3TGJE

S195a trypsinogen complexed with bovine pancreatic trypsin inhibitor (bpti)
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
224
structure length
215
Chain Sequence
KIVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Comparison of Anionic and Cationic Trypsinogens: The Anionic Activation Domain is More Flexible in Solution and Differs in its Mode of Bpti Binding in the Crystal Structure
pubmed rcsb
source organism Rattus norvegicus
molecule tags Complex (serine protease/inhibitor)
total genus 53
structure length 215
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tgjE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tgjE02
2HNTE 2VIPA 2ZIQH 1HAOH 1TPPA 4WH6A 3M5MA 2J2UA 3FP8E 2OC7A 1A5GH 1YCPH 1C9TA 2NU1E 3RXCA 1Z1JA 2BVXH 1HIAB 1ANBA 4HTCH 2VINA 1AUTC 1L4ZA 4YOIA 1CVWH 1EPTB 5L2ZH 4X2VA 2G51A 3V13A 1FONA 3HATH 4SGBE 3TJOA 1AKSA 3KL6A 3GCHB 1UVTH 4OS1A 2PW8H 3SORA 3O8BA 4X6OA 1H8IH 4IBLH 1O30A 3LGYA 1GBDA 1DPOA 2VWNA 4OS4A 3AW1A 4A1VA 1MKXK 3KQCA 1BOQA 4ISIH 2F83A 5DKMA 1XUHA 4JK6A 1EJNA 1P9UA 3E91A 1MU8B 2FMJA 2O8MA 1YPHE 3NWUA 3UPEA 1EAUA 2D2DA 3ATKA 1TOMH 1AVWA 2F91A 2ZECA 2J34A 1EAWA 4JZIA 1AGJA 2THFB 3E16B 1T31A 1D3PB 4MPVA 3BEUA 3ESTA 3A7VA 4BAHB 1BMAA 1BTHH 4Q7XA 3RXKA 1O3GA 2F9VA 1PPBH 1HGTH 5DP5A 3STIA 1GBBA 1P2IA 2FDAA 1V6DA 2QC2A 3A89A 4XDEA 2BZAA 3BSQA 3L3TA 1GJ4H 1K1JA 4B74A 1NN6A 1PYTC 1FY5A 5AFYH 4MTBA 1O3JA 1F0UA 1BMMH 1W7GH 3GDSA 3OY5U 2TPIZ 5F8TA 2GDEH 3H7TA 1TE0A 1RTKA 1UTJA 3NUMA 3M35A 2P3FH 4BAQB 3PO1C 3ODDA 1NRRH 2UWOA 1O3AA 1EAIA 3M61U 4FU9A 1QNJA 4AGKA 3URCA 1YF4A 1GGDC 1LQDB 2SNWA 9LPRA 1C5YB 5FCKA 3TPIZ 2K1QA 3HGPA 2NWNA 1AQ7A 4A92A 1A4WH 3LT3A 2B5TB 2OUAA 3R0FA 4ZMAH 2R0KA 1CU1A 2F9BH 1B5GH 1FAXA 1SLVB 3MU1A 1THSH 1ZSJA 1GG6B 1WU1A 3CENA 3F1SB 3SJ9A 1GHBG 4WH8A 1NS3A 3TH4H 1HAZB 3PV4A 5FAHA 1O3NA 4ISLA 1QQ4A 2Y5GA 1UVUH 3T29A 5H4IB 1TRYA 3TITA 2JETB 5E0JA 1LKBA 1GHXH 2QIQA 3BTEE 1MD7A 1UHBA 4A5TS 3BEIB 5HM2A 3ZV8A 5EPYA 1F5RA 3PYHA 4U2WA 5FPSA 3TVJB 3A7YA 2J94A 4NSVA 1F2SE 4YT6H 1HAVA 4X1SU 1ANDA 5EODA 4AFUA 3NPSA 1O5CB 1LVYA 1C5QA 2CJIA 2PKAB 1LPKB 1TX7A 4X6PA 1TGBA 1EOLA 1H1BA 2ZU3A 2WINI 3S0NA 4H6TA 1NRNH 1B7XB 1F0TA 1IQHA 3RM2H 1TNIA 2ZFPH 1C5SA 1TNKA 2QA9E 4Y8ZA 4UE7H 1AVXA 5GDSH 2BD3A 3RXSA 2V3OH 4HFPB 4FUCA 1KTTB 1WAYB 1K2I1 1CHGA 2ZCLP 5BPEA 3LGVA 1V2RT 4YT7H 4K60A 1ZSKA 1HAGE 1YPLH 5HM9A 1GMCG 1ZTJA 1LHGH 5F03A 2GZ8A 4BOHA 1ELCA 1VCWA 3MTYA 4NA7A 3KHVA 3A7WA 1GJAB 1H9IE 3K6ZA 3A86A 1FMGA 5T6DA 6CHAC 4THNH 4INKA 4O3TA 1ZMJA 1ZRBA 1ESBA 1UTKA 7ESTE 5CHAC 2XC5A 5GWZA 4BTUB 2PWXA 3E0PB 4JZEH 2CN0H 5A8ZA 1O2GH 4YESB 1VCPA 1O2RA 1P05A 3GICB 2CHAB 2J92A 1W0ZU 3RU4E 1DLKB 3UQVA 3RXEA 2PUQH 4LOYH 4B71A 2ZI2H 2BLWA 3LONA 4QT8C 4AFZA 2XNIA 1GMDF 3M3SA 1TBRH 1Y5BT 1N6YA 5HMAA 1VITF 4R8TB 3NKKA 4X2WA 1LO6A 1IQJA 2C93B 3DD2H 4Y0ZE 2FOBA 3FFGA 8GCHG 1F0SA 1JBUH 5C5OA 3S9AA 1TNLA 2Z6BD 5GCHF 5ABWA 4YZUA 3ZZBA 4D7GA 2FOAA 2BDHA 1IHTH 3PLKA 3UWJH 1VJ9U 2WV5A 3IWMA 2SGQE 3LGIA 1ELGA 2GP9B 2GZ7A 2A5IA 2W7UA 1PQ7A 5DK1A 3RUOA 4AYVB 3LKWA 1SGDE 3QWCH 1GBKA 1C5NH 1IQLA 1AN1E 1Y8TA 2PKSC 4B2BA 1OX1A 1OP0A 2OBQA 2AGGX 4MDSA 1XUKA 1MBMA 1INCA 2BDYA 3SGAE 1TWXB 1OWKA 1AI8H 3UR6A 3TK5A 1ANEA 1K1OA 5DP7A 1HYLA 3UNQA 3ZZAA 4Y0YE 1DWBH 4NFFA 2ZHWH 2BQ6B 2ALVA 3MWIU 3VXFH 1S0QA 1GI8B 3SUEA 1S83A 1SBWA 4YOJA 1EX3A 4A1XA 2OC0A 2XWAA 5C5NA 1W13U 1WCZA 1S84A 1AD8H 1AKSB 3PMBB 3RXFA 3UQOA 3SI4H 2P59A 3FP7E 3QDZB 1GDQA 1RJXB 4KTUA 3M7QA 4E7NA 3A7ZA 1D9IA 2RA3A 1DXPA 1T8NA 1NRPH 1P57B 1FZZA 1W11U 3AAVA 1OWIA 1GI1A 2B9LA 1IHSH 1AIXH 2BY8X 2Z9JA 3G01A 3TGJE 1H9HE 1TPSA 2W26A 3EQ0H 4IW4E 3EDXB 1CBWB 1GMCF 1TLDA 1KDQA 2ZCKP 3LJOA 3TJUA 4JMYA 4CRFA 1TOCB 1O35A 3ZVBA 1SGTA 5C2ZA 1W7XH 2ZWLH 1LHCH 2W5EA 2XC0A 1IAUA 3UY9A 1LPGB 1O3FA 1ZPCA 1P09A 2GVFA 1E36B 1HLTH 1NESE 3GYMA 3TK6A 1QB9A 1SC8U 2ZKSA 2V6NA 3RC4A 1DUAA 3MH7A 3A81A 3RXMA 1TPAE 4JCNA 1SHHB 4X8SH 2SGFE 2EI7A 4H4FA 1SGPE 1AB9C 1ZJKA 2XRCA 3LGWA 3T26A 4CRGA 3MOCA 3BN9A 2F9PA 1CA0B 4X1NU 4ABEA 4K8YA 4UFGH 4CR9A 5LPEA 3UOUA 1HXEH 2Z94A 2GX4A 4I8GA 5DG6A 1A5HA 5G4BA 1QRXA 3A80A 4I8LA 3HK6B 4A1TA 1EP5A 4MPXA 2CF8H 1ORFA 1QRZA 2ZP0H 1CHOG 7GCHF 3SGBE 1BT7A 1GI9B 2UUYA 1UCYE 3QO6A 1GMHF 1GDNA 2ZTZA 4WY3A 1ZHMA 1O2XA 1DY9A 4K1EA 1NFWA 3GCOA 4I33A 3QGNB 1YM0A 3KN2A 5C1XA 2FI3E 1L4DA 2G52A 4CH2B 2HOBA 4Y7BA 5C1UA 1PPFE 2C8XB 8KME2 1SG8B 1HJ8A 4ISNA 2BZ6H 2FOHA 1BRUP 6GCHG 2ASUB 4ABGA 1YP9A 3N7OA 3A82A 1GDUA 2R3UA 2GV7A 2FX4A 4GCHG 5K7RA 3TU7H 2CMYA 2C90B 1LMWB 4AB9A 2FODA 1RIWC 1QR3E 4NIVA 1HAXB 2GGVB 1K1NA 1QL7A 1UHBB 3MNBA 3P8FA 1HXFH 2ODQA 3MH6A 2XW9A 1DWEH 4NGAH 2XC4A 1HAVB 1W0YH 1PJPA 4MLFB 2P8OB 4I31A 1DLEA 1GI6A 2BDGA 1TNGA 3TK9A 2VH6A 1NFYA 2PTNA 1O2ZA 1BUIA 2BLVA 4BAKB 3O8CA 1YKTA 3TGKE 1C2IA 1XX9A 2VVVA 1O3MA 1G3BA 3M5NA 1WTHD 2A32A 2UWLA 1SMFE 3RU4T 1IOEA 3U8TH 5CMXH 2XYAA 2LNCA 1QBVH 1O2WA 1HUTH 2BLOA 1DOJA 1ZPZA 3LC5A 1MD8A 5FPYA 1JWTA 2Z9KA 1C1OA 3ZV9A 1K22H 5DGJA 1B0EA 3BTTE 5ETXA 1OP8A 2VWLA 1UK2A 4CRDA 1JOUB 4XE4A 1UTQA 1MZDA 2VIOA 5A8XA 2FP7B 3M7TA 1O2TA 3OSYA 1EAXA 