3TGOA

Crystal structure of the e. coli bamcd complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
217
structure length
217
Chain Sequence
EVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0169 lipoprotein yfiO
publication title Crystal structure of the beta-barrel assembly machinery BamCD protein complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 91
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tgoA00
3AS4A 3UUXA 5HQ8A 2C2LA 2Q7FA 4IN3B 4G2VA 2L6JA 1PC2A 1ZBPA 2FI7A 2ONDA 4BT8A 2XGOA 1HH8A 1Y8MA 3LYAA 3PE4A 3CEQA 4JL0A 5EX0A 1HZ4A 4AIFA 2XPIA 2FEZA 2J9QA 2KCVA 4GCOA 3LPZA 4H7YA 2WPVA 3GYZA 5C1DA 4CGVA 4G1TA 2MHKA 2Y4UA 2C0LA 3MV2B 1XNFA 2KC7A 3CVLA 4N3BA 5ARFA 5FZQA 4GYWA 5CCLA 5A7DB 2JLBA 1OUVA 2VQ2A 1QQEA 2PL2A 2P58C 4GA1A 2V5FA 4BWRA 4I9CA 5DIZA 3URZA 2NC9A 4J8FA 4WNGA 4U04A 2XCBA 1KLXA 3IEGA 2QFCA 3RJVA 4LEUA 3LY7A 3LCAA 4BTAA 5KJMA 3CVPA 2PZIA 4J0UA 3UQ3A 2HR2A 4GYYA 5EX3A 3CKBA 4JA7A 5G04C 1NA0A 1KT0A 4BTBA 4HOQA 4AM9A 3Q47B 4O6FA 4I17A 3QOUA 4HOUA 2WQHA 5ARGA 1E96B 3AS5A 3UPVA 2E2EA 3MV3B 4U07A 3LKUA 2VGXA 2KCLA 4YVQC 3CKCA 2UY1A 2FO7A 4B94A 3QWVA 3ASDA 2AVPA 5D0OD 5CHEE 3Q49B 3CVNA 4F3VA 4I2ZA 4HOTA 2XCCA 3TG4A 5LCWJ 5A6CA 2LSVA 3AS8A 3OXFA 3ASFA 4KBQA 5G05J 4I1AA 4BT9A 4CDRA 4UQZA 3S7DA 2HYZA 4YVOA 4G26A 3E4BA 4UI9K 1FCHA 4AY5A 3FP3A 4WUYA 3CK7A 4N3CA 4G23A 4N2QA 1HXIA 4N5CA 2PQRA 4ME2A 2LNIA 2PQNA 4A1SA 3LY9A 5DBKA 3MKRA 4N3AA 4WNDA 4HORA 3ESKA 5JJTA 2VGXB 3WXXA 2KCKA 4UI9J 4UQXA 2BUGA 4N2SA 2UY1B 4GZ6A 4XI9A 4NQ0A 3RIBA 4JHRA 1IYGA 5FT9A 3Q5MA 5D0QD 3VTYA 2YQ8A 3HYMB 4AY6A 4GZ3A 3VTXA 3TG5A 1WAO1 4RG6A 3OXGA 3GZ1A 1W3BA 3R9AB 4NRHB 3RU0A 1YA0A 5BNWA 3ULQA 3QDNA 4GYOA 3U3WA 5FZSA 5KJNA 3QKYA 2R5SA 4YNDA 3ASGA 3TAXA 3KAEA 5AYWD 3Q15A 5M72A 3U4TA 2C0MA 2HO1A 3RKVA 4EQFA 3S7BA 3ZHEA 2FF4A 2Y4TA 5EKQD 1KT1A 3ZGQA 4CGWA 4N39A 4WNFA 4J8DA 3RO2A 3NF1A 3ZFWA 3FWVA 1ELRA 3OXLA 3O48A 3MEKA 3QWWA 3GW4A 2GW1A 3CVQA 3MA5A 4GPKA 1QZ2A 2XEVA 2VSNA 3EDTB 1IHGA 4U0ZA 5BW8C 1A17A 4APOA 5HI7A 5G04J 5FZRA 3GZ2A 4Y6CA 3TGOA 2IF4A 3ZN3A 3ASHA 5KJLA 4J8EA 4ABNA 3Q4AB 2IFUA 2KATA 5JJ7A 3SF4A 4WNEA 3FFLA 4GZ5A 3RO3A 3CK9A 4JA9A 2VSYA 4KYOB 4G24A 4I9EA 3ZHEB 2OOEA 4RG9A 3PDNA 5LCWC 4G25A 4GA2A 3CK8A 2VYIA 2XGMA 3CV0A 1TJCA 3JYSA 4XI0A 5G05C 1NZNA 2I6HA 1P5QA 4W9RA 1WM5A 2FBNA 2YHCA 3KS2A 4I2WA 4U0UA 3QWPA 1B89A 2XGSA 2VGYA 4U0SA 5BT1A 3K9IA 5CCMA 1NA3A 2LSUA 4H7XA 4HOSA 3S7JA 5KJKA 5FTPA 3KD7A 3N71A 3BEEA 1ZU2A 4UQYA 4Y6WA 4XIFA 3ZPJA 2DBAA 4GCNA 3PE3A 5JJ6A 3LY8A 1ELWA 5FJYA 4KXKB 3S7FA 4GA0A 4UI9C 3SZ7A 2UWJG
chains in the Genus database with same CATH superfamily
1XGWA 3P2BA 2R2LA 4OAUC 5HQ8A 3HHMA 4I6EA 2C2LA 4DI4A 3V79K 3ZIMA 1N0RA 3BU8A 1WY6A 4AXHA 4AP2A 2FI7A 2R59A 2XGOA 1Y8MA 3T8KA 2QY7A 3CEQA 4D10C 4AIFA 3QARA 2FEZA 2KCVA 3ZRHA 2VJ8A 4O1PA 3SD5A 4NIKA 4G1TA 4A3TA 2C0LA 4G8KA 3MGBA 3DBSA 4GZDA 3CSFA 3CVLA 4UWGA 2WXFA 4N3BA 1OUVA 2VQ2A 4FLBA 5J08A 2V5FA 4B89A 5EYLA 3V2OA 3R7QA 3NZUA 2VSXE 1TYQG 3CVUA 3ZUVB 1UW4B 4U04A 3ZYMA 1KLXA 4EECA 4DX6D 3L54A 3IEGA 2QFCA 1EYHA 4G8LA 4LUNU 3OTNA 3C3QA 4PS3A 4L1BA 4B0ZA 3C98A 4BY6A 5CERB 2PZIA 4LCTA 2QZAA 5EILA 2B0OE 3E32A 4EZLA 4TUUA 4HLEA 2BKGA 1SA4A 2WQHA 2OEWA 2GROB 3AS5A 1MX4A 1E90A 3UPVA 4P29A 3CKCA 2CG3A 2VTBB 4MBGA 4JD2G 1NFIE 3QWVA 1FVFA 1E8YA 4BX9A 1O1SA 4FU3A 3NQPA 1TEZA 1O1RA 1HE8A 2V8SE 3DEOA 3NAWA 4R7LA 3TG4A 5LCWJ 3PRZA 2IEJA 2LSVA 3C72A 3Q7FA 1PY1A 2GRLA 4E85A 4U95D 1H2TC 3ZW3A 1RZ4A 5G05J 2EQXA 5CMWA 5FQ7A 4FA6A 3S7DA 2HYZA 4G26A 1FCHA 3DXMG 4G23A 1IQRA 2OV8A 1HXIA 1S63A 2FO1E 2P9PG 4CT4A 2LXMA 3DSTA 2PQRA 3JUIA 3R9MA 2ETBA 5KBAA 3LY9A 5LOZA 3MKRA 5AARA 3ZYKA 3RRUA 1HO8A 3T8MA 2VGXB 3EHNA 4UI9J 4UQXA 1D8DA 2F8XK 3ML8A 3SGHA 3Q5MA 2ZGDA 4HVBA 4FP7A 5CMYA 1S64A 4GTSA 3TWVA 4GTPA 3OXGA 2IONA 3SFZA 4V3IA 3U9WA 4UWLA 2QYUA 2DCPA 3QDNA 3UIOC 2XQ0A 3C5RA 1FT2A 5KJNA 3HXEA 2DZOA 3KAEA 1YCSB 4GTTA 2C0MA 3AU5A 2L0TB 4EQFA 2PM6A 4O60A 2LAIA 2KZTA 4JHKA 1JWFA 5A23A 4WNFA 3SBSA 1FVHA 2J09A 1LD7A 2IOLA 3FWVA 4TV3A 1UOHA 3OXLA 1N94A 3CVQA 1QZ2A 1ELKA 3D9PA 2VSNA 1EDUA 5B3SE 2XHEA 3G2UA 1JPLA 1LTXA 4XKBA 1UN8A 4J6IA 2X6IA 3GZ2A 4CRWA 4Y6CA 3L17A 4DLQA 5EYPF 2CHXA 4G11A 5ENPD 3ASHA 3MKQA 3RSEG 2DZNA 3NOGD 3PREA 3LS8A 3Q4AB 4XZ4A 3DSUA 2P9UG 4LSZE 3ASNE 1U3CA 4CYMD 1YMPA 2GRQB 3L82A 1V54E 2RG8A 1TNUA 4HRMB 4GAAA 2XS8A 3RO3A 3UTMA 1AWCB 3X2QE 4G24A 3UMVA 3QB2A 3B7RL 3W9FA 1N54A 1L5JA 4RG9A 2DVWA 1H0AA 2VYIA 4JHJA 4PDXA 2BEDA 4ANVA 1MQSA 1OWMA 1LF8A 4L7TA 1P5QA 1PAQA 1WM5A 5BV1A 3FH8A 1U2VG 3DSSA 5JA4D 1NA3A 4AV7A 3CHPA 1UJJA 1OWNA 4OAVB 4LNBA 1K1BA 2DWZA 2X6FA 3RAUA 4A3VA 5BPPA 3UM1A 3B7UX 3IKOB 3CHOA 4PS8A 5AQAA 1ELWA 3CGHA 4X8QA 1NP7A 3SZ7A 1N4PA 1BLXB 2XRYA 3UIPC 1BPOA 1OWOA 3UUXA 3HG0D 3I4RB 1ZBPA 1TN7A 2ONDA 3DSXA 1HH8A 3Q75A 5ANRA 4JL0A 2H6GA 3HVEB 5EX0A 1HZ4A 4FADA 2LUHA 2WQ7A 1N4QA 2B6CA 2XPIA 4ILHB 2BTDA 2J9QA 4H7YA 3GYZA 3ABME 4IYPA 1DVPA 2MHKA 2WXOA 2OVBA 2WXNA 4GB9A 2EIME 3MJWA 2EIKE 3Q7AA 1QQEA 4JB8P 1N4SA 4IRUA 5CECB 3FUNA 3ZXPA 3FU6A 3UI2A 4DRXE 2IY0C 4WNGA 3DSWA 3L13A 2M63A 4DX1A 3CVXA 3LY7A 3LCAA 1BD8A 4FHKA 2KBXA 5KJMA 3PNTB 1EF1C 4J0UA 3UQ3A 3CKBA 1JCQA 5G04C 4LERA 4BTBA 4FC8A 4HOQA 1WDYA 3Q47B 1MX6A 4I17A 2F8YA 3QOUA 4HOUA 3CHRA 4C48B 1E96B 3T5VA 4EBAA 3MV3B 4ZHBA 3LKUA 2KCLA 3O4ZA 3PZ2A 4WWPA 4LRZA 4B94A 3EHQA 4XKCA 3L9TA 