3TGOA

Crystal structure of the e. coli bamcd complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
217
structure length
217
Chain Sequence
b'EVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0169 lipoprotein yfiO
publication title Crystal structure of the beta-barrel assembly machinery BamCD protein complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 91
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tgoA00
2UWJG 4G2VA 2R5SA 3CVQA 5G05J 3CKBA 4J8EA 1NA3A 3TGOA 3Q5MA 4B94A 3JYSA 1QZ2A 2C0LA 5ARFA 3S7JA 2VSNA 2IFUA 3BEEA 4BT9A 1P5QA 3PDNA 2VGXB 2KC7A 1B89A 2LSVA 3QWPA 4XI0A 4J0UA 3ZGQA 4WNEA 4WNGA 4EQFA 2Y4TA 2XGSA 5LCWC 4BTAA 4BWRA 1IYGA 4N3CA 3TG4A 3GYZA 4HORA 3CK9A 3CK7A 3GZ2A 4GZ3A 4I17A 4UI9K 5ARGA 4GA1A 3CKCA 2ONDA 4W9RA 2KCVA 4G26A 4JA7A 5KJLA 4UI9C 4RG9A 3KS2A 5G04C 3FFLA 4GYYA 4G25A 4GZ6A 4A1SA 4GZ5A 5A6CA 2XGOA 2KATA 4GYOA 5C1DA 3ZPJA 3UQ3A 3TAXA 4YVOA 3ZN3A 2Y4UA 4H7XA 2PQNA 1ZU2A 4Y6CA 4N2QA 1PC2A 2VGYA 4GYWA 3K9IA 2XCBA 5FZRA 3RIBA 5JJTA 3RU0A 4F3VA 4ME2A 3QOUA 2HYZA 4UQXA 3R9AB 4KBQA 4AY6A 5A7DB 4YVQC 4GA0A 2YHCA 2PQRA 3FP3A 3LY8A 4CDRA 2L6JA 5FTPA 3U4TA 1TJCA 4NRHB 4GCOA 5HQ8A 3Q47B 3UPVA 2FO7A 4J8DA 2LNIA 3QDNA 4HOTA 1NZNA 2FI7A 3S7BA 5CHEE 5CCMA 4U0SA 2XCCA 1NA0A 3Q15A 3RKVA 4U0ZA 1ELWA 4I1AA 4HOSA 4U04A 5KJMA 5G05C 3WXXA 5BNWA 1HZ4A 2E2EA 4I2WA 4U07A 3RO3A 4G24A 5JJ6A 3OXGA 5DBKA 3GZ1A 4UQZA 5EKQD 3MKRA 3RO2A 3TG5A 1E96B 3LPZA 3SZ7A 3SF4A 3PE3A 3ZHEA 4H7YA 2KCKA 3E4BA 2KCLA 3CV0A 2FBNA 1A17A 1IHGA 2VYIA 3IEGA 4I9EA 4XI9A 4ABNA 3OXFA 4J8FA 4NQ0A 3KAEA 4APOA 4GPKA 2IF4A 5FJYA 3LYAA 5FZSA 4AIFA 3ASDA 5BW8C 4BT8A 4CGVA 2JLBA 1WM5A 3ZHEB 4UQYA 3AS5A 3GW4A 1Y8MA 4I9CA 5CCLA 5AYWD 2PZIA 2LSUA 4N2SA 4WNFA 3CVLA 4JL0A 5DIZA 2XGMA 2OOEA 4YNDA 5D0QD 3ZFWA 3URZA 4N3BA 3ASHA 3CK8A 3CVPA 4WNDA 3OXLA 2Q7FA 4HOQA 4Y6WA 3LCAA 3PE4A 5KJKA 3CEQA 4KXKB 4N39A 3MV3B 3HYMB 2UY1A 1ELRA 3NF1A 1W3BA 4KYOB 3N71A 3MEKA 3ULQA 2MHKA 3QWVA 4BTBA 3Q4AB 3FWVA 5LCWJ 4XIFA 1KT0A 3VTYA 1KLXA 2C0MA 1YA0A 4N5CA 5KJNA 3RJVA 3U3WA 3UUXA 5FZQA 4LEUA 3CVNA 2UY1B 3AS8A 2VQ2A 4UI9J 1FCHA 4HOUA 5G04J 3VTXA 5M72A 2XEVA 2J9QA 4RG6A 1KT1A 4AY5A 2PL2A 5EX3A 2WQHA 2DBAA 3LY7A 3KD7A 5HI7A 2VSYA 2NC9A 2YQ8A 4I2ZA 5BT1A 2QFCA 3LKUA 2BUGA 2GW1A 3ASFA 5D0OD 4G23A 3MV2B 2WPVA 2P58C 1QQEA 3QWWA 5FT9A 4WUYA 4U0UA 3AS4A 3S7FA 4JA9A 5JJ7A 2FF4A 4AM9A 4GA2A 2FEZA 1HH8A 2C2LA 2V5FA 5EX0A 2XPIA 3O48A 4N3AA 2AVPA 2HO1A 3Q49B 3QKYA 3MA5A 4GCNA 1WAO1 1XNFA 4IN3B 1OUVA 3S7DA 3EDTB 4O6FA 3LY9A 4G1TA 2I6HA 3ESKA 4CGWA 2HR2A 3ASGA 1HXIA 1ZBPA 4JHRA 2VGXA
chains in the Genus database with same CATH superfamily
3PS6A 3IBEA 4U8VD 5G05J 5ENRD 4MRUA 3W9GA 5CEAA 5ARFA 3R9MA 3BG0B 3C3OA 4BT9A 3PDNA 3SD5A 1OXJA 2LSVA 1UN9A 2P9UG 4XI0A 3ZGQA 4WNGA 4EQFA 2BF0X 2YINA 5LCWC 3ZIMA 2WXLA 4BTAA 2LXMA 1IYGA 3FUMA 4N3CA 1E90A 3JCKC 5AQ9A 1WDYA 3EUVA 3GYZA 3CK9A 3GZ2A 4L2LA 3ZUVB 2KCVA 4G26A 4JA7A 3ONLA 1N4SA 2L0TB 4DI3A 2ZU6B 4GZ6A 1DVPA 4GYOA 5C1DA 5BUZA 3UQ3A 1LD7A 3WG7E 3DXKG 3IV0A 3CHRA 2X6JA 4CYMD 1ZU2A 1H2VC 1PC2A 2NXPA 3JUEA 3FTZA 3Q9NC 3LS8A 5FQ4A 5JJTA 3E32A 1BD8A 3ZW3A 4I1OB 3T5VA 3GZSA 1H0AA 2X6FA 5B1BE 4YVQC 5BPPA 1EYHA 2Y3AA 2PQRA 3NZUA 2XEEA 3TWTA 5FTPA 2LO6A 2R59A 5EILA 2XZTG 4XE0A 1YMPA 3Q9UC 3Q47B 3UPVA 4JHJA 2LNIA 4LNBA 3D9MA 1G3NB 1OWMA 3FU0A 4ANWA 3CVYA 4DRXE 2XCCA 3RKVA 4U0ZA 4HVBA 2PNNA 4Q69A 2X6IA 2WXMA 1IHBA 3NQPA 5G05C 1Z3XA 1HZ4A 4RSYA 3AAAC 3RO3A 2EIME 1O1TA 4G24A 3ZNGA 3IHVA 4XKBA 3NZSA 4CZ2D 1N9AA 4TXQA 3DRAA 3D9OA 4C9BB 3Q79A 5J90A 1TEZA 3HXFA 3E4BA 3ML9A 1UJKA 5T8IA 2YHEA 2FBNA 4K5AB 3PEUB 2VSXE 3ZXPA 3CSFA 3EIJA 4I9EA 4XI9A 3FTXA 3TWVA 2RG8A 2XS1A 4J8FA 4NQ0A 2ETBA 3KAEA 4APOA 2IF4A 3CQCB 2QY7A 3UI2A 3SFYA 5FZSA 3ASDA 3DPDA 1N4RA 3FUEA 5AQ7A 3ZHEB 3TWUA 3D3MA 3AS5A 4QFVA 3SGHA 2ZIRA 5CCLA 3L6AA 2PZIA 4GTSA 1QBQA 2GROB 3TJPA 2DZNA 3CVLA 4IYPA 3FDHA 5D66A 3BG1B 5DIZA 4DUIA 5D0QD 3PEVB 4N3BA 3ASHA 3FH8A 3ZVVA 3VLFA 3ONKA 4HOQA 4GMJA 2XRYA 4U95D 5EYPF 2WXRA 2HE0A 4ACKA 3CEQA 5AAOA 4IRUA 1S70B 4KXKB 4N39A 4MS6A 1ELRA 3MZLB 4FJYA 1AP7A 4ZHBA 3N71A 4I6EA 3QWVA 4BTBA 3EIQC 5J08A 5E76A 4XIFA 3U9WA 5BV1A 3VTYA 2GRQB 3MYVA 4B93B 1X81A 1GW6A 2XPYA 1VDYA 1YA0A 5KJNA 3TWWA 3AG4E 3X2QE 2UY1B 2VTBA 2VQ2A 3T9KA 2I2OA 1TN6A 4LERA 1FCHA 3TWQA 2XEVA 2J9QA 4RG6A 3ZYMA 3E34A 2V0PA 4TXRA 3J5QB 2DCPA 4DPRA 4ATZD 3LY7A 1MHQA 5HI7A 4I2ZA 2YQ8A 4A3TA 5BT1A 3P2BA 1H19A 4I43A 2WVIA 4F53A 3L08A 1QQEA 3QWWA 5FT9A 4A1GA 1JPLA 2GRPB 3RRUA 1K3ZD 4UWLA 3CVUA 5CERB 3ENEA 4WWNA 4GA2A 4Q96A 4TUUA 1HH8A 3FEYA 4GTTA 3MA5A 3EHMA 2V5QC 1XNFA 2IOLA 3S7DA 1ELKA 4G1TA 3D9HA 3T8KA 2XRZA 2HR2A 2ZGGA 4HI8A 4BERA 3BQOA 4G2VA 1V55E 4BX8A 2VJ8A 4F6RD 2IO3C 3TGOA 2LUHA 4J8YA 3KSLA 5JA4D 1BLXB 2P2CP 3C3QA 2V8SE 1BPOA 4BSZB 4TV3A 3S7JA 3UM2A 4PS7A 3L17A 5HKPA 5ANLA 2RD0A 4DX6D 1P5QA 2XS8A 2VGXB 4B0ZA 4HS2A 1EF1C 2Y1LE 3QWPA 5AENA 4HBDA 2FULA 4OVUA 1WY6A 3DSWA 3TG4A 1TYQG 2ZXWE 3UIOC 4GZ3A 4I17A 3HRAA 5AIJA 5EDSA 1JCQA 4GA1A 3UM1A 1JWFA 3G2VA 4X8QA 2ONDA 4ILIA 4AOFA 1BI8B 2WM9A 1MX4A 2IO2C 3FFLA 4GAAA 4GYYA 4L1BA 4G25A 3QAQA 4UWKA 3B7BA 2KATA 3PUKA 2AXUA 3TAXA 1K8KG 3E37A 3ZN3A 1E8XA 2Y4UA 3DSTA 4AV7A 1OWPA 4P29A 4Y6CA 3AG1E 4N2QA 3SHFA 4AEZC 4GYWA 2XCBA 3FUHA 2PM7A 3ULEG 2MYOA 4HLEA 3DBSA 1WG0A 3B13A 3DEPA 2OV8A 2AXZA 1TN8A 2AJAA 4HXIA 1OT8A 3U66A 4WWPA 4V3IA 3PZDA 