1PPEE 4TY7A 4D9RA 2FEQH 2A4QA 1TNJA 3B8JA 1HAIH 1H9LB 2FOFA 2EEKA 1BBRK 1YBWA 1YPGH 1ZTLA 3SGQE 2Z7FE 6ESTA 4CHAC 1FJSA 1SOTA 1O36A 1W8BH 3BTHE 2BDIA 1QJ1B 1XUFA 4Q7ZA 2QYIA 1Q31A 1O3LA 3V3MA 1Y3UA 2BVRH 4UD9H 5CE1A 1RGQA 1ELAA 1NROH 2DE8A 1P2QA 1ELTA 1PPCE 1RS0A 4FUIA 4GSOA 1ESTA 1O31A 4ZHAA 2R2MB 4BTTB 1MUEB 4WVPE 1FV9A 1FI8A 1UJ1A 1NRQH 3DFJA 1RFNA 1HJAC 3ZZ9A 2PR3A 3MU5A 1NPMA 3PLPA 1MTNB 3E0NB 4ABBA 1SFIA 2EI8A 2QF3A 1GCTC 3L33A 1TMTH 4Y8YA 3ZZ5A 1A0LA 2Z9GA 3GOVB 4IC6A 3ATIA 1A46H 3KNXA 4B2CA 1XMNB 1C5ZB 4JK5A 1V2MT 2ODPA 4Y71A 4FVDA 4KTCA 2G5VA 3VGCB 4OGXA 4R0IA 1GI5A 1O2YA 4X0WU 1GJ5H 1V2WT 1QCPA 2TBSA 4O9VA 1Z8IB 2QXHA 2BQ7B 1A61H 1J15A 1GL0E 4YLQH 3B9FH 1W12U 1VGCC 3K9XB 4Y7AA 3STJA 4AB8A 4MPUA 1PFXC 3SNDA 2ZFTA 1AFQC 1TQ0B 1G2MA 1QJ6B 2ZDMA 1TBQH 2GD4B 2GMTB 2VIVA 2BY9X 2QXIA 4OS6A 1P2OA 1V2TT 2RA0A 2P93A 1Y59T 3E8LA 1V2QT 2WPLS 4ABHA 3E6PH 4TY6A 4TWYA 2G5NA 5FBEA 1EPTC 3UFAA 2Y7ZA 2AGIX 3RXBA 2AH4X 3Q3YA 1CSOE 2CV3A 1H4WA 3SU3A 3UIRA 3F9EA 1G32B 5J4SA 1HAYB 3TH3H 3KCGH 2HNTF 1O0DH 1AWHB 1BB0B 1QB1A 2XXLA 2GDDA 2ZGJA 3ZZ6A 1WQVH 1P02A 1G9IE 5HXFA 2Z9LA 2ZDKA 2VIQA 1FNIA 1KDQB 2ALPA 3T28A 1OXGA 3ATWA 2Y5FA 2PSYA 1SGIB 1NZQH 1O3DA 1O5BB 2ZGCA 4MQAA 4X2XA 3VB4A 1E37B 1GHWH 1AU8A 1V2OT 5I46H 1KSNA 1VCQA 1NO9H 2C4FH 3U8RH 2O8WA 1GI4A 1KYNA 4GUXA 3SBKA 2F9UA 2F3CE 4LZ4B 1K9OE 5IDKA 3P8OA 3QTVH 1C2JA 1T4VH 4BNRA 5EG4A 1SB1H 5HGGA 4UFDH 1FIWA 2ZDNA 2FS9A 1C2KA 5JBTA 1SGRE 2R2WU 1SGCA 1W3CA 1UCYH 1GJ8B 3GCTF 1ELDE 3SI3H 1EB1H 3SJ8A 3EE0B 2ZTYA 1RD3B 3MNSA 1CT0E 3K2UA 1DX5M 1ZTKA 1RXPA 1CA8B 3TNSA 4ZKRU 2H9EH 1QY6A 5F8ZA 2H5DA 4DURA 2FI4E 1UTLM 1Y5UT 1BJUA 1BTXA 1XVMA 2A45B 4MNYA 3TH2H 3OU0A 4B1TA 1DANH 1GJBB 4BXWA 3ATLA 2TGPZ 2STBE 1GMDG 4H42U 3HKIB 3RXHA 3UTUH 2HALA 1OWDA 5E2OA 1HFDA 1VITG 4AG1A 3Q3XA 1C1UH 1HB0B 4ZKOU 2BD2A 2OLGA 1SOZA 5JB9S 3ZVEA 4Q2KA 5GCHG 1QA0A 4UFFH 1TBZH 1F0RA 3A7TA 1J8AA 2P3TB 2QAAA 1K21H 1OWHA 1FY1A 2J9NA 4NIXA 4D9QA 1KXDA 1M9UA 1GVZA 1MAYA 1NU9A 5JBCS 1DY8A 1G2LA 5C3NA 3BG4B 1LHDH 1P12E 2AMPA 1AMHA 2XBVA 5FX6A 1P0SH 1KLTA 1ZLRA 3PO1B 4AGJA 1T8LA 1TYNA 1QBNA 1SPJA 4WXIA 5LPFA 2B7DH 1ELFA 2TGTA 1FUJA 3LPRA 3SN8A 1O2NA 2FOMB 1G36A 2PSXA 2SFAA 3F9HA 1GGDB 3MU8A 3LJJA 3KQBA 4AFQA 2ZFSA 4IGDA 5JDUB 1GBJA 3BTFE 1O3HA 1TAWA 1GHVH 1XXDA 2BXTH 1FPCH 1G30B 5GXPA 1P01A 1GI3A 1T8OA 2EI6A 1C2LA 2GT7A 4PROA 1O2LA 2A4RA 2ZQ2A 3D65E 4ZKSU 3ZVDA 1QL9A 5L2YH 4CRCA 1F7ZA 2A5KA 4LZ1H 1NC6A 1HNEE 2HPQH 1G3CA 3SJOA 3F68H 1YLDA 4JZFH 2Y82A 3ATMA 2FESH 4GPGA 3E3TA 1O3KA 2ZHFH 2ZPRA 3SOSA 2QGRA 2TGDA 2ANKH 1BJVA 1TGCA 1SVPA 4E05H 3UR9A 3GY5A 2QXJA 4D8NA 1CQQA 1C5LH 1UTPA 5C20A 2ZF0H 2HGTH 1LVOA 2O8UA 4OS2A 1PPGE 3T25A 1UMAH 4KP0A 3OX7U 1P9SA 1MKWK 3RM0H 2OC8A 1TNHA 2BY6X 5JBAS 1TONA 5EQRA 1DICA 2SGAA 2BD7A 5ESTE 1EJAA 4IMQA 1EZXC 1MMJN 3S7HB 1JIMA 2FS8A 1AZZA 2FYQA 2LPRA 4UEHH 2BVSH 2GTBA 4VGCC 1UVOA 1C2EA 3RXLA 1O32A 1P2JA 3SQHE 4FU7A 3SW2B 1T32A 5EGMA 4XOJA 1P11E 2AEIH 2C8YB 1GBTA 1RTLA 4Z6AH 7GCHG 2ZCHP 1QBOA 3UUZA 4FUFA 1K1PA 1GMHG 3M5OA 1ABIH 4KGAA 3PMJA 2D1JA 2GCTC 5ESBA 4YLUA 1O3EA 1WTGH 5CHAB 1XXFA 1G3EA 1FPHH 2ZGBH 8ESTE 3V7TA 4X6NA 2WPJS 1GI7B 3F9GA 3SU5A 1OYQA 4DG4A 5DO4H 1GCDA 1J17T 1O2MA 3CS7A 1MCTA 5GJ4B 1N6XA 1C5OH 1YPMH 1GBMA 2ZGXH 5F6MA 1TA6A 1ZPBA 4NZLA 2FOCA 5EW1H 1BDAA 1BZXE 3SU0A 1ABJH 3JZ2B 4JYVH 4SGAE 1GI0A 3ZYDA 4BAOB 3C1KA 2F9OA 2ESTE 1KXAA 1ESAA 2OC1A 1AE8H 5IYTA 4FUEA 3URDA 1LCYA 3AVZA 1MAXA 3RDZA 1V2KT 2PGBB 5L6NH 3DHKH 3KF2A 4Z0KA 1A5IA 4ZUHA 3DFLA 2NU2E 4U30A 4U32A 3RXRA 2VJ1A 4U01A 1D3DB 4GAWA 1PQ8A 1UVPA 3QK1A 1C5TA 1T7CA 4FUJA 1PQAA 3GY4A 3NXPA 1PPHE 1EATA 2PKSB 4NIWA 3FANA 1MTUA 1G37A 1TGNA 1V2LT 3H7OA 1XKBC 1A0HB 2GCHF 2V35A 5I25A 3OY6U 3CP7A 1ACBE 1SGFA 1V3XA 3PTBA 3V0XA 5TCAA 4WXVA 5FBIA 8LPRA 2OP9A 1YPJH 3TJVA 2AYWA 1XVOA 2A1DB 1E0FD 1A7SA 1QHRB 3GY2A 3RLWH 1WV7H 1GBHA 3EA7A 4ABJA 4WMEA 1DE7H 3HKJB 1GHYH 2O9QA 1ZGIA 3FZDA 1GL1A 1NFUA 1SGEE 4I7YH 2QCYA 2A5AA 4I32A 1YLCA 3SJIA 2TGAA 3HGNA 1O2UA 2ANWA 3P8NA 3O8DA 2PV9B 1XUIA 1DWCH 4X1RU 1E34B 3Q76A 3I29A 4WJG2 5T3HA 1QFKH 4I8KA 4IC5A 2V0BA 1N1LA 4IMZA 2VIWA 2OQUA 1UVSH 1BTWA 1K1LA 4CR5A 1PPZA 1A1RA 1L0ZA 1OOKB 4NA9H 4AG2A 2EC9H 2ZU5A 2D8WA 3P95A 3A85A 1WUNH 1V2ST 1MQ6A 4ABDA 2BXUH 1O39A 1DITH 4FXGH 1SQTA 1YPEH 2A31A 1W10U 3MNCA 1AZ8A 1MTWA 3M36A 2ZFQH 2VB0A 4JZDH 2HRVA 4K1TA 1A0JA 1JRTA 1ELVA 4ISOA 3U8OH 1FDPA 2BMGB 2IJOB 3T27A 4RKOB 1N8OC 3GDUA 3P17H 4B2AA 3LH1A 1CGHA 1ID5H 2A0QB 4X8VH 1TIOA 5PTPA 2BX4A 1Z6JH 3WY8A 1TRNA 1O2JA 2SNVA 2Z3EA 3PTNA 1XM1A 3ZYEA 4Y10E 4I8JA 2ZO3H 1B0FA 4NWLA 1NTPA 1WQSA 4ZAEA 3ZZDA 1THRH 1DWDH 1OWJA 3SHAH 2ZU1A 4INLA 2V3HH 3L6PA 3QTOH 5EXNA 1OSSA 2FI5E 4HZHA 2G4UA 3VB7A 1C5RA 2NU3E 1BTYA 2PFEA 2J38A 1T4UH 4GHTA 2W3KA 3GISB 2D26C 4DJZB 4CH8B 4DCDA 2XBWA 1THPB 1MKXH 1DXWA 2GV6A 4WMDA 5GIBA 5DP6A 2PHBA 2BQWB 1TALA 1GJ6A 2BD9A 3P70B 2Y5HA 2BD4A 3T62A 3MMGA 3ZVFA 5EW2H 1P2KA 3RMNH 1RIWB 2ZPSA 3Q3KA 5JB8S 3MO6A 1O38A 2C8WB 3NZIA 1O34A 5JPMH 1JRSA 2WV4A 2VIDA 1HBTH 1TX8A 1OPHB 2HPPH 1JIRA 1H8DH 2Z3DA 3BTWE 4J2YB 2Y6TA 1K1IA 2BYAX 4CBNA 