3TGHA

Gap50 the anchor in the inner membrane complex of plasmodium
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
339
structure length
315
Chain Sequence
KCQLRFASLGDWGKDTKGQILNAKYFKQFIKNERVTFIVSPGSNFIDGVKGLNDPAWKNLYEDVYSEEKGDMYMPFFTVLGTRDWTGNYNAQLLKGQGDATNYPKWIMPNYWYHYFTHFTVSHKDLAAAFIFIDTWVLSSNFPYKKIHEKAWNDLKSQLSVAKKIADFIIVVGDQPIYSSGYSRGSSYLAYYLLPLLKDAEVDLYISGHDNNMEVIEDNDMAHITCGSGSMSQGKSGMKNSKSLFFSSDIGFCVHELSNNGIVTKFVSSKKGEVIYTHKLNIKKKKTLDKVNALQHFAALPNVELTDVPSSGPMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of GAP50, the anchor of the invasion machinery in the inner membrane complex of Plasmodium falciparum.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Cell invasion
molecule keywords Glideosome-associated protein 50
total genus 114
structure length 315
sequence length 339
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3tghA00
3C5WC 5HPEA 4H2IA 4IL1A 3H61A 2IE3C 3H64A 3ZTVA 4NZVA 1IT6A 5JPEA 1SU1A 1XM7A 5GTUA 4FBWA 4UT3B 3RL5A 4V0WA 5C1VA 1S3LA 1W24A 2A22A 4DSYA 2WDCA 3QFOA 4KKZA 5IOHA 2BQ8X 1V73A 4ORCA 3H68A 2HY1A 2NYLC 2NYMC 2NXFA 4LTYA 2Q8UA 3C9FA 3RQZA 1OIDA 2HYOA 2O8AA 4JA7A 3K7VC 4O24A 4FBQA 4V0VA 4ZX2A 1MF8A 2JOGA 4H2GA 1QFCA 1HPUA 2WDDA 4MOVA 3DW8C 1S70A 4I5NC 3IVDA 1JK7A 1S8EA 4KBPA 5J28A 4O5GA 5B8IA 1U32A 1II7A 2IAEC 2KKNA 3RL4A 4YKEA 4XPNA 1FJMA 2NPPC 3IVEA 3THNA 4H1SA 2WDEA 5F3WA 1QHWA 3T1IA 4F0ZA 1OI8A 5EQVA 4LACC 1KBPA 2ZBMA 4ORBA 1AUIA 1WAO1 3ZU0A 5JPFA 4TUGA 2HYPA 3ICFA 1G5BA 4J6OA 1WARA 2QJCA 3PSOA 2YVTA 4FCXA 4I5LC 3V4YA 5INBA 4UWQA 3LL8A 2DFJA 1HP1A 3JYFA 2GJUA 2BDXA 3H67A 5DNYA 3FGAC 4LU9A 3THOB 3TGHA 3RL3A 1S95A 2P6BA 1NNWA 3H60A 4FBKA 2QFPA 2QFRA 4HD0A 3IB8A 3HVQA 4DT2A 1Z2XA 4UT3A 2AHDA 3H66A 1USHA 3QFNA 3QFKA 3GVEA 1UTEA 1M63A 3DSDA 2O8GA 1UF3A 2Z72A 4MP0A 4TUIA 3H63A 3IB7A 1S3NA 3H62B 4O43A 5JJTA 1TCOA 3DSCA 3P71C 1XZWA 2XMOA 3AV0A 1Z2WA 4V0XA 2Z06A 4WWLA 3QG5C 4M0VA 4B2OA 4JA9A 1T70A 3KBPA 2BCDA 3H69A 2R17A 1T71A 4MOYA 4UT2A 4O4KA 3AUZA 1OIEA 2IE4C 4IYPC 3E7AA 4H1YP 3K7WC 4H2FA 4ORAA 3EGHA 3EGGA 2WDFA 2CV9A 1S3MA 4G9JA 4Q7FA 3PSNA 4ZVZA 1HO5A 4OR9A 4DHLA 3CK2A 3E7BA 4H2BA 3QFMA 2USHA 3N5UA 2Z1AA