3AU5A 3FP3A 1HS6A 3DSUA 2Y0BG 3U64A 1MZCA 4I6GA 3U4TA 3UKRG 1TJCA 2J07A 4NRHB 1NFIE 2P9IG 4A63B 1INZA 4I6JA 3L16A 3ISMC 1D8EA 4HOTA 2I1JA 5CRVA 1JCSA 3S7BA 5CCMA 4U0SA 1MQSA 3Q15A 3EHQA 3SFZA 1ELWA 1E8YA 1N4PA 2BTDA 4KVOA 5D2MC 2QYUA 1DCQA 3RSEG 3FUKA 3LXUX 1IQUA 2X6KA 3OXGA 1FVFA 2OEWA 4L9PA 5AN8A 5DBKA 1HFAA 3MKRA 3CIAA 1E96B 2IOSA 3LPZA 3ZYQA 1DC2A 3HIZA 3SF4A 3EHRA 1KPSB 3ZHEA 4TUMA 3F6QA 3EJNA 2DVWA 1FT1A 1TR4A 3DWLG 4F7AA 1SA4A 1A17A 3FH5A 4YDOA 2VYIA 3J5PA 3FULA 5FQ8A 5KNGA 2GRMA 4ATGA 5FQ7A 4C48B 3SBTB 3OXFA 5B3SE 4C0EA 4GPKA 4R7LA 4AP2A 3FTSA 3HG0D 1E7VA 2GRLA 1UW4B 4CGVA 5ANRA 3ZEFA 2I1KA 5T3RA 4DK5A 3FUDA 3GW4A 3FUIA 1Y8MA 4XZ4A 2GRNB 1N54A 1EPUA 2BKKB 3AG2E 1DCEA 5CEDB 3IKOB 3FTUA 1D8DA 3URZA 5LP0A 4B8CB 4WNDA 5E75A 3OXLA 2Q7FA 4HNAD 2L6BA 3L9TA 2F8XK 3MJWA 3FTVA 2WXNA 3AG3E 3D9LA 3NAWA 2EQXA 4BSXA 3Q7FA 4BETA 2X6HA 2UY1A 1L5JA 4CDNA 1W3BA 4KYOB 3Q78A 4HB5A 3TXMA 5G2NA 1JCRA 3Q4AB 4XKCA 2OEVA 3L13A 2R17C 4XEIG 3TWXA 3B7RL 2HM8A 2A4ZA 3RAUA 4WAFA 1TJFA 1Z6TA 3RJVA 1SZ9A 3U3WA 5FZQA 4J8SA 1HG2A 3G2TA 2EIJE 3D9IA 4FLHA 5EIBE 3AS8A 3B95A 2AWIA 4GTPA 2ILRA 3T5XA 4HI9A 3SI5A 4EECA 2ZGDA 2AW6A 1U3DA 3VTXA 5M72A 3SO8A 4AY5A 2JABA 2DBAA 4TXPA 4K03A 3LVRE 2DWZA 3KD7A 1U2VG 4PS3A 2VSYA 1MX2A 4UUCA 3KEAA 1Y6IA 4DX7D 4FULA 3C98A 3CGHA 2H6GA 1OCRE 3UM3A 4EZKA 1JUQA 5ENQD 2X38A 2P58C 5LX8A 3UKUG 3NOCD 4O1OA 2IEJA 3UXGA 3AS4A 1OCZE 5CMYA 1KZOA 4FC8A 1N52A 4URKA 1OY3D 1RZ4A 1XGWA 1E8ZA 1TNYA 4GZCA 2XPIA 4LUNU 3O48A 2HO1A 1SW6A 3EU5A 3QKYA 4GCNA 2J4BA 2WMNA 4L2YA 4IN3B 2EINE 4E6HA 1S0PA 3AU4A 1SZAA 1NP7A 1MYOA 4O6FA 3JXJA 4OYSA 4JW1A 1E8WA 3HDXA 3ASGA 1HXIA 1ZBPA 2VGXA 2KBXA 1H6PA 4J7WA 3RRMB 3D9JA 3DSSA 2R5SA 4Q94A 3CKBA 4J8EA 1NA3A 3I4RB 5EIDA 4B94A 2MRIA 1QZ2A 3SQVA 2CG3A 3DXMG 2VSNA 3BEEA 1FPPA 3ABLE 3APCA 3W9FA 4D10C 2RFAA 2VGEA 3ABKE 1B89A 3CHOA 2WXKA 2V4HC 3C5RA 4DX2A 4J0UA 3ML8A 2CG2A 4WNEA 3AJIA 1TN7A 2DYSE 2QYJA 3CHMA 2NYJA 3HXEA 4JEHA 4GZDA 3BUAA 1HF8A 2GGFA 1JWGA 3P1UA 3CHSA 3CHQA 3D9NA 4W9RA 4ANXA 3ULYA 4J6IA 3KS2A 3ASNE 1DNPA 2RFMA 2V4LA 3SNXA 4GZ5A 2XGOA 1X5BA 3ZPJA 2H6HA 2CHXA 4GTMA 4PDXA 2PQNA 5CECB 1FT2A 5LOZA 3K9IA 3CVWA 1N4QA 4K0RA 5FZRA 3CLJA 3RIBA 3CVVA 4B89A 4F3VA 1N0QA 3C3RA 2HYZA 4UQXA 4KBQA 2WXIA 4AY6A 2WXFA 4IULA 1UOHA 3LY8A 1MX6A 4CDRA 4EHMA 2L6JA 1N95A 5JHAA 4DLQA 1SVXA 2DYRE 3TXNA 2KZTB 5HS0A 3ZYKA 3QDNA 3UX4A 4XX5A 2F37A 5CHEE 5ITZF 5FWQA 4FADA 1PAQA 1NA0A 4M7CA 1OWOA 4F1SA 4HOSA 3EU9A 4ILGA 3UT7A 3DPYA 5ENPD 5BNWA 4GTQA 3UT4A 1V54E 4I2WA 4U07A 2XZDG 3QK0A 5C2YA 1QNFA 3Q73A 1SQMA 5G55A 2ETCA 3D9KA 1H2UA 5EKQD 3RO2A 1HU3A 3UIPC 2VSOE 3Q75A 3ABME 5BXOA 3SZ7A 2ZISA 1YCSB 3APDA 2DIWA 3PE3A 2OCCE 2KCKA 2FO1E 3L22A 3TWSA 3HXDA 1QYMA 2CFUA 5HRYA 1IHGA 3FHEA 2I9CA 5CMWA 5LFAA 3V30A 5JMND 2P9PG 4JEUA 3SFXA 4ABNA 3FU3A 4N5QA 2WXGA 4G8LA 4DLOA 1IQRA 3LYAA 5AJDA 5B1AE 2CHZA 3MKQB 2P9SG 1WM5A 3T8MA 2P9LG 4I9CA 4HRNA 1IKND 3UINC 4N2SA 3PNTB 2IQCA 1S64A 1H6OA 4WNFA 2X3MA 3HXBA 1FVHA 1OWLA 2XGMA 2OOEA 3JQ0A 3ZFWA 4BESA 5EYLA 4K5CA 2WQ6A 4ANVA 4HQDA 1D9SA 5KWDA 2IONA 3PE4A 2QC9A 1O5MA 3QARA 4GTVA 4M3OA 1Z3YA 3LDZA 2NSZA 3MEKA 3ULQA 4JZYA 2MHKA 2KM4A 2B0OE 3CR3A 3FWVA 5ENOD 2LXLA 3S2AA 2J09A 2WXPA 3QNKA 1KT0A 2L9BA 4OAVB 3NB2A 4AJWA 4N5CA 3UUXA 4U8HA 2IY0C 3CVNA 4BY6A 1NL4A 4KVMA 2J8SD 4O60A 4UI9J 2DZOA 5G04J 2E0IA 4U7EB 5AJLA 4YDWA 1KT1A 4CEMA 5BXUA 2PL2A 2WQHA 2WXOA 3ZKJA 3PZ2A 4FJZA 3FTYA 2LAHA 1TNBA 5CRUA 4ZFHA 3O4ZA 2QFCA 5KNHD 2BUGA 2PM6A 4Z68A 2GRRB 5D0OD 4G23A 4DX1A 3MV2B 4UWHA 2WPVA 3KSQA 3G2SA 1UG3A 4WUYA 1E7UA 3ASOE 3S7FA 3G2WA 1Z5SC 5JJ7A 1TNOA 3PZ3A 3JUIA 1LF8A 4AM9A 5KCMA 3V2OA 3TWRA 3DEOA 3B7TA 2FEZA 3TL5A 1A5EA 4LNGA 5EX0A 2Y69E 1PY1A 3E30A 2AVPA 3HVEB 4HRMB 1HX8A 3IHYA 1MJ0A 5IY5E 3EDTB 2M63A 3LY9A 4WWOA 3ZXSA 2EIKE 4PH4B 4CGWA 4L7TA 3DSXA 3VLDA 5EN5D 1NI1A 2UWJG 3LJ3A 3QB2A 4U63A 4ANUA 1BI7B 4AVXA 3CVQA 1N0RA 2F8YA 3ZRHA 5AQAA 3PZ1A 3Q5MA 3JYSA 2C0LA 2WQ7A 1S63A 2J08A 2IFUA 5AQBA 1K1BA 2CFZA 4LRZA 4RLYA 2KC7A 2A5UA 1YYHA 4GPMA 2R2LA 3I5PA 2Y4TA 2XGSA 4EBAA 2B6CA 3MGBA 4BWRA 2QZAA 1TNZA 2YNQA 5FQ6A 2F0YA 4BX9A 2AXVA 4PS8A 5BV0A 4HORA 5KBAA 3CK7A 3SY2A 2R02A 3G2UA 4JHKA 4UI9K 5ARGA 4FHKA 4JB8P 3CSTA 1H2TC 3CKCA 4CCAA 3FUFA 2H6FA 5KJLA 4UI9C 3ESLA 4RG9A 4JPSA 5G04C 2BEDA 3NOGD 3V79K 4A1SA 5A6CA 2WMOA 3LJNA 1UN8A 4L23A 4YVOA 4NIKA 4HRLA 1HE8A 3I3NA 4H7XA 2VGYA 3I4GA 3SBSA 5FIOA 2KZTA 3RU0A 4B8AA 5CBNA 4ME2A 4JVSA 3QOUA 2XHEA 2CHWA 4ACLA 3R9AB 3BU8A 4KT6B 4APFA 5A7DB 3HXCA 3PRZA 4GA0A 2YHCA 1AWCB 3V31A 5AARA 2WXJA 3L82A 5FINA 3FH7A 4LCTA 3B7SA 1SA5A 4GCOA 5HQ8A 4I1MA 2JEKA 4U96D 2FO7A 4J8DA 4GTOA 4FLBA 2P9NG 2J4DA 1NZNA 1KZPA 2FI7A 4MKTA 2WXHA 4HFGA 3QJZA 4MLPA 4I1AA 4TRQA 3NBNB 1OWNA 4U04A 2KXPC 5KJMA 3WXXA 2E2EA 2L0IA 3HHMA 4FP7A 5H7PA 1N94A 4E85A 1OCCE 5JJ6A 4CRWA 3PNLB 4AXHA 3GZ1A 4UQZA 2R05A 3TG5A 3C72A 3PVLA 3MKQA 4H7YA 3FY4A 4OVVA 2WB2A 4BEPA 2KCLA 3CV0A 4DI4A 3FEXA 3FTWA 4JD2G 4KZCA 3IEGA 4LNUD 4O1PA 5CBOA 5FJYA 4GMLA 4RVBA 4YDYA 4AIFA 4G8KA 4UWFA 5BW8C 3LEWA 4BT8A 4EBAG 3OAWA 2RKKA 2JLBA 4K5BA 4F1PA 4UQYA 3IXEA 4NURA 4CDMA 3JXIA 3OTNA 5AYWD 4EZJA 2LSUA 3MCXA 3PUJA 3JQ1A 2OVFA 3R7QA 3B7UX 4YDEA 4JL0A 2P9KG 2XENA 3ZYLA 3Q7AA 1TNUA 4YNDA 4FA6A 2XPZA 4ILHB 3CK8A 4GMRA 3CVPA 3APFA 1OCOE 3D9PA 2OVBA 4GTRA 3R7RA 4Y6WA 4A3VA 1K1AA 3LCAA 4JC8A 4A55A 5KJKA 4EZLA 3MV3B 3HYMB 2MOWA 3NF1A 4U8YD 5A23A 2H6IA 2BKGA 1O1SA 1HO8A 3KEZA 5LCWJ 1Q2ZA 4MBGA 3LVQE 2XQ0A 4GB9A 1HG5A 3FU5A 4JXTA 5ENNA 4DJAA 3CQGB 3PH0C 4DX5D 3QC1A 1KLXA 4NACA 3CHPA 3FUNA 2C0MA 1U3CA 1RW2A 1LTXA 4LEUA 2R03A 4OAUC 5ENTD 3L54A 1N11A 2EILE 3UMVA 4HOUA 4CT0A 2ETAA 5EX3A 4BFRA 4RQIA 3DSVA 4HLLA 3RK6A 3PZ4A 3HVEA 2NC9A 1LD8A 1EDUA 4UWGA 5ENSD 4FU3A 3LKUA 2GW1A 3EHNA 3ASFA 1UJJA 3VLEA 2VTBB 4GU5A 2LAIA 2XEHA 1H6KA 4U0UA 4KMOA 4JA9A 4LSZE 4CT4A 3PREA 3V2XA 2FF4A 3UM0A 4QQIA 3CVXA 2J49A 2WXQA 4FHJA 1O1RA 4C0MA 2C2LA 2V5FA 3ZU7B 4N3AA 3FU6A 3Q49B 1BU9A 3FUJA 1WAO1 3MX3A 2IJGX 1OUVA 3RRNB 4KZ0A 1ZB1A 1IXVA 5T4YA 2IU1A 2I6HA 3UTMA 3ESKA 4EPZA 4PUCA 5JHBA 2A5EA 3E33A 3UT8A 4JHRA 4G11A 4LG6A
