3B2I A;  2RTK A;  2MF6 A;  2OVA A;  4NV8 A;  1KFF A;  1JV4 A;  2Q39 A;  3ZQ3 A;  2RD7 C;  1SWN A;  3FA8 A;  5HCE C;  3ZWE A;  1SLE B;  2A8G A;  3VHH A;  5BVT A;  4Y0S A;  3T2X A;  2RA6 A;  5AJC A;  3B2K A;  1O1U A;  4EFG A;  1W4T A;  1SLD B;  1LIF A;  1SWJ A;  1KZX A;  3RSW A;  1T68 X;  1STP A;  1TXL A;  5FFH A;  2LB6 A;  2LA7 A;  1IKE A;  3FLL A;  2OL6 O;  3AKN A;  1ALB A;  3GAQ A;  4ID2 A;  4A1Y A;  4FGI B;  4U8U M;  4YFR A;  3T1D A;  2VFB A;  2AT0 X;  2BLG A;  1SWB A;  2RN4 A;  2RTA A;  4AW8 A;  2AVI A;  1IFC A;  3RY1 A;  1N9M A;  4IAW A;  4IAX A;  3C78 X;  3CBS A;  1SWQ A;  3GE2 A;  5HBS A;  3RBY A;  3F8A A;  1JJJ A;  5FQ6 E;  2RTO B;  3IFB A;  4I3D A;  4IMN A;  3SLO A;  3WOV A;  5D45 A;  2OZQ A;  4LKT A;  4NYR A;  5EZ2 A;  4EQA C;  2X4M A;  3BLG A;  1JYJ A;  2X32 A;  4U3Q A;  4HPB A;  4Z28 A;  1QY0 A;  3E3C A;  1VWF B;  3FEL A;  3NX2 A;  5JR8 A;  2DJF A;  3EM0 A;  1BBP A;  3RDO A;  3WZN A;  4ZHF A;  2HZQ A;  3NP1 A;  2X45 A;  5AQ6 A;  3P6C A;  3FIQ A;  2UZ2 A;  2FWV A;  2G7B A;  2GTL O;  2IZF B;  2QO4 A;  3KQ0 A;  4UU2 A;  2HMB A;  4D6B A;  1U0X A;  3HWF A;  1QAB E;  1PMP A;  3BX7 A;  5B5F A;  2BSZ A;  2BS5 A;  5FQ7 E;  1YIV A;  2XST A;  3FA9 A;  1SLF B;  2OFB A;  4TKH A;  3NQ9 A;  1DF8 A;  3NQ3 A;  1IIU A;  1SWP A;  5EED A;  1QWD A;  2RTJ A;  3DSZ A;  1BM5 A;  3T6L A;  1CBS A;  1SRJ A;  4A1H A;  4U9C A;  1LEL A;  1Y53 X;  5L8O A;  1CBR A;  1OSP O;  2WUT A;  3MG5 A;  1FEM A;  1HQP A;  1SWD A;  2OY5 O;  1KQW A;  3JS1 A;  4MVK A;  1Y9L A;  4NNS A;  5CYB A;  3ZW0 B;  1KXO A;  1VWI B;  4ARH A;  4CV7 A;  3OJY C;  4IB9 A;  5LJE A;  5HZ9 A;  2FR3 A;  1VWE B;  1I04 A;  1L6M A;  2AT5 X;  4YKO A;  5B27 A;  2IFB A;  1CJ5 A;  3CQN A;  2ACO A;  3RWX A;  3VG6 A;  2KTS A;  1N9Y A;  4IBA A;  3SZJ A;  3CR6 A;  4ODD A;  4EDE A;  1BLR A;  1RXJ A;  4GD9 A;  4BX5 A;  4GDZ A;  1EPA A;  3HWD A;  1Y9T A;  5HCD C;  2FTB A;  1SRI A;  2Q2P A;  4TKJ A;  1QFV A;  2GJ5 A;  2QM9 A;  3Q34 A;  4WFV