3TGHA

Gap50 the anchor in the inner membrane complex of plasmodium
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
339
structure length
315
Chain Sequence
KCQLRFASLGDWGKDTKGQILNAKYFKQFIKNERVTFIVSPGSNFIDGVKGLNDPAWKNLYEDVYSEEKGDMYMPFFTVLGTRDWTGNYNAQLLKGQGDATNYPKWIMPNYWYHYFTHFTVSHKDLAAAFIFIDTWVLSSNFPYKKIHEKAWNDLKSQLSVAKKIADFIIVVGDQPIYSSGYSRGSSYLAYYLLPLLKDAEVDLYISGHDNNMEVIEDNDMAHITCGSGSMSQGKSGMKNSKSLFFSSDIGFCVHELSNNGIVTKFVSSKKGEVIYTHKLNIKKKKTLDKVNALQHFAALPNVELTDVPSSGPMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GAP50, the anchor of the invasion machinery in the inner membrane complex of Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Cell invasion
molecule keywords Glideosome-associated protein 50
total genus 114
structure length 315
sequence length 339
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3tghA00
2BCDA 4F0ZA 3QFKA 4DHLA 4LU9A 3ICFA 2WDCA 5INBA 3H69A 2R17A 3E7BA 2NPPC 1HPUA 4KKZA 2IE4C 4O43A 4LACC 4UT2A 5JPFA 1G5BA 3H60A 3LL8A 2QFPA 4TUGA 3P71C 3DSDA 4V0WA 4FCXA 2Z72A 1HO5A 4ORCA 1USHA 3N5UA 1TCOA 2GJUA 1OIEA 4FBWA 2BQ8X 2WDEA 1HP1A 3H64A 1IT6A 1NNWA 3THOB 4ZX2A 2P6BA 4O5GA 4MOYA 2WDFA 3CK2A 3PSNA 4H1SA 5JJTA 4UT3B 3QG5C 1OI8A 3IVEA 4DSYA 3AUZA 4M0VA 3AV0A 3K7VC 4ORBA 3IB8A 4Q7FA 3RL4A 4B2OA 4I5NC 3DW8C 3H67A 4JA7A 3DSCA 3E7AA 3H66A 1SU1A 2NYLC 2USHA 2ZBMA 3ZTVA 3QFMA 4FBQA 4ZVZA 3HVQA 3ZU0A 3KBPA 4JA9A 1MF8A 2HYOA 2KKNA 1AUIA 5F3WA 1S8EA 4H2GA 1WARA 3FGAC 1QFCA 3RL5A 1S3LA 4UWQA 4MP0A 5EQVA 1WAO1 1OIDA 3H62B 3PSOA 3RQZA 1KBPA 2DFJA 4IL1A 3JYFA 1T70A 4H2FA 1UF3A 3C9FA 1S3MA 3THNA 2Z1AA 4TUIA 2Z06A 1S3NA 4V0XA 2BDXA 1XZWA 1S70A 4HD0A 2YVTA 3IB7A 1XM7A 5JPEA 2O8AA 3H61A 3T1IA 3K7WC 1UTEA 2CV9A 2QJCA 5HPEA 2WDDA 4O4KA 5DNYA 1W24A 2IE3C 3EGHA 1II7A 3H68A 4MOVA 3IVDA 1FJMA 3QFNA 4I5LC 4V0VA 1Z2WA 4IYPC 4NZVA 2O8GA 1V73A 2HYPA 4H1YP 3C5WC 4G9JA 4DT2A 1T71A 5IOHA 2NYMC 3EGGA 2AHDA 4FBKA 4H2BA 5C1VA 2IAEC 4YKEA 2JOGA 4KBPA 2XMOA 1QHWA 1U32A 3RL3A 4UT3A 1M63A 2QFRA 4WWLA 5J28A 4LTYA 1Z2XA 4O24A 3TGHA 4XPNA 2HY1A 2NXFA 4H2IA 3V4YA 1S95A 4ORAA 2A22A 4J6OA 3GVEA 4OR9A 1JK7A 3H63A 3QFOA 5B8IA 5GTUA 2Q8UA
chains in the Genus database with same CATH superfamily