chains in the Genus database with same CATH topology
3PS6A 3VLDA 3RRMB 2UWJG 3LJ3A 3D9JA 3QB2A 4G2VA 4U63A 4ANUA 2R5SA 3IBEA 4BX8A 4AVXA 4Q94A 3CVQA 5G05J 3CKBA 4J8EA 2VJ8A 1NA3A 3I4RB 4MRUA 3TGOA 3ZRHA 3Q5MA 4B94A 2V8SE 1BPOA 3JYSA 4TV3A 2MRIA 1QZ2A 2C0LA 5ARFA 2CG3A 3S7JA 2WQ7A 2J08A 4PS7A 2VSNA 2IFUA 3BG0B 3L17A 3BEEA 4BT9A 5ANLA 2RD0A 3APCA 1P5QA 4D10C 2CFZA 4LRZA 3PDNA 2VGXB 3SD5A 4B0ZA 2KC7A 1B89A 4HS2A 1EF1C 2A5UA 3CHOA 2LSVA 1UN9A 2WXKA 3QWPA 4XI0A 5AENA 4J0UA 3ZGQA 3ML8A 2CG2A 4WNEA 3I5PA 4WNGA 2Y4TA 4EQFA 2BF0X 2XGSA 2YINA 4EBAA 5LCWC 3ZIMA 2WXLA 3MGBA 4BTAA 4BWRA 1IYGA 2FULA 2YNQA 3FUMA 4OVUA 4N3CA 1E90A 5FQ6A 1WY6A 3JCKC 3CHMA 3TG4A 4BX9A 2AXVA 4JEHA 4PS8A 4GZDA 3GYZA 5BV0A 4HORA 3CK9A 3CK7A 1HF8A 3GZ2A 4GZ3A 2GGFA 4I17A 1JWGA 3P1UA 4L2LA 3CHSA 5AIJA 3G2UA 4JHKA 4UI9K 5ARGA 4GA1A 5EDSA 4FHKA 3CSTA 1H2TC 1JWFA 3CHQA 3CKCA 3G2VA 2ONDA 3D9NA 4ILIA 4W9RA 4AOFA 4ANXA 4CCAA 3FUFA 2WM9A 2KCVA 4G26A 4JA7A 4J6IA 5KJLA 4UI9C 3ESLA 4RG9A 3KS2A 3ONLA 4JPSA 5G04C 3FFLA 4GAAA 4GYYA 1DNPA 4L1BA 2V4LA 2L0TB 4G25A 3QAQA 2ZU6B 3SNXA 4DI3A 4GZ6A 4UWKA 4A1SA 1DVPA 4GZ5A 5A6CA 2XGOA 2KATA 1X5BA 3PUKA 4GYOA 2AXUA 5C1DA 2WMOA 3ZPJA 3UQ3A 3TAXA 5BUZA 1UN8A 4L23A 2CHXA 3IV0A 4YVOA 1HE8A 3ZN3A 1E8XA 2Y4UA 4AV7A 4PDXA 3I3NA 1OWPA 3CHRA 4H7XA 4P29A 2X6JA 2PQNA 1ZU2A 4Y6CA 4N2QA 1H2VC 3SHFA 1PC2A 2VGYA 4GYWA 3I4GA 3K9IA 5LOZA 2NXPA 4AEZC 3CVWA 2XCBA 4K0RA 3FTZA 5FZRA 3FUHA 2PM7A 3CLJA 3SBSA 3RIBA 3LS8A 5FQ4A 5JJTA 2KZTA 4HLEA 3RU0A 3CVVA 3DBSA 4B8AA 4B89A 3ZW3A 3B13A 4F3VA 4ME2A 2OV8A 2AXZA 4JVSA 3QOUA 4I1OB 2HYZA 2XHEA 2CHWA 4UQXA 4ACLA 3R9AB 3T5VA 3GZSA 4KBQA 2WXIA 1H0AA 4AY6A 2X6FA 4HXIA 3U66A 4KT6B 2WXFA 4WWPA 4APFA 4IULA 5A7DB 4V3IA 4YVQC 5BPPA 3PZDA 3AU5A 1EYHA 3PRZA 4GA0A 2YHCA 2Y3AA 2PQRA 3FP3A 1HS6A 3LY8A 3NZUA 4CDRA 2WXJA 2L6JA 5FTPA 3FH7A 4LCTA 3U64A 3B7SA 4I6GA 2LO6A 2R59A 5JHAA 3U4TA 4DLQA 4XE0A 1TJCA 2J07A 4NRHB 4GCOA 5HQ8A 1INZA 3TXNA 4I6JA 4I1MA 2JEKA 3L16A 3Q47B 3UPVA 2KZTB 4JHJA 2FO7A 4J8DA 2LNIA 3ZYKA 4FLBA 2J4DA 3QDNA 4HOTA 2I1JA 3D9MA 1NZNA 1OWMA 3FU0A 2FI7A 4MKTA 3UX4A 4XX5A 3S7BA 4ANWA 2WXHA 4HFGA 5CHEE 5CCMA 4U0SA 3CVYA 2XCCA 1MQSA 5FWQA 4FADA 1PAQA 1NA0A 3Q15A 3QJZA 4MLPA 4U0ZA 3RKVA 4HVBA 1OWOA 3SFZA 4F1SA 1ELWA 4I1AA 4HOSA 4Q69A 2X6IA 2WXMA 4ILGA 4TRQA 3UT7A 1OWNA 4U04A 1E8YA 3NQPA 2BTDA 5KJMA 5G05C 1Z3XA 3WXXA 1HZ4A 4KVOA 5BNWA 4RSYA 3UT4A 2E2EA 2L0IA 3HHMA 4I2WA 4U07A 4FP7A 3FUKA 3RO3A 3QK0A 3LXUX 5C2YA 4E85A 1QNFA 4G24A 5JJ6A 1IQUA 2X6KA 1SQMA 3OXGA 4CRWA 1FVFA 5G55A 3PNLB 3IHVA 4XKBA 4AXHA 5DBKA 3NZSA 1HFAA 3D9KA 1H2UA 3GZ1A 4UQZA 5EKQD 3MKRA 3RO2A 1HU3A 2VSOE 3TG5A 3CIAA 1E96B 2IOSA 3LPZA 3SZ7A 3APDA 3ZYQA 2DIWA 3PVLA 3HIZA 3SF4A 3MKQA 3D9OA 4C9BB 3PE3A 5J90A 3ZHEA 4H7YA 1TEZA 2KCKA 3EJNA 3FY4A 3L22A 4OVVA 3E4BA 3ML9A 2WB2A 2KCLA 1UJKA 3CV0A 5T8IA 2YHEA 4DI4A 3FEXA 2FBNA 4F7AA 1A17A 3FTWA 3PEUB 2CFUA 1IHGA 3FHEA 3FH5A 2I9CA 2VSXE 5CMWA 2VYIA 3CSFA 4KZCA 3IEGA 3EIJA 4I9EA 4XI9A 5LFAA 3FTXA 3FULA 5FQ8A 2GRMA 4ATGA 2RG8A 4JEUA 5FQ7A 4ABNA 3FU3A 3SBTB 3OXFA 4J8FA 2WXGA 4C0EA 4NQ0A 3KAEA 4APOA 4GPKA 4R7LA 4AP2A 2IF4A 3CQCB 3FTSA 1IQRA 4DLOA 2QY7A 5FJYA 3LYAA 4GMLA 4RVBA 5FZSA 1E7VA 2GRLA 4AIFA 5AJDA 3ASDA 4UWFA 3DPDA 1UW4B 2CHZA 5BW8C 3LEWA 3FUEA 4BT8A 4EBAG 3OAWA 3MKQB 4CGVA 2JLBA 5ANRA 1WM5A 3T8MA 3ZHEB 3ZEFA 4UQYA 2I1KA 3D3MA 3AS5A 5T3RA 4DK5A 3FUDA 4QFVA 3GW4A 3FUIA 4NURA 3SGHA 4CDMA 1Y8MA 3OTNA 4I9CA 5CCLA 3L6AA 4XZ4A 5AYWD 2PZIA 4EZJA 2LSUA 4N2SA 3MCXA 3PUJA 1N54A 1EPUA 3PNTB 2IQCA 3JQ1A 3TJPA 4WNFA 3CVLA 2OVFA 2X3MA 4IYPA 3R7QA 3FDHA 3BG1B 3B7UX 4JL0A 5DIZA 1FVHA 1OWLA 2XGMA 3ZYLA 2OOEA 3IKOB 3JQ0A 4YNDA 3FTUA 5D0QD 3ZFWA 3URZA 4FA6A 2XPZA 3PEVB 4ILHB 3ASHA 4N3BA 5LP0A 3CK8A 4B8CB 3CVPA 3FH8A 2WQ6A 3APFA 3VLFA 3ZVVA 4WNDA 5E75A 3OXLA 3ONKA 4ANVA 2Q7FA 4HOQA 3D9PA 2OVBA 4GMJA 2XRYA 3R7RA 4Y6WA 4A3VA 3LCAA 4JC8A 2IONA 3MJWA 3FTVA 2WXNA 3D9LA 3PE4A 2WXRA 4A55A 2EQXA 5KJKA 4BSXA 3QARA 4ACKA 3CEQA 4IRUA 4KXKB 4EZLA 2X6HA 4N39A 3MV3B 4MS6A 4M3OA 3HYMB 2UY1A 1L5JA 1ELRA 2MOWA 4CDNA 3NF1A 3MZLB 4FJYA 1W3BA 1Z3YA 4KYOB 5A23A 3LDZA 2NSZA 3MEKA 3N71A 3ULQA 3TXMA 4I6EA 4JZYA 5G2NA 2MHKA 2KM4A 3QWVA 4BTBA 3Q4AB 4XKCA 3CR3A 1HO8A 3EIQC 3FWVA 3KEZA 3L13A 3S2AA 5LCWJ 5J08A 2J09A 3LVQE 2XQ0A 4GB9A 1HG5A 2R17C 2WXPA 3FU5A 4JXTA 4XIFA 5E76A 3QNKA 3CQGB 5ENNA 3U9WA 3PH0C 5BV1A 1KT0A 3QC1A 3VTYA 1KLXA 4NACA 2L9BA 3CHPA 3B7RL 3FUNA 2C0MA 1U3CA 2HM8A 2A4ZA 3MYVA 1GW6A 4WAFA 1TJFA 1VDYA 2XPYA 1YA0A 4AJWA 4N5CA 5KJNA 1Z6TA 3RJVA 1SZ9A 3U3WA 3UUXA 4U8HA 4LEUA 3CVNA 5FZQA 4J8SA 4BY6A 1HG2A 3G2TA 3D9IA 4FLHA 2UY1B 3AS8A 2VTBA 4KVMA 