A;  1N7Y A;  1X89 A;  2RTG B;  4ZH6 A;  1X71 A;  3RDM A;  3VE2 A;  1JJX A;  1FTP A;  2OF9 A;  4YDB A;  3D95 A;  2M4L A;  3UEV A;  2Z4H A;  1MVG A;  3VPJ E;  1RAV A;  1RST B;  2OVD A;  2RTQ B;  4Z2V A;  3CBC A;  3ELX A;  5LJD A;  1GXA A;  1LIB A;  1YWA A;  2FHN X;  4Y0Q A;  1ZNK A;  1ZNL A;  1CRB A;  2NP1 A;  3PPT A;  5EPQ A;  5F6B A;  4AZP A;  1NQM A;  1SWU A;  2WQ9 A;  1SWG A;  1U18 A;  1PTS A;  3BSZ E;  3PQS A;  5IO6 A;  1SXW A;  1G5W A;  3RDU A;  4MIR A;  1DZJ A;  3UEX A;  4CSB A;  3PH6 A;  1RXK A;  1SWA A;  2POA A;  3FW5 A;  4GGZ A;  4BGF A;  1VYF A;  2IZL B;  4ORY A;  3VU1 A;  1E2T A;  2GTL N;  4IRW A;  2LKK A;  4LKP A;  2ANS A;  1YWD A;  5B3M O;  1SY1 A;  2YMS A;  3BX8 A;  4Z2P A;  1NP1 A;  3OE3 A;  4ORS A;  4IB8 A;  3PQU A;  4INN A;  4O3X B;  4AZN A;  1EPB A;  2KD2 A;  2MWH A;  3HTY A;  4M7M A;  4Y5D A;  1LDO A;  3WYP A;  1SA8 A;  4D6A A;  5HCC C;  1TOW A;  1VWL B;  3WZP A;  3AUM O;  4ORU A;  1XCA A;  1SWR A;  3UEU A;  2R74 A;  1D2U A;  3PDF A;  2Z4I A;  4CK4 A;  3FID A;  2OVE A;  2IZC B;  2QCB A;  2WQA E;  4O3Z A;  5JD2 A;  4Y59 A;  2JU7 A;  1N43 A;  1BRQ A;  4ORX A;  3VE1 A;  5IO7 A;  3O22 A;  1KZW A;  1STS B;  4CDD A;  5D47 A;  2Y3F A;  3AKM A;  1LPJ A;  5B29 A;  1SRE A;  2X34 A;  2A0A A;  4I95 A;  1QG5 A;  2IZE B;  2NNQ A;  2A5C A;  2L67 A;  4YDA A;  1EAL A;  3KFF A;  1EIO A;  5H8T A;  4IB6 A;  1DC9 A;  1O8V A;  3NR3 A;  1NGL A;  3KVN A;  2FS7 A;  2ZAI A;  1MX7 A;  3I17 A;  1VPR A;  3T2W A;  2FR2 A;  1B4M A;  1TOU A;  2JMB A;  3D4R A;  1JBH A;  5HWZ A;  1PBY A;  2NND A;  3ZW1 A;  2MO5 A;  4Z6J A;  3D9W A;  2W2B A;  4IB7 A;  5CHK A;  3SAO A;  3S5X A;  1LCW A;  1VWJ B;  2JOZ A;  3PEC A;  1SY3 A;  1RXH A;  1KL4 A;  1AVG I;  4GK9 A;  4TNN A;  2ACP X;  4GH7 A;  4XME A;  5CE4 A;  2GC9 A;  2RTD B;  3IA8 A;  1LID A;  1JMX A;  1NBX A;  2I5Z O;  5KIC A;  1OPB A;  5LKF A;  1GT3 A;  2ALL X;  1GT5 A;  4BX6 A;  1SY2 A;  4ORR A;  1N4J A;  1AVD A;  1SRG A;  4JHQ A;  4DQ3 A;  