3I77A 3W94A 2A7HA 1P10A 1TGSZ 2UWPA 1QL8A 1ZJDA 3QLPH 3ITIA 1Z1IA 1GJCB 3PB1E 5AF9H 4B75A 4NG9H 1IQKA 1F5LA 1O33A 4ZXYH 3SNCA 3RC5A 2VH0A 5A09A 2SGPE 1EKBB 3Q00A 3ZVGA 5EXMA 3GCTG 3BEFB 1Y3VA 4BXSA 1S0RA 1QQUA 1J14A 3JZ1B 1TQ7B 3RXVA 4KELA 4DW2U 1SSXA 3A84A 1GBAA 4X2YA 1V2NT 1DS2E 3IG6B 2BB4A 1FY8E 1GBEA 1EZUC 2QN5T 1C1QA 1ZSLA 3BTQE 3MU0A 1BMNH 2Q6FA 2TRMA 4LK4A 3DT0H 4WWYA 3U98H 1P3CA 4CHAB 2FOGA 4K3JA 3SNEA 1ARCA 2QXGA 3A8CA 2WPHS 1ZYOA 4UDWH 1CT4E 1O5DH 2I6SA 2NU0E 2OQ5A 3E1XB 1C1VH 2ZTXA 3UNRA 2AMDA 1GPZA 2UUJB 4FVBA 5J4QA 1P8VC 1C2DA 3C27B 1C1PA 1QURH 1LQEA 1ETSH 1C5PA 3MO3A 2XBXA 1HJAB 1C2GA 2VGCC 5T6GA 1IQIA 2WPMS 3RXQA 1LKAA 1GCTB 4TYDA 4WMFA 4IN1A 2AIQA 4CBOA 4O3UA 3OTJE 4TWWA 1QB6A 2PTCE 1MBQA 3D23A 1ZR0A 2J95A 3RXGA 4B76A 2ZDAH 1PYTD 2PGQB 5A0CA 5DP4A 4FUDA 3GCHC 3VB5A 3RXIA 5C67A 1GBCA 1OWEA 1X7AC 2G81E 1MH0A 1VGCB 3MO9A 2XCFA 1G3DA 2Z9IA 2F9NA 1GJ7B 2B8OH 3NCLA 2ANMH 5DPAA 2AFQB 1VR1H 3ZZCA 2P94A 2JH5D 4YM9A 5FX5A 1BTPA 3GYLB 4FUHA 2Z3CA 2FLRH 4Q80A 1IQNA 3U9AH 4IN2A 3RMLH 1LVMA 4X6MA 4XBDA 1WYKA 2H9HA 1BBRE 3DUXH 3UNSA 2DUCA 1BHXB 4BAMB 1V2PT 1ETRH 3I78A 1Z6EA 1S81A 2FZZA 1DSUA 1GJ9B 2KAIA 4AYYB 2HNTC 3SV2H 3SV8A 1A3EH 3Q77A 1IQMA 4RN6A 2BOKA 1HJ9A 3ZZ8A 2ZZUH 1W2KH 1EUFA 1UTNA 2VU8E 1DM4B 1OP2A 3KQDA 4ASHA 4ESTE 1LHEH 1C2FA 2OXSA 2G55A 1EASA 5EQQA 2HWLB 2VWOA 4KTSA 3KGPA 2AGEX 4GVUA 3BIVH 4E06H 3ODFA 1ELBA 5GPIB 1ZOMA 2WUCA 3M5LA 1C4Y2 1C1NA 7LPRA 3M3TA 1D4PB 1Y3WA 2IOTA 4ZKNU 1L1JA 1LHFH 1Q2WA 2IN2A 1O2OA 4X8UH 1O5AB 1TRMA 4FU8A 3BG4C 1EP6A 1LVBA 2BD5A 1A3BH 1C5XB 1GG6C 2PUXB 1YPHC 1GBIA 2Y7XA 1C1TA 2OD3B 3GY6A 1C1WH 4OS5A 2VWMA 2WUBA 1MTSA 4HI3A 2FOEA 1QJ7B 3LDXH 1XUJA 1QA7A 1O2IA 2JETC 1EB2A 3QZRA 3SNAA 1Z8RA 2CF9H 3RLYH 2ZHEH 4MPWA 3TIUA 3BG8A 4BTIB 1VJAU 4WF8A 3A7XA 3ENSB 2XBYA 4FUBA 3LC3A 2ZPQA 4O97A 3BTKE 4X1PU 2C8ZB 4JYUH 1V2JT 4K69A 1LPZB 1FQ3A 4HGCA 5B6OA 3IITA 2WYJA 1GHAG 1MZAA 2OBOA 2B0FA 5E8EH 4X1QU 3UWIA 1C5UA 2XTTB 2ZHDA 3LOXA 3SHCH 4DOQA 1BTZA 3RXOA 2RCEA 3U1IB 3M3VA 3T5FH 3ZVCA 1YYY1 1C2MA 1P04A 5L30H 2GCHG 1OS8A 4ZH8A 1FY3A 4X8TH 3M7UA 2FPZA 5TJXA 1RRKA 1P2MA 3PM3A 4B73A 3PROA 1KLJH 4ZHLU 1HAHH 3GY8A 1SQAA 1GVKB 2JH0D 3QX5H 4K5ZA 2C3SA 3RU4D 2ULLA 1ZGVA 1UK4A 2YNAA 2XWBI 4NA8A 4JYTA 1SL3A 1S82A 3VEQB 1FN8A 2GZ9A 2Q6GA 4TPYA 5EPNA 2BY7X 5DP9A 4AN7A 5TCCA 1FN6A 3QZQA 3MH4A 3RP2A 4D7FA 1QGFA 4ZROA 2CHAC 2WPKS 1ZHPA 7KMEH 4F49A 5AHGH 1YCPK 5E2PA 1ELEE 1AHTH 4Y8XA 1C4U2 5FHTA 4AZ2B 3BIUH 3P92A 1ARBA 1O2KA 2EA3A 3SQEE 4Y79A 3QGJA 4J1YA 1NM6A 1UK3A 4ZHMU 1CO7E 2QY0B 1EOJA 1O2PA 4NSYA 4TPIZ 1D3TB 1D6RA 4KKDA 1ZMNA 1WSSH 2FYRA 1YC0A 1NRSH 1AY6H 1O3OA 2G8TA 1SI5H 3LU9B 4DVAU 1DT2A 3T2NA 1BIOA 1S85A 1EJMA 1S5SA 4JZ1A 3RXTA 4INHA 3SV9A 6CHAB 1Z7KA 3PLBA 2QF0A 1KLIH 1O2QA 1JXPA 2Y81A 6LPRA 4Q7YA 2BLQA 1FLEE 2ZFFH 4VGCB 1GWAA 2XCNA 4ABIA 1UCYK 4K8BA 1AUJA 1O5GH 1GI2A 1IQFA 3RXAA 1DUEA 3SU2A 3B23B 2O8LA 1C1MA 1DVAH 1SFQB 3TJNA 1BITA 2ZNKH 4XFQA 2WYGA 3S9BA 2A7CA 3NK8A 2BDCA 2P3UB 1J16A 1ETTH 1BCUH 4ABFA 1L1NA 2CXVA 2FLBH 3U1JB 3EA8A 3EGKH 1AE5A 5T6FA 2GCTB 1GHAF 5A0AE 1E35B 4AOQA 1GHBF 1O3IA 9ESTA 1KXEA 5E0HA 2BOHB 3ZZ4A 1UTMA 2ZHQH 1HAPH 3TLOA 5LPRA 3P8GA 1UTOA 1BBRH 3A8BA 5LH8A 1TABE 3SV7A 1O3CA 2H1UA 5E0GA 3SJKA 3ELAH 1CBWC 1MTVA 4H6SB 1QIXB 2H9TH 3GY3A 4XBCA 1FY4A 4MNVA 4YO9A 2H5CA 2HLCA 3FVFB 1AFEH 1TFXA 3VFEA 3RMMH 1F5KU 1KXFA 1P3EA 2M5TA 4DT7B 1SGYE 4CRBA 2P95A 1V2UT 5LGOA 4BANB 2FO9A 1HDTH 4GHQA 2ZGHA 4MNXA 1AWFH 1TMBH 4Y11E 3PMHB 1O2SA 4RKJB 3RXDA 1FIZA 1HIAA 2I6QA 1KY9A 2KAIB 3E90B 5A8YA 1NT1A 1EPTA 1SHYA 2R3YA 4D76A 3MYWA 3DA9B 5C1YA 3EAJA 2A2XH 1K1MA 3K65B 2FXRA 4LXBH 4XBBA 1AVGH 1Z71A 2A7JA 3VPKA 4NWKA 3EA9A 1VZQH 1CA0C 3AW0A 4GLYA 5EXLA 1FAKH 1XKAC 1P06A 3PWCA 4A6LA 2ZC9H 3BTDE 4UONA 3S9CA 2FM2A 3KQEA 3D49H 2BM2A 1GVLA 5EQSA 2CGAA 1SGNE 1KXCA 3MH5A 1D6WA 2JH6D 3ZVAA 3M37A 2ZQ1A 1BRBE 1V2VT 5DP3A 2BHGA 3FZZA 1YCPM 3H5CB 1SLUB 1Z8JB 2A4OA 3KIDU 2OINA 2ZFRH 3MNXA 5EU8A 1O5FH 1IQEA 3HK3B 3S69A 1KXBA 1ZZZA 5FXLA 3VB3A 1S6FA 1SGFG 1MCVA 4I8HA 1MQ5A 3A8AA 4Y76A 1BQYA 1QRWA 2BDBA 2FIRH 1AB9B 4NFEA 1UO6A 4DGJA 5AFZH 1DSTA 1C9PA 3F9FA 4F4OC 8GCHF 1EZSC 1L2EA 3P6ZB 4MNWA 4RSPA 2ZDVH 2P16A 1L1GA 3S7KB 1S6HA 2O8TA 4ISHH 3SO3A 3LGUA 1GHZA 2IPHA 4DIHH 1O37A 1C1SA 2ILNA 4DIIH 2P8OC 4MVNA 4FUGA 4YOGA 1Z8GA 2ODYB 4K1SA 5K0HA 1ANCA 2H6MA 1PQ5A 1N8OB 4A7IB 1U6QA 1EXFA 3ZZ3A 3BF6H 4M7GA 1DFPA 1OKXA 3SUFA 3RC6A 1CGJE 2FX6A 2GKVE 3RMOH 1SLXB 1C1RA 1CE5A 3MFJA 1J9CH 3GCNA 2UUKB 1ZMLA 3RXPA 2ZG0H 2A2QH 3GDVA 5JYIA 1SQOA 2YOLA 1EQ9A 3SZNA 1O3PB 1GBLA 1GJDB 2WPIS 5DP8A 1OYTH 2QV1A 2SGDE 2OTVA 2Y80A 2VVCA 1T8MA 1RTFB 2STAE 1TA2A 5FPTA 1O5EH 1P2NA 2AERH 4OS7A 3MI4A 1O3BA 1IQGA 1O2HA 1P03A 4CREA 2UUFB 4O03A 3V12A 5DJ7A 1Y3YA 2G00A 2TIOA 3MHWU 3UOPA 1HRTH 1BMLA 2R0LA 1CGIE 2RDLA 1TPOA 4YTAA 3A83A 3D62A 1C2HA 2JKHA 4AFSA 5A0BA 3RXJA 1TMUH 3HPTB 2ZDLA 1NY22 4K2YA 3RXUA 2FWWA 1A2CH 3K6YA 3BV9B 2PKAA 1BRAA 1EZQA 3AASA 1KTSB 1HPGA 1Y5AT 1TGTA 3QUMP 4ZXXH 3W95A 1SGQE 3LGTA 3TGIE 2G4TA 1C4V2 1LDTT 1C5VA 3FP6E 4E7RG 1TX6A 4Y6DA 1F92A 1HCGA 4AORA 4DY7B 