2BCDA 4F0ZA 3QFKA 4DHLA 4LU9A 3ICFA 2WDCA 5INBA 3H69A 2R17A 3E7BA 2NPPC 1HPUA 4KKZA 2IE4C 4O43A 4LACC 2ZO9B 4UT2A 5JPFA 1G5BA 3H60A 3LL8A 2QFPA 4TUGA 3P71C 3DSDA 4V0WA 4FCXA 2Z72A 1HO5A 4ORCA 1USHA 3N5UA 1TCOA 2GJUA 1OIEA 2YEQA 4FBWA 2BQ8X 2WDEA 1HP1A 3H64A 1IT6A 1NNWA 3THOB 3FLOA 4ZX2A 2P6BA 4O5GA 4MOYA 2WDFA 3CK2A 3PSNA 4H1SA 5JJTA 4UT3B 3QG5C 1OI8A 3IVEA 4DSYA 3AUZA 4M0VA 3AV0A 3K7VC 4ORBA 3IB8A 4Q7FA 3RL4A 4B2OA 4I5NC 3DW8C 3H67A 4JA7A 3DSCA 3E7AA 3H66A 1SU1A 2NYLC 2USHA 2ZBMA 3ZTVA 3QFMA 4FBQA 4ZVZA 3HVQA 3ZU0A 3KBPA 4JA9A 1MF8A 2HYOA 2KKNA 1AUIA 5F3WA 3E0JA 1S8EA 4H2GA 1WARA 3FGAC 1QFCA 3RL5A 1S3LA 4UWQA 4MP0A 5EQVA 1WAO1 1OIDA 3H62B 2ZOAA 3PSOA 3RQZA 1KBPA 2DFJA 4IL1A 3JYFA 1T70A 4H2FA 1UF3A 3C9FA 1S3MA 3THNA 2Z1AA 4TUIA 2Z06A 1S3NA 4V0XA 2BDXA 1XZWA 1S70A 4HD0A 2YVTA 3IB7A 1XM7A 5JPEA 2O8AA 3H61A 3T1IA 3K7WC 1UTEA 3D03A 2CV9A 2QJCA 5HPEA 2WDDA 4O4KA 5DNYA 1W24A 2IE3C 3EGHA 1II7A 3H68A 4MOVA 3IVDA 1FJMA 3QFNA 4I5LC 4V0VA 1Z2WA 4IYPC 4NZVA 2O8GA 1V73A 2HYPA 4H1YP 3C5WC 4G9JA 4DT2A 1T71A 5IOHA 2NYMC 3EGGA 2AHDA 4FBKA 4H2BA 5C1VA 2IAEC 4YKEA 2JOGA 4KBPA 2XMOA 1QHWA 1U32A 3RL3A 4UT3A 1M63A 2QFRA 4WWLA 5J28A 4LTYA 1Z2XA 4O24A 3TGHA 4XPNA 2HY1A 2NXFA 4H2IA 3V4YA 1S95A 4ORAA 2A22A 4J6OA 3GVEA 2DXNA 4OR9A 1JK7A 3H63A 3QFOA 2DXLA 5B8IA 5GTUA 2Q8UA
chains in the Genus database with same CATH topology
2BCDA 4F0ZA 3QFKA 4DHLA 4LU9A 3ICFA 2WDCA 5INBA 3H69A 2R17A 3E7BA 2NPPC 1HPUA 4KKZA 2IE4C 4O43A 4LACC 2ZO9B 4UT2A 5JPFA 1G5BA 3H60A 3LL8A 2QFPA 4TUGA 3P71C 3DSDA 4V0WA 4FCXA 2Z72A 1HO5A 4ORCA 1USHA 3N5UA 1TCOA 2GJUA 1OIEA 2YEQA 4FBWA 2BQ8X 2WDEA 1HP1A 3H64A 1IT6A 1NNWA 3THOB 3FLOA 4ZX2A 2P6BA 4O5GA 4MOYA 2WDFA 3CK2A 3PSNA 4H1SA 5JJTA 4UT3B 3QG5C 1OI8A 3IVEA 4DSYA 3AUZA 4M0VA 3AV0A 3K7VC 4ORBA 3IB8A 4Q7FA 3RL4A 4B2OA 4I5NC 3DW8C 3H67A 4JA7A 3DSCA 3E7AA 3H66A 1SU1A 2NYLC 2USHA 2ZBMA 3ZTVA 3QFMA 4FBQA 4ZVZA 3HVQA 3ZU0A 3KBPA 4JA9A 1MF8A 2HYOA 2KKNA 1AUIA 5F3WA 3E0JA 1S8EA 4H2GA 1WARA 3FGAC 1QFCA 3RL5A 1S3LA 4UWQA 4MP0A 5EQVA 1WAO1 1OIDA 3H62B 2ZOAA 3PSOA 3RQZA 1KBPA 2DFJA 4IL1A 3JYFA 1T70A 4H2FA 1UF3A 3C9FA 1S3MA 3THNA 2Z1AA 4TUIA 2Z06A 1S3NA 4V0XA 2BDXA 1XZWA 1S70A 4HD0A 