2AVPA 4KVMA 5CHEE 3CQCB 3CVYA 2XRZA 1Z6TA 3Q49B 3PVLA 2XCCA 5ITZF 2WXLA 3OXFA 1YYHA 4TUMA 3IBEA 4GU5A 2OCCE 3AJIA 1SA5A 4BT9A 4CDRA 1WG0A 4CDMA 4HI9A 2XZTG 3FUDA 4YVOA 1K8KG 4WUYA 4N2QA 4HXIA 1OXJA 2P9SG 4RLYA 1Q2ZA 2Y0BG 4EBAG 2LNIA 2PQNA 3ZXSA 5AIJA 4A1SA 5FQ6A 1BU9A 5DBKA 2JEKA 4N3AA 3ABLE 4CT0A 3ML9A 2WXJA 1N11A 3SI5A 5AJDA 2VGEA 5FIOA 4WAFA 3TWRA 1TNOA 2RFMA 3FU0A 5JJTA 2IOSA 3WXXA 3BG1B 5HRYA 2BUGA 4N2SA 2UY1B 5ENTD 3FTSA 5D0QD 3HYMB 4EHMA 4DLOA 1N0QA 4U7EB 2J4BA 3R9AB 1JCRA 5AAOA 3ULQA 4HFGA 4RQIA 3U3WA 5FZSA 5EDSA 4BEPA 2NSZA 2R5SA 3ASGA 3EIJA 3Q15A 1X81A 3RKVA 3UM2A 3L16A 4HQDA 2DIWA 3ZHEA 5BXUA 2Y4TA 3FDHA 3ZYLA 1KT1A 1FT1A 4CGWA 4N39A 3QNKA 4J8DA 3LJNA 3I3NA 1INZA 2YINA 5AN8A 1QBQA 3NF1A 1ELRA 3DPDA 3MEKA 3IV0A 5ENQD 1O5MA 2CHZA 3MA5A 3PZ1A 2XEVA 5JHAA 2EILE 4MS6A 3EDTB 3PZDA 5D2MC 2J07A 5BW8C 3PZ3A 4APOA 1SZAA 5G04J 3Q9NC 2IF4A 1N4RA 3VLDA 2CFUA 3FTWA 5KJLA 2OVFA 4ABNA 2AXZA 2IFUA 3SF4A 4WNEA 3FFLA 5ENOD 4YDYA 4Q96A 1OCRE 4JA9A 2VSYA 1UG3A 4M3OA 4URKA 2YHEA 1OWLA 4ACKA 2P9KG 4EZJA 3CSTA 5FWQA 2OOEA 2RKKA 4KVOA 4GA2A 2H6HA 3BG0B 3CK8A 4MRUA 4FJYA 1IHBA 3U64A 2X38A 4GMRA 4DX2A 3FH5A 2IQCA 3JYSA 2WMNA 2XENA 1NZNA 3E37A 4MLPA 3HIZA 2I6HA 2OEVA 3U66A 2FBNA 2YHCA 5G2NA 4ANWA 1D9SA 5D66A 2QYJA 2I9CA 4FLHA 4F1PA 2ETAA 4GTRA 1B89A 2XGSA 2F37A 5CCMA 1SW6A 2J49A 2LSUA 2H6IA 4TXPA 4HLLA 3EHMA 4APFA 4KT6B 5KCMA 3BEEA 4JVSA 3HRAA 1ZU2A 4UQYA 1O1TA 4Y6WA 5AENA 4XIFA 3FUEA 3L6AA 2DBAA 2LAHA 4GCNA 5ENRD 4AJWA 4JW1A 4UWKA 1DC2A 2R03A 5FJYA 3S2AA 3EIQC 3S7FA 1MHQA 2HE0A 1TNYA 4GA0A 2UWJG 4K5AB 3CVVA 3J5QB 1HF8A 3D9LA 3ULEG 4J7WA 2L6JA 2ETCA 4A55A 2V4HC 3QJZA 1HG5A 1Z3XA 1Z5SC 4DJAA 1E8WA 3LYAA 3B7SA 2VTBA 3HXBA 4AVXA 4HS2A 2WPVA 3UT4A 2AJAA 5C1DA 2AW6A 3PEUB 4CGVA 2A5EA 1OT8A 3R7RA 3FEXA 4JEUA 2KC7A 4I1OB 3AU4A 5T8IA 3Q9UC 5FZQA 4GYWA 5CCLA 1HS6A 2R02A 3SNXA 4I6GA 1IKND 4K5BA 2NYJA 4BWRA 3DRAA 5LP0A 3SFXA 4I9CA 5DIZA 3URZA 4PH4B 3LVQE 5J90A 2EINE 2NC9A 2J08A 2YNQA 3PNLB 4PUCA 2XCBA 3BQOA 3RJVA 5CBOA 5CRVA 1JWGA 4LEUA 2WQ6A 4HRNA 4BTAA 2HR2A 4JA7A 2WB2A 4U8VD 4F7AA 2A4ZA 4YDEA 1KT0A 1NA0A 2BKKB 4AM9A 4O6FA 3FY4A 4OVUA 4QQIA 3DWLG 5ARGA 2AXVA 3PS6A 2E2EA 3TJPA 4U07A 1SZ9A 2GRMA 2VGXA 4YVQC 3HDXA 3IXEA 4BETA 3TL5A 1A5EA 3B7TA 1K3ZD 4LNUD 3ASDA 3J5PA 3VLFA 2CG2A 4JPSA 1H6OA 4HRLA 3D9KA 3LXUX 1S70B 5BUZA 2LO6A 3RRNB 2L6BA 3SHFA 1HU3A 3AS8A 2R05A 5BV0A 2DYSE 2IO3C 3TWWA 4L2YA 2P9LG 3EU5A 3TXNA 4I1AA 4KMOA 5KNHD 2H6FA 3E4BA 4UI9K 3FUIA 3FP3A 3CK7A 4N3CA 3CVWA 4JXTA 3IHVA 3UM3A 1E8XA 4N5CA 4ME2A 4YDWA 2ZGGA 1SVXA 1TR4A 3MCXA 2Y1LE 4FJZA 3D9JA 3FTZA 2GRPB 4F6RD 4C0EA 4GTVA 4KZ0A 1IQUA 4GZ6A 4GMJA 3SY2A 3JQ0A 4JHRA 3ONKA 1IYGA 3VTYA 1E7VA 2YQ8A 4AY6A 3T5XA 4GZ3A 3VTXA 2Y69E 5ENSD 2Y3AA 4BSXA 1NI1A 1WAO1 3MYVA 5B1BE 3GZ1A 1W3BA 4NRHB 1OY3D 3RU0A 3PZ4A 3LDZA 4ILGA 5CBNA 3NBNB 3LJ3A 3NB2A 3QKYA 2WMOA 4ATZD 2BF0X 1HX8A 4YNDA 2WXMA 2CFZA 1K1AA 4OVVA 3DEPA 3F6QA 4XE0A 4E6HA 2E0IA 3ZNGA 4OYSA 2V0PA 3CHMA 5EKQD 3RO2A 2XEHA 4XX5A 4Z68A 3O48A 3QWWA 2V4LA 3GW4A 2R17C 2GW1A 1KZPA 2FULA 4GPKA 5LFAA 4I1MA 3JQ1A 4XEIG 4TXQA 4BX8A 3EHRA 1IHGA 4ANXA 1Z3YA 4U0ZA 3ISMC 5HI7A 1DCQA 5FZRA 3BUAA 3QC1A 5H7PA 1MJ0A 2ZIRA 3KEZA 3ULYA 3B95A 1X5BA 4J8YA 4YDOA 1MX2A 4J8EA 3RK6A 3HXCA 2AXUA 1D8EA 2KATA 1UN9A 5JJ7A 4DPRA 2VSOE 3TXMA 2I1JA 4WWNA 3C3RA 1N52A 2GRRB 4GZ5A 2GRNB 5CEAA 1H2VC 3TWUA 1AP7A 4K0RA 3AAAC 4J8SA 3HVEA 4M7CA 5EN5D 3E30A 4I43A 2CHWA 2KZTB 3EJNA 3C3OA 3I5PA 4G25A 2KXPC 2X3MA 4ANUA 3JCKC 4HB5A 1MZCA 3CV0A 1TJCA 4XI0A 4QFVA 3I4GA 3WG7E 5JHBA 2ZU6B 2WXRA 3KEAA 4W9RA 3TWSA 1TNBA 3KS2A 4JC8A 3SQVA 1HG2A 3T9KA 2X6JA 2VGYA 5EIDA 5BT1A 3K9IA 5AJLA 4F53A 4Q69A 1FPPA 4H7XA 4HOSA 4IULA 3UINC 3ENEA 5KJKA 4AOFA 3KSQA 3DPYA 5FTPA 2X6KA 2XPYA 1TN8A 3N71A 3PUJA 2IJGX 4CEMA 4BSZB 3MX3A 4I6JA 1N95A 4NACA 4ZFHA 4ATGA 4GZCA 3ESLA 3MKQB 4U8HA 2XEEA 3G2WA 3PE3A 5JJ6A 4KXKB 4DI3A 2WVIA 5HS0A 5AQ7A 4A63B 2RFAA 3D9IA 3AS4A 3PUKA 3HXFA 3FUHA 2Q7FA 4IN3B 4G2VA 3AG1E 3B13A 1PC2A 4BT8A 2ZXWE 1QNFA 4U63A 2WM9A 3ONLA 3PE4A 3FTVA 5ENNA 5AQBA 4ILIA 3FU5A 3P1UA 4GCOA 3LPZA 3SBTB 1H6PA 3V2XA 4CZ2D 2AWIA 3APCA 2X6HA 1OCOE 4GTOA 2Y4UA 3MV2B 5KNGA 1KPSB 2I1KA 1E7UA 1XNFA 3KSLA 4F1SA 1BI7B 2A5UA 3EU9A 3JUEA 2GGFA 5ARFA 5A7DB 2JLBA 3G2VA 4DK5A 2PL2A 5EIBE 2P58C 3FTUA 2F0YA 4GA1A 4U8YD 1RW2A 5ANLA 4J8FA 4HNAD 1ZB1A 4LG6A 5FQ4A 1VDYA 3UT8A 4GPMA 2WXPA 1DCEA 3FUJA 5IY5E 3CVPA 4CDNA 4EPZA 4GYYA 5EX3A 3QK0A 2V5QC 4PS7A 4TXRA 5C2YA 4HI8A 1GW6A 1UJKA 5CEDB 4C9BB 2UY1A 2FO7A 4L9PA 1JUQA 1LD8A 3AG2E 3APFA 2J4DA 2IO2C 3UM0A 4EZKA 5D0OD 3DSVA 3CVNA 3FUFA 5T3RA 5FINA 4F3VA 2DYRE 3LEWA 4I2ZA 5AQ9A 4LNGA 4B8AA 2EIJE 3E33A 2IU1A 4ACLA 4HOTA 3HXDA 4A1GA 5A6CA 2WXKA 1OWPA 1BI8B 3ASFA 1IXVA 3EUVA 1QYMA 2WXIA 4BFRA 4AEZC 4KBQA 3QAQA 1V55E 1Y6IA 4RSYA 3CIAA 3Q79A 4UQZA 3ZVVA 3ZYQA 4TRQA 5CRUA 4DUIA 1TJFA 3FTYA 3D9MA 4AY5A 3UKUG 2LXLA 2XZDG 2WXHA 3L08A 4WNDA 2RD0A 4HORA 3CQGB 3E34A 3MZLB 3ESKA 3G2SA 2ILRA 3CR3A 4K5CA 4L2LA 2KCKA 3APDA 3CHQA 3JXIA 1OCCE 3W9GA 3ZU7B 5BXOA 4XI9A 3CLJA 3B7BA 3FH7A 4FHJA 4NQ0A 3RIBA 5G55A 2WXQA 5FT9A 2ZISA 2PM7A 4K03A 3UT7A 3TG5A 4N5QA 4RG6A 4C0MA 1TN6A 5JMND 1YA0A 3Q78A 1JCSA 3NOCD 5BNWA 1DNPA 4GTQA 4GYOA 3NZSA 4GTMA 3V30A 5FQ8A 2P2CP 3TAXA 5AYWD 5T4YA 5M72A 3UXGA 4KZCA 3Q73A 3U4TA 2HO1A 4BESA 1G3NB 3L22A 3S7BA 3UX4A 2FF4A 3ZGQA 3ABKE 3PEVB 4B8CB 1H19A 3ZFWA 3UKRG 3SFYA 4DX5D 4UWHA 3TWTA 3TWQA 1E8ZA 4CCAA 3V31A 1MYOA 2MRIA 3FULA 3FEYA 1HFAA 3SO8A 2L9BA 1A17A 1NL4A 1TNZA 3FHEA 3TGOA 4UUCA 3ZN3A 3FUKA 4BERA 2XS1A 2P9IG 5E76A 3ZEFA 3OAWA 2MOWA 2MYOA 1EPUA 4L23A 5KWDA 1OCZE 3ZKJA 3D3MA 3CK9A 4Q94A 2NXPA 4KYOB 3FUMA 2QC9A 2KM4A 4I9EA 3TWXA 3ZHEB 3PDNA 5B1AE 5LCWC 3FTXA 4NURA 3DXKG 2JABA 4WWOA 4O1OA 1H2UA 1S0PA 4DX7D 1KZOA 1H6KA 3AG3E 2XGMA 3D9NA 3D9OA 5E75A 4B93B 4MKTA 5G05C 3GZSA 3FU3A 2XPZA 3ASOE 3G2TA 2WXGA 4I2WA 4RVBA 4U0UA 3AG4E 4U96D 1N9AA 3QWPA 3RRMB 4JEHA 4GMLA 4U0SA 4FULA 3S7JA 3IHYA 3VLEA 2L0IA 2I2OA 3KD7A 2PNNA 2P9NG 5LX8A 3ZPJA 1U3DA 1SQMA 3LVRE 3PH0C 4HBDA 5HKPA 3LY8A 2HM8A 3JXJA 3D9HA 3CHSA 4UWFA 4UI9C 2J8SD 4JZYA
