3TGOA

Crystal structure of the e. coli bamcd complex
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
217
structure length
217
Chain Sequence
EVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the beta-barrel assembly machinery BamCD protein complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords UPF0169 lipoprotein yfiO
total genus 91
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3tgoA00
2IFUA 2VYIA 4H7YA 4WUYA 4XI0A 3FFLA 4G26A 4HOUA 1YA0A 3MKRA 2OOEA 3RU0A 1KT0A 4APOA 4BT9A 4I9EA 5JJTA 5EX3A 3CVPA 4KYOB 2JLBA 3TG4A 4U04A 4AIFA 2UY1A 4W9RA 5CHEE 3GW4A 4UQXA 2Q7FA 3ZFWA 3LKUA 5G05J 4G23A 5HI7A 4N5CA 2FO7A 4GA0A 4NRHB 2Y4TA 5DIZA 1B89A 4KXKB 4UQYA 1PC2A 3PE4A 3VTYA 1QQEA 4HOTA 5BNWA 2VGXB 3PDNA 5M72A 3SF4A 4GZ3A 2PQRA 3FP3A 5FZRA 4I17A 5KJMA 3JYSA 3LCAA 4NQ0A 3ASFA 4U07A 1QZ2A 3RKVA 5C1DA 3ULQA 2FEZA 2C0MA 4RG6A 2UWJG 2VSNA 2VGYA 3AS8A 5G05C 3N71A 1HXIA 1WM5A 2P58C 1NZNA 2WQHA 3LY9A 3QWPA 4WNDA 5DBKA 3ZPJA 5CCMA 3QWVA 4UI9C 2IF4A 2XGOA 2HO1A 3GYZA 3HYMB 3R9AB 1ZU2A 5KJLA 1ZBPA 4GYOA 4WNEA 4JL0A 3CVQA 5G04J 3UQ3A 5BW8C 1ELWA 3ESKA 4CDRA 5FZQA 3U4TA 3FWVA 5JJ6A 2MHKA 4BT8A 3CV0A 3Q49B 3S7JA 2VGXA 2KC7A 5LCWJ 4GCOA 3ASHA 3EDTB 3AS5A 1NA3A 3IEGA 4UI9K 3UUXA 4AY5A 2Y4UA 3CK8A 4G25A 5LCWC 2C2LA 3MEKA 2FBNA 1HH8A 2YHCA 4GCNA 4N39A 2XCBA 4GZ5A 3URZA 2QFCA 5G04C 3RO3A 4Y6CA 2PZIA 4I9CA 3ZGQA 4YVQC 4U0UA 2I6HA 2KCVA 2LNIA 1TJCA 2HYZA 4U0SA 5BT1A 4ME2A 5FJYA 4N2QA 5CCLA 1ELRA 2KCKA 4G2VA 5FZSA 4G1TA 3SZ7A 3WXXA 4BTAA 4GZ6A 3Q4AB 3S7BA 3UPVA 2KCLA 3OXFA 4N3CA 2L6JA 5FTPA 1WAO1 3LY8A 2LSUA 3MV2B 3S7DA 4AM9A 4AY6A 5HQ8A 3ZHEB 3TAXA 3O48A 3E4BA 5ARFA 5EKQD 3MA5A 