2PI3 O;  2OL8 O;  1LNM A;  1URE A;  4KH8 A;  1VWQ B;  3JSQ A;  2FS6 A;  2KT4 B;  3BU1 A;  1DZP A;  3DTQ A;  4HPA A;  4OEM A;  4GDA A;  4K19 A;  3P6H A;  1S7D A;  2CM4 A;  3F6Z B;  2HKD A;  4OS3 A;  4PSQ A;  4TJZ A;  1HMS A;  3RE6 A;  1ICN A;  4GNW A;  4OKA A;  3VG7 A;  4ZR2 A;  4AZO A;  3MVF A;  2HYS A;  1KT3 A;  1VWK B;  4NLJ A;  1BWY A;  1SWH A;  1X8U A;  1FEL A;  4O4O A;  1SXY A;  4CPI A;  4AYH A;  4ML7 B;  5B11 O;  1I4U A;  1STR B;  2RTH B;  4N7D A;  2LBA A;  1SWL A;  4ZHG A;  1GM6 A;  3U9P C;  4O9S A;  1HMR A;  1JJU A;  2AT6 X;  4BX7 A;  1SWC A;  5KHP A;  1AVE A;  4ZJ0 A;  1DFV A;  2CZT A;  5H9K A;  4ZHH A;  1VWC B;  3D97 A;  1RSU B;  1VWH B;  1T0V A;  4ON1 A;  3EBK A;  4XMD A;  5HZ6 A;  4HPC A;  4QZT A;  4YVB A;  2JGS A;  2CM9 A;  4GKC A;  4O49 A;  4O3W A;  2AKQ A;  2RTE B;  2LBV A;  2Q2M A;  1SWT A;  3MM0 A;  1ZNH A;  3FEN A;  1B56 A;  2R73 A;  3O19 A;  2HZR A;  3FEP A;  1HY2 A;  2RTB B;  2QMI A;  1X8Q A;  2AT3 X;  4YGZ A;  5HTE A;  3ZW2 A;  4LZV A;  2F09 A;  4YCE A;  3KFH A;  4KII A;  5LJK A;  3NAD A;  4CPH A;  1TVQ A;  3CQR A;  4GGT A;  4GJV A;  4XMC A;  2JU3 A;  2FLJ A;  2QO5 A;  4O3Y A;  1WBI A;  2FRS A;  5D4A A;  3ZUI A;  3P6E A;  3NQK A;  1AB0 A;  1RLB E;  2OVS A;  3I0A A;  4CPE A;  1S44 A;  4MVI A;  2X8S A;  1SWK A;  2KW1 A;  4OMW A;  3VG4 A;  3U0D A;  3BS2 A;  4N7C A;  1EI5 A;  5H9A A;  1KOI A;  2PY1 A;  1W5R A;  5CSE A;  3MBT A;  4FBV A;  3B2H A;  3RZY A;  2DJG A;  2QOS C;  1YWB A;  5IRU A;  2XKL A;  1H91 A;  4LQZ A;  1SXU A;  4HPD A;  1CBQ A;  1OBP A;  1OEE A;  2OL7 A;  5L8I A;  4EKV A;  1E06 A;  5HZQ A;  2IZD B;  3STM X;  3X00 A;  5HZ5 A;  1SWE A;  2K23 A;  3WJB A;  4CDC A;  2MJI A;  3ELZ A;  4I9R A;  3WZQ A;  3ZW1 B;  2Y3E A;  2RTL A;  1MK5 A;  2OY7 A;  3OBL A;  3S5V A;  3KFI A;  5KID A;  4OS8 A;  1GT1 A;  2AMM X;  2OY8 A;  1SWO A;  2A3F X; 
#chains in the Genus database with same CATH homology