chains in the Genus database with same CATH superfamily
3D03A 3C5WC 5HPEA 4H2IA 4IL1A 3H61A 2IE3C 2DXLA 3H64A 3ZTVA 4NZVA 1IT6A 5JPEA 1SU1A 1XM7A 3FLOA 4FBWA 4UT3B 5GTUA 3RL5A 4V0WA 5C1VA 1S3LA 1W24A 2A22A 4DSYA 2WDCA 3QFOA 4KKZA 5IOHA 2BQ8X 1V73A 4ORCA 3H68A 2HY1A 2NYLC 2NYMC 2NXFA 4LTYA 2Q8UA 3C9FA 3RQZA 1OIDA 2HYOA 2O8AA 4JA7A 3K7VC 4O24A 4FBQA 4V0VA 4ZX2A 1MF8A 2JOGA 4H2GA 1QFCA 1HPUA 2WDDA 4MOVA 3DW8C 1S70A 4I5NC 3IVDA 1JK7A 1S8EA 4KBPA 5J28A 4O5GA 2ZO9B 5B8IA 1U32A 1II7A 2IAEC 2KKNA 3RL4A 4YKEA 4XPNA 1FJMA 2NPPC 3IVEA 3THNA 2YEQA 4H1SA 2WDEA 5F3WA 1QHWA 3T1IA 4F0ZA 1OI8A 5EQVA 4LACC 1KBPA 2ZBMA 4ORBA 1AUIA 1WAO1 3ZU0A 5JPFA 4TUGA 2HYPA 3ICFA 1G5BA 4J6OA 1WARA 2QJCA 3PSOA 2YVTA 4FCXA 4I5LC 3V4YA 5INBA 4UWQA 3LL8A 2DFJA 1HP1A 3JYFA 2GJUA 2BDXA 3H67A 5DNYA 2ZOAA 3FGAC 4LU9A 3THOB 3TGHA 3RL3A 1S95A 2P6BA 1NNWA 3H60A 4FBKA 2QFPA 2QFRA 4HD0A 3E0JA 3IB8A 3HVQA 4DT2A 1Z2XA 4UT3A 2AHDA 3H66A 1USHA 3QFNA 3QFKA 3GVEA 1UTEA 2DXNA 1M63A 3DSDA 2O8GA 1UF3A 2Z72A 4MP0A 4TUIA 3H63A 3IB7A 1S3NA 3H62B 4O43A 5JJTA 1TCOA 3DSCA 3P71C 1XZWA 2XMOA 1Z2WA 3AV0A 4V0XA 2Z06A 4WWLA 3QG5C 4M0VA 4B2OA 4JA9A 1T70A 3KBPA 2BCDA 3H69A 2R17A 1T71A 4MOYA 4UT2A 4O4KA 3AUZA 1OIEA 2IE4C 4IYPC 3E7AA 4H1YP 3K7WC 4H2FA 4ORAA 3EGHA 3EGGA 2WDFA 2CV9A 1S3MA 4G9JA 4Q7FA 3PSNA 4ZVZA 1HO5A 4OR9A 4DHLA 3CK2A 3E7BA 4H2BA 3QFMA 2USHA 3N5UA 2Z1AA
chains in the Genus database with same CATH topology
3D03A 3C5WC 5HPEA 4H2IA 4IL1A 3H61A 2IE3C 2DXLA 3H64A 3ZTVA 4NZVA 1IT6A 5JPEA 1SU1A 1XM7A 3FLOA 4FBWA 4UT3B 5GTUA 3RL5A 4V0WA 5C1VA 1S3LA 1W24A 2A22A 4DSYA 2WDCA 3QFOA 4KKZA 5IOHA 2BQ8X 1V73A 4ORCA 3H68A 2HY1A 2NYLC 2NYMC 2NXFA 4LTYA 2Q8UA 3C9FA 3RQZA 1OIDA 2HYOA 2O8AA 4JA7A 3K7VC 4O24A 4FBQA 4V0VA 4ZX2A 1MF8A 2JOGA 4H2GA 1QFCA 1HPUA 2WDDA 4MOVA 3DW8C 1S70A 4I5NC 3IVDA 1JK7A 1S8EA 4KBPA 5J28A 4O5GA 2ZO9B 5B8IA 1U32A 1II7A 2IAEC 2KKNA 3RL4A 4YKEA 4XPNA 1FJMA 2NPPC 3IVEA 3THNA 2YEQA 4H1SA 2WDEA 5F3WA 1QHWA 3T1IA 4F0ZA 1OI8A 5EQVA 4LACC 1KBPA 2ZBMA 4ORBA 1AUIA 1WAO1 3ZU0A 5JPFA 4TUGA 2HYPA 3ICFA 1G5BA 4J6OA 1WARA 2QJCA 3PSOA 2YVTA 4FCXA 4I5LC 3V4YA 5INBA 4UWQA 3LL8A 2DFJA 1HP1A 3JYFA 2GJUA 2BDXA 3H67A 5DNYA 2ZOAA 3FGAC 4LU9A 3THOB 3TGHA 3RL3A 1S95A 2P6BA 