5KJNA 4HOQA 2V5FA 2FI7A 3MV3B 4XI9A 4BTBA 3KD7A 4GYYA 2C0LA 4GA1A 4RG9A 1OUVA 2PQNA 4HORA 3RIBA 4I1AA 4CGWA 4KBQA 1XNFA 3TGOA 4N3AA 3LYAA 3AS4A 4G24A 1A17A 4H7XA 4O6FA 2BUGA 4Y6WA 3RJVA 3CVNA 2PL2A 4JHRA 4HOSA 4J0UA 2ONDA 2E2EA 3LPZA 5ARGA 4B94A 4CGVA 2XGSA 3CEQA 4ABNA 1HZ4A 5JJ7A 1W3BA 3OXGA 3ZHEA 4BWRA 4UQZA 3S7FA 4YNDA 3OXLA 3K9IA 3Q15A 2NC9A 1IHGA 2XPIA 4J8DA 3QDNA 1E96B 4GA2A 4WNFA 3ASGA 3CKBA 3CKCA 3Q47B 2KATA 4I2WA 5AYWD 2XGMA 5KJKA 2GW1A 3CVLA 1KLXA 4N3BA 4A1SA 2VQ2A 3U3WA 4LEUA 2VSYA 5FT9A 4J8FA 3Q5MA 3CK7A 4UI9J 3CK9A 4N2SA 1Y8MA 3QOUA 4J8EA 3KAEA 4GPKA 4I2ZA 4XIFA 2AVPA 2YQ8A 5D0QD 2LSVA 4EQFA 4JA7A 3VTXA 4WNGA 3RO2A 1NA0A 2HR2A 1IYGA 2XEVA 2DBAA 3TG5A 3GZ2A 3NF1A 4YVOA 3KS2A 3ASDA 2XCCA 4JA9A 1P5QA 3LY7A 5A7DB 2WPVA 3BEEA 3GZ1A 1KT1A 2R5SA 3PE3A 4GYWA 3QWWA 1FCHA 4IN3B 5D0OD 3QKYA 3ZN3A 5EX0A 5A6CA 2FF4A 2UY1B 2J9QA 4U0ZA 4F3VA
chains in the Genus database with same CATH superfamily
3X2QE 4G26A 1BI8B 4I9EA 3QK0A 3PEVB 3TWTA 4V3IA 1JWGA 1X5BA 4XX5A 3PE4A 1OCCE 1SA5A 5T3RA 4Q94A 5BPPA 5ENNA 3ZYMA 4U96D 4RG6A 2VTBB 2EIKE 5CEAA 3LY9A 2YNQA 2NYJA 4WNEA 2R59A 2MYOA 4XZ4A 4BT8A 3FTVA 3ZGQA 1UJKA 1MJ0A 2WXOA 4ME2A 4G2VA 4DPRA 2YHEA 5FTPA 4AM9A 3O48A 5EN5D 3C3QA 3MV3B 3NZSA 4KVMA 2E0IA 1FPPA 4HFGA 4DX7D 2ONDA 2XGSA 1QBQA 3CLJA 4JEHA 1IQRA 3Q15A 5J90A 3CKBA 4NIKA 4A1SA 4N3BA 4J8FA 1G3NB 3EHQA 3FTXA 2XRYA 2IOLA 1OT8A 4G11A 3RO2A 1AWCB 1BPOA 4EPZA 4K5CA 2WXHA 1S63A 3CIAA 3UKRG 4H7YA 5CMWA 3LXUX 1UN9A 5KCMA 3CVPA 1EF1C 4U04A 4FADA 1AP7A 2WXQA 4UWGA 2Y69E 2FO7A 1NFIE 2P2CP 4KXKB 3DSWA 3SF4A 1WY6A 5KJMA 4AVXA 2CHXA 3J5PA 3AS8A 2WQHA 4PDXA 4BERA 1EPUA 2HO1A 3HYMB 2L6BA 3ZIMA 