chains in the Genus database with same CATH topology
3D9IA 3AS4A 3PUKA 3CVVA 1XGWA 3P2BA 2XRYA 1BPOA 1OWOA 3UUXA 5HQ8A 3FUHA 3HHMA 4I6EA 1HF8A 2C2LA 2Q7FA 3D9LA 4IN3B 3I4RB 4DI4A 4G2VA 2L6JA 3ZIMA 4A55A 3QJZA 3B13A 1HG5A 1WY6A 1PC2A 1Z3XA 4AXHA 1ZBPA 4AP2A 2FI7A 2ONDA 2R59A 4BT8A 1QNFA 2XGOA 4U63A 1HH8A 2WM9A 1E8WA 3ONLA 4DJAA 1Y8MA 3LYAA 3FTVA 3PE4A 5ANRA 3B7SA 2QY7A 3CEQA 3HVEB 4JL0A 1HZ4A 5EX0A 5ENNA 4FADA 2VTBA 4D10C 4AIFA 2WQ7A 3QARA 2XPIA 4ILHB 2FEZA 4ILIA 4AVXA 2BTDA 2J9QA 2KCVA 3FU5A 3P1UA 4GCOA 3LPZA 4H7YA 4HS2A 3SBTB 3ZRHA 2VJ8A 2WPVA 3UT4A 2AWIA 3GYZA 3SD5A 5C1DA 2AW6A 3PEUB 4IYPA 3APCA 2X6HA 4CGVA 4G1TA 1DVPA 3R7RA 4A3TA 2MHKA 2Y4UA 2C0LA 3MV2B 3FEXA 2WXOA 1E7UA 2I1KA 1XNFA 3MGBA 3DBSA 4GZDA 4JEUA 2KC7A 3CSFA 4I1OB 2OVBA 3AU4A 3CVLA 4F1SA 4UWGA 2WXFA 2A5UA 2WXNA 5T8IA 2GGFA 4N3BA 5ARFA 5FZQA 4GB9A 4GYWA 5CCLA 1HS6A 3MJWA 5A7DB 2JLBA 3G2VA 1OUVA 2VQ2A 1QQEA 4FLBA 4DK5A 5J08A 2PL2A 2P58C 3SNXA 3FTUA 4I6GA 4GA1A 2V5FA 4B89A 4BWRA 5LP0A 4I9CA 5DIZA 4IRUA 3R7QA 3URZA 5ANLA 4PH4B 3LVQE 3NZUA 5J90A 2NC9A 2VSXE 2J08A 3FUNA 2YNQA 4J8FA 3FU6A 3PNLB 3CVUA 4WNGA 1UW4B 4PUCA 4U04A 2XCBA 3ZYMA 1KLXA 4EECA 3L54A 3IEGA 2QFCA 3L13A 3RJVA 2M63A 5FQ4A 1VDYA 1EYHA 3UT8A 1JWGA 3CVXA 2WXPA 4LUNU 3OTNA 4LEUA 3LY7A 4PS3A 3LCAA 2WQ6A 3FUJA 4L1BA 4FHKA 4B0ZA 3C98A 4BY6A 4BTAA 5KJMA 3PNTB 3CVPA 1EF1C 2PZIA 4CDNA 4J0UA 3UQ3A 4EPZA 2HR2A 4GYYA 5EX3A 3CKBA 4JA7A 5G04C 4F7AA 2WB2A 2A4ZA 4LCTA 3QK0A 1KT0A 1NA0A 4FC8A 4LERA 4BTBA 4PS7A 4HOQA 4AM9A 4EZLA 4TUUA 4HLEA 3Q47B 3FY4A 4O6FA 4I17A 5C2YA 4OVUA 3QOUA 4HOUA 2WQHA 2AXVA 3CHRA 5ARGA 1E96B 3AS5A 3UPVA 1E90A 3PS6A 3T5VA 4EBAA 2E2EA 3MV3B 4U07A 3TJPA 1GW6A 1SZ9A 2GRMA 3LKUA 1UJKA 2VGXA 4P29A 2KCLA 4YVQC 3O4ZA 3HDXA 3CKCA 2CG3A 4WWPA 4C9BB 2VTBB 4LRZA 2UY1A 2FO7A 4B94A 1JUQA 3TL5A 4XKCA 3QWVA 1FVFA 1E8YA 4BX9A 3APFA 3B7TA 4FU3A 3NQPA 2J4DA 1TEZA 3ASDA 1HE8A 2AVPA 4EZKA 5D0OD 3VLFA 4KVMA 2CG2A 5CHEE 3CQCB 3CVYA 4JPSA 2XRZA 1Z6TA 2V8SE 3Q49B 3CVNA 3FUFA 5T3RA 3PVLA 4F3VA 3D9KA 3LXUX 4R7LA 3LEWA 4I2ZA 4B8AA 4ACLA 2IU1A 4HOTA 5BUZA 2LO6A 2XCCA 4A1GA 3RRNB 3TG4A 5LCWJ 5A6CA 3SHFA 3PRZA 2WXKA 2LSVA 2WXLA 1OWPA 1HU3A 3AS8A 3OXFA 1PY1A 3ASFA 2GRLA 4E85A 5BV0A 2WXIA 4BFRA 1H2TC 4AEZC 4L2YA 3IBEA 3ZW3A 4KBQA 3QAQA 4GU5A 3TXNA 5G05J 1Y6IA 4RSYA 2EQXA 3CIAA 4I1AA 5CMWA 4BT9A 5FQ7A 4CDRA 4CDMA 4FA6A 4UQZA 3S7DA 3ZVVA 4KMOA 3ZYQA 4TRQA 2HYZA 3FUDA 1TJFA 4YVOA 4G26A 3FTYA 3D9MA 3E4BA 4UI9K 1FCHA 3FUIA 4AY5A 3FP3A 3CK7A 4N3CA 4WUYA 3CVWA 4G23A 4N2QA 1IQRA 2OV8A 1HXIA 4HXIA 4JXTA 3IHVA 4ATGA 4CT4A 1E8XA 4N5CA 2PQRA 3JUIA 4ME2A 2WXHA 4EBAG 2LNIA 2PQNA 3ZXSA 5AIJA 4A1SA 5FQ6A 3LY9A 5DBKA 2JEKA 5LOZA 3MKRA 4N3AA 4CT0A 3L08A 3MCXA 2WXJA 2RD0A 3ML9A 4WNDA 4FJZA 3SI5A 5AJDA 3D9JA 4HORA 3CQGB 3ZYKA 3FTZA 4WAFA 3MZLB 3RRUA 3FU0A 3ESKA 3G2SA 2ILRA 5JJTA 1HO8A 3CR3A 4L2LA 3T8MA 4C0EA 2IOSA 2VGXB 3BG1B 2KCKA 3WXXA 4KZ0A 3EHNA 4UI9J 3APDA 4UQXA 3CHQA 1IQUA 2BUGA 4N2SA 2UY1B 4GZ6A 4XI9A 3CLJA 4GMJA 3FH7A 4FHJA 4NQ0A 3RIBA 3JQ0A 4JHRA 3ONKA 5G55A 2WXQA 3ML8A 5FT9A 3FTSA 3Q5MA 3SGHA 1IYGA 5D0QD 3VTYA 1E7VA 2YQ8A 3HYMB 4AY6A 4HVBA 3T5XA 4DLOA 4GZ3A 3VTXA 4FP7A 2PM7A 2Y3AA 4BSXA 4K03A 3UT7A 5CMYA 3TG5A 1WAO1 4RG6A 3MYVA 2J4BA 3OXGA 2IONA 3GZ1A 4C0MA 1W3BA 3R9AB 4NRHB 3SFZA 3RU0A 1YA0A 4V3IA 3U9WA 5BNWA 3ULQA 3LDZA 4ILGA 1DNPA 4UWLA 2DCPA 3QDNA 4HFGA 2XQ0A 4GYOA 3U3WA 5FZSA 5EDSA 3LJ3A 3NZSA 5KJNA 3QKYA 2NSZA 2WMOA 2R5SA 2BF0X 1HX8A 4YNDA 2WXMA 2CFZA 3ASGA 5FQ8A 3TAXA 4OVVA 3KAEA 5AYWD 3EIJA 3Q15A 4XE0A 5T4YA 5M72A 4KZCA 4E6HA 2E0IA 3U4TA 2C0MA 2HO1A 3AU5A 2L0TB 3RKVA 3L22A 3L16A 4EQFA 2PM6A 2DIWA 3S7BA 3ZHEA 4OYSA 3UX4A 2FF4A 2LAIA 2Y4TA 2KZTA 2V0PA 3CHMA 3FDHA 4JHKA 5EKQD 1KT1A 1JWFA 3ZYLA 3ZGQA 4CGWA 5A23A 4N39A 4WNFA 3SBSA 3QNKA 4J8DA 3I3NA 3RO2A 1FVHA 1INZA 2J09A 2YINA 3PEVB 4B8CB 4XX5A 1H19A 3NF1A 3ZFWA 2IOLA 3FWVA 4TV3A 1ELRA 3OXLA 3O48A 3DPDA 3MEKA 3QWWA 3IV0A 2CHZA 2V4LA 3GW4A 4UWHA 2R17C 2GW1A 1E8ZA 3CVQA 3MA5A 2FULA 4CCAA 4GPKA 1QZ2A 5LFAA 1ELKA 4I1MA 3JQ1A 2XEVA 5JHAA 2MRIA 3FULA 3D9PA 2VSNA 1EDUA 4MS6A 2XHEA 3G2UA 3EDTB 1JPLA 4BX8A 1IHGA 3FEYA 3PZDA 1HFAA 4ANXA 1Z3YA 4XKBA 2J07A 4U0ZA 1UN8A 2L9BA 5BW8C 1A17A 4J6IA 4APOA 1SZAA 5HI7A 2X6IA 5G04J 5FZRA 3GZ2A 4CRWA 4Y6CA 3QC1A 3L17A 4DLQA 3FHEA 3TGOA 2CHXA 2IF4A 3ZN3A 3FUKA 4G11A 2CFUA 3VLDA 3ASHA 5E76A 3ZEFA 3FTWA 3KEZA 3MKQA 5KJLA 3OAWA 1X5BA 2MOWA 2OVFA 3PREA 3LS8A 4J8EA 4ABNA 3RK6A 3Q4AB 4XZ4A 2AXZA 2IFUA 2AXUA 2KATA 1EPUA 1U3CA 1UN9A 5JJ7A 4L23A 4DPRA 3SF4A 2VSOE 3TXMA 2I1JA 2RG8A 4WWNA 4WNEA 3FFLA 1N52A 4GAAA 3D3MA 4GZ5A 3RO3A 4Q96A 3CK9A 4JA9A 2VSYA 2NXPA 4Q94A 