1VITH 3SU4A 3O8RA 3FAOA 4NZQA 2AIPA 3SUDA 1FXYA 3A8DA 1NFXA 2BD8A 1O2VA 2YNBA 1QTFA 1AO5A 3U69H 2FTMA 1TB6H 2AS9A 3F6UH 3VB6A 1MTNC 2VNTA 2Q1JA 3QN7A 2BY5X 3GY7A 5JBBS 2BX3A 3LH3A 1SR5C 5FCRA 2J4IA 3ZZ7A 2ZA5A 1NU7B 1Q3XA 1Y3XA 1K28D 3TNTA 1ZHRA 3A88A 2GT8A 3LIWA 3VGCC 3SUGA 3SV6A 3UREA 2R9PA 2H2ZA 2Q6DA 1BRCE 1CHOF 3PWBA 1YPKH 1W14U 2RG3A 4IS5A 1XUGA 1SLWB 3SU1A 1CT2E 1YGCH 2ANYA 2W3IA 3OYPA 2SGEE 5A2MH 1JMOH 1DDJA 2GMTC 3MU4A 1D3QB 4UFEH 3EYDA 1WBGB 4NCYA 6GCHF 5SGAE 1HV7A 4XSKU 1BHXF 3R3GB 4OGYA 4GCHF 5EOKA 1C5WB 3CS0A 1KIGH 1E38B 1BTUA 1WOFA 3AAUA 4NIYA 2AMQA 4ABAA 3BTME 5BRRE 3KEEA 3SNBA 4MG3A 4AX9H 2W7SA 2BTCE 5HYOA 2DE9A 2FTLE 2ZU2A 2ZEBA 3PMAB 2BDAA 2HVXA 3VXEH 1BA8B 1ZRKA 3BTGE 3A87A 2VVUA 2NU4E 2ZU4A 2OCVB 5F8XA 5AVDA 2A4GA 2PLXA 1C5MD 1MKWH 1GBFA 1LTOA 3SU6A 4CRAA 1MU6B 2VGCB 1AFQB
chains in the Genus database with same CATH superfamily
2HNTE 2VIPA 2ZIQH 1HAOH 1TPPA 4WH6A 3M5MA 2J2UA 3FP8E 2OC7A 1A5GH 1YCPH 1C9TA 2NU1E 3RXCA 1Z1JA 2BVXH 1HIAB 1ANBA 4HTCH 2VINA 1AUTC 1L4ZA 4YOIA 1CVWH 1EPTB 5L2ZH 4X2VA 2G51A 3V13A 1FONA 1NBMD 3HATH 4SGBE 3TJOA 1AKSA 3KL6A 3GCHB 1UVTH 4OS1A 2PW8H 3SORA 3O8BA 4X6OA 1H8IH 4IBLH 1O30A 3LGYA 1GBDA 1DPOA 2VWNA 4OS4A 3AW1A 4A1VA 1MKXK 3KQCA 4B6EA 2L74A 1BOQA 4ISIH 2F83A 5DKMA 1XUHA 4JK6A 1EJNA 1P9UA 3E91A 1MU8B 2FMJA 2O8MA 1YPHE 3NWUA 3UPEA 1EAUA 2D2DA 3ATKA 1TOMH 1AVWA 2F91A 2ZECA 2J34A 1EAWA 4JZIA 1AGJA 2THFB 3E16B 1T31A 1D3PB 4MPVA 3BEUA 3ESTA 3A7VA 1SQRA 4BAHB 1BMAA 1QZ8A 1BTHH 4Q7XA 3RXKA 1O3GA 2F9VA 1PPBH 1HGTH 5DP5A 3STIA 1GBBA 1P2IA 2FDAA 1V6DA 2QC2A 3A89A 3OFND 4XDEA 2BZAA 3BSQA 3L3TA 1GJ4H 1K1JA 4B74A 1NN6A 1PYTC 1FY5A 5AFYH 4MTBA 1O3JA 1F0UA 1BMMH 1W7GH 3GDSA 3OY5U 2TPIZ 5F8TA 2GDEH 3H7TA 1TE0A 1RTKA 1UTJA 3NUMA 3M35A 2P3FH 4BAQB 3PO1C 3ODDA 1NRRH 2UWOA 1O3AA 1EAIA 3M61U 4FU9A 1QNJA 4AGKA 3URCA 2F43B 1YWUA 1YF4A 5DN6D 3WWFA 1GGDC 1LQDB 2SNWA 9LPRA 1C5YB 5FCKA 3TPIZ 2K1QA 2EY4C 3HGPA 2NWNA 1AQ7A 4A92A 1A4WH 3LT3A 2B5TB 2OUAA 3R0FA 4ZMAH 2R0KA 1CU1A 2F9BH 1B5GH 1FAXA 2F4LA 1SLVB 3MU1A 1THSH 1ZSJA 1GG6B 1WU1A 3CENA 3F1SB 3SJ9A 1GHBG 4WH8A 1NS3A 3TH4H 1HAZB 3PV4A 5FAHA 1O3NA 4ISLA 1QQ4A 2Y5GA 1UVUH 3T29A 5H4IB 1TRYA 3TITA 2JETB 5E0JA 1LKBA 1GHXH 2QIQA 3BTEE 1MD7A 5DSFA 1UHBA 4A5TS 3BEIB 5HM2A 3ZV8A 5EPYA 1F5RA 3PYHA 4U2WA 5FPSA 3TVJB 3A7YA 2J94A 4NSVA 1F2SE 4YT6H 1HAVA 4X1SU 1ANDA 5EODA 4XD7D 3PRDA 4AFUA 3NPSA 1O5CB 1LVYA 1C5QA 2CJIA 2PKAB 1LPKB 1TX7A 4X6PA 1TGBA 1EOLA 1H1BA 2ZU3A 2WINI 3S0NA 4H6TA 1NRNH 1B7XB 1F0TA 1IQHA 3RM2H 1TNIA 2ZFPH 1C5SA 1TNKA 2QA9E 4Y8ZA 4UE7H 1AVXA 5GDSH 2KM0A 2BD3A 3RXSA 2V3OH 4HFPB 2KCAA 4FUCA 1KTTB 1WAYB 1K2I1 1CHGA 5EJZA 2ZCLP 5BPEA 3LGVA 1V2RT 4YT7H 4K60A 1ZSKA 1HAGE 1YPLH 5HM9A 1GMCG 1ZTJA 1LHGH 5F03A 2GZ8A 4BOHA 1ELCA 1VCWA 3MTYA 4NA7A 3KHVA 3A7WA 1GJAB 1H9IE 3K6ZA 3A86A 1FMGA 2RFKC 5T6DA 6CHAC 4THNH 4INKA 4O3TA 1ZMJA 1ZRBA 1ESBA 1UTKA 7ESTE 5CHAC 2XC5A 5GWZA 4BTUB 2PWXA 3E0PB 4JZEH 2CN0H 5A8ZA 1O2GH 4YESB 1VCPA 1O2RA 1P05A 3GICB 2CHAB 2J92A 1W0ZU 3RU4E 1DLKB 3UQVA 3RXEA 2PUQH 4LOYH 4B71A 2ZI2H 2BLWA 3EE7A 3LONA 4QT8C 4AFZA 2XNIA 1GMDF 2J5UA 3M3SA 1TBRH 1Y5BT 1N6YA 5HMAA 1VITF 4R8TB 3NKKA 4X2WA 1LO6A 1IQJA 2C93B 3DD2H 4Y0ZE 2FOBA 3FFGA 8GCHG 1F0SA 1JBUH 5C5OA 3S9AA 1TNLA 2Z6BD 5GCHF 3PRBA 5ABWA 4YZUA 3ZZBA 4D7GA 2FOAA 2BDHA 1IHTH 3PLKA 3UWJH 4YXWD 1VJ9U 2WV5A 3IWMA 2SGQE 3LGIA 1ELGA 2GP9B 2GZ7A 2A5IA 2W7UA 1PQ7A 5DK1A 3RUOA 2WV9A 4AYVB 3LKWA 1SGDE 3QWCH 2V7QD 3KYGA 4TSFD 1GBKA 1C5NH 1IQLA 1AN1E 1Y8TA 2PKSC 4B2BA 1OX1A 1OP0A 2OBQA 2AGGX 4MDSA 1XUKA 1MBMA 1INCA 2BDYA 3SGAE 1TWXB 1OWKA 1AI8H 3UR6A 3TK5A 1ANEA 1K1OA 5DP7A 1HYLA 3UNQA 2K8IA 3ZZAA 4Y0YE 1DWBH 4NFFA 2ZHWH 2BQ6B 2ALVA 3MWIU 3VXFH 1S0QA 1GI8B 3SUEA 1S83A 1SBWA 4YOJA 1EX3A 4A1XA 2OC0A 2XWAA 5C5NA 1W13U 1WCZA 1S84A 1AD8H 1AKSB 3PMBB 3RXFA 3UQOA 3SI4H 2P59A 3FP7E 3QDZB 1GDQA 1RJXB 4KTUA 3M7QA 4E7NA 3A7ZA 1D9IA 2RA3A 1DXPA 1T8NA 1NRPH 1P57B 1FZZA 1W11U 3AAVA 1OWIA 1GI1A 2B9LA 4TT3D 1IHSH 1AIXH 2BY8X 2Z9JA 3G01A 3TGJE 1H9HE 1TPSA 2W26A 3EQ0H 4IW4E 3EDXB 1CBWB 1GMCF 1TLDA 1KDQA 2ZCKP 3LJOA 3TJUA 5C0TA 4JMYA 4CRFA 1TOCB 1O35A 3ZVBA 1SGTA 5C2ZA 1W7XH 2ZWLH 1LHCH 2W5EA 2XC0A 1IAUA 3UY9A 1LPGB 1O3FA 1ZPCA 2QE7D 1P09A 2GVFA 1E36B 1HLTH 1NESE 3GYMA 3TK6A 1QB9A 4ASUD 1SC8U 2ZKSA 2V6NA 2KR7A 3RC4A 1DUAA 3MH7A 3A81A 3RXMA 1TPAE 4JCNA 1SHHB 4X8SH 2SGFE 2EI7A 4H4FA 1SGPE 1AB9C 1ZJKA 2XRCA 3LGWA 3T26A 4CRGA 3MOCA 3BN9A 2F9PA 1CA0B 4X1NU 4ABEA 4K8YA 4UFGH 1EFRD 4CR9A 3UOUA 5LPEA 1HXEH 2Z94A 2GX4A 4I8GA 5DG6A 1A5HA 5G4BA 1QRXA 3A80A 4I8LA 3HK6B 4A1TA 1EP5A 4MPXA 2CF8H 1ORFA 1QRZA 2ZP0H 1CHOG 7GCHF 3SGBE 1BT7A 1GI9B 2UUYA 1UCYE 3QO6A 1GMHF 1GDNA 2ZTZA 4WY3A 1ZHMA 1O2XA 1DY9A 4K1EA 1NFWA 3GCOA 4I33A 3QGNB 1YM0A 3KN2A 5C1XA 2FI3E 1L4DA 2G52A 4CH2B 2HOBA 4Y7BA 5C1UA 1PPFE 2C8XB 8KME2 1SG8B 1HJ8A 4ISNA 2BZ6H 2FOHA 1BRUP 6GCHG 1KMHB 2ASUB 4ABGA 1YP9A 3N7OA 3A82A 1GDUA 1S6LA 2R3UA 2GV7A 2FX4A 4GCHG 5K7RA 3TU7H 2CMYA 2C90B 1LMWB 4AB9A 2FODA 1RIWC 1QR3E 4NIVA 1HAXB 2GGVB 1K1NA 2K0QA 1QL7A 1UHBB 3MNBA 3P8FA 1HXFH 2ODQA 3MH6A 2XW9A 1DWEH 4NGAH 