4L2LA 1TNUA 2ETAA 1EYHA 3ASHA 5LCWC 2DZOA 2YHCA 5G04C 3ZYQA 3L13A 3QJZA 2KCVA 2HYZA 3PNTB 3O4ZA 4C0EA 1E90A 5BV1A 4HRNA 3ZUVB 3MV2B 3I4GA 4ACLA 2HE0A 3MA5A 4BX8A 1LD8A 2WXMA 4TXQA 4A55A 4DX2A 5FQ4A 4IULA 1N4RA 4FJYA 1VDYA 4ATGA 4JHKA 2H6FA 3D9NA 3QDNA 1IYGA 2GROB 3Q5MA 1Y8MA 1N95A 4WWNA 2AVPA 2JABA 5AENA 1N11A 2XEVA 4FP7A 1P5QA 2QYJA 2WQ6A 2WXNA 5ENRD 2R5SA 4GYWA 1FCHA 5EX0A 4JC8A 5CERB 3FUKA 4WAFA 3FUMA 2WXKA 2R2LA 1YYHA 1IKND 4DX6D 4UQXA 3W9GA 3D9LA 3JUEA 2VGXB 2RD0A 3T5XA 2F37A 3LCAA 3MGBA 5T8IA 1OWPA 2X6IA 3N71A 4WNDA 1QYMA 3C3RA 4U63A 3TWQA 3T5VA 3U4TA 2KC7A 1YMPA 4ANWA 1LF8A 2BKKB 3G2WA 4ILHB 2GRRB 2PZIA 4KVOA 3FEYA 4CYMD 2WXPA 3V2OA 4EZLA 3D9PA 2L6JA 2OEWA 2BKGA 4GYYA 4RG9A 4EECA 4PS8A 3LYAA 4YDWA 3AS4A 1TNOA 4FU3A 3SHFA 4I1MA 2GRMA 1SA4A 4HRLA 1TN7A 5E75A 3TXMA 3FULA 3JXJA 3DSVA 4GPMA 3S2AA 2DYSE 1SQMA 3EU5A 3FHEA 4EQFA 1Z5SC 4HBDA 2AJAA 3R7RA 2WXRA 3FU5A 1JWFA 3D9OA 1O1RA 3V79K 1NP7A 5ENPD 2DVWA 4W9RA 5CMYA 3CHPA 3FU6A 5EYPF 1QQEA 3DBSA 3PEUB 3QB2A 4I17A 2P9IG 4PUCA 3L9TA 4GZDA 3E32A 4FJZA 3ZPJA 1NZNA 3UKUG 3ZEFA 3OAWA 3FH8A 5FZQA 3FWVA 2VJ8A 2A5EA 1HH8A 4GZ5A 5EIBE 3HXDA 4BY6A 4U0UA 2H6IA 3ABME 3C3OA 5BT1A 4U0SA 3ZYKA 5FJYA 3RK6A 2ZXWE 5FZSA 4BTAA 5AARA 3L08A 4N3CA 2LSUA 3LJNA 3JQ0A 3SBTB 1OUVA 3SY2A 1UOHA 4H7XA 4HOSA 4J0UA 3CSTA 2E2EA 5JJ7A 3S7FA 4OVVA 3CHQA 4DLQA 4Y6CA 4LSZE 1E96B 4GA2A 3Q47B 2WVIA 1BI7B 2VSYA 3ONKA 3SFZA 3CK9A 3DSSA 2J08A 5D0QD 3PZDA 4ZHBA 3APFA 4IN3B 2FULA 5JHAA 2DWZA 4HVBA 1SW6A 3GW4A 4GTOA 3EHMA 4K0RA 3HXFA 1B89A 3NOGD 4ANVA 1S70B 5ANLA 3FTZA 2FEZA 2L0TB 3IHVA 4N5QA 5ANRA 5DBKA 3TXNA 2V0PA 3GYZA 3RRNB 1MYOA 3L16A 5ENSD 3Q49B 1FVFA 3EDTB 