2VQ2A 2AWIA 2ILRA 2I2OA 3L54A 3T5XA 4UI9J 4LERA 1FCHA 3UMVA 4HOUA 3SI5A 5G04J 4EECA 2AW6A 1U3DA 3VTXA 2E0IA 5M72A 2XEVA 2J9QA 4RG6A 5AJLA 3ZYMA 1KT1A 4AY5A 4CEMA 4CT0A 2V0PA 2PL2A 5EX3A 2WQHA 4BFRA 2DCPA 2WXOA 2DBAA 4FJZA 4K03A 4DPRA 3FTYA 3LVRE 2LAHA 3LY7A 4DJAA 3KD7A 1MHQA 3RK6A 4PS3A 5HI7A 2VSYA 3HVEA 2NC9A 2YQ8A 1Y6IA 4I2ZA 1EDUA 4FULA 3C98A 4UWGA 4A3TA 3P2BA 3CGHA 1H19A 3O4ZA 5BT1A 2QFCA 4FU3A 4I43A 2WVIA 3LKUA 2BUGA 4EZKA 2PM6A 2GW1A 3EHNA 3ASFA 5D0OD 4G23A 1UJJA 1JUQA 3MV2B 3VLEA 4F53A 2VTBB 4UWHA 4GU5A 2WPVA 2X38A 2LAIA 2P58C 5LX8A 3L08A 3G2SA 1QQEA 3QWWA 1H6KA 5FT9A 1UG3A 4WUYA 4A1GA 4U0UA 3AS4A 1E7UA 3G2WA 4KMOA 4JA9A 5CMYA 3S7FA 4CT4A 1JPLA 4FC8A 1N52A 3PREA 5JJ7A 2FF4A 3RRUA 3CVXA 4URKA 4UWLA 3CVUA 3JUIA 1LF8A 4AM9A 3ENEA 2J49A 2WXQA 4WWNA 5KCMA 1XGWA 1E8ZA 4GA2A 4Q96A 3B7TA 4FHJA 2FEZA 4TUUA 4GZCA 4C0MA 1HH8A 2C2LA 2V5FA 3TL5A 3FEYA 5EX0A 2XPIA 4LUNU 3O48A 1PY1A 3FU6A 2AVPA 3HVEB 2HO1A 3Q49B 4N3AA 3QKYA 3MA5A 1HX8A 3FUJA 3EHMA 4GCNA 3IHYA 1WAO1 2J4BA 3MX3A 1XNFA 2WMNA 4L2YA 4IN3B 2IJGX 2IOLA 1OUVA 3RRNB 3S7DA 3EDTB 1S0PA 4E6HA 3AU4A 4KZ0A 1ELKA 1NP7A 1SZAA 4O6FA 2M63A 3LY9A 4OYSA 4WWOA 5T4YA 3ZXSA 4JW1A 2IU1A 4G1TA 2I6HA 3ESKA 4EPZA 1E8WA 4PH4B 4CGWA 3HDXA 4L7TA 2XRZA 4PUCA 5JHBA 2HR2A 3ASGA 3UT8A 1HXIA 1ZBPA 4JHRA 2VGXA 4G11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWJ G;  4G2V A;  2R5S A;  3CVQ A;  5G05 J;  3CKB A;  4J8E A;  1NA3 A;  3TGO A;  3Q5M A;  4B94 A;  3JYS A;  1QZ2 A;  2C0L A;  5ARF A;  3S7J A;  2VSN A;  2IFU A;  3BEE A;  4BT9 A;  1P5Q A;  3PDN A;  2VGX B;  2KC7 A;  1B89 A;  2LSV A;  3QWP A;  4XI0 A;  4J0U A;  3ZGQ A;  4WNE A;  4WNG A;  4EQF A;  2Y4T A;  2XGS A;  5LCW C;  4BTA A;  4BWR A;  1IYG A;  4N3C A;  3TG4 A;  3GYZ A;  4HOR A;  3CK9 A;  3CK7 A;  3GZ2 A;  4GZ3 A;  4I17 A;  4UI9 K;  5ARG A;  4GA1 A;  3CKC A;  2OND A;  4W9R A;  2KCV A;  4G26 A;  4JA7 A;  5KJL A;  4UI9 C;  4RG9 A;  3KS2 A;  5G04 C;  3FFL A;  4GYY A;  4G25 A;  4GZ6 A;  4A1S A;  4GZ5 A;  5A6C A;  2XGO A;  2KAT A;  4GYO A;  5C1D A;  3ZPJ A;  3UQ3 A;  3TAX A;  4YVO A;  3ZN3 A;  2Y4U A;  4H7X A;  2PQN A;  1ZU2 A;  4Y6C A;  4N2Q A;  1PC2 A;  2VGY A;  4GYW A;  3K9I A;  2XCB A;  5FZR A;  3RIB A;  5JJT A;  3RU0 A;  4F3V A;  4ME2 A;  3QOU A;  2HYZ A;  4UQX A;  3R9A B;  4KBQ A;  4AY6 A;  5A7D B;  4YVQ C;  4GA0 A;  2YHC A;  2PQR A;  3FP3 A;  3LY8 A;  4CDR A;  2L6J A;  5FTP A;  3U4T A;  1TJC A;  4NRH B;  4GCO A;  5HQ8 A;  3Q47 B;  3UPV A;  2FO7 A;  4J8D A;  2LNI A;  3QDN A;  4HOT A;  1NZN A;  2FI7 A;  3S7B A;  5CHE E;  5CCM A;  4U0S A;  2XCC A;  1NA0 A;  3Q15 A;  3RKV A;  4U0Z A;  1ELW A;  4I1A A;  4HOS A;  4U04 A;  5KJM A;  5G05 C;  3WXX A;  5BNW A;  1HZ4 A;  2E2E A;  4I2W A;  4U07 A;  3RO3 A;  4G24 A;  5JJ6 A;  3OXG A;  5DBK A;  3GZ1 A;  4UQZ A;  5EKQ D;  3MKR A;  3RO2 A;  3TG5 A;  1E96 B;  3LPZ A;  3SZ7 A;  3SF4 A;  3PE3 A;  3ZHE A;  4H7Y A;  2KCK A;  3E4B A;  2KCL A;  3CV0 A;  2FBN A;  1A17 A;  1IHG A;  2VYI A;  3IEG A;  4I9E A;  4XI9 A;  4ABN A;  3OXF A;  4J8F A;  4NQ0 A;  3KAE A;  4APO A;  4GPK A;  2IF4 A;  5FJY A;  3LYA A;  5FZS A;  4AIF A;  3ASD A;  5BW8 C;  4BT8 A;  4CGV A;  2JLB A;  1WM5 A;  3ZHE B;  4UQY A;  3AS5 A;  3GW4 A;  1Y8M A;  4I9C A;  5CCL A;  5AYW D;  2PZI A;  2LSU A;  4N2S A;  4WNF A;  3CVL A;  4JL0 A;  5DIZ A;  2XGM A;  2OOE A;  4YND A;  5D0Q D;  3ZFW A;  3URZ A;  4N3B A;  3ASH A;  3CK8 A;  3CVP A;  4WND A;  3OXL A;  2Q7F A;  4HOQ A;  4Y6W A;  3LCA A;  3PE4 A;  5KJK A;  3CEQ A;  4KXK B;  4N39 A;  3MV3 B;  3HYM B;  2UY1 A;  1ELR A;  3NF1 A;  1W3B A;  4KYO B;  3N71 A;  3MEK A;  3ULQ A;  2MHK A;  3QWV A;  4BTB A;  3Q4A B;  3FWV A;  5LCW J;  4XIF A;  1KT0 A;  3VTY A;  1KLX A;  2C0M A;  1YA0 A;  4N5C A;  5KJN A;  3RJV A;  3U3W A;  3UUX A;  5FZQ A;  4LEU A;  3CVN A;  2UY1 B;  3AS8 A;  2VQ2 A;  4UI9 J;  1FCH A;  4HOU A;  5G04 J;  3VTX A;  5M72 A;  2XEV A;  2J9Q A;  4RG6 A;  1KT1 A;  4AY5 A;  2PL2 A;  5EX3 A;  2WQH A;  2DBA A;  3LY7 A;  3KD7 A;  5HI7 A;  2VSY A;  2NC9 A;  2YQ8 A;  4I2Z A;  5BT1 A;  2QFC A;  3LKU A;  2BUG A;  2GW1 A;  3ASF A;  5D0O D;  4G23 A;  3MV2 B;  2WPV A;  2P58 C;  1QQE A;  3QWW A;  5FT9 A;  4WUY A;  4U0U A;  3AS4 A;  3S7F A;  4JA9 A;  5JJ7 A;  2FF4 A;  4AM9 A;  4GA2 A;  2FEZ A;  1HH8 A;  2C2L A;  2V5F A;  5EX0 A;  2XPI A;  3O48 A;  4N3A A;  2AVP A;  2HO1 A;  3Q49 B;  3QKY A;  3MA5 A;  4GCN A;  1WAO 1;  1XNF A;  4IN3 B;  1OUV A;  3S7D A;  3EDT B;  4O6F A;  3LY9 A;  4G1T A;  2I6H A;  3ESK A;  4CGW A;  2HR2 A;  3ASG A;  1HXI A;  1ZBP A;  4JHR A;  2VGX A; 
#chains in the Genus database with same CATH topology