4KYOB 4G24A 1H2VC 3FUMA 3UMVA 3QB2A 1UG3A 3B7RL 4K0RA 4M3OA 4URKA 2YHEA 2KM4A 4I9EA 1OWLA 1N54A 4ACKA 1L5JA 4J8SA 3HVEA 4I43A 3ZHEB 4EZJA 3CSTA 5FWQA 2OOEA 2CHWA 4RG9A 4KVOA 2KZTB 3PDNA 5LCWC 3FTXA 3EJNA 3I5PA 4G25A 4GA2A 4NURA 2X3MA 4WWOA 4ANUA 3BG0B 3CK8A 4MRUA 4FJYA 3JCKC 1H2UA 1S0PA 3U64A 2X38A 1H0AA 2VYIA 4JHJA 1H6KA 4PDXA 3FH5A 2XGMA 2IQCA 1TJCA 3CV0A 3D9NA 3D9OA 2WMNA 3JYSA 3I4GA 4QFVA 4XI0A 5E75A 4MKTA 5G05C 3GZSA 4ANVA 3FU3A 1NZNA 1MQSA 1OWMA 5JHBA 4MLPA 2ZU6B 2WXRA 2XPZA 1LF8A 3HIZA 2I6HA 4L7TA 1P5QA 1PAQA 4W9RA 3G2TA 2WXGA 3U66A 1WM5A 2FBNA 2YHCA 3KS2A 4I2WA 5G2NA 4RVBA 4JC8A 4ANWA 4U0UA 5BV1A 3FH8A 2I9CA 1HG2A 3QWPA 4FLHA 3RRMB 4JEHA 2X6JA 1B89A 2XGSA 2VGYA 4GMLA 4U0SA 5BT1A 3K9IA 5AJLA 4F53A 4Q69A 1NA3A 5CCMA 2J49A 2LSUA 4FULA 4H7XA 4AV7A 4HOSA 3CHPA 3S7JA 4IULA 5KJKA 3ENEA 1UJJA 1OWNA 3IHYA 3VLEA 4AOFA 2L0IA 3EHMA 4APFA 5FTPA 2X6KA 2XPYA 2I2OA 3KD7A 3N71A 4KT6B 5KCMA 3PUJA 3BEEA 4JVSA 1ZU2A 2IJGX 4CEMA 2X6FA 4UQYA 4Y6WA 4A3VA 3MX3A 4I6JA 5BPPA 5AENA 4XIFA 3ZPJA 1U3DA 1SQMA 4NACA 5LX8A 3FUEA 3B7UX 3LVRE 3IKOB 2DBAA 2LAHA 3CHOA 3ESLA 3L6AA 3MKQB 4GCNA 4GZCA 4PS8A 4U8HA 4AJWA 3PH0C 4JW1A 4UWKA 3G2WA 3PE3A 5JJ6A 3LY8A 1ELWA 2HM8A 3CGHA 5FJYA 4KXKB 3S2AA 3EIQC 3S7FA 1MHQA 4DI3A 1NP7A 2WVIA 3CHSA 4UWFA 4GA0A 4UI9C 3SZ7A 4JZYA 2UWJG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AS4 A;  3UUX A;  5HQ8 A;  2C2L A;  2Q7F A;  4IN3 B;  4G2V A;  2L6J A;  1PC2 A;  1ZBP A;  2FI7 A;  2OND A;  4BT8 A;  2XGO A;  1HH8 A;  1Y8M A;  3LYA A;  3PE4 A;  3CEQ A;  4JL0 A;  5EX0 A;  1HZ4 A;  4AIF A;  2XPI A;  2FEZ A;  2J9Q A;  2KCV A;  4GCO A;  3LPZ A;  4H7Y A;  2WPV A;  3GYZ A;  5C1D A;  4CGV A;  4G1T A;  2MHK A;  2Y4U A;  2C0L A;  3MV2 B;  1XNF A;  2KC7 A;  3CVL A;  4N3B A;  5ARF A;  5FZQ A;  4GYW A;  5CCL A;  5A7D B;  2JLB A;  1OUV A;  2VQ2 A;  1QQE A;  2PL2 A;  2P58 C;  4GA1 A;  2V5F A;  4BWR A;  4I9C A;  5DIZ A;  3URZ A;  2NC9 A;  4J8F A;  4WNG A;  4U04 A;  2XCB A;  1KLX A;  3IEG A;  2QFC A;  3RJV A;  4LEU A;  3LY7 A;  3LCA A;  4BTA A;  5KJM A;  3CVP A;  2PZI A;  4J0U A;  3UQ3 A;  2HR2 A;  4GYY A;  5EX3 A;  3CKB A;  4JA7 A;  5G04 C;  1NA0 A;  1KT0 A;  4BTB A;  4HOQ A;  4AM9 A;  3Q47 B;  4O6F A;  4I17 A;  3QOU A;  4HOU A;  2WQH A;  5ARG A;  1E96 B;  3AS5 A;  3UPV A;  2E2E A;  3MV3 B;  4U07 A;  3LKU A;  2VGX A;  2KCL A;  4YVQ C;  3CKC A;  2UY1 A;  2FO7 A;  4B94 A;  3QWV A;  3ASD A;  2AVP A;  5D0O D;  5CHE E;  3Q49 B;  3CVN A;  4F3V A;  4I2Z A;  4HOT A;  2XCC A;  3TG4 A;  5LCW J;  5A6C A;  2LSV A;  3AS8 A;  3OXF A;  3ASF A;  4KBQ A;  5G05 J;  4I1A A;  4BT9 A;  4CDR A;  4UQZ A;  3S7D A;  2HYZ A;  4YVO A;  4G26 A;  3E4B A;  4UI9 K;  1FCH A;  4AY5 A;  3FP3 A;  4WUY A;  3CK7 A;  4N3C A;  4G23 A;  4N2Q A;  1HXI A;  4N5C A;  2PQR A;  4ME2 A;  2LNI A;  2PQN A;  4A1S A;  3LY9 A;  5DBK A;  3MKR A;  4N3A A;  4WND A;  4HOR A;  3ESK A;  5JJT A;  2VGX B;  3WXX A;  2KCK A;  4UI9 J;  4UQX A;  2BUG A;  4N2S A;  2UY1 B;  4GZ6 A;  4XI9 A;  4NQ0 A;  3RIB A;  4JHR A;  1IYG A;  5FT9 A;  3Q5M A;  5D0Q D;  3VTY A;  2YQ8 A;  3HYM B;  4AY6 A;  4GZ3 A;  3VTX A;  3TG5 A;  1WAO 1;  4RG6 A;  3OXG A;  3GZ1 A;  1W3B A;  3R9A B;  4NRH B;  3RU0 A;  1YA0 A;  5BNW A;  3ULQ A;  3QDN A;  4GYO A;  3U3W A;  5FZS A;  5KJN A;  3QKY A;  2R5S A;  4YND A;  3ASG A;  3TAX A;  3KAE A;  5AYW D;  3Q15 A;  5M72 A;  3U4T A;  2C0M A;  2HO1 A;  3RKV A;  4EQF A;  3S7B A;  3ZHE A;  2FF4 A;  2Y4T A;  5EKQ D;  1KT1 A;  3ZGQ A;  4CGW A;  4N39 A;  4WNF A;  4J8D A;  3RO2 A;  3NF1 A;  3ZFW A;  3FWV A;  1ELR A;  3OXL A;  3O48 A;  3MEK A;  3QWW A;  3GW4 A;  2GW1 A;  3CVQ A;  3MA5 A;  4GPK A;  1QZ2 A;  2XEV A;  2VSN A;  3EDT B;  1IHG A;  4U0Z A;  5BW8 C;  1A17 A;  4APO A;  5HI7 A;  5G04 J;  5FZR A;  3GZ2 A;  4Y6C A;  3TGO A;  2IF4 A;  3ZN3 A;  3ASH A;  5KJL A;  4J8E A;  4ABN A;  3Q4A B;  2IFU A;  2KAT A;  5JJ7 A;  3SF4 A;  4WNE A;  3FFL A;  4GZ5 A;  3RO3 A;  3CK9 A;  4JA9 A;  2VSY A;  4KYO B;  4G24 A;  4I9E A;  3ZHE B;  2OOE A;  4RG9 A;  3PDN A;  5LCW C;  4G25 A;  4GA2 A;  3CK8 A;  2VYI A;  2XGM A;  3CV0 A;  1TJC A;  3JYS A;  4XI0 A;  5G05 C;  1NZN A;  2I6H A;  1P5Q A;  4W9R A;  1WM5 A;  2FBN A;  2YHC A;  3KS2 A;  4I2W A;  4U0U A;  3QWP A;  1B89 A;  2XGS A;  2VGY A;  4U0S A;  5BT1 A;  3K9I A;  5CCM A;  1NA3 A;  2LSU A;  4H7X A;  4HOS A;  3S7J A;  5KJK A;  5FTP A;  3KD7 A;  3N71 A;  3BEE A;  1ZU2 A;  4UQY A;  4Y6W A;  4XIF A;  3ZPJ A;  2DBA A;  4GCN A;  3PE3 A;  5JJ6 A;  3LY8 A;  1ELW A;  5FJY A;  4KXK B;  3S7F A;  4GA0 A;  4UI9 C;  3SZ7 A;  2UWJ G; 
#chains in the Genus database with same CATH topology