3DWLG 3UIPC 2XCBA 4J6IA 4KMOA 4I9CA 5LFAA 3JUIA 1O1TA 3BU8A 3ASNE 3UT8A 4ILIA 4F7AA 3BG0B 2ZGGA 4IRUA 4O1OA 3ZHEB 4HI8A 2VTBA 1TEZA 4B93B 4PS7A 2WQ7A 4OVUA 4Q69A 3AG1E 3T9KA 3VLEA 3CVVA 4HB5A 3G2TA 3HDXA 4LERA 4TXPA 5KJKA 3UM3A 3JQ1A 4E85A 4TV3A 4LUNU 4JVSA 3TWSA 5KWDA 3GZ2A 3ASOE 3LVRE 1N0QA 1WG0A 2UY1B 2VYIA 3RSEG 1HE8A 3EJNA 5AQAA 2IO2C 5DIZA 3W9FA 5T4YA 1N52A 2A5UA 3ZYLA 1HXIA 4G8KA 5JA4D 4PH4B 3E37A 2VGEA 1Q2ZA 2Y4UA 2C2LA 3KEAA 4N39A 3HXBA 5FQ6A 1OCRE 2Y0BG 5IY5E 1N94A 4I6JA 1ELRA 1D8EA 3DPDA 3UM1A 4RQIA 1HO8A 3ZNGA 3TAXA 3D9HA 2OVBA 4XI9A 4HLEA 2C0LA 5G2NA 3SBSA 3APCA 4I1AA 3ZVVA 4KZCA 4JB8P 4OAVB 3PUKA 3Q79A 3PZ1A 4GMLA 4J8SA 5CECB 2VSXE 3CHSA 4J8YA 3OXGA 5AJLA 3ZHEA 2WXFA 2YINA 4A1GA 4O60A 5KBAA 3OTNA 2WXIA 4U8VD 5AQ7A 4J8EA 3WG7E 4AJWA 1MZCA 2LSVA 4JA7A 3NF1A 5ENQD 2I2OA 3B95A 5CBOA 1K8KG 2FO1E 3U66A 4MRUA 4XI0A 3NBNB 2KZTB 4ILGA 2B6CA 5ITZF 3LKUA 2Y4TA 4BX9A 2ILRA 4FHJA 4HQDA 4GZ3A 4B8CB 2LAHA 2PM7A 4B0ZA 3JYSA 3UT7A 4U07A 4UWFA 4JHJA 2OCCE 4DK5A 2ETCA 3ML8A 2XQ0A 5KJLA 4JXTA 3UQ3A 5BW8C 4A3VA 3CV0A 3RRUA 4GTMA 3ONLA 2FBNA 3URZA 4R7LA 3CHRA 4LNBA 2V8SE 3MCXA 5CBNA 4GTRA 3ULYA 5AQBA 2GRPB 1JPLA 3LY8A 3DSXA 2LAIA 5BUZA 2XEEA 4C0MA 3SFXA 4WWOA 4G24A 1IQUA 2BF0X 1LTXA 3PRZA 3VLDA 4FA6A 5AIJA 3NZUA 5ARGA 4ABNA 3V2XA 3FEXA 3QARA 3I5PA 3LVQE 3MKQB 5J08A 3K9IA 2XPIA 4AY6A 3TWWA 1HU3A 3EIQC 3J5QB 2ZIRA 5ENTD 2KM4A 4WNGA 4HXIA 3FUFA 4GTSA 4YVOA 3ASDA 2XCCA 3FH5A 5H7PA 4L2YA 2WXGA 1E7UA 1KT1A 4DLOA 5D0OD 4BEPA 4GAAA 2IONA 1U3DA 5CCLA 3TG4A 3D3MA 4GA0A 1PC2A 5FZRA 3PREA 5FINA 1JUQA 4L9PA 4LNGA 4C9BB 4OYSA 2GRLA 3SNXA 3CVQA 4DUIA 3JCKC 5JJ6A 4GCOA 3CR3A 3FTYA 4CT4A 4F53A 