 3PS6 A;  3IBE A;  4U8V D;  5G05 J;  5ENR D;  4MRU A;  3W9G A;  5CEA A;  5ARF A;  3R9M A;  3BG0 B;  3C3O A;  4BT9 A;  3PDN A;  3SD5 A;  1OXJ A;  2LSV A;  1UN9 A;  2P9U G;  4XI0 A;  3ZGQ A;  4WNG A;  4EQF A;  2BF0 X;  2YIN A;  5LCW C;  3ZIM A;  2WXL A;  4BTA A;  2LXM A;  1IYG A;  3FUM A;  4N3C A;  1E90 A;  3JCK C;  5AQ9 A;  1WDY A;  3EUV A;  3GYZ A;  3CK9 A;  3GZ2 A;  4L2L A;  3ZUV B;  2KCV A;  4G26 A;  4JA7 A;  3ONL A;  1N4S A;  2L0T B;  4DI3 A;  2ZU6 B;  4GZ6 A;  1DVP A;  4GYO A;  5C1D A;  5BUZ A;  3UQ3 A;  1LD7 A;  3WG7 E;  3DXK G;  3IV0 A;  3CHR A;  2X6J A;  4CYM D;  1ZU2 A;  1H2V C;  1PC2 A;  2NXP A;  3JUE A;  3FTZ A;  3Q9N C;  3LS8 A;  5FQ4 A;  5JJT A;  3E32 A;  1BD8 A;  3ZW3 A;  4I1O B;  3T5V A;  3GZS A;  1H0A A;  2X6F A;  5B1B E;  4YVQ C;  5BPP A;  1EYH A;  2Y3A A;  2PQR A;  3NZU A;  2XEE A;  3TWT A;  5FTP A;  2LO6 A;  2R59 A;  5EIL A;  2XZT G;  4XE0 A;  1YMP A;  3Q9U C;  3Q47 B;  3UPV A;  4JHJ A;  2LNI A;  4LNB A;  3D9M A;  1G3N B;  1OWM A;  3FU0 A;  4ANW A;  3CVY A;  4DRX E;  2XCC A;  3RKV A;  4U0Z A;  4HVB A;  2PNN A;  4Q69 A;  2X6I A;  2WXM A;  1IHB A;  3NQP A;  5G05 C;  1Z3X A;  1HZ4 A;  4RSY A;  3AAA C;  3RO3 A;  2EIM E;  1O1T A;  4G24 A;  3ZNG A;  3IHV A;  4XKB A;  3NZS A;  4CZ2 D;  1N9A A;  4TXQ A;  3DRA A;  3D9O A;  4C9B B;  3Q79 A;  5J90 A;  1TEZ A;  3HXF A;  3E4B A;  3ML9 A;  1UJK A;  5T8I A;  2YHE A;  2FBN A;  4K5A B;  3PEU B;  2VSX E;  3ZXP A;  3CSF A;  3EIJ A;  4I9E A;  4XI9 A;  3FTX A;  3TWV A;  2RG8 A;  2XS1 A;  4J8F A;  4NQ0 A;  2ETB A;  3KAE A;  4APO A;  2IF4 A;  3CQC B;  2QY7 A;  3UI2 A;  3SFY A;  5FZS A;  3ASD A;  3DPD A;  1N4R A;  3FUE A;  5AQ7 A;  3ZHE B;  3TWU A;  3D3M A;  3AS5 A;  4QFV A;  3SGH A;  2ZIR A;  5CCL A;  3L6A A;  2PZI A;  4GTS A;  1QBQ A;  2GRO B;  3TJP A;  2DZN A;  3CVL A;  4IYP A;  3FDH A;  5D66 A;  3BG1 B;  5DIZ A;  4DUI A;  5D0Q D;  3PEV B;  4N3B A;  3ASH A;  3FH8 A;  3ZVV A;  3VLF A;  3ONK A;  4HOQ A;  4GMJ A;  2XRY A;  4U95 D;  5EYP F;  2WXR A;  2HE0 A;  4ACK A;  3CEQ A;  5AAO A;  4IRU A;  1S70 B;  4KXK B;  4N39 A;  4MS6 A;  1ELR A;  3MZL B;  4FJY A;  1AP7 A;  4ZHB A;  3N71 A;  4I6E A;  3QWV A;  4BTB A;  3EIQ C;  5J08 A;  5E76 A;  4XIF A;  3U9W A;  5BV1 A;  3VTY A;  2GRQ B;  3MYV A;  4B93 B;  1X81 A;  1GW6 A;  2XPY A;  1VDY A;  1YA0 A;  5KJN A;  3TWW A;  3AG4 E;  3X2Q E;  2UY1 B;  2VTB A;  2VQ2 A;  3T9K A;  2I2O A;  1TN6 A;  4LER A;  1FCH A;  3TWQ A;  2XEV A;  2J9Q A;  4RG6 A;  3ZYM A;  3E34 A;  2V0P A;  4TXR A;  3J5Q B;  2DCP A;  4DPR A;  4ATZ D;  3LY7 A;  1MHQ A;  5HI7 A;  4I2Z A;  2YQ8 A;  4A3T A;  5BT1 A;  3P2B A;  1H19 A;  4I43 A;  2WVI A;  4F53 A;  3L08 A;  1QQE A;  3QWW A;  5FT9 A;  4A1G A;  1JPL A;  2GRP B;  3RRU A;  1K3Z D;  4UWL A;  3CVU A;  5CER B;  3ENE A;  4WWN A;  4GA2 A;  4Q96 A;  4TUU A;  1HH8 A;  3FEY A;  4GTT A;  3MA5 A;  3EHM A;  2V5Q C;  1XNF A;  2IOL A;  3S7D A;  1ELK A;  4G1T A;  3D9H A;  3T8K A;  2XRZ A;  2HR2 A;  2ZGG A;  4HI8 A;  4BER A;  3BQO A;  4G2V A;  1V55 E;  4BX8 A;  2VJ8 A;  4F6R D;  2IO3 C;  3TGO A;  2LUH A;  4J8Y A;  3KSL A;  5JA4 D;  1BLX B;  2P2C P;  3C3Q A;  2V8S E;  1BPO A;  4BSZ B;  4TV3 A;  3S7J A;  3UM2 A;  4PS7 A;  3L17 A;  5HKP A;  5ANL A;  2RD0 A;  4DX6 D;  1P5Q A;  2XS8 A;  2VGX B;  4B0Z A;  4HS2 A;  1EF1 C;  2Y1L E;  3QWP A;  5AEN A;  4HBD A;  2FUL A;  4OVU A;  1WY6 A;  3DSW A;  3TG4 A;  1TYQ G;  2ZXW E;  3UIO C;  4GZ3 A;  4I17 A;  3HRA A;  5AIJ A;  5EDS A;  1JCQ A;  4GA1 A;  3UM1 A;  1JWF A;  3G2V A;  4X8Q A;  2OND A;  4ILI A;  4AOF A;  1BI8 B;  2WM9 A;  1MX4 A;  2IO2 C;  3FFL A;  4GAA A;  4GYY A;  4L1B A;  4G25 A;  3QAQ A;  4UWK A;  3B7B A;  2KAT A;  3PUK A;  2AXU A;  3TAX A;  1K8K G;  3E37 A;  3ZN3 A;  1E8X A;  2Y4U A;  3DST A;  4AV7 A;  1OWP A;  4P29 A;  4Y6C A;  3AG1 E;  4N2Q A;  3SHF A;  4AEZ C;  4GYW A;  2XCB A;  3FUH A;  2PM7 A;  3ULE G;  2MYO A;  4HLE A;  3DBS A;  1WG0 A;  3B13 A;  3DEP A;  2OV8 A;  2AXZ A;  1TN8 A;  2AJA A;  4HXI A;  1OT8 A;  3U66 A;  4WWP A;  4V3I A;  3PZD A;  3AU5 A;  3FP3 A;  1HS6 A;  3DSU A;  2Y0B G;  3U64 A;  1MZC A;  4I6G A;  3U4T A;  3UKR G;  1TJC A;  2J07 A;  4NRH B;  1NFI E;  2P9I G;  4A63 B;  1INZ A;  4I6J A;  3L16 A;  3ISM C;  1D8E A;  4HOT A;  2I1J A;  5CRV A;  1JCS A;  3S7B A;  5CCM A;  4U0S A;  1MQS A;  3Q15 A;  3EHQ A;  3SFZ A;  1ELW A;  1E8Y A;  1N4P A;  2BTD A;  4KVO A;  5D2M C;  2QYU A;  1DCQ A;  3RSE G;  3FUK A;  3LXU X;  1IQU A;  2X6K A;  3OXG A;  1FVF A;  2OEW A;  4L9P A;  5AN8 A;  5DBK A;  1HFA A;  3MKR A;  3CIA A;  1E96 B;  2IOS A;  3LPZ A;  3ZYQ A;  1DC2 A;  3HIZ A;  3SF4 A;  3EHR A;  1KPS B;  3ZHE A;  4TUM A;  3F6Q A;  3EJN A;  2DVW A;  1FT1 A;  1TR4 A;  3DWL G;  4F7A A;  1SA4 A;  1A17 A;  3FH5 A;  4YDO A;  2VYI A;  3J5P A;  3FUL A;  5FQ8 A;  5KNG A;  2GRM A;  4ATG A;  5FQ7 A;  4C48 B;  3SBT B;  3OXF A;  5B3S E;  4C0E A;  4GPK A;  4R7L A;  4AP2 A;  3FTS A;  3HG0 D;  1E7V A;  2GRL A;  1UW4 B;  4CGV A;  5ANR A;  3ZEF A;  2I1K A;  5T3R A;  4DK5 A;  3FUD A;  3GW4 A;  3FUI A;  1Y8M A;  4XZ4 A;  2GRN B;  1N54 A;  1EPU A;  2BKK B;  3AG2 E;  1DCE A;  5CED B;  3IKO B;  3FTU A;  1D8D A;  3URZ A;  5LP0 A;  4B8C B;  4WND A;  5E75 A;  3OXL A;  2Q7F A;  4HNA D;  2L6B A;  3L9T A;  2F8X K;  3MJW A;  3FTV A;  2WXN A;  3AG3 E;  3D9L A;  3NAW A;  2EQX A;  4BSX A;  3Q7F A;  4BET A;  2X6H A;  2UY1 A;  1L5J A;  4CDN A;  1W3B A;  4KYO B;  3Q78 A;  4HB5 A;  3TXM A;  5G2N A;  1JCR A;  3Q4A B;  4XKC A;  2OEV A;  3L13 A;  2R17 C;  4XEI G;  3TWX A;  3B7R L;  2HM8 A;  2A4Z A;  3RAU A;  4WAF A;  1TJF A;  1Z6T A;  3RJV A;  1SZ9 A;  3U3W A;  5FZQ A;  4J8S A;  1HG2 A;  3G2T A;  2EIJ E;  3D9I A;  4FLH A;  5EIB E;  3AS8 A;  3B95 A;  2AWI A;  4GTP A;  2ILR A;  3T5X A;  4HI9 A;  3SI5 A;  4EEC A;  2ZGD A;  2AW6 A;  1U3D A;  3VTX A;  5M72 A;  3SO8 A;  4AY5 A;  2JAB A;  2DBA A;  4TXP A;  4K03 A;  3LVR E;  2DWZ A;  3KD7 A;  1U2V G;  4PS3 A;  2VSY A;  1MX2 A;  4UUC A;  3KEA A;  1Y6I A;  4DX7 D;  4FUL A;  3C98 A;  3CGH A;  2H6G A;  1OCR E;  3UM3 A;  4EZK