 1XGW A;  3P2B A;  2R2L A;  4OAU C;  5HQ8 A;  3HHM A;  4I6E A;  2C2L A;  4DI4 A;  3V79 K;  3ZIM A;  1N0R A;  3BU8 A;  1WY6 A;  4AXH A;  4AP2 A;  2FI7 A;  2R59 A;  2XGO A;  1Y8M A;  3T8K A;  2QY7 A;  3CEQ A;  4D10 C;  4AIF A;  3QAR A;  2FEZ A;  2KCV A;  3ZRH A;  2VJ8 A;  4O1P A;  3SD5 A;  4NIK A;  4G1T A;  4A3T A;  2C0L A;  4G8K A;  3MGB A;  3DBS A;  4GZD A;  3CSF A;  3CVL A;  4UWG A;  2WXF A;  4N3B A;  1OUV A;  2VQ2 A;  4FLB A;  5J08 A;  2V5F A;  4B89 A;  5EYL A;  3V2O A;  3R7Q A;  3NZU A;  2VSX E;  1TYQ G;  3CVU A;  3ZUV B;  1UW4 B;  4U04 A;  3ZYM A;  1KLX A;  4EEC A;  4DX6 D;  3L54 A;  3IEG A;  2QFC A;  1EYH A;  4G8L A;  4LUN U;  3OTN A;  3C3Q A;  4PS3 A;  4L1B A;  4B0Z A;  3C98 A;  4BY6 A;  5CER B;  2PZI A;  4LCT A;  2QZA A;  5EIL A;  2B0O E;  3E32 A;  4EZL A;  4TUU A;  4HLE A;  2BKG A;  1SA4 A;  2WQH A;  2OEW A;  2GRO B;  3AS5 A;  1MX4 A;  1E90 A;  3UPV A;  4P29 A;  3CKC A;  2CG3 A;  2VTB B;  4MBG A;  4JD2 G;  1NFI E;  3QWV A;  1FVF A;  1E8Y A;  4BX9 A;  1O1S A;  4FU3 A;  3NQP A;  1TEZ A;  1O1R A;  1HE8 A;  2V8S E;  3DEO A;  3NAW A;  4R7L A;  3TG4 A;  5LCW J;  3PRZ A;  2IEJ A;  2LSV A;  3C72 A;  3Q7F A;  1PY1 A;  2GRL A;  4E85 A;  4U95 D;  1H2T C;  3ZW3 A;  1RZ4 A;  5G05 J;  2EQX A;  5CMW A;  5FQ7 A;  4FA6 A;  3S7D A;  2HYZ A;  4G26 A;  1FCH A;  3DXM G;  4G23 A;  1IQR A;  2OV8 A;  1HXI A;  1S63 A;  2FO1 E;  2P9P G;  4CT4 A;  2LXM A;  3DST A;  2PQR A;  3JUI A;  3R9M A;  2ETB A;  5KBA A;  3LY9 A;  5LOZ A;  3MKR A;  5AAR A;  3ZYK A;  3RRU A;  1HO8 A;  3T8M A;  2VGX B;  3EHN A;  4UI9 J;  4UQX A;  1D8D A;  2F8X K;  3ML8 A;  3SGH A;  3Q5M A;  2ZGD A;  4HVB A;  4FP7 A;  5CMY A;  1S64 A;  4GTS A;  3TWV A;  4GTP A;  3OXG A;  2ION A;  3SFZ A;  4V3I A;  3U9W A;  4UWL A;  2QYU A;  2DCP A;  3QDN A;  3UIO C;  2XQ0 A;  3C5R A;  1FT2 A;  5KJN A;  3HXE A;  2DZO A;  3KAE A;  1YCS B;  4GTT A;  2C0M A;  3AU5 A;  2L0T B;  4EQF A;  2PM6 A;  4O60 A;  2LAI A;  2KZT A;  4JHK A;  1JWF A;  5A23 A;  4WNF A;  3SBS A;  1FVH A;  2J09 A;  1LD7 A;  2IOL A;  3FWV A;  4TV3 A;  1UOH A;  3OXL A;  1N94 A;  3CVQ A;  1QZ2 A;  1ELK A;  3D9P A;  2VSN A;  1EDU A;  5B3S E;  2XHE A;  3G2U A;  1JPL A;  1LTX A;  4XKB A;  1UN8 A;  4J6I A;  2X6I A;  3GZ2 A;  4CRW A;  4Y6C A;  3L17 A;  4DLQ A;  5EYP F;  2CHX A;  4G11 A;  5ENP D;  3ASH A;  3MKQ A;  3RSE G;  2DZN A;  3NOG D;  3PRE A;  3LS8 A;  3Q4A B;  4XZ4 A;  3DSU A;  2P9U G;  4LSZ E;  3ASN E;  1U3C A;  4CYM D;  1YMP A;  2GRQ B;  3L82 A;  1V54 E;  2RG8 A;  1TNU A;  4HRM B;  4GAA A;  2XS8 A;  3RO3 A;  3UTM A;  1AWC B;  3X2Q E;  4G24 A;  3UMV A;  3QB2 A;  3B7R L;  3W9F A;  1N54 A;  1L5J A;  4RG9 A;  2DVW A;  1H0A A;  2VYI A;  4JHJ A;  4PDX A;  2BED A;  4ANV A;  1MQS A;  1OWM A;  1LF8 A;  4L7T A;  1P5Q A;  1PAQ A;  1WM5 A;  5BV1 A;  3FH8 A;  1U2V G;  3DSS A;  5JA4 D;  1NA3 A;  4AV7 A;  3CHP A;  1UJJ A;  1OWN A;  4OAV B;  4LNB A;  1K1B A;  2DWZ A;  2X6F A;  3RAU A;  4A3V A;  5BPP A;  3UM1 A;  3B7U X;  3IKO B;  3CHO A;  4PS8 A;  5AQA A;  1ELW A;  3CGH A;  4X8Q A;  1NP7 A;  3SZ7 A;  1N4P A;  1BLX B;  2XRY A;  3UIP C;  1BPO A;  1OWO A;  3UUX A;  3HG0 D;  3I4R B;  1ZBP A;  1TN7 A;  2OND A;  3DSX A;  1HH8 A;  3Q75 A;  5ANR A;  4JL0 A;  2H6G A;  3HVE B;  5EX0 A;  1HZ4 A;  4FAD A;  2LUH A;  2WQ7 A;  1N4Q A;  2B6C A;  2XPI A;  4ILH B;  2BTD A;  2J9Q A;  4H7Y A;  3GYZ A;  3ABM E;  4IYP A;  1DVP A;  2MHK A;  2WXO A;  2OVB A;  2WXN A;  4GB9 A;  2EIM E;  3MJW A;  2EIK E;  3Q7A A;  1QQE A;  4JB8 P;  1N4S A;  4IRU A;  5CEC B;  3FUN A;  3ZXP A;  3FU6 A;  3UI2 A;  4DRX E;  2IY0 C;  4WNG A;  3DSW A;  3L13 A;  2M63 A;  4DX1 A;  3CVX A;  3LY7 A;  3LCA A;  1BD8 A;  4FHK A;  2KBX A;  5KJM A;  3PNT B;  1EF1 C;  4J0U A;  3UQ3 A;  3CKB A;  1JCQ A;  5G04 C;  4LER A;  4BTB A;  4FC8 A;  4HOQ A;  1WDY A;  3Q47 B;  1MX6 A;  4I17 A;  2F8Y A;  3QOU A;  4HOU A;  3CHR A;  4C48 B;  1E96 B;  3T5V A;  4EBA A;  3MV3 B;  4ZHB A;  3LKU A;  2KCL A;  3O4Z A;  3PZ2 A;  4WWP A;  4LRZ A;  4B94 A;  3EHQ A;  4XKC A;  3L9T A;  2AVP A;  4KVM A;  5CHE E;  3CQC B;  3CVY A;  2XRZ A;  1Z6T A;  3Q49 B;  3PVL A;  2XCC A;  5ITZ F;  2WXL A;  3OXF A;  1YYH A;  4TUM A;  3IBE A;  4GU5 A;  2OCC E;  3AJI A;  1SA5 A;  4BT9 A;  4CDR A;  1WG0 A;  4CDM A;  4HI9 A;  2XZT G;  3FUD A;  4YVO A;  1K8K G;  4WUY A;  4N2Q A;  4HXI A;  1OXJ A;  2P9S G;  4RLY A;  1Q2Z A;  2Y0B G;  4EBA G;  2LNI A;  2PQN A;  3ZXS A;  5AIJ A;  4A1S A;  5FQ6 A;  1BU9 A;  5DBK A;  2JEK A;  4N3A A;  3ABL E;  4CT0 A;  3ML9 A;  2WXJ A;  1N11 A;  3SI5 A;  5AJD A;  2VGE A;  5FIO A;  4WAF A;  3TWR A;  1TNO A;  2RFM A;  3FU0 A;  5JJT A;  2IOS A;  3WXX A;  3BG1 B;  5HRY A;  2BUG A;  4N2S A;  2UY1 B;  5ENT D;  3FTS A;  5D0Q D;  3HYM B;  4EHM A;  4DLO A;  1N0Q A;  4U7E B;  2J4B A;  3R9A B;  1JCR A;  5AAO A;  3ULQ A;  4HFG A;  4RQI A;  3U3W A;  5FZS A;  5EDS A;  4BEP A;  2NSZ A;  2R5S A;  3ASG A;  3EIJ A;  3Q15 A;  1X81 A;  3RKV A;  3UM2 A;  3L16 A;  4HQD A;  2DIW A;  3ZHE A;  5BXU A;  2Y4T A;  3FDH A;  3ZYL A;  1KT1 A;  1FT1 A;  4CGW A;  4N39 A;  3QNK A;  4J8D A;  3LJN A;  3I3N A;  1INZ A;  2YIN A;  5AN8 A;  1QBQ A;  3NF1 A;  1ELR A;  3DPD A;  3MEK A;  3IV0 A;  5ENQ D;  1O5M A;  2CHZ A;  3MA5 A;  3PZ1 A;  2XEV A;  5JHA A;  2EIL E;  4MS6 A;  3EDT B;  3PZD A;  5D2M C;  2J07 A;  5BW8 C;  3PZ3 A;  4APO A;  1SZA A;  5G04 J;  3Q9N C;  2IF4 A;  1N4R A;  3VLD A;  2CFU A;  3FTW A;  5KJL A;  2OVF A;  4ABN A;  2AXZ A;  2IFU A;  3SF4 A;  4WNE A;  3FFL A;  5ENO D;  4YDY A;  4Q96 A;  1OCR E;  4JA9 A;  2VSY A;  1UG3 A;  4M3O A;  4URK A;  2YHE A;  1OWL A;  4ACK A;  2P9K G;  4EZJ A;  3CST A;  5FWQ A;  2OOE A;  2RKK A;  4KVO A;  4GA2 A;  2H6H A;  3BG0 B;  3CK8 A;  4MRU A;  4FJY A;  1IHB A;  3U64 A;  2X38 A;  4GMR A;  4DX2 A;  3FH5 A;  2IQC A;  3JYS A;  2WMN A;  2XEN A;  1NZN A;  3E37 A;  4MLP A;  3HIZ A;  2I6H A;  2OEV A;  3U66 A;  2FBN A;  2YHC A;  5G2N A;  4ANW A;  1D9S A;  5D66 A;  2QYJ A;  2I9C A;  4FLH A;  4F1P A;  2ETA A;  4GTR A;  1B89 A;  2XGS A;  2F37 A;  5CCM A;  1SW6 