5AJDA 4APFA 2DCPA 4G1TA 4U8YD 1BU9A 1WAO1 4B89A 1TNBA 4QQIA 2FI7A 3UXGA 4Q96A 3ESLA 4NACA 4O6FA 4Y6WA 5C2YA 2X6KA 2H6GA 3HHMA 4E6HA 3OXLA 2NC9A 1OCOE 4IYPA 3CVLA 4LEUA 2B0OE 2AXVA 3ZKJA 4I2ZA 4M7CA 2YQ8A 3V31A 1ELKA 3HVEA 1UJJA 3EHNA 5EIDA 1H6KA 1OCZE 4ANUA 4U8HA 3ZW3A 5BV0A 4DRXE 1E8XA 1MX6A 2DYRE 3AJIA 3ZFWA 1WDYA 4G23A 3EUVA 4DX1A 3AG2E 1QZ2A 3ULQA 1K1BA 4C48B 3SQVA 3CHMA 1ZU2A 4KT6B 1ZBPA 1DCQA 1S0PA 2VGXA 1IXVA 1NL4A 1NA3A 3R7QA 3IXEA 4HS2A 3Q9NC 2DZNA 4YVQC 3L54A 3G2SA 2ZISA 4FLHA 3AU4A 1TNZA 2F0YA 4GZ6A 3S7BA 3C98A 4F1PA 3MJWA 1H6OA 3ISMC 1LD7A 4JD2G 5ARFA 3B7BA 4I6GA 1MX2A 4BTBA 1N4SA 3TWRA 4JW1A 3RJVA 3DEPA 2XS1A 2NSZA 4CGVA 2VSOE 1N4QA 2QYUA 2I9CA 4D10C 4YNDA 1TJFA 3FUHA 1HX8A 3ASGA 3BUAA 3U3WA 3ZXPA 1H0AA 3QOUA 3KAEA 4XIFA 2BTDA 5FQ8A 1NI1A 2H6HA 4AEZC 2X6FA 3C5RA 1ZB1A 5CEDB 4JA9A 3AAAC 2Y3AA 5EDSA 3F6QA 3MKRA 2KZTA 3RU0A 2DIWA 3Q7AA 3DXKG 4GZCA 5EX3A 3T8KA 3FU3A 4JZYA 2IO3C 4KZ0A 4DI4A 5G05J 3PVLA 3FP3A 3R9MA 3FDHA 2UWJG 5G05C 5CCMA 1XGWA 1JCRA 2QY7A 4UI9C 4GTQA 4U95D 4YDYA 2XPYA 4GYOA 5G04J 3BQOA 1DCEA 3IEGA 4G25A 3RRMB 3RO3A 1KZOA 1UW4B 3ABKE 3B7SA 1TR4A 3D9JA 1E8YA 2JEKA 2IOSA 4GTPA 3IKOB 3L6AA 3T8MA 4HORA 1BLXB 3KEZA 2LO6A 1INZA 4L23A 3CEQA 1HZ4A 4BWRA 3PH0C 1MHQA 4WNFA 3HVEB 2VQ2A 4A3TA 1GW6A 4UI9J 3CK7A 2WB2A 3NQPA 1PY1A 2V4HC 3RAUA 1NA0A 2J07A 3KS2A 2RKKA 3E30A 5CRVA 2KBXA 3PE3A 3QKYA 4UWLA 4U0ZA 5ENOD 2IFUA 1UG3A 2OOEA 5CHEE 3DXMG 3KSQA 5B3SE 4UQYA 2OVFA 5LOZA 2PQRA 3TWVA 3E33A 2EINE 4K5BA 1N0RA 5FIOA 5C1DA 1Z3XA 3DEOA 2F8XK 1PAQA 3JXIA 3QNKA 4UUCA 3NAWA 4GMRA 3R9AB 3ESKA 3ULEG 3L17A 4K5AB 1UN8A 5AQ9A 3AS5A 4URKA 2GRNB 3CGHA 3CK8A 2QFCA 4JEUA 4XEIG 