 4EXZ A;  1D3S A;  3P6F A;  2K62 A;  3APU A;  4FBR A;  3CMP A;  3LHN A;  4XMF A;  2G79 A;  4KC8 A;  3APX A;  3ZUO A;  3G7X A;  3K3L A;  4MVL A;  5F6Z A;  3UEW A;  3EYC A;  3B2L A;  4QNI A;  1MX8 A;  1T8V A;  2W2A A;  4KCA A;  4QRL A;  2DM5 A;  3MX7 A;  5DPQ A;  3WJG A;  1IFB A;  1ERB A;  1TW4 A;  4ZHD A;  4I6S A;  4O4S A;  1ADL A;  3TZS A;  4GZV A;  1SXX A;  1AEL A;  1GX9 A;  3P6G A;  3N91 A;  1ACD A;  4QZU A;  4ES7 A;  1GKA A;  3S26 A;  2JU8 A;  2W2F A;  1IW2 A;  1SMP I;  5LKE A;  2WEX A;  1DV9 A;  3TF6 A;  1ZND A;  1A57 A;  1A3Y A;  3C76 X;  1JYD A;  4QYN A;  3UAQ A;  1PEE A;  1R0U A;  3WJD A;  3C77 X;  1FDQ A;  1YP7 A;  1LFO A;  1G74 A;  4I9S A;  2NNE A;  5HTD A;  1QY1 A;  1HBQ A;  3LV4 A;  3EMM A;  4YGH A;  5LJC A;  1E5P A;  4IMO A;  1G85 A;  4RUU A;  4ZCB A;  5F58 A;  3HK1 A;  5EDB A;  5EEE A;  4U8U N;  5H9L A;  2JW1 A;  1UZ2 X;  1YWC A;  4QGX A;  3NPO A;  1EXS A;  3ZW0 A;  1P6P A;  2F73 A;  1I06 A;  4YFQ A;  2QO6 A;  4ZGU A;  4BOE A;  3SOT A;  2GTL M;  5AEO A;  1MUP A;  2X8F A;  3OD9 A;  2A2G A;  3FA6 A;  4ALB A;  3S60 A;  3WJC A;  4YH0 A;  1HMT A;  3TGA A;  1B0O A;  3HOE A;  4ZH9 A;  2BT9 A;  3PP6 A;  2G78 A;  1GX8 A;  1KT5 A;  1KT6 A;  3NX1 A;  1EUO A;  1U17 A;  3STN A;  1FE3 A;  1VYG A;  3H3I A;  4R0B A;  1AQB A;  1X8P A;  4U8U O;  4HWM A;  4QGV A;  4Y0P A;  4YCH A;  3U03 A;  2A13 A;  1N0S A;  1OEJ A;  1NP4 A;  1GGL A;  5LJH A;  4AZQ A;  5EDC A;  1B8E A;  4GET A;  4L3R A;  4EEJ A;  1EW3 A;  1DZK A;  3FYF A;  1DF3 A;  2E4J A;  2HLV A;  2RCQ A;  5FAZ A;  4AZM A;  4YGG A;  4COT A;  1HBP A;  3P02 A;  1S2P A;  2RCT A;  1BSY A;  4GE1 A;  4MVE A;  4I3C A;  3JQO A;  1ZNE A;  1GKA B;  2WWP A;  1KGL A;  2FT9 A;  3F9D A;  3HOL A;  1LKE A;  3QKG A;  4QAE A;  1A2D A;  1JIW I;  2Q9S A;  4QYP A;  5LJG A;  2L9C A;  5AJB A;  3BU9 A;  4JGL A;  5HA1 A;  4TKB A;  1DZM A;  1LIC A;  4NLI A;  4HFO A;  5D48 A;  3APW A;  3NBX X;  4NW4 A;  2ASN X;  2CBS A;  5F1E A;  3FMZ A;  1HN2 A;  3FR2 A;  1JZU A;  2MM3 A;  1ML7 A;  1KT7 A;  3P24 A;  1ZNG A;  