A;  2J49 A;  2LSU A;  2H6I A;  4TXP A;  4HLL A;  3EHM A;  4APF A;  4KT6 B;  5KCM A;  3BEE A;  4JVS A;  3HRA A;  1ZU2 A;  4UQY A;  1O1T A;  4Y6W A;  5AEN A;  4XIF A;  3FUE A;  3L6A A;  2DBA A;  2LAH A;  4GCN A;  5ENR D;  4AJW A;  4JW1 A;  4UWK A;  1DC2 A;  2R03 A;  5FJY A;  3S2A A;  3EIQ C;  3S7F A;  1MHQ A;  2HE0 A;  1TNY A;  4GA0 A;  2UWJ G;  4K5A B;  3CVV A;  3J5Q B;  1HF8 A;  3D9L A;  3ULE G;  4J7W A;  2L6J A;  2ETC A;  4A55 A;  2V4H C;  3QJZ A;  1HG5 A;  1Z3X A;  1Z5S C;  4DJA A;  1E8W A;  3LYA A;  3B7S A;  2VTB A;  3HXB A;  4AVX A;  4HS2 A;  2WPV A;  3UT4 A;  2AJA A;  5C1D A;  2AW6 A;  3PEU B;  4CGV A;  2A5E A;  1OT8 A;  3R7R A;  3FEX A;  4JEU A;  2KC7 A;  4I1O B;  3AU4 A;  5T8I A;  3Q9U C;  5FZQ A;  4GYW A;  5CCL A;  1HS6 A;  2R02 A;  3SNX A;  4I6G A;  1IKN D;  4K5B A;  2NYJ A;  4BWR A;  3DRA A;  5LP0 A;  3SFX A;  4I9C A;  5DIZ A;  3URZ A;  4PH4 B;  3LVQ E;  5J90 A;  2EIN E;  2NC9 A;  2J08 A;  2YNQ A;  3PNL B;  4PUC A;  2XCB A;  3BQO A;  3RJV A;  5CBO A;  5CRV A;  1JWG A;  4LEU A;  2WQ6 A;  4HRN A;  4BTA A;  2HR2 A;  4JA7 A;  2WB2 A;  4U8V D;  4F7A A;  2A4Z A;  4YDE A;  1KT0 A;  1NA0 A;  2BKK B;  4AM9 A;  4O6F A;  3FY4 A;  4OVU A;  4QQI A;  3DWL G;  5ARG A;  2AXV A;  3PS6 A;  2E2E A;  3TJP A;  4U07 A;  1SZ9 A;  2GRM A;  2VGX A;  4YVQ C;  3HDX A;  3IXE A;  4BET A;  3TL5 A;  1A5E A;  3B7T A;  1K3Z D;  4LNU D;  3ASD A;  3J5P A;  3VLF A;  2CG2 A;  4JPS A;  1H6O A;  4HRL A;  3D9K A;  3LXU X;  1S70 B;  5BUZ A;  2LO6 A;  3RRN B;  2L6B A;  3SHF A;  1HU3 A;  3AS8 A;  2R05 A;  5BV0 A;  2DYS E;  2IO3 C;  3TWW A;  4L2Y A;  2P9L G;  3EU5 A;  3TXN A;  4I1A A;  4KMO A;  5KNH D;  2H6F A;  3E4B A;  4UI9 K;  3FUI A;  3FP3 A;  3CK7 A;  4N3C A;  3CVW A;  4JXT A;  3IHV A;  3UM3 A;  1E8X A;  4N5C A;  4ME2 A;  4YDW A;  2ZGG A;  1SVX A;  1TR4 A;  3MCX A;  2Y1L E;  4FJZ A;  3D9J A;  3FTZ A;  2GRP B;  4F6R D;  4C0E A;  4GTV A;  4KZ0 A;  1IQU A;  4GZ6 A;  4GMJ A;  3SY2 A;  3JQ0 A;  4JHR A;  3ONK A;  1IYG A;  3VTY A;  1E7V A;  2YQ8 A;  4AY6 A;  3T5X A;  4GZ3 A;  3VTX A;  2Y69 E;  5ENS D;  2Y3A A;  4BSX A;  1NI1 A;  1WAO 1;  3MYV A;  5B1B E;  3GZ1 A;  1W3B A;  4NRH B;  1OY3 D;  3RU0 A;  3PZ4 A;  3LDZ A;  4ILG A;  5CBN A;  3NBN B;  3LJ3 A;  3NB2 A;  3QKY A;  2WMO A;  4ATZ D;  2BF0 X;  1HX8 A;  4YND A;  2WXM A;  2CFZ A;  1K1A A;  4OVV A;  3DEP A;  3F6Q A;  4XE0 A;  4E6H A;  2E0I A;  3ZNG A;  4OYS A;  2V0P A;  3CHM A;  5EKQ D;  3RO2 A;  2XEH A;  4XX5 A;  4Z68 A;  3O48 A;  3QWW A;  2V4L A;  3GW4 A;  2R17 C;  2GW1 A;  1KZP A;  2FUL A;  4GPK A;  5LFA A;  4I1M A;  3JQ1 A;  4XEI G;  4TXQ A;  4BX8 A;  3EHR A;  1IHG A;  4ANX A;  1Z3Y A;  4U0Z A;  3ISM C;  5HI7 A;  1DCQ A;  5FZR A;  3BUA A;  3QC1 A;  5H7P A;  1MJ0 A;  2ZIR A;  3KEZ A;  3ULY A;  3B95 A;  1X5B A;  4J8Y A;  4YDO A;  1MX2 A;  4J8E A;  3RK6 A;  3HXC A;  2AXU A;  1D8E A;  2KAT A;  1UN9 A;  5JJ7 A;  4DPR A;  2VSO E;  3TXM A;  2I1J A;  4WWN A;  3C3R A;  1N52 A;  2GRR B;  4GZ5 A;  2GRN B;  5CEA A;  1H2V C;  3TWU A;  1AP7 A;  4K0R A;  3AAA C;  4J8S A;  3HVE A;  4M7C A;  5EN5 D;  3E30 A;  4I43 A;  2CHW A;  2KZT B;  3EJN A;  3C3O A;  3I5P A;  4G25 A;  2KXP C;  2X3M A;  4ANU A;  3JCK C;  4HB5 A;  1MZC A;  3CV0 A;  1TJC A;  4XI0 A;  4QFV A;  3I4G A;  3WG7 E;  5JHB A;  2ZU6 B;  2WXR A;  3KEA A;  4W9R A;  3TWS A;  1TNB A;  3KS2 A;  4JC8 A;  3SQV A;  1HG2 A;  3T9K A;  2X6J A;  2VGY A;  5EID A;  5BT1 A;  3K9I A;  5AJL A;  4F53 A;  4Q69 A;  1FPP A;  4H7X A;  4HOS A;  4IUL A;  3UIN C;  3ENE A;  5KJK A;  4AOF A;  3KSQ A;  3DPY A;  5FTP A;  2X6K A;  2XPY A;  1TN8 A;  3N71 A;  3PUJ A;  2IJG X;  4CEM A;  4BSZ B;  3MX3 A;  4I6J A;  1N95 A;  4NAC A;  4ZFH A;  4ATG A;  4GZC A;  3ESL A;  3MKQ B;  4U8H A;  2XEE A;  3G2W A;  3PE3 A;  5JJ6 A;  4KXK B;  4DI3 A;  2WVI A;  5HS0 A;  5AQ7 A;  4A63 B;  2RFA A;  3D9I A;  3AS4 A;  3PUK A;  3HXF A;  3FUH A;  2Q7F A;  4IN3 B;  4G2V A;  3AG1 E;  3B13 A;  1PC2 A;  4BT8 A;  2ZXW E;  1QNF A;  4U63 A;  2WM9 A;  3ONL A;  3PE4 A;  3FTV A;  5ENN A;  5AQB A;  4ILI A;  3FU5 A;  3P1U A;  4GCO A;  3LPZ A;  3SBT B;  1H6P A;  3V2X A;  4CZ2 D;  2AWI A;  3APC A;  2X6H A;  1OCO E;  4GTO A;  2Y4U A;  3MV2 B;  5KNG A;  1KPS B;  2I1K A;  1E7U A;  1XNF A;  3KSL A;  4F1S A;  1BI7 B;  2A5U A;  3EU9 A;  3JUE A;  2GGF A;  5ARF A;  5A7D B;  2JLB A;  3G2V A;  4DK5 A;  2PL2 A;  5EIB E;  2P58 C;  3FTU A;  2F0Y A;  4GA1 A;  4U8Y D;  1RW2 A;  5ANL A;  4J8F A;  4HNA D;  1ZB1 A;  4LG6 A;  5FQ4 A;  1VDY A;  3UT8 A;  4GPM A;  2WXP A;  1DCE A;  3FUJ A;  5IY5 E;  3CVP A;  4CDN A;  4EPZ A;  4GYY A;  5EX3 A;  3QK0 A;  2V5Q C;  4PS7 A;  4TXR A;  5C2Y A;  4HI8 A;  1GW6 A;  1UJK A;  5CED B;  4C9B B;  2UY1 A;  2FO7 A;  4L9P A;  1JUQ A;  1LD8 A;  3AG2 E;  3APF A;  2J4D A;  2IO2 C;  3UM0 A;  4EZK A;  5D0O D;  3DSV A;  3CVN A;  3FUF A;  5T3R A;  5FIN A;  4F3V A;  2DYR E;  3LEW A;  4I2Z A;  5AQ9 A;  4LNG A;  4B8A A;  2EIJ E;  3E33 A;  2IU1 A;  4ACL A;  4HOT A;  3HXD A;  4A1G A;  5A6C A;  2WXK A;  1OWP A;  1BI8 B;  3ASF A;  1IXV A;  3EUV A;  1QYM A;  2WXI A;  4BFR A;  4AEZ C;  4KBQ A;  3QAQ A;  1V55 E;  1Y6I A;  4RSY A;  3CIA A;  3Q79 A;  4UQZ A;  3ZVV A;  3ZYQ A;  4TRQ A;  5CRU A;  4DUI A;  1TJF A;  3FTY A;  3D9M A;  4AY5 A;  3UKU G;  2LXL A;  2XZD G;  2WXH A;  3L08 A;  4WND A;  2RD0 A;  4HOR A;  