3UM0A 3APDA 3B13A 5HQ8A 4K03A 3GZSA 2PNNA 5FQ7A 4HOQA 3Q75A 3KD7A 1HG5A 4HLLA 2P9SG 4EZJA 4EZKA 4CGWA 3PZ2A 3CVUA 4AXHA 3B7UX 2R05A 2OV8A 4J8DA 4I2WA 5JMND 4FLBA 5D2MC 4N2SA 2AWIA 4ZFHA 2WMNA 2J4BA 2NXPA 1V54E 2DBAA 1SVXA 3FUNA 5A7DB 3V30A 2GRQB 4WUYA 3CVXA 5JJTA 5AN8A 1KT0A 4BT9A 2XZDG 2EQXA 2Q7FA 3HG0D 4N5CA 4HOTA 3PDNA 5M72A 2R03A 2CG2A 3ABLE 3UT4A 2C0MA 1O1SA 1RW2A 5B1BE 3QWPA 5LP0A 2Y1LE 3SO8A 2HM8A 4JL0A 1S64A 4L7TA 2IEJA 3CHOA 2A4ZA 4UI9K 3UUXA 4RSYA 1E8ZA 4LRZA 5EYLA 4B8AA 2X6JA 2I6HA 1H2UA 3Q9UC 1V55E 4TUMA 4N2QA 4LCTA 3SZ7A 4GTTA 3Q4AB 2L0IA 4UWHA 3HRAA 2WMOA 3S7DA 3MKQA 3MZLB 2WXJA 5E76A 3FUEA 2P9LG 1FT1A 3RIBA 4MBGA 3CQCB 1DC2A 4LG6A 3FUDA 1IHGA 1SZ9A 1Y6IA 2MOWA 5HKPA 2ZGDA 1A5EA 3I4RB 1TN8A 3DSTA 4J7WA 1QNFA 2V4LA 4FC8A 2CHZA 4RVBA 4G8LA 2LUHA 4BESA 1N9AA 5BXOA 1HF8A 3DPYA 5JHBA 5AAOA 3FU0A 2X38A 3G2UA 2WM9A 2VSNA 3MX3A 4EBAG 2IF4A 1U2VG 4CCAA 3CVYA 3LDZA 1ELWA 2J09A 3FTWA 4GB9A 4I1OB 3S7JA 3LS8A 1FVHA 3CSFA 3PZ3A 4BSXA 4I43A 2XS8A 5B1AE 3PUJA 3TJPA 2WXLA 3PZ4A 2AXUA 1HG2A 2P9UG 2PM6A 4M3OA 3AG4E 5BXUA 1HS6A 4TUUA 1H19A 5KJNA 2J8SD 2PQNA 4DX5D 4YDOA 3LEWA 4HRMB 2PL2A 3L22A 4JHRA 1E7VA 4CEMA 3Q78A 1W3BA 4U7EB 4UQZA 2F8YA 3FTSA 3PNLB 3VLFA 2KATA 4DI3A 1KLXA 5FT9A 1OY3D 4MLPA 3DSUA 1K3ZD 2X3MA 3VTXA 3C72A 3FUJA 3ZU7B 4TRQA 4RLYA 4WWPA 3EIJA 2WPVA 3BEEA 3GZ1A 4CT0A 1E8WA 3FY4A 3UTMA 2FF4A 2P9KG 5A23A 2IJGX 1OWMA 4KYOB 2JLBA 1N54A 1K1AA 2V5QC 4YDEA 1OXJA 3HIZA 5G55A 3RKVA 4XKCA 4CDNA 1H2VC 2OEVA 1N4PA 3ZRHA 3QWVA 2XGOA 3P2BA 3FH7A 3DRAA 4CDRA 2R02A 5LCWJ 3UI2A 4AY5A 2MRIA 2XRZA 1IHBA 4P29A 1U3CA 3ZXSA 1H2TC 2P9PG 4AP2A 1SZAA 3HXCA 4GMJA 2CFUA 2QC9A 3TWUA 2CG3A 2XEHA 