1NNWA 3H60A 4FBKA 2QFPA 2QFRA 4HD0A 3E0JA 3IB8A 3HVQA 4DT2A 1Z2XA 4UT3A 2AHDA 3H66A 1USHA 3QFNA 3QFKA 3GVEA 1UTEA 2DXNA 1M63A 3DSDA 2O8GA 1UF3A 2Z72A 4MP0A 4TUIA 3H63A 3IB7A 1S3NA 3H62B 4O43A 5JJTA 1TCOA 3DSCA 3P71C 1XZWA 2XMOA 1Z2WA 3AV0A 4V0XA 2Z06A 4WWLA 3QG5C 4M0VA 4B2OA 4JA9A 1T70A 3KBPA 2BCDA 3H69A 2R17A 1T71A 4MOYA 4UT2A 4O4KA 3AUZA 1OIEA 2IE4C 4IYPC 3E7AA 4H1YP 3K7WC 4H2FA 4ORAA 3EGHA 3EGGA 2WDFA 2CV9A 1S3MA 4G9JA 4Q7FA 3PSNA 4ZVZA 1HO5A 4OR9A 4DHLA 3CK2A 3E7BA 4H2BA 3QFMA 2USHA 3N5UA 2Z1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C5W C;  5HPE A;  4H2I A;  4IL1 A;  3H61 A;  2IE3 C;  3H64 A;  3ZTV A;  4NZV A;  1IT6 A;  5JPE A;  1SU1 A;  1XM7 A;  5GTU A;  4FBW A;  4UT3 B;  3RL5 A;  4V0W A;  5C1V A;  1S3L A;  1W24 A;  2A22 A;  4DSY A;  2WDC A;  3QFO A;  4KKZ A;  5IOH A;  2BQ8 X;  1V73 A;  4ORC A;  3H68 A;  2HY1 A;  2NYL C;  2NYM C;  2NXF A;  4LTY A;  2Q8U A;  3C9F A;  3RQZ A;  1OID A;  2HYO A;  2O8A A;  4JA7 A;  3K7V C;  4O24 A;  4FBQ A;  4V0V A;  4ZX2 A;  1MF8 A;  2JOG A;  4H2G A;  1QFC A;  1HPU A;  2WDD A;  4MOV A;  3DW8 C;  1S70 A;  4I5N C;  3IVD A;  1JK7 A;  1S8E A;  4KBP A;  5J28 A;  4O5G A;  5B8I A;  1U32 A;  1II7 A;  2IAE C;  2KKN A;  3RL4 A;  4YKE A;  4XPN A;  1FJM A;  2NPP C;  3IVE A;  3THN A;  4H1S A;  2WDE A;  5F3W A;  1QHW A;  3T1I A;  4F0Z A;  1OI8 A;  5EQV A;  4LAC C;  1KBP A;  2ZBM A;  4ORB A;  1AUI A;  1WAO 1;  3ZU0 A;  5JPF A;  4TUG A;  2HYP A;  3ICF A;  1G5B A;  4J6O A;  1WAR A;  2QJC A;  3PSO A;  2YVT A;  4FCX A;  4I5L C;  3V4Y A;  5INB A;  4UWQ A;  3LL8 A;  2DFJ A;  1HP1 A;  3JYF A;  2GJU A;  2BDX A;  3H67 A;  5DNY A;  3FGA C;  4LU9 A;  3THO B;  3TGH A;  3RL3 A;  1S95 A;  2P6B A;  1NNW A;  3H60 A;  4FBK A;  2QFP A;  2QFR A;  4HD0 A;  3IB8 A;  3HVQ A;  4DT2 A;  1Z2X A;  4UT3 A;  2AHD A;  3H66 A;  1USH A;  3QFN A;  3QFK A;  3GVE A;  1UTE A;  1M63 A;  3DSD A;  2O8G A;  1UF3 A;  2Z72 A;  4MP0 A;  4TUI A;  3H63 A;  3IB7 A;  1S3N A;  3H62 B;  4O43 A;  5JJT A;  1TCO A;  3DSC A;  3P71 C;  1XZW A;  2XMO A;  3AV0 A;  1Z2W A;  4V0X A;  2Z06 A;  4WWL A;  3QG5 C;  4M0V A;  4B2O A;  4JA9 A;  1T70 A;  3KBP A;  2BCD A;  3H69 A;  2R17 A;  1T71 A;  4MOY A;  4UT2 A;  4O4K A;  3AUZ A;  1OIE A;  2IE4 C;  4IYP C;  3E7A A;  4H1Y P;  3K7W C;  4H2F A;  4ORA A;  3EGH A;  3EGG A;  2WDF A;  2CV9 A;  1S3M A;  4G9J A;  4Q7F A;  3PSN A;  4ZVZ A;  1HO5 A;  4OR9 A;  4DHL A;  3CK2 A;  3E7B A;  4H2B A;  3QFM A;  2USH A;  3N5U A;  2Z1A A; 