A;  1JUQ A;  5ENQ D;  2X38 A;  2P58 C;  5LX8 A;  3UKU G;  3NOC D;  4O1O A;  2IEJ A;  3UXG A;  3AS4 A;  1OCZ E;  5CMY A;  1KZO A;  4FC8 A;  1N52 A;  4URK A;  1OY3 D;  1RZ4 A;  1XGW A;  1E8Z A;  1TNY A;  4GZC A;  2XPI A;  4LUN U;  3O48 A;  2HO1 A;  1SW6 A;  3EU5 A;  3QKY A;  4GCN A;  2J4B A;  2WMN A;  4L2Y A;  4IN3 B;  2EIN E;  4E6H A;  1S0P A;  3AU4 A;  1SZA A;  1NP7 A;  1MYO A;  4O6F A;  3JXJ A;  4OYS A;  4JW1 A;  1E8W A;  3HDX A;  3ASG A;  1HXI A;  1ZBP A;  2VGX A;  2KBX A;  1H6P A;  4J7W A;  3RRM B;  3D9J A;  3DSS A;  2R5S A;  4Q94 A;  3CKB A;  4J8E A;  1NA3 A;  3I4R B;  5EID A;  4B94 A;  2MRI A;  1QZ2 A;  3SQV A;  2CG3 A;  3DXM G;  2VSN A;  3BEE A;  1FPP A;  3ABL E;  3APC A;  3W9F A;  4D10 C;  2RFA A;  2VGE A;  3ABK E;  1B89 A;  3CHO A;  2WXK A;  2V4H C;  3C5R A;  4DX2 A;  4J0U A;  3ML8 A;  2CG2 A;  4WNE A;  3AJI A;  1TN7 A;  2DYS E;  2QYJ A;  3CHM A;  2NYJ A;  3HXE A;  4JEH A;  4GZD A;  3BUA A;  1HF8 A;  2GGF A;  1JWG A;  3P1U A;  3CHS A;  3CHQ A;  3D9N A;  4W9R A;  4ANX A;  3ULY A;  4J6I A;  3KS2 A;  3ASN E;  1DNP A;  2RFM A;  2V4L A;  3SNX A;  4GZ5 A;  2XGO A;  1X5B A;  3ZPJ A;  2H6H A;  2CHX A;  4GTM A;  4PDX A;  2PQN A;  5CEC B;  1FT2 A;  5LOZ A;  3K9I A;  3CVW A;  1N4Q A;  4K0R A;  5FZR A;  3CLJ A;  3RIB A;  3CVV A;  4B89 A;  4F3V A;  1N0Q A;  3C3R A;  2HYZ A;  4UQX A;  4KBQ A;  2WXI A;  4AY6 A;  2WXF A;  4IUL A;  1UOH A;  3LY8 A;  1MX6 A;  4CDR A;  4EHM A;  2L6J A;  1N95 A;  5JHA A;  4DLQ A;  1SVX A;  2DYR E;  3TXN A;  2KZT B;  5HS0 A;  3ZYK A;  3QDN A;  3UX4 A;  4XX5 A;  2F37 A;  5CHE E;  5ITZ F;  5FWQ A;  4FAD A;  1PAQ A;  1NA0 A;  4M7C A;  1OWO A;  4F1S A;  4HOS A;  3EU9 A;  4ILG A;  3UT7 A;  3DPY A;  5ENP D;  5BNW A;  4GTQ A;  3UT4 A;  1V54 E;  4I2W A;  4U07 A;  2XZD G;  3QK0 A;  5C2Y A;  1QNF A;  3Q73 A;  1SQM A;  5G55 A;  2ETC A;  3D9K A;  1H2U A;  5EKQ D;  3RO2 A;  1HU3 A;  3UIP C;  2VSO E;  3Q75 A;  3ABM E;  5BXO A;  3SZ7 A;  2ZIS A;  1YCS B;  3APD A;  2DIW A;  3PE3 A;  2OCC E;  2KCK A;  2FO1 E;  3L22 A;  3TWS A;  3HXD A;  1QYM A;  2CFU A;  5HRY A;  1IHG A;  3FHE A;  2I9C A;  5CMW A;  5LFA A;  3V30 A;  5JMN D;  2P9P G;  4JEU A;  3SFX A;  4ABN A;  3FU3 A;  4N5Q A;  2WXG A;  4G8L A;  4DLO A;  1IQR A;  3LYA A;  5AJD A;  5B1A E;  2CHZ A;  3MKQ B;  2P9S G;  1WM5 A;  3T8M A;  2P9L G;  4I9C A;  4HRN A;  1IKN D;  3UIN C;  4N2S A;  3PNT B;  2IQC A;  1S64 A;  1H6O A;  4WNF A;  2X3M A;  3HXB A;  1FVH A;  1OWL A;  2XGM A;  2OOE A;  3JQ0 A;  3ZFW A;  4BES A;  5EYL A;  4K5C A;  2WQ6 A;  4ANV A;  4HQD A;  1D9S A;  5KWD A;  2ION A;  3PE4 A;  2QC9 A;  1O5M A;  3QAR A;  4GTV A;  4M3O A;  1Z3Y A;  3LDZ A;  2NSZ A;  3MEK A;  3ULQ A;  4JZY A;  2MHK A;  2KM4 A;  2B0O E;  3CR3 A;  3FWV A;  5ENO D;  2LXL A;  3S2A A;  2J09 A;  2WXP A;  3QNK A;  1KT0 A;  2L9B A;  4OAV B;  3NB2 A;  4AJW A;  4N5C A;  3UUX A;  4U8H A;  2IY0 C;  3CVN A;  4BY6 A;  1NL4 A;  4KVM A;  2J8S D;  4O60 A;  4UI9 J;  2DZO A;  5G04 J;  2E0I A;  4U7E B;  5AJL A;  4YDW A;  1KT1 A;  4CEM A;  5BXU A;  2PL2 A;  2WQH A;  2WXO A;  3ZKJ A;  3PZ2 A;  4FJZ A;  3FTY A;  2LAH A;  1TNB A;  5CRU A;  4ZFH A;  3O4Z A;  2QFC A;  5KNH D;  2BUG A;  2PM6 A;  4Z68 A;  2GRR B;  5D0O D;  4G23 A;  4DX1 A;  3MV2 B;  4UWH A;  2WPV A;  3KSQ A;  3G2S A;  1UG3 A;  4WUY A;  1E7U A;  3ASO E;  3S7F A;  3G2W A;  1Z5S C;  5JJ7 A;  1TNO A;  3PZ3 A;  3JUI A;  1LF8 A;  4AM9 A;  5KCM A;  3V2O A;  3TWR A;  3DEO A;  3B7T A;  2FEZ A;  3TL5 A;  1A5E A;  4LNG A;  5EX0 A;  2Y69 E;  1PY1 A;  3E30 A;  2AVP A;  3HVE B;  4HRM B;  1HX8 A;  3IHY A;  1MJ0 A;  5IY5 E;  3EDT B;  2M63 A;  3LY9 A;  4WWO A;  3ZXS A;  2EIK E;  4PH4 B;  4CGW A;  4L7T A;  3DSX A;  3VLD A;  5EN5 D;  1NI1 A;  2UWJ G;  3LJ3 A;  3QB2 A;  4U63 A;  4ANU A;  1BI7 B;  4AVX A;  3CVQ A;  1N0R A;  2F8Y A;  3ZRH A;  5AQA A;  3PZ1 A;  3Q5M A;  3JYS A;  2C0L A;  2WQ7 A;  1S63 A;  2J08 A;  2IFU A;  5AQB A;  1K1B A;  2CFZ A;  4LRZ A;  4RLY A;  2KC7 A;  2A5U A;  1YYH A;  4GPM A;  2R2L A;  3I5P A;  2Y4T A;  2XGS A;  4EBA A;  2B6C A;  3MGB A;  4BWR A;  2QZA A;  1TNZ A;  2YNQ A;  5FQ6 A;  2F0Y A;  4BX9 A;  2AXV A;  4PS8 A;  5BV0 A;  4HOR A;  5KBA A;  3CK7 A;  3SY2 A;  2R02 A;  3G2U A;  4JHK A;  4UI9 K;  5ARG A;  4FHK A;  4JB8 P;  3CST A;  1H2T C;  3CKC A;  4CCA A;  3FUF A;  2H6F A;  5KJL A;  4UI9 C;  3ESL A;  4RG9 A;  4JPS A;  5G04 C;  2BED A;  3NOG D;  3V79 K;  4A1S A;  5A6C A;  2WMO A;  3LJN A;  1UN8 A;  4L23 A;  4YVO A;  4NIK A;  4HRL A;  1HE8 A;  3I3N A;  4H7X A;  2VGY A;  3I4G A;  3SBS A;  5FIO A;  2KZT A;  3RU0 A;  4B8A A;  5CBN A;  4ME2 A;  4JVS A;  3QOU A;  2XHE A;  2CHW A;  4ACL A;  3R9A B;  3BU8 A;  4KT6 B;  4APF A;  5A7D B;  3HXC A;  3PRZ A;  4GA0 A;  2YHC A;  1AWC B;  3V31 A;  5AAR A;  2WXJ A;  3L82 A;  5FIN A;  3FH7 A;  4LCT A;  3B7S A;  1SA5 A;  4GCO A;  5HQ8 A;  4I1M A;  2JEK A;  4U96 D;  2FO7 A;  4J8D A;  4GTO A;  4FLB A;  2P9N G;  2J4D A;  1NZN A;  1KZP A;  2FI7 A;  4MKT A;  2WXH A;  4HFG A;  3QJZ A;  4MLP A;  4I1A A;  4TRQ A;  3NBN B;  1OWN A;  4U04 A;  2KXP C;  5KJM A;  3WXX A;  2E2E A;  2L0I A;  3HHM A;  4FP7 A;  5H7P A;  1N94 A;  4E85 A;  1OCC E;  5JJ6 A;  4CRW A;  3PNL B;  4AXH A;  3GZ1 A;  4UQZ A;  2R05 A;  3TG5 A;  3C72 A;  3PVL A;  3MKQ A;  4H7Y A;  3FY4 A;  4OVV A;  2WB2 A;  4BEP A;  2KCL A;  3CV0 A;  