3OXFA 4NURA 3KSLA 1HFAA 3E4BA 1OWNA 4GTVA 4GA1A 2AXZA 4KBQA 1XNFA 4BFRA 4FULA 4CRWA 2BUGA 3UIOC 3CVNA 5KNGA 2AW6A 4A63B 4ANXA 3CKCA 3Q7FA 2GW1A 2L9BA 3D9MA 3SI5A 4ATZD 2EIME 2RG8A 4BETA 4EHMA 3B7TA 2XHEA 4X8QA 4F3VA 4GU5A 3U64A 3FFLA 1L5JA 4HOUA 4F1SA 2IU1A 1Z6TA 2UY1A 3ML9A 5HS0A 4NRHB 3FUIA 5BNWA 4NQ0A 3EU9A 3B7RL 2VGYA 4AV7A 4F6RD 3UMVA 2P58C 2IY0C 3MYVA 4I6EA 1KPSB 2QZAA 2RFAA 4AOFA 4DJAA 5KNHD 3AG3E 1RZ4A 3AU5A 3I3NA 3MEKA 4GCNA 2X6HA 4CDMA 1TJCA 3D9IA 1JCQA 2KCKA 3UPVA 2KCLA 4MS6A 2EILE 5LX8A 1JCSA 5EKQD 2R17C 1MQSA 3NB2A 3IBEA 3UX4A 1D8DA 5D66A 1O5MA 1A17A 3TWXA 3QC1A 2BEDA 1BD8A 4L1BA 4FHKA 3PS6A 3SGHA 3ENEA 1TNYA 5AYWD 3L82A 3SFYA 4XKBA 5FWQA 1OWOA 1OWLA 1TN6A 3HXEA 2I1KA 2HR2A 3LY7A 2GGFA 3QWWA 1YCSB 1DVPA 4APOA 1YA0A 2XZTG 2CFZA 4AIFA 2EIJE 1MX4A 5HI7A 3TL5A 4OAUC 3VTYA 2ETBA 5EILA 3ASFA 3U9WA 1WM5A 3IHYA 4TXRA 2P9NG 1KZPA 2I1JA 1X81A 2MHKA 3QAQA 3CQGB 4HI9A 2IQCA 1FT2A 4MKTA 3UINC 3D9KA 2LNIA 5HRYA 3BG1B 4EBAA 3WXXA 3E34A 1H6PA 4PS3A 4LNUD 4BSZB 1EDUA 3LJ3A 4CZ2D 3CVWA 2V5FA 3FTUA 4ACKA 3TGOA 4JPSA 4N3AA 4QFVA 1TYQG 4O1PA 3LPZA 4B94A 2RFMA 3EHRA 1DNPA 2ZU6B 2M63A 3P1UA 3UM2A 2KXPC 2XGMA 2CHWA 1D9SA 3G2VA 3Q73A 4GPKA 4HNAD 4XE0A 5CRUA 2J4DA 3NOCD 4UWKA 3IV0A 2XPZA 3TG5A 2LXMA 4Z68A 2LXLA 5A6CA 3ZN3A 3SD5A 2J49A 2XENA 1Z3YA 2J9QA
chains in the Genus database with same CATH topology
2FULA 5JHAA 4G26A 1E8XA 4I9EA 3QK0A 1HF8A 3PEVB 4HVBA 3GW4A 4V3IA 3ZFWA 5JHBA 3EHMA 4G23A 1JWGA 4K0RA 1X5BA 4XX5A 1B89A 3PE4A 4ANVA 5ANLA 5T3RA 4Q94A 5BPPA 3FU0A 5ENNA 2X38A 3G2UA 3ZYMA 1QZ2A 3FTZA 3ULQA 2FEZA 2L0TB 2WM9A 2VSNA 3IHVA 3MX3A 4RG6A 2VTBB 3CHMA 3LY9A 5ANRA 5DBKA 4EBAG 