3PED A;  4ORW A;  4BVM A;  1BRP A;  1I05 A;  1IKJ A;  1X8O A;  5FEN A;  5K06 A;  2GTF X;  4YBP A;  4MIS A;  3V8U A;  5H9N A;  2N93 A;  4ZHC A;  4DQ4 A;  4XMH A;  4M6S A;  2JN3 A;  4WFU A;  3RKG A;  2L5P A;  3CWK A;  2AL0 X;  2WSJ A;  3FA7 A;  4LZU A;  3ZI8 A;  2R56 A;  4TLJ A;  1ERX A;  4WHI A;  2OFR X;  4YFP A;  5L8N A;  4NYQ A;  2L68 A;  3WBG A;  3L4R A;  1KT4 A;  3B2J A;  4OS0 A;  3D96 A;  1LF7 A;  2KTD A;  4UU3 A;  1OBU A;  3VG3 A;  5BVS A;  1O1V A;  1A18 A;  4NNT A;  3EBW A;  4O4U A;  2CZU A;  1G7N A;  1OBQ A;  4QQ1 A;  1EQD A;  3WVM A;  4FQB B;  4O4X A;  1PBO A;  4TQ2 A;  5DG4 A;  2O62 A;  5FQ8 E;  4GU8 A;  2Q4N A;  1BJ7 A;  2WEW A;  3P6D A;  3ZZV A;  3WXQ A;  2WR6 A;  2AT8 X;  1FEN A;  1CBI A;  2RQ0 A;  4RUN A;  3STK A;  2HNX A;  1BSO A;  2P8G A;  4GNY A;  1E02 A;  4XMG A;  5LJB A;  1YUP A;  1Z24 A;  1X8N A;  1QY2 A;  1EII A;  1OEK A;  2CBR A;  2BHV A;  4BQU A;  5HA0 A;  4IAB A;  4A8Z A;  3APV A;  5HZ8 A;  1QFT A;  1MDC A;  4ZFX A;  3HWG A;  3FEK A;  3BY0 A;  3BRN A;  1SY0 A;  3PH5 A;  3VG2 A;  4ALO A;  1OPA A;  4PJ2 A;  2X46 A;  5F7G A;  3FW4 A;  2OFM X;  3Q6L A;  2ZAG A;  5D8J A;  3TGC A;  1BSQ A;  4GRJ A;  4L1N A;  5IO5 A;  1ZRY A;  2X8T A;  4KT5 A;  2YG2 A;  5C0N A;  3KFG A;  4YBU A;  4YMY A;  5HAE A;  5BVQ A;  3WJF A;  1PM1 X;  1KQX A;  4FBO A;  4YKM A;  1QQS A;  3BDR A;  4OMX A;  1GT4 A;  1LIE A;  1ICM A;  3FR5 A;  3FR4 A;  4AZR A;  3VG5 A;  3KZA A;  4NP1 A;  4ZGF A;  2AH7 X;  4A60 A;  3WJE A;  4QGW A;  1RBP A;  4Y0R A;  1BEB A;  1E00 A;  3O2Y A;  4I3B A;  5BYP A;  2MHD A;  2EU7 X;  2A2U A;  2LFO A;  4KC7 A;  3HWE A;  1YP6 A;  1XKI A;  2BS6 A;  3TGB A;  3B2I A;  2OVA A;  1JV4 A;  2Q39 A;  3ZQ3 A;  2RD7 C;  3FA8 A;  5HCE C;  3ZWE A;  5BVT A;  4Y0S A;  2RA6 A;  5AJC A;  3B2K A;  1O1U A;  4EFG A;  1LIF A;  1KZX A;  3RSW A;  1T68 X;  1TXL A;  5FFH A;  2LB6 A;  2LA7 A;  1IKE A;  3FLL A;  4ID2 A;  3AKN A;  1ALB A;  3GAQ A;  4A1Y A;  4FGI B;  4U8U M;  4YFR A;  3T1D