4DI4 A;  3FEX A;  3FTW A;  4JD2 G;  4KZC A;  3IEG A;  4LNU D;  4O1P A;  5CBO A;  5FJY A;  4GML A;  4RVB A;  4YDY A;  4AIF A;  4G8K A;  4UWF A;  5BW8 C;  3LEW A;  4BT8 A;  4EBA G;  3OAW A;  2RKK A;  2JLB A;  4K5B A;  4F1P A;  4UQY A;  3IXE A;  4NUR A;  4CDM A;  3JXI A;  3OTN A;  5AYW D;  4EZJ A;  2LSU A;  3MCX A;  3PUJ A;  3JQ1 A;  2OVF A;  3R7Q A;  3B7U X;  4YDE A;  4JL0 A;  2P9K G;  2XEN A;  3ZYL A;  3Q7A A;  1TNU A;  4YND A;  4FA6 A;  2XPZ A;  4ILH B;  3CK8 A;  4GMR A;  3CVP A;  3APF A;  1OCO E;  3D9P A;  2OVB A;  4GTR A;  3R7R A;  4Y6W A;  4A3V A;  1K1A A;  3LCA A;  4JC8 A;  4A55 A;  5KJK A;  4EZL A;  3MV3 B;  3HYM B;  2MOW A;  3NF1 A;  4U8Y D;  5A23 A;  2H6I A;  2BKG A;  1O1S A;  1HO8 A;  3KEZ A;  5LCW J;  1Q2Z A;  4MBG A;  3LVQ E;  2XQ0 A;  4GB9 A;  1HG5 A;  3FU5 A;  4JXT A;  5ENN A;  4DJA A;  3CQG B;  3PH0 C;  4DX5 D;  3QC1 A;  1KLX A;  4NAC A;  3CHP A;  3FUN A;  2C0M A;  1U3C A;  1RW2 A;  1LTX A;  4LEU A;  2R03 A;  4OAU C;  5ENT D;  3L54 A;  1N11 A;  2EIL E;  3UMV A;  4HOU A;  4CT0 A;  2ETA A;  5EX3 A;  4BFR A;  4RQI A;  3DSV A;  4HLL A;  3RK6 A;  3PZ4 A;  3HVE A;  2NC9 A;  1LD8 A;  1EDU A;  4UWG A;  5ENS D;  4FU3 A;  3LKU A;  2GW1 A;  3EHN A;  3ASF A;  1UJJ A;  3VLE A;  2VTB B;  4GU5 A;  2LAI A;  2XEH A;  1H6K A;  4U0U A;  4KMO A;  4JA9 A;  4LSZ E;  4CT4 A;  3PRE A;  3V2X A;  2FF4 A;  3UM0 A;  4QQI A;  3CVX A;  2J49 A;  2WXQ A;  4FHJ A;  1O1R A;  4C0M A;  2C2L A;  2V5F A;  3ZU7 B;  4N3A A;  3FU6 A;  3Q49 B;  1BU9 A;  3FUJ A;  1WAO 1;  3MX3 A;  2IJG X;  1OUV A;  3RRN B;  4KZ0 A;  1ZB1 A;  1IXV A;  5T4Y A;  2IU1 A;  2I6H A;  3UTM A;  3ESK A;  4EPZ A;  4PUC A;  5JHB A;  2A5E A;  3E33 A;  3UT8 A;  4JHR A;  4G11 A;  4LG6 A; 
#chains in the Genus database with same CATH homology
 3PS6 A;  3VLD A;  3RRM B;  2UWJ G;  3LJ3 A;  3D9J A;  3QB2 A;  4G2V A;  4U63 A;  4ANU A;  2R5S A;  3IBE A;  4BX8 A;  4AVX A;  4Q94 A;  3CVQ A;  5G05 J;  3CKB A;  4J8E A;  2VJ8 A;  1NA3 A;  3I4R B;  4MRU A;  3TGO A;  3ZRH A;  3Q5M A;  4B94 A;  2V8S E;  1BPO A;  3JYS A;  4TV3 A;  2MRI A;  1QZ2 A;  2C0L A;  5ARF A;  2CG3 A;  3S7J A;  2WQ7 A;  2J08 A;  4PS7 A;  2VSN A;  2IFU A;  3BG0 B;  3L17 A;  3BEE A;  4BT9 A;  5ANL A;  2RD0 A;  3APC A;  1P5Q A;  4D10 C;  2CFZ A;  4LRZ A;  3PDN A;  2VGX B;  3SD5 A;  4B0Z A;  2KC7 A;  1B89 A;  4HS2 A;  1EF1 C;  2A5U A;  3CHO A;  2LSV A;  1UN9 A;  2WXK A;  3QWP A;  4XI0 A;  5AEN A;  4J0U A;  3ZGQ A;  3ML8 A;  2CG2 A;  4WNE A;  3I5P A;  4WNG A;  2Y4T A;  4EQF A;  2BF0 X;  2XGS A;  2YIN A;  4EBA A;  5LCW C;  3ZIM A;  2WXL A;  3MGB A;  4BTA A;  4BWR A;  1IYG A;  2FUL A;  2YNQ A;  3FUM A;  4OVU A;  4N3C A;  1E90 A;  5FQ6 A;  1WY6 A;  3JCK C;  3CHM A;  3TG4 A;  4BX9 A;  2AXV A;  4JEH A;  4PS8 A;  4GZD A;  3GYZ A;  5BV0 A;  4HOR A;  3CK9 A;  3CK7 A;  1HF8 A;  3GZ2 A;  4GZ3 A;  2GGF A;  4I17 A;  1JWG A;  3P1U A;  4L2L A;  3CHS A;  5AIJ A;  3G2U A;  4JHK A;  4UI9 K;  5ARG A;  4GA1 A;  5EDS A;  4FHK A;  3CST A;  1H2T C;  1JWF A;  3CHQ A;  3CKC A;  3G2V A;  2OND A;  3D9N A;  4ILI A;  4W9R A;  4AOF A;  4ANX A;  4CCA A;  3FUF A;  2WM9 A;  2KCV A;  4G26 A;  4JA7 A;  4J6I A;  5KJL A;  4UI9 C;  3ESL A;  4RG9 A;  3KS2 A;  3ONL A;  4JPS A;  5G04 C;  3FFL A;  4GAA A;  4GYY A;  1DNP A;  4L1B A;  2V4L A;  2L0T B;  4G25 A;  3QAQ A;  2ZU6 B;  3SNX A;  4DI3 A;  4GZ6 A;  4UWK A;  4A1S A;  1DVP A;  4GZ5 A;  5A6C A;  2XGO A;  2KAT A;  1X5B A;  3PUK A;  4GYO A;  2AXU A;  5C1D A;  2WMO A;  3ZPJ A;  3UQ3 A;  3TAX A;  5BUZ A;  1UN8 A;  4L23 A;  2CHX A;  3IV0 A;  4YVO A;  1HE8 A;  3ZN3 A;  1E8X A;  2Y4U A;  4AV7 A;  4PDX A;  3I3N A;  1OWP A;  3CHR A;  4H7X A;  4P29 A;  2X6J A;  2PQN A;  1ZU2 A;  4Y6C A;  4N2Q A;  1H2V C;  3SHF A;  1PC2 A;  2VGY A;  4GYW A;  3I4G A;  3K9I A;  5LOZ A;  2NXP A;  4AEZ C;  3CVW A;  2XCB A;  4K0R A;  3FTZ A;  5FZR A;  3FUH A;  2PM7 A;  3CLJ A;  3SBS A;  3RIB A;  3LS8 A;  5FQ4 A;  5JJT A;  2KZT A;  4HLE A;  3RU0 A;  3CVV A;  3DBS A;  4B8A A;  4B89 A;  3ZW3 A;  3B13 A;  4F3V A;  4ME2 A;  2OV8 A;  2AXZ A;  4JVS A;  3QOU A;  4I1O B;  2HYZ A;  2XHE A;  2CHW A;  4UQX A;  4ACL A;  3R9A B;  3T5V A;  3GZS A;  4KBQ A;  2WXI A;  1H0A A;  4AY6 A;  2X6F A;  4HXI A;  3U66 A;  4KT6 B;  2WXF A;  4WWP A;  4APF A;  4IUL A;  5A7D B;  4V3I A;  4YVQ C;  5BPP A;  3PZD A;  3AU5 A;  1EYH A;  3PRZ A;  4GA0 A;  2YHC A;  2Y3A A;  2PQR A;  3FP3 A;  1HS6 A;  3LY8 A;  3NZU A;  4CDR A;  2WXJ A;  2L6J A;  5FTP A;  3FH7 A;  4LCT A;  3U64 A;  3B7S A;  4I6G A;  2LO6 A;  2R59 A;  5JHA A;  3U4T A;  4DLQ A;  4XE0 A;  1TJC A;  2J07 A;  4NRH B;  4GCO A;  5HQ8 A;  1INZ A;  3TXN A;  4I6J A;  4I1M A;  2JEK A;  3L16 A;  3Q47 B;  3UPV A;  2KZT B;  4JHJ A;  2FO7 A;  4J8D A;  2LNI A;  3ZYK A;  4FLB A;  2J4D A;  3QDN A;  4HOT A;  2I1J A;  3D9M A;  1NZN A;  1OWM A;  3FU0 A;  2FI7 A;  4MKT A;  3UX4 A;  4XX5 A;  3S7B A;  4ANW A;  2WXH A;  4HFG A;  5CHE E;  5CCM A;  4U0S A;  3CVY A;  2XCC A;  1MQS A;  5FWQ A;  4FAD A;  1PAQ A;  1NA0 A;  3Q15 A;  3QJZ A;  4MLP A;  4U0Z A;  3RKV A;  4HVB A;  1OWO A;  3SFZ A;  4F1S A;  1ELW A;  4I1A A;  4HOS A;  4Q69 A;  2X6I A;  2WXM A;  4ILG A;  4TRQ A;  3UT7 A;  1OWN A;  4U04 A;  1E8Y A;  3NQP A;  2BTD A;  5KJM A;  5G05 C;  1Z3X A;  3WXX A;  1HZ4 A;  4KVO A;  5BNW A;  4RSY A;  3UT4 A;  2E2E A;  2L0I A;  