2XC4A 1HAVB 1W0YH 1PJPA 4MLFB 2P8OB 4I31A 1DLEA 1GI6A 2BDGA 1TNGA 3TK9A 2VH6A 1NFYA 2PTNA 1O2ZA 1BUIA 2BLVA 4BAKB 3O8CA 1YKTA 3TGKE 1C2IA 1XX9A 2VVVA 1O3MA 1G3BA 3M5NA 1WTHD 3FN8A 2A32A 2UWLA 4Z1MD 1SMFE 3RU4T 1IOEA 3U8TH 5CMXH 2XYAA 2LNCA 1QBVH 1O2WA 1HUTH 2BLOA 1DOJA 1ZPZA 3LC5A 4RI0A 1MD8A 5FPYA 1JWTA 2Z9KA 1C1OA 3ZV9A 1K22H 5DGJA 1B0EA 3BTTE 5ETXA 1OP8A 2VWLA 1UK2A 4XRNA 4CRDA 4HG6A 1JOUB 4XE4A 1UTQA 1MZDA 2VIOA 5A8XA 2XNDD 3AK5A 2FP7B 3M7TA 1O2TA 3OSYA 4DT4A 1EAXA 1PPEE 4TY7A 4D9RA 2FEQH 2A4QA 1TNJA 2KX4A 1HAIH 3B8JA 1H9LB 3KQ5A 1COWD 2FOFA 2EEKA 1BBRK 1YBWA 1YPGH 1ZTLA 3SGQE 5F53A 2Z7FE 6ESTA 4CHAC 1FJSA 1SOTA 1O36A 1W8BH 3BTHE 2BDIA 1QJ1B 1XUFA 5HKKD 4Q7ZA 2QYIA 1Q31A 1O3LA 3V3MA 1Y3UA 2BVRH 2JIZD 4UD9H 5CE1A 1RGQA 1ELAA 1NROH 2DE8A 1P2QA 1ELTA 1PPCE 3KYFA 1RS0A 4FUIA 4GSOA 1ESTA 1H8HD 1O31A 4ZHAA 2R2MB 4BTTB 1MUEB 4WVPE 2W6JD 1FV9A 1FI8A 1UJ1A 1NRQH 3DFJA 1RFNA 1HJAC 3ZZ9A 2PR3A 3MU5A 1NPMA 3PLPA 1MTNB 3CNRA 3E0NB 1SFIA 2EI8A 4ABBA 2QF3A 1GCTC 3L33A 1TMTH 4Y8YA 3ZZ5A 1A0LA 2Z9GA 2L6OA 3GOVB 4IC6A 3ATIA 1A46H 3KNXA 4B2CA 1XMNB 1C5ZB 4JK5A 1V2MT 2ODPA 4Y71A 4FVDA 4KTCA 2IPQX 2G5VA 3VGCB 4OGXA 4R0IA 1GI5A 2PP6A 1O2YA 1SKYE 4X0WU 1GJ5H 1V2WT 1QCPA 2TBSA 4O9VA 1Z8IB 2QXHA 2BQ7B 1A61H 1J15A 1GL0E 3SZEA 4YLQH 3B9FH 1W12U 1VGCC 3K9XB 4Y7AA 3STJA 4AB8A 4MPUA 1PFXC 3SNDA 2ZFTA 1AFQC 1TQ0B 1G2MA 1QJ6B 2ZDMA 1TBQH 2YMSB 2GD4B 2GMTB 2VIVA 2BY9X 2QXIA 4OS6A 1P2OA 1V2TT 2RA0A 2P93A 1Y59T 3E8LA 1V2QT 2WPLS 4ACBA 4ABHA 3E6PH 4TY6A 4TWYA 2G5NA 5FBEA 1EPTC 1W0JD 3UFAA 2Y7ZA 2AGIX 3RXBA 3F0OA 2AH4X 3Q3YA 1CSOE 2CV3A 1H4WA 3SU3A 3UIRA 3F9EA 1G32B 5J4SA 1HAYB 3TH3H 3KCGH 2HNTF 1O0DH 1AWHB 1BB0B 1QB1A 2XXLA 2GDDA 2ZGJA 3ZZ6A 1WQVH 1P02A 1G9IE 5HXFA 2Z9LA 2ZDKA 2VIQA 1FNIA 1KDQB 2ALPA 3T28A 1OXGA 3ATWA 2Y5FA 2PSYA 1SGIB 1NZQH 1O3DA 1O5BB 2ZGCA 4MQAA 4X2XA 3VB4A 1E37B 1GHWH 1AU8A 1V2OT 5I46H 1KSNA 1VCQA 1NO9H 2C4FH 3U8RH 2O8WA 1GI4A 1KYNA 4GUXA 3SBKA 2F9UA 2F3CE 4LZ4B 1K9OE 5IDKA 3P8OA 3QTVH 1C2JA 1T4VH 4BNRA 5EG4A 1SB1H 5HGGA 4UFDH 1FIWA 2ZDNA 2FS9A 1C2KA 5JBTA 1SGRE 2R2WU 1SGCA 1W3CA 1UCYH 1GJ8B 3GCTF 1ELDE 3SI3H 1EB1H 3SJ8A 3EE0B 2ZTYA 1RD3B 3MNSA 1CT0E 3K2UA 2KCYA 1DX5M 1ZTKA 1RXPA 3FOAA 1CA8B 3TNSA 4ZKRU 2H9EH 1QY6A 5F8ZA 2H5DA 4DURA 2FI4E 1UTLM 1Y5UT 1BJUA 1BTXA 1XVMA 2A45B 4MNYA 3TH2H 3OU0A 4B1TA 3UB0A 2QF4A 1DANH 1GJBB 4BXWA 3ATLA 2TGPZ 2STBE 1GMDG 4H42U 3HKIB 3RXHA 3UTUH 2HALA 1OWDA 5E2OA 1HFDA 1VITG 4AG1A 3Q3XA 1C1UH 1HB0B 4ZKOU 2BD2A 2OLGA 1SOZA 5JB9S 3ZVEA 4Q2KA 5GCHG 1QA0A 4UFFH 1TBZH 1F0RA 3A7TA 1J8AA 2P3TB 2QAAA 1K21H 1OWHA 1FY1A 2J9NA 4NIXA 4D9QA 1KXDA 1M9UA 1GVZA 1MAYA 1NU9A 1FX0B 1DY8A 5JBCS 1G2LA 5C3NA 3BG4B 1LHDH 1P12E 2AMPA 1AMHA 2XBVA 5FX6A 1P0SH 1KLTA 1ZLRA 3PO1B 4AGJA 1T8LA 1TYNA 1QBNA 1SPJA 4WXIA 5LPFA 2B7DH 1ELFA 2TGTA 1WXRA 1FUJA 2AHME 3LPRA 3SN8A 1O2NA 2FOMB 1G36A 2PSXA 2SFAA 3F9HA 1GGDB 3MU8A 3LJJA 3KQBA 4AFQA 1W0KD 2ZFSA 4IGDA 5JDUB 1GBJA 3BTFE 1O3HA 1TAWA 1GHVH 1XXDA 2BXTH 1FPCH 1G30B 5GXPA 1P01A 1GI3A 1T8OA 2EI6A 1C2LA 2GT7A 4PROA 1O2LA 2A4RA 2ZQ2A 3D65E 4ZKSU 3ZVDA 1QL9A 5L2YH 4CRCA 1F7ZA 2A5KA 4LZ1H 1NC6A 1HNEE 2HPQH 1G3CA 3SJOA 3F68H 1YLDA 4JZFH 2Y82A 3ATMA 2FESH 4GPGA 3E3TA 1O3KA 2ZHFH 2ZPRA 3SOSA 2QGRA 2TGDA 2ANKH 1BJVA 1TGCA 1SVPA 5EJLA 4E05H 3UR9A 3GY5A 2QXJA 4D8NA 1CQQA 1C5LH 1UTPA 5C20A 2ZF0H 2HGTH 1LVOA 2O8UA 4OS2A 1PPGE 3T25A 1UMAH 4KP0A 3OX7U 2WPDD 1P9SA 1MKWK 3RM0H 2OC8A 1TNHA 2BY6X 5JBAS 1TONA 5EQRA 1DICA 2SGAA 2BD7A 4F48B 5ESTE 1EJAA 4IMQA 1EZXC 1MMJN 3S7HB 1JIMA 2FS8A 5HIYA 1AZZA 2FYQA 2LPRA 4UEHH 2BVSH 2GTBA 4VGCC 1UVOA 1C2EA 3RXLA 1O32A 1P2JA 3SQHE 3F3BA 4FU7A 3SW2B 1T32A 5EGMA 4XOJA 1P11E 2AEIH 2C8YB 1GBTA 1RTLA 4P02A 4Z6AH 7GCHG 2ZCHP 1QBOA 2IJD1 4FUFA 3UUZA 1K1PA 1GMHG 3M5OA 1ABIH 4KGAA 3PMJA 2D1JA 2GCTC 5ESBA 4YLUA 1O3EA 1WTGH 5CHAB 1XXFA 1G3EA 1FPHH 2JDID 2ZGBH 8ESTE 3V7TA 4X6NA 2WPJS 1GI7B 3F9GA 3SU5A 1OYQA 4DG4A 5DO4H 1GCDA 1J17T 1O2MA 3CS7A 1MCTA 5GJ4B 1N6XA 1C5OH 1YPMH 1GBMA 2ZGXH 5F6MA 1TA6A 1ZPBA 4NZLA 2FOCA 5EW1H 1BDAA 1BZXE 3SU0A 1ABJH 3JZ2B 4JYVH 4SGAE 1GI0A 3ZYDA 2JJ2D 2V3MA 4BAOB 3C1KA 2F9OA 2ESTE 1KXAA 1ESAA 2OC1A 1AE8H 5IYTA 4FUEA 3URDA 1LCYA 3AVZA 1MAXA 3RDZA 1V2KT 2PGBB 5L6NH 3DHKH 3KF2A 4Z0KA 1A5IA 4ZUHA 3DFLA 2NU2E 4U30A 4U32A 3RXRA 2VJ1A 4U01A 1D3DB 4GAWA 1PQ8A 1UVPA 3QK1A 1C5TA 2VBCA 1T7CA 4FUJA 1PQAA 3GY4A 3NXPA 5C94A 1PPHE 1EATA 2PKSB 4NIWA 3FANA 1MTUA 1G37A 1TGNA 1V2LT 3H7OA 1XKBC 1A0HB 2GCHF 2V35A 5I25A 3OY6U 3CP7A 5EJ1A 1ACBE 1SGFA 1V3XA 3PTBA 3V0XA 5TCAA 4WXVA 5FBIA 8LPRA 2OP9A 1YPJH 3TJVA 2AYWA 1XVOA 2A1DB 1E0FD 1A7SA 1QHRB 3GY2A 3RLWH 1WV7H 1GBHA 3EA7A 4ABJA 4WMEA 1DE7H 3HKJB 1GHYH 2O9QA 1ZGIA 3FZDA 1GL1A 1NFUA 1SGEE 4I7YH 2QCYA 2A5AA 4I32A 1YLCA 3SJIA 2TGAA 3HGNA 1MABB 1O2UA 2ANWA 3P8NA 3O8DA 2PV9B 1XUIA 1DWCH 4X1RU 1E34B 3Q76A 3I29A 4WJG2 5T3HA 1QFKH 4I8KA 4IC5A 2V0BA 1N1LA 4IMZA 2EQNA 2VIWA 2OQUA 1UVSH 1BTWA 1K1LA 4CR5A 1PPZA 1A1RA 1L0ZA 1OOKB 4NA9H 3WW7A 4AG2A 2EC9H 2ZU5A 2D8WA 3P95A 3A85A 5IK2D 1WUNH 1V2ST 3SYJA 1MQ6A 4ABDA 2BXUH 1O39A 1DITH 4FXGH 1SQTA 1YPEH 2A31A 1W10U 3MNCA 1AZ8A 1MTWA 2HVYB 3MQKC 3M36A 2CK3D 2ZFQH 2VB0A 4JZDH 2HRVA 4K1TA 1A0JA 1JRTA 1ELVA 4ISOA 3U8OH 1FDPA 2BMGB 2IJOB 3T27A 4RKOB 1N8OC 3GDUA 3P17H 4B2AA 3LH1A 1CGHA 1ID5H 2A0QB 4X8VH 1TIOA 5PTPA 1WDIA 2BX4A 1Z6JH 3WY8A 1TRNA 1O2JA 2SNVA 2Z3EA 3PTNA 1XM1A 3ZYEA 4Y10E 1YLNA 4I8JA 2ZO3H 1B0FA 4NWLA 1NTPA 1WQSA 4ZAEA 3ZZDA 1THRH 1DWDH 2WZQA 1OWJA 3SHAH 2ZU1A 4INLA 2V3HH 3L6PA 3QTOH 5EXNA 1OSSA 2FI5E 4HZHA 2G4UA 3VB7A 1C5RA 2NU3E 1BTYA 2PFEA 2J38A 1T4UH 4GHTA 4RT1A 2W3KA 3GISB 2D26C 4DJZB 4CH8B 4DCDA 2XBWA 1THPB 1MKXH 3FO8D 3PV2A 1DXWA 2GV6A 4WMDA 5GIBA 5DP6A 2PHBA 2BQWB 3N7DA 1TALA 1GJ6A 2BD9A 3P70B 2Y5HA 2BD4A 3T62A 3MMGA 2J98B 4FOUC 3ZVFA 5EW2H 1P2KA 3RMNH 1RIWB 2ZPSA 3Q3KA 5JB8S 3MO6A 1O38A 2YMSD 2C8WB 3NZIA 1O34A 5JPMH 1JRSA 2WV4A 2VIDA 1HBTH 1TX8A 5EIYA 1OPHB 2HPPH 1JIRA 1H8DH 2Z3DA 3BTWE 4J2YB 2Y6TA 1K1IA 2BYAX 2QF5A 4CBNA 3I77A 3W94A 2A7HA 1P10A 1TGSZ 5C0UA 2UWPA 1QL8A 1ZJDA 3QLPH 3ITIA 1Z1IA 1GJCB 3PB1E 5AF9H 4B75A 4NG9H 1IQKA 1F5LA 1O33A 4ZXYH 3SNCA 3RC5A 2VH0A 5A09A 2SGPE 1EKBB 3Q00A 3ZVGA 5EXMA 3GCTG 3BEFB 1Y3VA 4BXSA 1S0RA 1QQUA 1J14A 2KZ4A 3JZ1B 1TQ7B 3RXVA 4KELA 4DW2U 1SSXA 3A84A 1GBAA 4X2YA 1V2NT 1DS2E 3IG6B 2BB4A 1FY8E 1GBEA 1EZUC 2QN5T 1C1QA 1ZSLA 3BTQE 3MU0A 1BMNH 2Q6FA 2TRMA 4LK4A 3DT0H 4WWYA 3U98H 1P3CA 4CHAB 2FOGA 4K3JA 3SNEA 1ARCA 3UAIC 2QXGA 3A8CA 2WPHS 1ZYOA 4UDWH 1CT4E 1O5DH 2I6SA 2NU0E 2OQ5A 3E1XB 1C1VH 2ZTXA 3UNRA 2AMDA 1GPZA 3OTPA 2UUJB 4FVBA 5J4QA 1P8VC 1C2DA 3C27B 1C1PA 1QURH 1LQEA 1ETSH 4ZCNA 1C5PA 3MO3A 2GJGA 2XBXA 1HJAB 1C2GA 2VGCC 5T6GA 1IQIA 2WPMS 3RXQA 1LKAA 1GCTB 4TYDA 4WMFA 4IN1A 2AIQA 4CBOA 4O3UA 3OTJE 4TWWA 1QB6A 2PTCE 1MBQA 3D23A 1ZR0A 2J95A 3RXGA 4B76A 2ZDAH 1PYTD 2PGQB 5A0CA 5DP4A 4FUDA 3GCHC 3VB5A 3RXIA 5C67A 1GBCA 1OWEA 1X7AC 2G81E 1MH0A 1VGCB 3MO9A 2XCFA 1G3DA 2Z9IA 2F9NA 1K0HA 1GJ7B 2B8OH 3NCLA 2ANMH 5DPAA 2AFQB 1VR1H 3ZZCA 2P94A 2JH5D 4YM9A 5FX5A 1BTPA 3GYLB 4FUHA 2Z3CA 2FLRH 4Q80A 1IQNA 3U9AH 4IN2A 3VG8A 3RMLH 1LVMA 4X6MA 4XBDA 1WYKA 2H9HA 1BBRE 3DUXH 3UNSA 2DUCA 1BHXB 4BAMB 1V2PT 1ETRH 3I78A 1Z6EA 1S81A 2FZZA 1DSUA 1GJ9B 2KAIA 4AYYB 2HNTC 3SV2H 3SV8A 1A3EH 3Q77A 1IQMA 4RN6A 2BOKA 1HJ9A 3ZZ8A 2ZZUH 1W2KH 1EUFA 1UTNA 2VU8E 1DM4B 1OP2A 3KQDA 1VKYA 4ASHA 4ESTE 1NBME 3N99A 1LHEH 1C2FA 1UW7A 2OXSA 2G55A 1EASA 5EQQA 2HWLB 1E1QD 2VWOA 4KTSA 3KGPA 2W6ID 2AGEX 4GVUA 3BIVH 4E06H 3ODFA 1ELBA 5GPIB 1ZOMA 2WUCA 3M5LA 1C4Y2 1C1NA 7LPRA 3M3TA 1D4PB 1Y3WA 2IOTA 4ZKNU 1L1JA 1LHFH 3PV5A 1Q2WA 2IN2A 1O2OA 4X8UH 1O5AB 1TRMA 4FU8A 3BG4C 1EP6A 1LVBA 2BD5A 1A3BH 1C5XB 1GG6C 2PUXB 1YPHC 1GBIA 2Y7XA 1C1TA 2OD3B 3GY6A 1C1WH 4OS5A 2VWMA 2WUBA 1MTSA 4HI3A 2FOEA 1QJ7B 3LDXH 1XUJA 1QA7A 1O2IA 2JETC 1EB2A 3N7EA 3QZRA 3SNAA 2RDEA 1Z8RA 2CF9H 3RLYH 2ZHEH 4MPWA 3TIUA 3BG8A 4BTIB 1VJAU 4WF8A 3A7XA 5T1VA 3ENSB 2XBYA 4FUBA 3LC3A 2ZPQA 4O97A 3BTKE 4X1PU 2C8ZB 4JYUH 1V2JT 4K69A 1LPZB 1FQ3A 4HGCA 5B6OA 1OHHD 3IITA 2WYJA 1GHAG 1MZAA 2OBOA 2B0FA 5E8EH 4X1QU 3UWIA 3FKSD 1C5UA 2XTTB 2ZHDA 3LOXA 3SHCH 4F55A 4DOQA 4OM9A 1BTZA 3RXOA 2RCEA 3U1IB 3M3VA 3T5FH 4FETA 3ZVCA 1YYY1 1C2MA 2J98A 1P04A 5L30H 2GCHG 1OS8A 4ZH8A 1FY3A 4X8TH 4RT0A 3M7UA 2FPZA 5TJXA 1RRKA 1P2MA 3PM3A 4B73A 3PROA 1KLJH 4ZHLU 5C17A 1HAHH 3GY8A 1SQAA 1GVKB 2JH0D 3QX5H 4K5ZA 2C3SA 3RU4D 2ULLA 1ZGVA 2HLDD 1UK4A 2YNAA 2XWBI 4NA8A 4JYTA 1SL3A 1S82A 3VEQB 1FN8A 2GZ9A 2Q6GA 2J97A 3F2FA 4TPYA 5EPNA 2BY7X 5DP9A 4AN7A 5TCCA 1FN6A 3QZQA 3MH4A 3RP2A 4D7FA 1QGFA 4ZROA 2CHAC 2WPKS 1ZHPA 4P00A 4F49A 7KMEH 5AHGH 1YCPK 5E2PA 1ELEE 1AHTH 3GS9A 4Y8XA 1C4U2 5FHTA 4AZ2B 3BIUH 3P92A 1ARBA 1O2KA 2EA3A 3SQEE 4Y79A 3QGJA 4J1YA 1NM6A 5GNDA 1UK3A 4ZHMU 1CO7E 2QY0B 4AC9A 1EOJA 1O2PA 3DSOA 4NSYA 4TPIZ 3OEED 1D3TB 1D6RA 3DCLA 4KKDA 1ZMNA 1WSSH 2FYRA 1YC0A 1NRSH 1AY6H 1O3OA 2G8TA 1SI5H 3LU9B 4DVAU 1DT2A 3T2NA 1BIOA 1S85A 1EJMA 1S5SA 4JZ1A 3RXTA 4INHA 3SV9A 6CHAB 1Z7KA 3PLBA 2QF0A 1KLIH 1O2QA 1JXPA 2Y81A 6LPRA 4Q7YA 2BLQA 2KCPA 1FLEE 2ZFFH 4VGCB 1GWAA 2XCNA 3W1EA 4ABIA 1YY3A 1UCYK 4K8BA 1AUJA 1O5GH 1GI2A 1IQFA 3RXAA 1DUEA 3SU2A 3B23B 2O8LA 1C1MA 1DVAH 1SFQB 3TJNA 1BITA 2ZNKH 4XFQA 2WYGA 3S9BA 2A7CA 3NK8A 2BDCA 2P3UB 5HIZA 1J16A 1ETTH 1BCUH 4ABFA 1L1NA 2CXVA 2FLBH 3DSPA 3U1JB 3EA8A 3EGKH 1AE5A 5T6FA 2GCTB 5KECA 1GHAF 5A0AE 1E35B 4AOQA 1GHBF 1O3IA 9ESTA 1KXEA 5E0HA 2BOHB 3ZZ4A 1UTMA 2ZHQH 1HAPH 3OEHD 3TLOA 5LPRA 3P8GA 1UTOA 1BBRH 3A8BA 5LH8A 1TABE 4Q4LA 3SV7A 1O3CA 2H1UA 5E0GA 3SJKA 3ELAH 1CBWC 1MTVA 4H6SB 1QIXB 2H9TH 3GY3A 4XBCA 1FY4A 4MNVA 4YO9A 2H5CA 2HLCA 2WHXA 3FVFB 1AFEH 1TFXA 3VFEA 3RMMH 1F5KU 1KXFA 1P3EA 2M5TA 4DT7B 1SGYE 4CRBA 2P95A 1V2UT 5LGOA 4BANB 2FO9A 1HDTH 4GHQA 2ZGHA 4MNXA 1AWFH 2WSSD 1TMBH 4Y11E 1E79D 3PMHB 1O2SA 4RKJB 3RXDA 1FIZA 1HIAA 2I6QA 1KY9A 2KAIB 3E90B 5A8YA 1NT1A 1EPTA 1SHYA 3DSGA 2R3YA 4D76A 3MYWA 3DA9B 5C1YA 3EAJA 2A2XH 1K1MA 2XOKD 3K65B 2FXRA 4LXBH 4XBBA 1AVGH 1Z71A 2A7JA 3VPKA 4NWKA 3EA9A 1VZQH 5CDFE 1CA0C 3AW0A 4GLYA 5EXLA 1FAKH 1XKAC 1P06A 3PWCA 4A6LA 2ZC9H 3BTDE 4UONA 3S9CA 2FM2A 3KQEA 3D49H 2BM2A 1GVLA 5EQSA 2CGAA 1SGNE 1KXCA 3MH5A 1D6WA 2JH6D 3ZVAA 3M37A 2ZQ1A 1BRBE 1V2VT 5DP3A 2BHGA 