2YVTA 3IB7A 1XM7A 5JPEA 2O8AA 3H61A 3T1IA 3K7WC 1UTEA 3D03A 2CV9A 2QJCA 5HPEA 2WDDA 4O4KA 5DNYA 1W24A 2IE3C 3EGHA 1II7A 3H68A 4MOVA 3IVDA 1FJMA 3QFNA 4I5LC 4V0VA 1Z2WA 4IYPC 4NZVA 2O8GA 1V73A 2HYPA 4H1YP 3C5WC 4G9JA 4DT2A 1T71A 5IOHA 2NYMC 3EGGA 2AHDA 4FBKA 4H2BA 5C1VA 2IAEC 4YKEA 2JOGA 4KBPA 2XMOA 1QHWA 1U32A 3RL3A 4UT3A 1M63A 2QFRA 4WWLA 5J28A 4LTYA 1Z2XA 4O24A 3TGHA 4XPNA 2HY1A 2NXFA 4H2IA 3V4YA 1S95A 4ORAA 2A22A 4J6OA 3GVEA 2DXNA 4OR9A 1JK7A 3H63A 3QFOA 2DXLA 5B8IA 5GTUA 2Q8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCD A;  4F0Z A;  3QFK A;  4DHL A;  4LU9 A;  3ICF A;  2WDC A;  5INB A;  3H69 A;  2R17 A;  3E7B A;  2NPP C;  1HPU A;  4KKZ A;  2IE4 C;  4O43 A;  4LAC C;  4UT2 A;  5JPF A;  1G5B A;  3H60 A;  3LL8 A;  2QFP A;  4TUG A;  3P71 C;  3DSD A;  4V0W A;  4FCX A;  2Z72 A;  1HO5 A;  4ORC A;  1USH A;  3N5U A;  1TCO A;  2GJU A;  1OIE A;  4FBW A;  2BQ8 X;  2WDE A;  1HP1 A;  3H64 A;  1IT6 A;  1NNW A;  3THO B;  4ZX2 A;  2P6B A;  4O5G A;  4MOY A;  2WDF A;  3CK2 A;  3PSN A;  4H1S A;  5JJT A;  4UT3 B;  3QG5 C;  1OI8 A;  3IVE A;  4DSY A;  3AUZ A;  4M0V A;  3AV0 A;  3K7V C;  4ORB A;  3IB8 A;  4Q7F A;  3RL4 A;  4B2O A;  4I5N C;  3DW8 C;  3H67 A;  4JA7 A;  3DSC A;  3E7A A;  3H66 A;  1SU1 A;  2NYL C;  2USH A;  2ZBM A;  3ZTV A;  3QFM A;  4FBQ A;  4ZVZ A;  3HVQ A;  3ZU0 A;  3KBP A;  4JA9 A;  1MF8 A;  2HYO A;  2KKN A;  1AUI A;  5F3W A;  1S8E A;  4H2G A;  1WAR A;  3FGA C;  1QFC A;  3RL5 A;  1S3L A;  4UWQ A;  4MP0 A;  5EQV A;  1WAO 1;  1OID A;  3H62 B;  3PSO A;  3RQZ A;  1KBP A;  2DFJ A;  4IL1 A;  3JYF A;  1T70 A;  4H2F A;  1UF3 A;  3C9F A;  1S3M A;  3THN A;  2Z1A A;  4TUI A;  2Z06 A;  1S3N A;  4V0X A;  2BDX A;  1XZW A;  1S70 A;  4HD0 A;  2YVT A;  3IB7 A;  1XM7 A;  5JPE A;  2O8A A;  3H61 A;  3T1I A;  3K7W C;  1UTE A;  2CV9 A;  2QJC A;  5HPE A;  2WDD A;  4O4K A;  5DNY A;  1W24 A;  2IE3 C;  3EGH A;  1II7 A;  3H68 A;  4MOV A;  3IVD A;  1FJM A;  3QFN A;  4I5L C;  4V0V A;  1Z2W A;  4IYP C;  4NZV A;  2O8G A;  1V73 A;  2HYP A;  4H1Y P;  3C5W C;  4G9J A;  4DT2 A;  1T71 A;  5IOH A;  2NYM C;  3EGG A;  2AHD A;  4FBK A;  4H2B A;  5C1V A;  2IAE C;  4YKE A;  2JOG A;  4KBP A;  2XMO A;  1QHW A;  1U32 A;  3RL3 A;  4UT3 A;  1M63 A;  2QFR A;  4WWL A;  5J28 A;  4LTY A;  1Z2X A;  4O24 A;  3TGH A;  4XPN A;  2HY1 A;  2NXF A;  4H2I A;  3V4Y A;  1S95 A;  4ORA A;  2A22 A;  4J6O A;  3GVE A;  4OR9 A;  1JK7 A;  3H63 A;  3QFO A;  5B8I A;  5GTU A;  2Q8U A; 