3HHM A;  4I2W A;  4U07 A;  4FP7 A;  3FUK A;  3RO3 A;  3QK0 A;  3LXU X;  5C2Y A;  4E85 A;  1QNF A;  4G24 A;  5JJ6 A;  1IQU A;  2X6K A;  1SQM A;  3OXG A;  4CRW A;  1FVF A;  5G55 A;  3PNL B;  3IHV A;  4XKB A;  4AXH A;  5DBK A;  3NZS A;  1HFA A;  3D9K A;  1H2U A;  3GZ1 A;  4UQZ A;  5EKQ D;  3MKR A;  3RO2 A;  1HU3 A;  2VSO E;  3TG5 A;  3CIA A;  1E96 B;  2IOS A;  3LPZ A;  3SZ7 A;  3APD A;  3ZYQ A;  2DIW A;  3PVL A;  3HIZ A;  3SF4 A;  3MKQ A;  3D9O A;  4C9B B;  3PE3 A;  5J90 A;  3ZHE A;  4H7Y A;  1TEZ A;  2KCK A;  3EJN A;  3FY4 A;  3L22 A;  4OVV A;  3E4B A;  3ML9 A;  2WB2 A;  2KCL A;  1UJK A;  3CV0 A;  5T8I A;  2YHE A;  4DI4 A;  3FEX A;  2FBN A;  4F7A A;  1A17 A;  3FTW A;  3PEU B;  2CFU A;  1IHG A;  3FHE A;  3FH5 A;  2I9C A;  2VSX E;  5CMW A;  2VYI A;  3CSF A;  4KZC A;  3IEG A;  3EIJ A;  4I9E A;  4XI9 A;  5LFA A;  3FTX A;  3FUL A;  5FQ8 A;  2GRM A;  4ATG A;  2RG8 A;  4JEU A;  5FQ7 A;  4ABN A;  3FU3 A;  3SBT B;  3OXF A;  4J8F A;  2WXG A;  4C0E A;  4NQ0 A;  3KAE A;  4APO A;  4GPK A;  4R7L A;  4AP2 A;  2IF4 A;  3CQC B;  3FTS A;  1IQR A;  4DLO A;  2QY7 A;  5FJY A;  3LYA A;  4GML A;  4RVB A;  5FZS A;  1E7V A;  2GRL A;  4AIF A;  5AJD A;  3ASD A;  4UWF A;  3DPD A;  1UW4 B;  2CHZ A;  5BW8 C;  3LEW A;  3FUE A;  4BT8 A;  4EBA G;  3OAW A;  3MKQ B;  4CGV A;  2JLB A;  5ANR A;  1WM5 A;  3T8M A;  3ZHE B;  3ZEF A;  4UQY A;  2I1K A;  3D3M A;  3AS5 A;  5T3R A;  4DK5 A;  3FUD A;  4QFV A;  3GW4 A;  3FUI A;  4NUR A;  3SGH A;  4CDM A;  1Y8M A;  3OTN A;  4I9C A;  5CCL A;  3L6A A;  4XZ4 A;  5AYW D;  2PZI A;  4EZJ A;  2LSU A;  4N2S A;  3MCX A;  3PUJ A;  1N54 A;  1EPU A;  3PNT B;  2IQC A;  3JQ1 A;  3TJP A;  4WNF A;  3CVL A;  2OVF A;  2X3M A;  4IYP A;  3R7Q A;  3FDH A;  3BG1 B;  3B7U X;  4JL0 A;  5DIZ A;  1FVH A;  1OWL A;  2XGM A;  3ZYL A;  2OOE A;  3IKO B;  3JQ0 A;  4YND A;  3FTU A;  5D0Q D;  3ZFW A;  3URZ A;  4FA6 A;  2XPZ A;  3PEV B;  4ILH B;  3ASH A;  4N3B A;  5LP0 A;  3CK8 A;  4B8C B;  3CVP A;  3FH8 A;  2WQ6 A;  3APF A;  3VLF A;  3ZVV A;  4WND A;  5E75 A;  3OXL A;  3ONK A;  4ANV A;  2Q7F A;  4HOQ A;  3D9P A;  2OVB A;  4GMJ A;  2XRY A;  3R7R A;  4Y6W A;  4A3V A;  3LCA A;  4JC8 A;  2ION A;  3MJW A;  3FTV A;  2WXN A;  3D9L A;  3PE4 A;  2WXR A;  4A55 A;  2EQX A;  5KJK A;  4BSX A;  3QAR A;  4ACK A;  3CEQ A;  4IRU A;  4KXK B;  4EZL A;  2X6H A;  4N39 A;  3MV3 B;  4MS6 A;  4M3O A;  3HYM B;  2UY1 A;  1L5J A;  1ELR A;  2MOW A;  4CDN A;  3NF1 A;  3MZL B;  4FJY A;  1W3B A;  1Z3Y A;  4KYO B;  5A23 A;  3LDZ A;  2NSZ A;  3MEK A;  3N71 A;  3ULQ A;  3TXM A;  4I6E A;  4JZY A;  5G2N A;  2MHK A;  2KM4 A;  3QWV A;  4BTB A;  3Q4A B;  4XKC A;  3CR3 A;  1HO8 A;  3EIQ C;  3FWV A;  3KEZ A;  3L13 A;  3S2A A;  5LCW J;  5J08 A;  2J09 A;  3LVQ E;  2XQ0 A;  4GB9 A;  1HG5 A;  2R17 C;  2WXP A;  3FU5 A;  4JXT A;  4XIF A;  5E76 A;  3QNK A;  3CQG B;  5ENN A;  3U9W A;  3PH0 C;  5BV1 A;  1KT0 A;  3QC1 A;  3VTY A;  1KLX A;  4NAC A;  2L9B A;  3CHP A;  3B7R L;  3FUN A;  2C0M A;  1U3C A;  2HM8 A;  2A4Z A;  3MYV A;  1GW6 A;  4WAF A;  1TJF A;  1VDY A;  2XPY A;  1YA0 A;  4AJW A;  4N5C A;  5KJN A;  1Z6T A;  3RJV A;  1SZ9 A;  3U3W A;  3UUX A;  4U8H A;  4LEU A;  3CVN A;  5FZQ A;  4J8S A;  4BY6 A;  1HG2 A;  3G2T A;  3D9I A;  4FLH A;  2UY1 B;  3AS8 A;  2VTB A;  4KVM A;  2VQ2 A;  2AWI A;  2ILR A;  2I2O A;  3L54 A;  3T5X A;  4UI9 J;  4LER A;  1FCH A;  3UMV A;  4HOU A;  3SI5 A;  5G04 J;  4EEC A;  2AW6 A;  1U3D A;  3VTX A;  2E0I A;  5M72 A;  2XEV A;  2J9Q A;  4RG6 A;  5AJL A;  3ZYM A;  1KT1 A;  4AY5 A;  4CEM A;  4CT0 A;  2V0P A;  2PL2 A;  5EX3 A;  2WQH A;  4BFR A;  2DCP A;  2WXO A;  2DBA A;  4FJZ A;  4K03 A;  4DPR A;  3FTY A;  3LVR E;  2LAH A;  3LY7 A;  4DJA A;  3KD7 A;  1MHQ A;  3RK6 A;  4PS3 A;  5HI7 A;  2VSY A;  3HVE A;  2NC9 A;  2YQ8 A;  1Y6I A;  4I2Z A;  1EDU A;  4FUL A;  3C98 A;  4UWG A;  4A3T A;  3P2B A;  3CGH A;  1H19 A;  3O4Z A;  5BT1 A;  2QFC A;  4FU3 A;  4I43 A;  2WVI A;  3LKU A;  2BUG A;  4EZK A;  2PM6 A;  2GW1 A;  3EHN A;  3ASF A;  5D0O D;  4G23 A;  1UJJ A;  1JUQ A;  3MV2 B;  3VLE A;  4F53 A;  2VTB B;  4UWH A;  4GU5 A;  2WPV A;  2X38 A;  2LAI A;  2P58 C;  5LX8 A;  3L08 A;  3G2S A;  1QQE A;  3QWW A;  1H6K A;  5FT9 A;  1UG3 A;  4WUY A;  4A1G A;  4U0U A;  3AS4 A;  1E7U A;  3G2W A;  4KMO A;  4JA9 A;  5CMY A;  3S7F A;  4CT4 A;  1JPL A;  4FC8 A;  1N52 A;  3PRE A;  5JJ7 A;  2FF4 A;  3RRU A;  3CVX A;  4URK A;  4UWL A;  3CVU A;  3JUI A;  1LF8 A;  4AM9 A;  3ENE A;  2J49 A;  2WXQ A;  4WWN A;  5KCM A;  1XGW A;  1E8Z A;  4GA2 A;  4Q96 A;  3B7T A;  4FHJ A;  2FEZ A;  4TUU A;  4GZC A;  4C0M A;  1HH8 A;  2C2L A;  2V5F A;  3TL5 A;  3FEY A;  5EX0 A;  2XPI A;  4LUN U;  3O48 A;  1PY1 A;  3FU6 A;  2AVP A;  3HVE B;  2HO1 A;  3Q49 B;  4N3A A;  3QKY A;  3MA5 A;  1HX8 A;  3FUJ A;  3EHM A;  4GCN A;  3IHY A;  1WAO 1;  2J4B A;  3MX3 A;  1XNF A;  2WMN A;  4L2Y A;  4IN3 B;  2IJG X;  2IOL A;  1OUV A;  3RRN B;  3S7D A;  3EDT B;  1S0P A;  4E6H A;  3AU4 A;  4KZ0 A;  1ELK A;  1NP7 A;  1SZA A;  4O6F A;  2M63 A;  3LY9 A;  4OYS A;  4WWO A;  5T4Y A;  3ZXS A;  4JW1 A;  2IU1 A;  4G1T A;  2I6H A;  3ESK A;  4EPZ A;  1E8W A;  4PH4 B;  4CGW A;  3HDX A;  4L7T A;  2XRZ A;  4PUC A;  5JHB A;  2HR2 A;  3ASG A;  3UT8 A;  1HXI A;  1ZBP A;  4JHR A;  2VGX A;  4G11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...