#chains in the Genus database with same CATH topology
 3D03 A;  3C5W C;  5HPE A;  4H2I A;  4IL1 A;  3H61 A;  2IE3 C;  2DXL A;  3H64 A;  3ZTV A;  4NZV A;  1IT6 A;  5JPE A;  1SU1 A;  1XM7 A;  3FLO A;  4FBW A;  4UT3 B;  5GTU A;  3RL5 A;  4V0W A;  5C1V A;  1S3L A;  1W24 A;  2A22 A;  4DSY A;  2WDC A;  3QFO A;  4KKZ A;  5IOH A;  2BQ8 X;  1V73 A;  4ORC A;  3H68 A;  2HY1 A;  2NYL C;  2NYM C;  2NXF A;  4LTY A;  2Q8U A;  3C9F A;  3RQZ A;  1OID A;  2HYO A;  2O8A A;  4JA7 A;  3K7V C;  4O24 A;  4FBQ A;  4V0V A;  4ZX2 A;  1MF8 A;  2JOG A;  4H2G A;  1QFC A;  1HPU A;  2WDD A;  4MOV A;  3DW8 C;  1S70 A;  4I5N C;  3IVD A;  1JK7 A;  1S8E A;  4KBP A;  5J28 A;  4O5G A;  2ZO9 B;  5B8I A;  1U32 A;  1II7 A;  2IAE C;  2KKN A;  3RL4 A;  4YKE A;  4XPN A;  1FJM A;  2NPP C;  3IVE A;  3THN A;  2YEQ A;  4H1S A;  2WDE A;  5F3W A;  1QHW A;  3T1I A;  4F0Z A;  1OI8 A;  5EQV A;  4LAC C;  1KBP A;  2ZBM A;  4ORB A;  1AUI A;  1WAO 1;  3ZU0 A;  5JPF A;  4TUG A;  2HYP A;  3ICF A;  1G5B A;  4J6O A;  1WAR A;  2QJC A;  3PSO A;  2YVT A;  4FCX A;  4I5L C;  3V4Y A;  5INB A;  4UWQ A;  3LL8 A;  2DFJ A;  1HP1 A;  3JYF A;  2GJU A;  2BDX A;  3H67 A;  5DNY A;  2ZOA A;  3FGA C;  4LU9 A;  3THO B;  3TGH A;  3RL3 A;  1S95 A;  2P6B A;  1NNW A;  3H60 A;  4FBK A;  2QFP A;  2QFR A;  4HD0 A;  3E0J A;  3IB8 A;  3HVQ A;  4DT2 A;  1Z2X A;  4UT3 A;  2AHD A;  3H66 A;  1USH A;  3QFN A;  3QFK A;  3GVE A;  1UTE A;  2DXN A;  1M63 A;  3DSD A;  2O8G A;  1UF3 A;  2Z72 A;  4MP0 A;  4TUI A;  3H63 A;  3IB7 A;  1S3N A;  3H62 B;  4O43 A;  5JJT A;  1TCO A;  3DSC A;  3P71 C;  1XZW A;  2XMO A;  1Z2W A;  3AV0 A;  4V0X A;  2Z06 A;  4WWL A;  3QG5 C;  4M0V A;  4B2O A;  4JA9 A;  1T70 A;  3KBP A;  2BCD A;  3H69 A;  2R17 A;  1T71 A;  4MOY A;  4UT2 A;  4O4K A;  3AUZ A;  1OIE A;  2IE4 C;  4IYP C;  3E7A A;  4H1Y P;  3K7W C;  4H2F A;  4ORA A;  3EGH A;  3EGG A;  2WDF A;  2CV9 A;  1S3M A;  4G9J A;  4Q7F A;  3PSN A;  4ZVZ A;  1HO5 A;  4OR9 A;  4DHL A;  3CK2 A;  3E7B A;  4H2B A;  3QFM A;  2USH A;  3N5U A;  2Z1A A; 