3FZZA 1YCPM 3H5CB 1SLUB 1Z8JB 2A4OA 3KIDU 2OINA 2ZFRH 3MNXA 5EU8A 1O5FH 1IQEA 3HK3B 3S69A 1KXBA 1ZZZA 5FXLA 3VB3A 1S6FA 1SGFG 1MCVA 4I8HA 1MQ5A 3A8AA 4Y76A 1BQYA 1QRWA 2BDBA 2KFWA 4B6FA 2FIRH 1AB9B 4NFEA 1E1RD 1UO6A 4DGJA 5AFZH 1DSTA 1C9PA 3F9FA 4F4OC 8GCHF 1EZSC 1L2EA 3P6ZB 4MNWA 4RSPA 2ZDVH 2P16A 1BMFD 1L1GA 3S7KB 1S6HA 2O8TA 4ISHH 3SO3A 3LGUA 2M2AA 1GHZA 2IPHA 4DIHH 1O37A 1C1SA 2ILNA 4I86A 4DIIH 2P8OC 4MVNA 3F0PA 4FUGA 4YOGA 1Z8GA 2ODYB 4K1SA 5K0HA 1ANCA 2H6MA 1PQ5A 4Q63A 1N8OB 4A7IB 1U6QA 1EXFA 3ZZ3A 5FL7D 3BF6H 4M7GA 1DFPA 1OKXA 3SUFA 3RC6A 1CGJE 2FX6A 2GKVE 3RMOH 2LELA 1SLXB 1C1RA 1CE5A 3MFJA 1J9CH 3GCNA 2UUKB 1ZMLA 3RXPA 2ZG0H 3OE7D 2A2QH 3WWBA 3GDVA 5JYIA 1SQOA 2YOLA 1EQ9A 3SZNA 1O3PB 1GBLA 1GJDB 2WPIS 5DP8A 1OYTH 2QV1A 2SGDE 2OTVA 2Y80A 2VVCA 1T8MA 1RTFB 2STAE 1TA2A 5FPTA 1O5EH 1P2NA 2AERH 4OS7A 3MI4A 1O3BA 1IQGA 1O2HA 1P03A 4CREA 2UUFB 4O03A 3V12A 5B6LA 5DJ7A 1Y3YA 2G00A 2TIOA 3MHWU 3UOPA 1HRTH 1BMLA 2R0LA 1CGIE 2RDLA 1TPOA 4YTAA 4M9FA 3A83A 3D62A 1C2HA 2JKHA 4AFSA 5A0BA 3RXJA 1TMUH 3HPTB 2ZDLA 1NY22 4K2YA 3RXUA 2FWWA 1A2CH 3K6YA 3BV9B 2PKAA 1BRAA 1EZQA 3AASA 1KTSB 1HPGA 1Y5AT 1TGTA 1H8ED 3QUMP 4ZXXH 3W95A 1SGQE 3LGTA 3ZIAD 3TGIE 2G4TA 5KEDA 1C4V2 1LDTT 1C5VA 3FP6E 4E7RG 1TX6A 4Y6DA 1F92A 1HCGA 4AORA 4DY7B 1VITH 3SU4A 3O8RA 3FAOA 4NZQA 2AIPA 3SUDA 1FXYA 3A8DA 1NFXA 2BD8A 1O2VA 2YNBA 1QTFA 1AO5A 3U69H 2FTMA 1TB6H 2AS9A 3F6UH 3VB6A 1MTNC 2VNTA 2Q1JA 3F2GA 3QN7A 2BY5X 5KGOA 2JJ1D 3OAAD 3GY7A 5JBBS 2BX3A 3LH3A 1SR5C 5FCRA 2J4IA 3ZZ7A 2ZA5A 1NU7B 1Q3XA 1Y3XA 1K28D 3TNTA 2OK5A 1ZHRA 3A88A 2GT8A 3LIWA 3VGCC 3SUGA 3SV6A 3UREA 2R9PA 2H2ZA 2Q6DA 1BRCE 1CHOF 3PWBA 1YPKH 1W14U 2RG3A 3NRLA 2LP6A 4IS5A 1XUGA 1SLWB 3SU1A 1CT2E 1YGCH 2ANYA 2W3IA 3OYPA 2SGEE 5A2MH 1JMOH 1DDJA 3F2HA 2YMSC 2GMTC 3MU4A 1D3QB 4UFEH 3EYDA 1WBGB 4NCYA 6GCHF 5SGAE 1HV7A 4XSKU 1BHXF 3R3GB 4OGYA 2KCOA 4GCHF 5EOKA 1C5WB 3CS0A 1KIGH 3H09A 1E38B 1BTUA 1WOFA 3AAUA 4NIYA 5CHBA 2AMQA 4ABAA 3BTME 5BRRE 3KEEA 3SNBA 4MG3A 4AX9H 2W7SA 3U28C 2BTCE 5HYOA 2DE9A 2FTLE 2ZU2A 2ZEBA 3PMAB 2BDAA 2HVXA 3VXEH 1BA8B 4ACAA 1ZRKA 3BTGE 3A87A 2VVUA 2NU4E 2ZU4A 2OCVB 5F8XA 5AVDA 2A4GA 2PLXA 1C5MD 1MKWH 1GBFA 1LTOA 3SU6A 4CRAA 1MU6B 2VGCB 1AFQB
chains in the Genus database with same CATH topology
2HNTE 2VIPA 2ZIQH 1HAOH 1TPPA 4WH6A 3M5MA 2J2UA 3FP8E 2OC7A 1A5GH 1YCPH 1C9TA 2NU1E 3RXCA 1Z1JA 2BVXH 1HIAB 1ANBA 4HTCH 2VINA 1AUTC 1L4ZA 4YOIA 1CVWH 1EPTB 5L2ZH 4X2VA 2G51A 3V13A 1FONA 3HATH 4SGBE 3TJOA 1AKSA 3KL6A 3GCHB 1UVTH 4OS1A 2PW8H 3SORA 3O8BA 4X6OA 1H8IH 4IBLH 1O30A 3LGYA 1GBDA 1DPOA 2VWNA 4OS4A 3AW1A 4A1VA 1MKXK 3KQCA 1BOQA 4ISIH 2F83A 5DKMA 1XUHA 4JK6A 1EJNA 1P9UA 3E91A 1MU8B 2FMJA 2O8MA 1YPHE 3NWUA 3UPEA 1EAUA 2D2DA 3ATKA 1TOMH 1AVWA 2F91A 2ZECA 2J34A 1EAWA 4JZIA 1AGJA 2THFB 3E16B 1T31A 1D3PB 4MPVA 3BEUA 3ESTA 3A7VA 4BAHB 1BMAA 1BTHH 4Q7XA 3RXKA 1O3GA 2F9VA 1PPBH 1HGTH 5DP5A 3STIA 1GBBA 1P2IA 2FDAA 1V6DA 2QC2A 3A89A 4XDEA 2BZAA 3BSQA 3L3TA 1GJ4H 1K1JA 4B74A 1NN6A 1PYTC 1FY5A 5AFYH 4MTBA 1O3JA 1F0UA 1BMMH 1W7GH 3GDSA 3OY5U 2TPIZ 5F8TA 2GDEH 3H7TA 1TE0A 1RTKA 1UTJA 3NUMA 3M35A 2P3FH 4BAQB 3PO1C 3ODDA 1NRRH 2UWOA 1O3AA 1EAIA 3M61U 4FU9A 1QNJA 4AGKA 3URCA 1YF4A 1GGDC 1LQDB 2SNWA 9LPRA 1C5YB 5FCKA 3TPIZ 2K1QA 3HGPA 2NWNA 1AQ7A 4A92A 1A4WH 3LT3A 2B5TB 2OUAA 3R0FA 4ZMAH 2R0KA 1CU1A 2F9BH 1B5GH 1FAXA 1SLVB 3MU1A 1THSH 1ZSJA 1GG6B 1WU1A 3CENA 3F1SB 3SJ9A 1GHBG 4WH8A 1NS3A 3TH4H 1HAZB 3PV4A 5FAHA 1O3NA 4ISLA 1QQ4A 2Y5GA 1UVUH 3T29A 5H4IB 1TRYA 3TITA 2JETB 5E0JA 1LKBA 1GHXH 2QIQA 3BTEE 1MD7A 1UHBA 4A5TS 3BEIB 5HM2A 3ZV8A 5EPYA 1F5RA 3PYHA 4U2WA 5FPSA 3TVJB 3A7YA 2J94A 4NSVA 1F2SE 4YT6H 1HAVA 4X1SU 1ANDA 5EODA 4AFUA 3NPSA 1O5CB 1LVYA 1C5QA 2CJIA 2PKAB 1LPKB 1TX7A 4X6PA 1TGBA 1EOLA 1H1BA 2ZU3A 2WINI 3S0NA 4H6TA 1NRNH 1B7XB 1F0TA 1IQHA 3RM2H 1TNIA 2ZFPH 1C5SA 1TNKA 2QA9E 4Y8ZA 4UE7H 1AVXA 5GDSH 2BD3A 3RXSA 2V3OH 4HFPB 4FUCA 1KTTB 1WAYB 1K2I1 1CHGA 2ZCLP 5BPEA 3LGVA 1V2RT 4YT7H 4K60A 1ZSKA 1HAGE 1YPLH 5HM9A 1GMCG 1ZTJA 1LHGH 5F03A 2GZ8A 4BOHA 1ELCA 1VCWA 3MTYA 4NA7A 3KHVA 3A7WA 1GJAB 1H9IE 3K6ZA 3A86A 1FMGA 5T6DA 6CHAC 4THNH 4INKA 4O3TA 1ZMJA 1ZRBA 1ESBA 1UTKA 7ESTE 5CHAC 2XC5A 5GWZA 4BTUB 2PWXA 3E0PB 4JZEH 2CN0H 5A8ZA 1O2GH 4YESB 1VCPA 1O2RA 1P05A 3GICB 2CHAB 2J92A 1W0ZU 3RU4E 1DLKB 3UQVA 3RXEA 2PUQH 4LOYH 4B71A 2ZI2H 2BLWA 3LONA 4QT8C 4AFZA 2XNIA 1GMDF 3M3SA 1TBRH 1Y5BT 1N6YA 5HMAA 1VITF 4R8TB 3NKKA 4X2WA 1LO6A 1IQJA 2C93B 3DD2H 4Y0ZE 2FOBA 3FFGA 8GCHG 1F0SA 1JBUH 5C5OA 3S9AA 1TNLA 2Z6BD 5GCHF 5ABWA 4YZUA 3ZZBA 4D7GA 2FOAA 2BDHA 1IHTH 3PLKA 3UWJH 1VJ9U 2WV5A 3IWMA 2SGQE 3LGIA 1ELGA 2GP9B 2GZ7A 2A5IA 2W7UA 1PQ7A 5DK1A 3RUOA 4AYVB 3LKWA 1SGDE 3QWCH 1GBKA 1C5NH 1IQLA 1AN1E 1Y8TA 2PKSC 4B2BA 1OX1A 1OP0A 2OBQA 2AGGX 4MDSA 1XUKA 1MBMA 1INCA 2BDYA 3SGAE 1TWXB 1OWKA 1AI8H 3UR6A 3TK5A 1ANEA 1K1OA 5DP7A 1HYLA 3UNQA 3ZZAA 4Y0YE 1DWBH 4NFFA 2ZHWH 2BQ6B 2ALVA 3MWIU 3VXFH 1S0QA 1GI8B 3SUEA 1S83A 1SBWA 4YOJA 1EX3A 4A1XA 2OC0A 2XWAA 5C5NA 1W13U 1WCZA 1S84A 1AD8H 1AKSB 3PMBB 3RXFA 3UQOA 3SI4H 2P59A 3FP7E 3QDZB 1GDQA 1RJXB 4KTUA 