3CQG B;  3E34 A;  3MZL B;  3ESK A;  3G2S A;  2ILR A;  3CR3 A;  4K5C A;  4L2L A;  2KCK A;  3APD A;  3CHQ A;  3JXI A;  1OCC E;  3W9G A;  3ZU7 B;  5BXO A;  4XI9 A;  3CLJ A;  3B7B A;  3FH7 A;  4FHJ A;  4NQ0 A;  3RIB A;  5G55 A;  2WXQ A;  5FT9 A;  2ZIS A;  2PM7 A;  4K03 A;  3UT7 A;  3TG5 A;  4N5Q A;  4RG6 A;  4C0M A;  1TN6 A;  5JMN D;  1YA0 A;  3Q78 A;  1JCS A;  3NOC D;  5BNW A;  1DNP A;  4GTQ A;  4GYO A;  3NZS A;  4GTM A;  3V30 A;  5FQ8 A;  2P2C P;  3TAX A;  5AYW D;  5T4Y A;  5M72 A;  3UXG A;  4KZC A;  3Q73 A;  3U4T A;  2HO1 A;  4BES A;  1G3N B;  3L22 A;  3S7B A;  3UX4 A;  2FF4 A;  3ZGQ A;  3ABK E;  3PEV B;  4B8C B;  1H19 A;  3ZFW A;  3UKR G;  3SFY A;  4DX5 D;  4UWH A;  3TWT A;  3TWQ A;  1E8Z A;  4CCA A;  3V31 A;  1MYO A;  2MRI A;  3FUL A;  3FEY A;  1HFA A;  3SO8 A;  2L9B A;  1A17 A;  1NL4 A;  1TNZ A;  3FHE A;  3TGO A;  4UUC A;  3ZN3 A;  3FUK A;  4BER A;  2XS1 A;  2P9I G;  5E76 A;  3ZEF A;  3OAW A;  2MOW A;  2MYO A;  1EPU A;  4L23 A;  5KWD A;  1OCZ E;  3ZKJ A;  3D3M A;  3CK9 A;  4Q94 A;  2NXP A;  4KYO B;  3FUM A;  2QC9 A;  2KM4 A;  4I9E A;  3TWX A;  3ZHE B;  3PDN A;  5B1A E;  5LCW C;  3FTX A;  4NUR A;  3DXK G;  2JAB A;  4WWO A;  4O1O A;  1H2U A;  1S0P A;  4DX7 D;  1KZO A;  1H6K A;  3AG3 E;  2XGM A;  3D9N A;  3D9O A;  5E75 A;  4B93 B;  4MKT A;  5G05 C;  3GZS A;  3FU3 A;  2XPZ A;  3ASO E;  3G2T A;  2WXG A;  4I2W A;  4RVB A;  4U0U A;  3AG4 E;  4U96 D;  1N9A A;  3QWP A;  3RRM B;  4JEH A;  4GML A;  4U0S A;  4FUL A;  3S7J A;  3IHY A;  3VLE A;  2L0I A;  2I2O A;  3KD7 A;  2PNN A;  2P9N G;  5LX8 A;  3ZPJ A;  1U3D A;  1SQM A;  3LVR E;  3PH0 C;  4HBD A;  5HKP A;  3LY8 A;  2HM8 A;  3JXJ A;  3D9H A;  3CHS A;  4UWF A;  4UI9 C;  2J8S D;  4JZY A; 
#chains in the Genus database with same CATH homology
 3D9I A;  3AS4 A;  3PUK A;  3CVV A;  1XGW A;  3P2B A;  2XRY A;  1BPO A;  1OWO A;  3UUX A;  5HQ8 A;  3FUH A;  3HHM A;  4I6E A;  1HF8 A;  2C2L A;  2Q7F A;  3D9L A;  4IN3 B;  3I4R B;  4DI4 A;  4G2V A;  2L6J A;  3ZIM A;  4A55 A;  3QJZ A;  3B13 A;  1HG5 A;  1WY6 A;  1PC2 A;  1Z3X A;  4AXH A;  1ZBP A;  4AP2 A;  2FI7 A;  2OND A;  2R59 A;  4BT8 A;  1QNF A;  2XGO A;  4U63 A;  1HH8 A;  2WM9 A;  1E8W A;  3ONL A;  4DJA A;  1Y8M A;  3LYA A;  3FTV A;  3PE4 A;  5ANR A;  3B7S A;  2QY7 A;  3CEQ A;  3HVE B;  4JL0 A;  1HZ4 A;  5EX0 A;  5ENN A;  4FAD A;  2VTB A;  4D10 C;  4AIF A;  2WQ7 A;  3QAR A;  2XPI A;  4ILH B;  2FEZ A;  4ILI A;  4AVX A;  2BTD A;  2J9Q A;  2KCV A;  3FU5 A;  3P1U A;  4GCO A;  3LPZ A;  4H7Y A;  4HS2 A;  3SBT B;  3ZRH A;  2VJ8 A;  2WPV A;  3UT4 A;  2AWI A;  3GYZ A;  3SD5 A;  5C1D A;  2AW6 A;  3PEU B;  4IYP A;  3APC A;  2X6H A;  4CGV A;  4G1T A;  1DVP A;  3R7R A;  4A3T A;  2MHK A;  2Y4U A;  2C0L A;  3MV2 B;  3FEX A;  2WXO A;  1E7U A;  2I1K A;  1XNF A;  3MGB A;  3DBS A;  4GZD A;  4JEU A;  2KC7 A;  3CSF A;  4I1O B;  2OVB A;  3AU4 A;  3CVL A;  4F1S A;  4UWG A;  2WXF A;  2A5U A;  2WXN A;  5T8I A;  2GGF A;  4N3B A;  5ARF A;  5FZQ A;  4GB9 A;  4GYW A;  5CCL A;  1HS6 A;  3MJW A;  5A7D B;  2JLB A;  3G2V A;  1OUV A;  2VQ2 A;  1QQE A;  4FLB A;  4DK5 A;  5J08 A;  2PL2 A;  2P58 C;  3SNX A;  3FTU A;  4I6G A;  4GA1 A;  2V5F A;  4B89 A;  4BWR A;  5LP0 A;  4I9C A;  5DIZ A;  4IRU A;  3R7Q A;  3URZ A;  5ANL A;  4PH4 B;  3LVQ E;  3NZU A;  5J90 A;  2NC9 A;  2VSX E;  2J08 A;  3FUN A;  2YNQ A;  4J8F A;  3FU6 A;  3PNL B;  3CVU A;  4WNG A;  1UW4 B;  4PUC A;  4U04 A;  2XCB A;  3ZYM A;  1KLX A;  4EEC A;  3L54 A;  3IEG A;  2QFC A;  3L13 A;  3RJV A;  2M63 A;  5FQ4 A;  1VDY A;  1EYH A;  3UT8 A;  1JWG A;  3CVX A;  2WXP A;  4LUN U;  3OTN A;  4LEU A;  3LY7 A;  4PS3 A;  3LCA A;  2WQ6 A;  3FUJ A;  4L1B A;  4FHK A;  4B0Z A;  3C98 A;  4BY6 A;  4BTA A;  5KJM A;  3PNT B;  3CVP A;  1EF1 C;  2PZI A;  4CDN A;  4J0U A;  3UQ3 A;  4EPZ A;  2HR2 A;  4GYY A;  5EX3 A;  3CKB A;  4JA7 A;  5G04 C;  4F7A A;  2WB2 A;  2A4Z A;  4LCT A;  3QK0 A;  1KT0 A;  1NA0 A;  4FC8 A;  4LER A;  4BTB A;  4PS7 A;  4HOQ A;  4AM9 A;  4EZL A;  4TUU A;  4HLE A;  3Q47 B;  3FY4 A;  4O6F A;  4I17 A;  5C2Y A;  4OVU A;  3QOU A;  4HOU A;  2WQH A;  2AXV A;  3CHR A;  5ARG A;  1E96 B;  3AS5 A;  3UPV A;  1E90 A;  3PS6 A;  3T5V A;  4EBA A;  2E2E A;  3MV3 B;  4U07 A;  3TJP A;  1GW6 A;  1SZ9 A;  2GRM A;  3LKU A;  1UJK A;  2VGX A;  4P29 A;  2KCL A;  4YVQ C;  3O4Z A;  3HDX A;  3CKC A;  2CG3 A;  4WWP A;  4C9B B;  2VTB B;  4LRZ A;  2UY1 A;  2FO7 A;  4B94 A;  1JUQ A;  3TL5 A;  4XKC A;  3QWV A;  1FVF A;  1E8Y A;  4BX9 A;  3APF A;  3B7T A;  4FU3 A;  3NQP A;  2J4D A;  1TEZ A;  3ASD A;  1HE8 A;  2AVP A;  4EZK A;  5D0O D;  3VLF A;  4KVM A;  2CG2 A;  5CHE E;  3CQC B;  3CVY A;  4JPS A;  2XRZ A;  1Z6T A;  2V8S E;  3Q49 B;  3CVN A;  3FUF A;  5T3R A;  3PVL A;  4F3V A;  3D9K A;  3LXU X;  4R7L A;  3LEW A;  4I2Z A;  4B8A A;  4ACL A;  2IU1 A;  4HOT A;  5BUZ A;  2LO6 A;  2XCC A;  4A1G A;  3RRN B;  3TG4 A;  5LCW J;  5A6C A;  3SHF A;  3PRZ A;  2WXK A;  2LSV A;  2WXL A;  1OWP A;  1HU3 A;  3AS8 A;  3OXF A;  1PY1 A;  3ASF A;  2GRL A;  4E85 A;  5BV0 A;  2WXI A;  4BFR A;  1H2T C;  4AEZ C;  4L2Y A;  3IBE A;  3ZW3 A;  4KBQ A;  3QAQ A;  4GU5 A;  3TXN A;  5G05 J;  1Y6I A;  4RSY A;  2EQX A;  3CIA A;  4I1A A;  5CMW A;  4BT9 A;  5FQ7 A;  4CDR A;  4CDM A;  4FA6 A;  4UQZ A;  3S7D A;  3ZVV A;  4KMO A;  3ZYQ A;  4TRQ A;  2HYZ A;  3FUD A;  