#chains in the Genus database with same CATH homology
 3D03 A;  3C5W C;  5HPE A;  4H2I A;  4IL1 A;  3H61 A;  2IE3 C;  2DXL A;  3H64 A;  3ZTV A;  4NZV A;  1IT6 A;  5JPE A;  1SU1 A;  1XM7 A;  3FLO A;  4FBW A;  4UT3 B;  5GTU A;  3RL5 A;  4V0W A;  5C1V A;  1S3L A;  1W24 A;  2A22 A;  4DSY A;  2WDC A;  3QFO A;  4KKZ A;  5IOH A;  2BQ8 X;  1V73 A;  4ORC A;  3H68 A;  2HY1 A;  2NYL C;  2NYM C;  2NXF A;  4LTY A;  2Q8U A;  3C9F A;  3RQZ A;  1OID A;  2HYO A;  2O8A A;  4JA7 A;  3K7V C;  4O24 A;  4FBQ A;  4V0V A;  4ZX2 A;  1MF8 A;  2JOG A;  4H2G A;  1QFC A;  1HPU A;  2WDD A;  4MOV A;  3DW8 C;  1S70 A;  4I5N C;  3IVD A;  1JK7 A;  1S8E A;  4KBP A;  5J28 A;  4O5G A;  2ZO9 B;  5B8I A;  1U32 A;  1II7 A;  2IAE C;  2KKN A;  3RL4 A;  4YKE A;  4XPN A;  1FJM A;  2NPP C;  3IVE A;  3THN A;  2YEQ A;  4H1S A;  2WDE A;  5F3W A;  1QHW A;  3T1I A;  4F0Z A;  1OI8 A;  5EQV A;  4LAC C;  1KBP A;  2ZBM A;  4ORB A;  1AUI A;  1WAO 1;  3ZU0 A;  5JPF A;  4TUG A;  2HYP A;  3ICF A;  1G5B A;  4J6O A;  1WAR A;  2QJC A;  3PSO A;  2YVT A;  4FCX A;  4I5L C;  3V4Y A;  5INB A;  4UWQ A;  3LL8 A;  2DFJ A;  1HP1 A;  3JYF A;  2GJU A;  2BDX A;  3H67 A;  5DNY A;  2ZOA A;  3FGA C;  4LU9 A;  3THO B;  3TGH A;  3RL3 A;  1S95 A;  2P6B A;  1NNW A;  3H60 A;  4FBK A;  2QFP A;  2QFR A;  4HD0 A;  3E0J A;  3IB8 A;  3HVQ A;  4DT2 A;  1Z2X A;  4UT3 A;  2AHD A;  3H66 A;  1USH A;  3QFN A;  3QFK A;  3GVE A;  1UTE A;  2DXN A;  1M63 A;  3DSD A;  2O8G A;  1UF3 A;  2Z72 A;  4MP0 A;  4TUI A;  3H63 A;  3IB7 A;  1S3N A;  3H62 B;  4O43 A;  5JJT A;  1TCO A;  3DSC A;  3P71 C;  1XZW A;  2XMO A;  1Z2W A;  3AV0 A;  4V0X A;  2Z06 A;  4WWL A;  3QG5 C;  4M0V A;  4B2O A;  4JA9 A;  1T70 A;  3KBP A;  2BCD A;  3H69 A;  2R17 A;  1T71 A;  4MOY A;  4UT2 A;  4O4K A;  3AUZ A;  1OIE A;  2IE4 C;  4IYP C;  3E7A A;  4H1Y P;  3K7W C;  4H2F A;  4ORA A;  3EGH A;  3EGG A;  2WDF A;  2CV9 A;  1S3M A;  4G9J A;  4Q7F A;  3PSN A;  4ZVZ A;  1HO5 A;  4OR9 A;  4DHL A;  3CK2 A;  3E7B A;  4H2B A;  3QFM A;  2USH A;  3N5U A;  2Z1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...