A;  2AT0 X;  2BLG A;  4AW8 A;  2RN4 A;  1IFC A;  4IAW A;  4IAX A;  3C78 X;  3CBS A;  3GE2 A;  5HBS A;  1JJJ A;  3RBY A;  3F8A A;  5FQ6 E;  3IFB A;  3WOV A;  4I3D A;  4IMN A;  5D45 A;  2OZQ A;  4LKT A;  4NYR A;  5EZ2 A;  4EQA C;  3BLG A;  1JYJ A;  4U3Q A;  4HPB A;  1QY0 A;  3E3C A;  5JR8 A;  3FEL A;  3NX2 A;  3EM0 A;  1BBP A;  4ZHF A;  2HZQ A;  3NP1 A;  2X45 A;  5AQ6 A;  3P6C A;  3FIQ A;  2FWV A;  2G7B A;  2GTL O;  2QO4 A;  3KQ0 A;  4UU2 A;  2HMB A;  4D6B A;  1U0X A;  3HWF A;  1QAB E;  1PMP A;  3BX7 A;  2BS5 A;  5FQ7 E;  1YIV A;  2XST A;  3FA9 A;  4TKH A;  3NQ9 A;  3NQ3 A;  5EED A;  1IIU A;  1BM5 A;  1QWD A;  3DSZ A;  1CBS A;  4A1H A;  4U9C A;  5L8O A;  1CBR A;  2WUT A;  1FEM A;  1HQP A;  1KQW A;  3JS1 A;  4MVK A;  1Y9L A;  4NNS A;  5CYB A;  3ZW0 B;  1KXO A;  4CV7 A;  4ARH A;  3OJY C;  4IB9 A;  5LJE A;  5HZ9 A;  2FR3 A;  4YKO A;  1I04 A;  1L6M A;  2AT5 X;  5B27 A;  2IFB A;  1CJ5 A;  3CQN A;  2ACO A;  3RWX A;  3VG6 A;  2KTS A;  4IBA A;  4EDE A;  3CR6 A;  4ODD A;  1BLR A;  4GDZ A;  1EPA A;  3HWD A;  1Y9T A;  5HCD C;  2FTB A;  2Q2P A;  4TKJ A;  1QFV A;  2GJ5 A;  2QM9 A;  4WFV A;  4ZH6 A;  1X89 A;  3VE2 A;  1X71 A;  1JJX A;  1FTP A;  4YDB A;  3D95 A;  2M4L A;  3UEV A;  2Z4H A;  1MVG A;  3VPJ E;  2OVD A;  3CBC A;  3ELX A;  5LJD A;  1GXA A;  1LIB A;  1YWA A;  4Y0Q A;  1ZNK A;  1ZNL A;  1CRB A;  2NP1 A;  3PPT A;  5EPQ A;  5F6B A;  4AZP A;  2WQ9 A;  3BSZ E;  1U18 A;  3PQS A;  5IO6 A;  1SXW A;  1G5W A;  4MIR A;  1DZJ A;  3UEX A;  4CSB A;  3PH6 A;  2POA A;  3FW5 A;  1VYF A;  4ORY A;  3VU1 A;  2GTL N;  2LKK A;  4LKP A;  2ANS A;  1YWD A;  1SY1 A;  2YMS A;  3BX8 A;  1NP1 A;  3OE3 A;  4ORS A;  4IB8 A;  3PQU A;  4INN A;  4O3X B;  4AZN A;  1EPB A;  2KD2 A;  2MWH A;  3HTY A;  4M7M A;  4D6A A;  1SA8 A;  5HCC C;  1TOW A;  4ORU A;  1XCA A;  3UEU A;  2R74 A;  1D2U A;  2Z4I A;  4CK4 A;  2OVE A;  2WQA E;  4O3Z A;  2JU7 A;  3VE1 A;  1BRQ A;  4ORX A;  5IO7 A;  1KZW A;  3O22 A;  5D47 A;  3AKM A;  1LPJ A;  5B29 A;  2A0A A;  4I95 A;  1QG5 A;  2NNQ A;  2L67 A;  4YDA A;  1EAL A;  3KFF A;  1EIO A;  5H8T A;  4IB6 A;  1DC9 A;  1O8V A;  3NR3 A;  1NGL A;  2FS7 A;  2ZAI A;  1MX7 A;  3I17 A;  1VPR A;  2FR2 A;  1B4M A;  1TOU A;  2JMB A;  3D4R A;  1JBH A;  5HWZ A;  2NND A;  3ZW1 A;  2MO5 A;  2W2B A;  4IB7 A;  3SAO A;  3S5X A;  2JOZ A;  3PEC A;  1SY3 A;  1AVG I;  4GK9 A;  4TNN A;  2ACP X;  4GH7 A;  4XME A;  5CE4 A;  2GC9 A;  3IA8 A;  1LID A;  5KIC A;  1OPB A;  5LKF A;  1GT3 A;  2ALL X;  1GT5 A;  1SY2 A;  4ORR A;  4DQ3 A;  1LNM A;  1URE A;  4KH8 A;  3JSQ A;  2FS6 A;  2KT4 B;  3BU1 A;  1DZP A;  3DTQ A;  4HPA A;  4WBK A;  4K19 A;  3P6H A;  1S7D A;  2CM4 A;  3F6Z B;  4OS3 A;  4PSQ A;  4TJZ A;  3VG7 A;  1HMS A;  1ICN A;  4GNW A;  4ZR2 A;  4AZO A;  3MVF A;  2HYS A;  1KT3 A;  4NLJ A;  1BWY A;  1X8U A;  1FEL A;  4O4O A;  1SXY A;  4AYH A;  4ML7 B;  1I4U A;  4N7D A;  2LBA A;  4ZHG A;  1GM6 A;  3U9P C;  4O9S A;  1HMR A;  2AT6 X;  5KHP A;  4ZJ0 A;  1DFV A;  2CZT A;  5H9K A;  4ZHH A;  3D97 A;  4ON1 A;  1T0V A;  3EBK A;  4XMD A;  5HZ6 A;  4HPC A;  4QZT A;  4O49 A;  2CM9 A;  4GKC A;  4O3W A;  2LBV A;  2AKQ A;  2Q2M A;  1ZNH A;  3FEN A;  1B56 A;  2R73 A;  3O19 A;  2HZR A;  3FEP A;  2QMI A;  1X8Q A;  2AT3 X;  4YGZ A;  5HTE A;  3ZW2 A;  4LZV A;  2F09 A;  4YCE A;  3KFH A;  4KII A;  5LJK A;  3NAD A;  1TVQ A;  3CQR A;  4XMC A;  2JU3 A;  2FLJ A;  2QO5 A;  4O3Y A;  2FRS A;  5D4A A;  3ZUI A;  3P6E A;  3NQK A;  1AB0 A;  1RLB E;  2OVS A;  3I0A A;  1S44 A;  4MVI A;  2X8S A;  2KW1 A;  3VG4 A;  4OMW A;  3U0D A;  3BS2 A;  4N7C A;  1EI5 A;  5H9A A;  1KOI A;  2PY1 A;  3MBT A;  4FBV A;  3B2H A;  3RZY A;  2QOS C;  1YWB A;  2XKL A;  1H91 A;  4LQZ A;  1SXU A;  4HPD A;  1CBQ A;  1OBP A;  1OEE A;  5L8I A;  1E06 A;  5HZQ A;  3STM X;  5HZ5 A;  2K23 A;  3WJB A;  2MJI A;  3ELZ A;  4I9R A;  3ZW1 B;  3S5V A;  3OBL A;  3KFI A;  5KID A;  4OS8 A;  1GT1 A;  2AMM X;  2A3F X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...