1TJF A;  4YVO A;  4G26 A;  3FTY A;  3D9M A;  3E4B A;  4UI9 K;  1FCH A;  3FUI A;  4AY5 A;  3FP3 A;  3CK7 A;  4N3C A;  4WUY A;  3CVW A;  4G23 A;  4N2Q A;  1IQR A;  2OV8 A;  1HXI A;  4HXI A;  4JXT A;  3IHV A;  4ATG A;  4CT4 A;  1E8X A;  4N5C A;  2PQR A;  3JUI A;  4ME2 A;  2WXH A;  4EBA G;  2LNI A;  2PQN A;  3ZXS A;  5AIJ A;  4A1S A;  5FQ6 A;  3LY9 A;  5DBK A;  2JEK A;  5LOZ A;  3MKR A;  4N3A A;  4CT0 A;  3L08 A;  3MCX A;  2WXJ A;  2RD0 A;  3ML9 A;  4WND A;  4FJZ A;  3SI5 A;  5AJD A;  3D9J A;  4HOR A;  3CQG B;  3ZYK A;  3FTZ A;  4WAF A;  3MZL B;  3RRU A;  3FU0 A;  3ESK A;  3G2S A;  2ILR A;  5JJT A;  1HO8 A;  3CR3 A;  4L2L A;  3T8M A;  4C0E A;  2IOS A;  2VGX B;  3BG1 B;  2KCK A;  3WXX A;  4KZ0 A;  3EHN A;  4UI9 J;  3APD A;  4UQX A;  3CHQ A;  1IQU A;  2BUG A;  4N2S A;  2UY1 B;  4GZ6 A;  4XI9 A;  3CLJ A;  4GMJ A;  3FH7 A;  4FHJ A;  4NQ0 A;  3RIB A;  3JQ0 A;  4JHR A;  3ONK A;  5G55 A;  2WXQ A;  3ML8 A;  5FT9 A;  3FTS A;  3Q5M A;  3SGH A;  1IYG A;  5D0Q D;  3VTY A;  1E7V A;  2YQ8 A;  3HYM B;  4AY6 A;  4HVB A;  3T5X A;  4DLO A;  4GZ3 A;  3VTX A;  4FP7 A;  2PM7 A;  2Y3A A;  4BSX A;  4K03 A;  3UT7 A;  5CMY A;  3TG5 A;  1WAO 1;  4RG6 A;  3MYV A;  2J4B A;  3OXG A;  2ION A;  3GZ1 A;  4C0M A;  1W3B A;  3R9A B;  4NRH B;  3SFZ A;  3RU0 A;  1YA0 A;  4V3I A;  3U9W A;  5BNW A;  3ULQ A;  3LDZ A;  4ILG A;  1DNP A;  4UWL A;  2DCP A;  3QDN A;  4HFG A;  2XQ0 A;  4GYO A;  3U3W A;  5FZS A;  5EDS A;  3LJ3 A;  3NZS A;  5KJN A;  3QKY A;  2NSZ A;  2WMO A;  2R5S A;  2BF0 X;  1HX8 A;  4YND A;  2WXM A;  2CFZ A;  3ASG A;  5FQ8 A;  3TAX A;  4OVV A;  3KAE A;  5AYW D;  3EIJ A;  3Q15 A;  4XE0 A;  5T4Y A;  5M72 A;  4KZC A;  4E6H A;  2E0I A;  3U4T A;  2C0M A;  2HO1 A;  3AU5 A;  2L0T B;  3RKV A;  3L22 A;  3L16 A;  4EQF A;  2PM6 A;  2DIW A;  3S7B A;  3ZHE A;  4OYS A;  3UX4 A;  2FF4 A;  2LAI A;  2Y4T A;  2KZT A;  2V0P A;  3CHM A;  3FDH A;  4JHK A;  5EKQ D;  1KT1 A;  1JWF A;  3ZYL A;  3ZGQ A;  4CGW A;  5A23 A;  4N39 A;  4WNF A;  3SBS A;  3QNK A;  4J8D A;  3I3N A;  3RO2 A;  1FVH A;  1INZ A;  2J09 A;  2YIN A;  3PEV B;  4B8C B;  4XX5 A;  1H19 A;  3NF1 A;  3ZFW A;  2IOL A;  3FWV A;  4TV3 A;  1ELR A;  3OXL A;  3O48 A;  3DPD A;  3MEK A;  3QWW A;  3IV0 A;  2CHZ A;  2V4L A;  3GW4 A;  4UWH A;  2R17 C;  2GW1 A;  1E8Z A;  3CVQ A;  3MA5 A;  2FUL A;  4CCA A;  4GPK A;  1QZ2 A;  5LFA A;  1ELK A;  4I1M A;  3JQ1 A;  2XEV A;  5JHA A;  2MRI A;  3FUL A;  3D9P A;  2VSN A;  1EDU A;  4MS6 A;  2XHE A;  3G2U A;  3EDT B;  1JPL A;  4BX8 A;  1IHG A;  3FEY A;  3PZD A;  1HFA A;  4ANX A;  1Z3Y A;  4XKB A;  2J07 A;  4U0Z A;  1UN8 A;  2L9B A;  5BW8 C;  1A17 A;  4J6I A;  4APO A;  1SZA A;  5HI7 A;  2X6I A;  5G04 J;  5FZR A;  3GZ2 A;  4CRW A;  4Y6C A;  3QC1 A;  3L17 A;  4DLQ A;  3FHE A;  3TGO A;  2CHX A;  2IF4 A;  3ZN3 A;  3FUK A;  4G11 A;  2CFU A;  3VLD A;  3ASH A;  5E76 A;  3ZEF A;  3FTW A;  3KEZ A;  3MKQ A;  5KJL A;  3OAW A;  1X5B A;  2MOW A;  2OVF A;  3PRE A;  3LS8 A;  4J8E A;  4ABN A;  3RK6 A;  3Q4A B;  4XZ4 A;  2AXZ A;  2IFU A;  2AXU A;  2KAT A;  1EPU A;  1U3C A;  1UN9 A;  5JJ7 A;  4L23 A;  4DPR A;  3SF4 A;  2VSO E;  3TXM A;  2I1J A;  2RG8 A;  4WWN A;  4WNE A;  3FFL A;  1N52 A;  4GAA A;  3D3M A;  4GZ5 A;  3RO3 A;  4Q96 A;  3CK9 A;  4JA9 A;  2VSY A;  2NXP A;  4Q94 A;  4KYO B;  4G24 A;  1H2V C;  3FUM A;  3UMV A;  3QB2 A;  1UG3 A;  3B7R L;  4K0R A;  4M3O A;  4URK A;  2YHE A;  2KM4 A;  4I9E A;  1OWL A;  1N54 A;  4ACK A;  1L5J A;  4J8S A;  3HVE A;  4I43 A;  3ZHE B;  4EZJ A;  3CST A;  5FWQ A;  2OOE A;  2CHW A;  4RG9 A;  4KVO A;  2KZT B;  3PDN A;  5LCW C;  3FTX A;  3EJN A;  3I5P A;  4G25 A;  4GA2 A;  4NUR A;  2X3M A;  4WWO A;  4ANU A;  3BG0 B;  3CK8 A;  4MRU A;  4FJY A;  3JCK C;  1H2U A;  1S0P A;  3U64 A;  2X38 A;  1H0A A;  2VYI A;  4JHJ A;  1H6K A;  4PDX A;  3FH5 A;  2XGM A;  2IQC A;  1TJC A;  3CV0 A;  3D9N A;  3D9O A;  2WMN A;  3JYS A;  3I4G A;  4QFV A;  4XI0 A;  5E75 A;  4MKT A;  5G05 C;  3GZS A;  4ANV A;  3FU3 A;  1NZN A;  1MQS A;  1OWM A;  5JHB A;  4MLP A;  2ZU6 B;  2WXR A;  2XPZ A;  1LF8 A;  3HIZ A;  2I6H A;  4L7T A;  1P5Q A;  1PAQ A;  4W9R A;  3G2T A;  2WXG A;  3U66 A;  1WM5 A;  2FBN A;  2YHC A;  3KS2 A;  4I2W A;  5G2N A;  4RVB A;  4JC8 A;  4ANW A;  4U0U A;  5BV1 A;  3FH8 A;  2I9C A;  1HG2 A;  3QWP A;  4FLH A;  3RRM B;  4JEH A;  2X6J A;  1B89 A;  2XGS A;  2VGY A;  4GML A;  4U0S A;  5BT1 A;  3K9I A;  5AJL A;  4F53 A;  4Q69 A;  1NA3 A;  5CCM A;  2J49 A;  2LSU A;  4FUL A;  4H7X A;  4AV7 A;  4HOS A;  3CHP A;  3S7J A;  4IUL A;  5KJK A;  3ENE A;  1UJJ A;  1OWN A;  3IHY A;  3VLE A;  4AOF A;  2L0I A;  3EHM A;  4APF A;  5FTP A;  2X6K A;  2XPY A;  2I2O A;  3KD7 A;  3N71 A;  4KT6 B;  5KCM A;  3PUJ A;  3BEE A;  4JVS A;  1ZU2 A;  2IJG X;  4CEM A;  2X6F A;  4UQY A;  4Y6W A;  4A3V A;  3MX3 A;  4I6J A;  5BPP A;  5AEN A;  4XIF A;  3ZPJ A;  1U3D A;  1SQM A;  4NAC A;  5LX8 A;  3FUE A;  3B7U X;  3LVR E;  3IKO B;  2DBA A;  2LAH A;  3CHO A;  3ESL A;  3L6A A;  3MKQ B;  4GCN A;  4GZC A;  4PS8 A;  4U8H A;  4AJW A;  3PH0 C;  4JW1 A;  4UWK A;  3G2W A;  3PE3 A;  5JJ6 A;  3LY8 A;  1ELW A;  2HM8 A;  3CGH A;  5FJY A;  4KXK B;  3S2A A;  3EIQ C;  3S7F A;  1MHQ A;  4DI3 A;  1NP7 A;  2WVI A;  3CHS A;  4UWF A;  4GA0 A;  4UI9 C;  3SZ7 A;  4JZY A;  2UWJ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...