#chains in the Genus database with same CATH topology
 2BCD A;  4F0Z A;  3QFK A;  4DHL A;  4LU9 A;  3ICF A;  2WDC A;  5INB A;  3H69 A;  2R17 A;  3E7B A;  2NPP C;  1HPU A;  4KKZ A;  2IE4 C;  4O43 A;  4LAC C;  2ZO9 B;  4UT2 A;  5JPF A;  1G5B A;  3H60 A;  3LL8 A;  2QFP A;  4TUG A;  3P71 C;  3DSD A;  4V0W A;  4FCX A;  2Z72 A;  1HO5 A;  4ORC A;  1USH A;  3N5U A;  1TCO A;  2GJU A;  1OIE A;  2YEQ A;  4FBW A;  2BQ8 X;  2WDE A;  1HP1 A;  3H64 A;  1IT6 A;  1NNW A;  3THO B;  3FLO A;  4ZX2 A;  2P6B A;  4O5G A;  4MOY A;  2WDF A;  3CK2 A;  3PSN A;  4H1S A;  5JJT A;  4UT3 B;  3QG5 C;  1OI8 A;  3IVE A;  4DSY A;  3AUZ A;  4M0V A;  3AV0 A;  3K7V C;  4ORB A;  3IB8 A;  4Q7F A;  3RL4 A;  4B2O A;  4I5N C;  3DW8 C;  3H67 A;  4JA7 A;  3DSC A;  3E7A A;  3H66 A;  1SU1 A;  2NYL C;  2USH A;  2ZBM A;  3ZTV A;  3QFM A;  4FBQ A;  4ZVZ A;  3HVQ A;  3ZU0 A;  3KBP A;  4JA9 A;  1MF8 A;  2HYO A;  2KKN A;  1AUI A;  5F3W A;  3E0J A;  1S8E A;  4H2G A;  1WAR A;  3FGA C;  1QFC A;  3RL5 A;  1S3L A;  4UWQ A;  4MP0 A;  5EQV A;  1WAO 1;  1OID A;  3H62 B;  2ZOA A;  3PSO A;  3RQZ A;  1KBP A;  2DFJ A;  4IL1 A;  3JYF A;  1T70 A;  4H2F A;  1UF3 A;  3C9F A;  1S3M A;  3THN A;  2Z1A A;  4TUI A;  2Z06 A;  1S3N A;  4V0X A;  2BDX A;  1XZW A;  1S70 A;  4HD0 A;  2YVT A;  3IB7 A;  1XM7 A;  5JPE A;  2O8A A;  3H61 A;  3T1I A;  3K7W C;  1UTE A;  3D03 A;  2CV9 A;  2QJC A;  5HPE A;  2WDD A;  4O4K A;  5DNY A;  1W24 A;  2IE3 C;  3EGH A;  1II7 A;  3H68 A;  4MOV A;  3IVD A;  1FJM A;  3QFN A;  4I5L C;  4V0V A;  1Z2W A;  4IYP C;  4NZV A;  2O8G A;  1V73 A;  2HYP A;  4H1Y P;  3C5W C;  4G9J A;  4DT2 A;  1T71 A;  5IOH A;  2NYM C;  3EGG A;  2AHD A;  4FBK A;  4H2B A;  5C1V A;  2IAE C;  4YKE A;  2JOG A;  4KBP A;  2XMO A;  1QHW A;  1U32 A;  3RL3 A;  4UT3 A;  1M63 A;  2QFR A;  4WWL A;  5J28 A;  4LTY A;  1Z2X A;  4O24 A;  3TGH A;  4XPN A;  2HY1 A;  2NXF A;  4H2I A;  3V4Y A;  1S95 A;  4ORA A;  2A22 A;  4J6O A;  3GVE A;  2DXN A;  4OR9 A;  1JK7 A;  3H63 A;  3QFO A;  2DXL A;  5B8I A;  5GTU A;  2Q8U A; 