3M7QA 4E7NA 3A7ZA 1D9IA 2RA3A 1DXPA 1T8NA 1NRPH 1P57B 1FZZA 1W11U 3AAVA 1OWIA 1GI1A 2B9LA 1IHSH 1AIXH 2BY8X 2Z9JA 3G01A 3TGJE 1H9HE 1TPSA 2W26A 3EQ0H 4IW4E 3EDXB 1CBWB 1GMCF 1TLDA 1KDQA 2ZCKP 3LJOA 3TJUA 4JMYA 4CRFA 1TOCB 1O35A 3ZVBA 1SGTA 5C2ZA 1W7XH 2ZWLH 1LHCH 2W5EA 2XC0A 1IAUA 3UY9A 1LPGB 1O3FA 1ZPCA 1P09A 2GVFA 1E36B 1HLTH 1NESE 3GYMA 3TK6A 1QB9A 1SC8U 2ZKSA 2V6NA 3RC4A 1DUAA 3MH7A 3A81A 3RXMA 1TPAE 4JCNA 1SHHB 4X8SH 2SGFE 2EI7A 4H4FA 1SGPE 1AB9C 1ZJKA 2XRCA 3LGWA 3T26A 4CRGA 3MOCA 3BN9A 2F9PA 1CA0B 4X1NU 4ABEA 4K8YA 4UFGH 4CR9A 5LPEA 3UOUA 1HXEH 2Z94A 2GX4A 4I8GA 5DG6A 1A5HA 5G4BA 1QRXA 3A80A 4I8LA 3HK6B 4A1TA 1EP5A 4MPXA 2CF8H 1ORFA 1QRZA 2ZP0H 1CHOG 7GCHF 3SGBE 1BT7A 1GI9B 2UUYA 1UCYE 3QO6A 1GMHF 1GDNA 2ZTZA 4WY3A 1ZHMA 1O2XA 1DY9A 4K1EA 1NFWA 3GCOA 4I33A 3QGNB 1YM0A 3KN2A 5C1XA 2FI3E 1L4DA 2G52A 4CH2B 2HOBA 4Y7BA 5C1UA 1PPFE 2C8XB 8KME2 1SG8B 1HJ8A 4ISNA 2BZ6H 2FOHA 1BRUP 6GCHG 2ASUB 4ABGA 1YP9A 3N7OA 3A82A 1GDUA 2R3UA 2GV7A 2FX4A 4GCHG 5K7RA 3TU7H 2CMYA 2C90B 1LMWB 4AB9A 2FODA 1RIWC 1QR3E 4NIVA 1HAXB 2GGVB 1K1NA 1QL7A 1UHBB 3MNBA 3P8FA 1HXFH 2ODQA 3MH6A 2XW9A 1DWEH 4NGAH 2XC4A 1HAVB 1W0YH 1PJPA 4MLFB 2P8OB 4I31A 1DLEA 1GI6A 2BDGA 1TNGA 3TK9A 2VH6A 1NFYA 2PTNA 1O2ZA 1BUIA 2BLVA 4BAKB 3O8CA 1YKTA 3TGKE 1C2IA 1XX9A 2VVVA 1O3MA 1G3BA 3M5NA 1WTHD 2A32A 2UWLA 1SMFE 3RU4T 1IOEA 3U8TH 5CMXH 2XYAA 2LNCA 1QBVH 1O2WA 1HUTH 2BLOA 1DOJA 1ZPZA 3LC5A 1MD8A 5FPYA 1JWTA 2Z9KA 1C1OA 3ZV9A 1K22H 5DGJA 1B0EA 3BTTE 5ETXA 1OP8A 2VWLA 1UK2A 4CRDA 1JOUB 4XE4A 1UTQA 1MZDA 2VIOA 5A8XA 2FP7B 3M7TA 1O2TA 3OSYA 1EAXA 1PPEE 4TY7A 4D9RA 2FEQH 2A4QA 1TNJA 3B8JA 1HAIH 1H9LB 2FOFA 2EEKA 1BBRK 1YBWA 1YPGH 1ZTLA 3SGQE 2Z7FE 6ESTA 4CHAC 1FJSA 1SOTA 1O36A 1W8BH 3BTHE 2BDIA 1QJ1B 1XUFA 4Q7ZA 2QYIA 1Q31A 1O3LA 3V3MA 1Y3UA 2BVRH 4UD9H 5CE1A 1RGQA 1ELAA 1NROH 2DE8A 1P2QA 1ELTA 1PPCE 1RS0A 4FUIA 4GSOA 1ESTA 1O31A 4ZHAA 2R2MB 4BTTB 1MUEB 4WVPE 1FV9A 1FI8A 1UJ1A 1NRQH 3DFJA 1RFNA 1HJAC 3ZZ9A 2PR3A 3MU5A 1NPMA 3PLPA 1MTNB 3E0NB 4ABBA 1SFIA 2EI8A 2QF3A 1GCTC 3L33A 1TMTH 4Y8YA 3ZZ5A 1A0LA 2Z9GA 3GOVB 4IC6A 3ATIA 1A46H 3KNXA 4B2CA 1XMNB 1C5ZB 4JK5A 1V2MT 2ODPA 4Y71A 4FVDA 4KTCA 2G5VA 3VGCB 4OGXA 4R0IA 1GI5A 1O2YA 4X0WU 1GJ5H 1V2WT 1QCPA 2TBSA 4O9VA 1Z8IB 2QXHA 2BQ7B 1A61H 1J15A 1GL0E 4YLQH 3B9FH 1W12U 1VGCC 3K9XB 4Y7AA 3STJA 4AB8A 4MPUA 1PFXC 3SNDA 2ZFTA 1AFQC 1TQ0B 1G2MA 1QJ6B 2ZDMA 1TBQH 2GD4B 2GMTB 2VIVA 2BY9X 2QXIA 4OS6A 1P2OA 1V2TT 2RA0A 2P93A 1Y59T 3E8LA 1V2QT 2WPLS 4ABHA 3E6PH 4TY6A 4TWYA 2G5NA 5FBEA 1EPTC 3UFAA 2Y7ZA 2AGIX 3RXBA 2AH4X 3Q3YA 1CSOE 2CV3A 1H4WA 3SU3A 3UIRA 3F9EA 1G32B 5J4SA 1HAYB 3TH3H 3KCGH 2HNTF 1O0DH 1AWHB 1BB0B 1QB1A 2XXLA 2GDDA 2ZGJA 3ZZ6A 1WQVH 1P02A 1G9IE 5HXFA 2Z9LA 2ZDKA 2VIQA 1FNIA 1KDQB 2ALPA 3T28A 1OXGA 3ATWA 2Y5FA 2PSYA 1SGIB 1NZQH 1O3DA 1O5BB 2ZGCA 4MQAA 4X2XA 3VB4A 1E37B 1GHWH 1AU8A 1V2OT 5I46H 1KSNA 1VCQA 1NO9H 2C4FH 3U8RH 2O8WA 1GI4A 1KYNA 4GUXA 3SBKA 2F9UA 2F3CE 4LZ4B 1K9OE 5IDKA 3P8OA 3QTVH 1C2JA 1T4VH 4BNRA 5EG4A 1SB1H 5HGGA 4UFDH 1FIWA 2ZDNA 2FS9A 1C2KA 5JBTA 1SGRE 2R2WU 1SGCA 1W3CA 1UCYH 1GJ8B 3GCTF 1ELDE 3SI3H 1EB1H 3SJ8A 3EE0B 2ZTYA 1RD3B 3MNSA 1CT0E 3K2UA 1DX5M 1ZTKA 1RXPA 1CA8B 3TNSA 4ZKRU 2H9EH 1QY6A 5F8ZA 2H5DA 4DURA 2FI4E 1UTLM 1Y5UT 1BJUA 1BTXA 1XVMA 2A45B 4MNYA 3TH2H 3OU0A 4B1TA 1DANH 1GJBB 4BXWA 3ATLA 2TGPZ 2STBE 1GMDG 4H42U 3HKIB 3RXHA 3UTUH 2HALA 1OWDA 5E2OA 1HFDA 1VITG 4AG1A 3Q3XA 1C1UH 1HB0B 4ZKOU 2BD2A 2OLGA 1SOZA 5JB9S 3ZVEA 4Q2KA 5GCHG 1QA0A 4UFFH 1TBZH 1F0RA 3A7TA 1J8AA 2P3TB 2QAAA 1K21H 1OWHA 1FY1A 2J9NA 4NIXA 4D9QA 1KXDA 1M9UA 1GVZA 1MAYA 1NU9A 5JBCS 1DY8A 1G2LA 5C3NA 3BG4B 1LHDH 1P12E 2AMPA 1AMHA 2XBVA 5FX6A 1P0SH 1KLTA 1ZLRA 3PO1B 4AGJA 1T8LA 1TYNA 1QBNA 1SPJA 4WXIA 5LPFA 2B7DH 1ELFA 2TGTA 1FUJA 3LPRA 3SN8A 1O2NA 2FOMB 1G36A 2PSXA 2SFAA 3F9HA 1GGDB 3MU8A 3LJJA 3KQBA 4AFQA 2ZFSA 4IGDA 5JDUB 1GBJA 3BTFE 1O3HA 1TAWA 1GHVH 1XXDA 2BXTH 1FPCH 1G30B 5GXPA 1P01A 1GI3A 1T8OA 2EI6A 1C2LA 2GT7A 4PROA 1O2LA 2A4RA 2ZQ2A 3D65E 4ZKSU 3ZVDA 1QL9A 5L2YH 4CRCA 1F7ZA 2A5KA 4LZ1H 1NC6A 1HNEE 2HPQH 1G3CA 3SJOA 3F68H 1YLDA 4JZFH 2Y82A 3ATMA 2FESH 4GPGA 3E3TA 1O3KA 2ZHFH 2ZPRA 3SOSA 2QGRA 2TGDA 2ANKH 1BJVA 1TGCA 1SVPA 4E05H 3UR9A 3GY5A 2QXJA 4D8NA 1CQQA 1C5LH 1UTPA 5C20A 2ZF0H 2HGTH 1LVOA 2O8UA 4OS2A 1PPGE 3T25A 1UMAH 4KP0A 3OX7U 1P9SA 1MKWK 3RM0H 2OC8A 1TNHA 2BY6X 5JBAS 1TONA 5EQRA 1DICA 2SGAA 2BD7A 5ESTE 1EJAA 4IMQA 1EZXC 1MMJN 3S7HB 1JIMA 2FS8A 1AZZA 2FYQA 2LPRA 4UEHH 2BVSH 2GTBA 4VGCC 1UVOA 1C2EA 3RXLA 1O32A 1P2JA 3SQHE 4FU7A 3SW2B 1T32A 5EGMA 4XOJA 1P11E 2AEIH 2C8YB 1GBTA 1RTLA 4Z6AH 7GCHG 2ZCHP 1QBOA 3UUZA 4FUFA 1K1PA 1GMHG 3M5OA 1ABIH 4KGAA 3PMJA 2D1JA 2GCTC 5ESBA 4YLUA 1O3EA 1WTGH 5CHAB 1XXFA 1G3EA 1FPHH 2ZGBH 8ESTE 3V7TA 4X6NA 2WPJS 1GI7B 3F9GA 3SU5A 1OYQA 4DG4A 5DO4H 1GCDA 1J17T 1O2MA 3CS7A 1MCTA 5GJ4B 1N6XA 1C5OH 1YPMH 1GBMA 2ZGXH 5F6MA 1TA6A 1ZPBA 4NZLA 2FOCA 5EW1H 1BDAA 1BZXE 3SU0A 1ABJH 3JZ2B 4JYVH 4SGAE 1GI0A 3ZYDA 4BAOB 3C1KA 2F9OA 2ESTE 1KXAA 1ESAA 2OC1A 1AE8H 5IYTA 4FUEA 3URDA 1LCYA 3AVZA 1MAXA 3RDZA 1V2KT 2PGBB 5L6NH 3DHKH