#chains in the Genus database with same CATH homology
 2BCD A;  4F0Z A;  3QFK A;  4DHL A;  4LU9 A;  3ICF A;  2WDC A;  5INB A;  3H69 A;  2R17 A;  3E7B A;  2NPP C;  1HPU A;  4KKZ A;  2IE4 C;  4O43 A;  4LAC C;  2ZO9 B;  4UT2 A;  5JPF A;  1G5B A;  3H60 A;  3LL8 A;  2QFP A;  4TUG A;  3P71 C;  3DSD A;  4V0W A;  4FCX A;  2Z72 A;  1HO5 A;  4ORC A;  1USH A;  3N5U A;  1TCO A;  2GJU A;  1OIE A;  2YEQ A;  4FBW A;  2BQ8 X;  2WDE A;  1HP1 A;  3H64 A;  1IT6 A;  1NNW A;  3THO B;  3FLO A;  4ZX2 A;  2P6B A;  4O5G A;  4MOY A;  2WDF A;  3CK2 A;  3PSN A;  4H1S A;  5JJT A;  4UT3 B;  3QG5 C;  1OI8 A;  3IVE A;  4DSY A;  3AUZ A;  4M0V A;  3AV0 A;  3K7V C;  4ORB A;  3IB8 A;  4Q7F A;  3RL4 A;  4B2O A;  4I5N C;  3DW8 C;  3H67 A;  4JA7 A;  3DSC A;  3E7A A;  3H66 A;  1SU1 A;  2NYL C;  2USH A;  2ZBM A;  3ZTV A;  3QFM A;  4FBQ A;  4ZVZ A;  3HVQ A;  3ZU0 A;  3KBP A;  4JA9 A;  1MF8 A;  2HYO A;  2KKN A;  1AUI A;  5F3W A;  3E0J A;  1S8E A;  4H2G A;  1WAR A;  3FGA C;  1QFC A;  3RL5 A;  1S3L A;  4UWQ A;  4MP0 A;  5EQV A;  1WAO 1;  1OID A;  3H62 B;  2ZOA A;  3PSO A;  3RQZ A;  1KBP A;  2DFJ A;  4IL1 A;  3JYF A;  1T70 A;  4H2F A;  1UF3 A;  3C9F A;  1S3M A;  3THN A;  2Z1A A;  4TUI A;  2Z06 A;  1S3N A;  4V0X A;  2BDX A;  1XZW A;  1S70 A;  4HD0 A;  2YVT A;  3IB7 A;  1XM7 A;  5JPE A;  2O8A A;  3H61 A;  3T1I A;  3K7W C;  1UTE A;  3D03 A;  2CV9 A;  2QJC A;  5HPE A;  2WDD A;  4O4K A;  5DNY A;  1W24 A;  2IE3 C;  3EGH A;  1II7 A;  3H68 A;  4MOV A;  3IVD A;  1FJM A;  3QFN A;  4I5L C;  4V0V A;  1Z2W A;  4IYP C;  4NZV A;  2O8G A;  1V73 A;  2HYP A;  4H1Y P;  3C5W C;  4G9J A;  4DT2 A;  1T71 A;  5IOH A;  2NYM C;  3EGG A;  2AHD A;  4FBK A;  4H2B A;  5C1V A;  2IAE C;  4YKE A;  2JOG A;  4KBP A;  2XMO A;  1QHW A;  1U32 A;  3RL3 A;  4UT3 A;  1M63 A;  2QFR A;  4WWL A;  5J28 A;  4LTY A;  1Z2X A;  4O24 A;  3TGH A;  4XPN A;  2HY1 A;  2NXF A;  4H2I A;  3V4Y A;  1S95 A;  4ORA A;  2A22 A;  4J6O A;  3GVE A;  2DXN A;  4OR9 A;  1JK7 A;  3H63 A;  3QFO A;  2DXL A;  5B8I A;  5GTU A;  2Q8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...