3TXNA 2IF4A 2YNQA 2V0PA 3GYZA 1ZU2A 3RRNB 4CCAA 4KT6B 1ZBPA 4WNEA 3CVYA 3LDZA 2R59A 1ELWA 2J09A 3FTWA 4GB9A 4I1OB 4XZ4A 3L16A 1S0PA 4BT8A 3S7JA 3Q49B 2VGXA 1FVHA 3LS8A 3CSFA 3FTVA 3EDTB 1FVFA 1NA3A 4BSXA 3R7QA 4I43A 2XCBA 4J6IA 4KMOA 3PUJA 4HS2A 3ZGQA 1UJKA 4I9CA 3TJPA 5LFAA 4YVQC 3L54A 2WXLA 3G2SA 3JUIA 4FLHA 2WXOA 4ME2A 3AU4A 2AXUA 4G2VA 1HG2A 4DPRA 4GZ6A 3S7BA 3C98A 2PM6A 4M3OA 3MJWA 3UT8A 2YHEA 1HS6A 4ILIA 5FTPA 4TUUA 4AM9A 4F7AA 1H19A 3BG0B 3ZHEB 4IRUA 3O48A 5ARFA 4I6GA 5KJNA 3MV3B 4BTBA 2VTBA 1TEZA 4PS7A 4JW1A 2PQNA 3NZSA 4KVMA 2E0IA 4HFGA 2WQ7A 4OVUA 3RJVA 4Q69A 3LEWA 3VLEA 2PL2A 3L22A 4JHRA 2NSZA 3CVVA 2ONDA 4CGVA 1E7VA 2VSOE 2XGSA 2I9CA 3G2TA 4CEMA 1W3BA 4D10C 3CLJA 3HDXA 4JEHA 4LERA 4UQZA 4YNDA 3FTSA 1IQRA 1TJFA 3Q15A 5J90A 3PNLB 3FUHA 1HX8A 3ASGA 3CKBA 5KJKA 3VLFA 2KATA 3U3WA 4DI3A 4A1SA 1KLXA 4N3BA 5FT9A 4J8FA 1H0AA 4MLPA 3QOUA 3KAEA 3FTXA 4XIFA 2XRYA 3JQ1A 2BTDA 2IOLA 5FQ8A 4TV3A 2X3MA 4E85A 4LUNU 4JVSA 3VTXA 4G11A 3FUJA 3RO2A 4TRQA 4AEZC 3GZ2A 2X6FA 1BPOA 4EPZA 2WXHA 4JA9A 4WWPA 3EIJA 3LVRE 2WPVA 3BEEA 3GZ1A 4CT0A 1E8WA 3CIAA 3FY4A 2FF4A 2UY1B 2Y3AA 5EDSA 2VYIA 5A23A 4H7YA 5CMWA 3LXUX 3MKRA 2IJGX 1UN9A 2DIWA 1HE8A 2KZTA 3RU0A 1OWMA 5EX3A 4GZCA 3CVPA 1EF1C 2JLBA 3EJNA 4KYOB 3FU3A 4U04A 5KCMA 4FADA 1N54A 2WXQA 4JZYA 4KZ0A 4UWGA 4DI4A 5G05J 3PVLA 2FO7A 5DIZA 4KXKB 3HIZA 3SF4A 5T4YA 3FP3A 5G55A 1WY6A 1N52A 5KJMA 4AVXA 2CHXA 3RKVA 2A5UA 3FDHA 2UWJG 4XKCA 4CDNA 1H2VC 3AS8A 5G05C 3ZYLA 1HXIA 2WQHA 5CCMA 4PDXA 1XGWA 2QY7A 3ZRHA 3QWVA 4UI9C 2XGOA 1EPUA 2HO1A 2XPYA 3HYMB 4PH4B 3P2BA 3FH7A 4GYOA 5G04J 4CDRA 3ZIMA 4L2LA 5LCWJ 1EYHA 3ASHA 4AY5A 3IEGA 2MRIA 2XRZA 2Y4UA 4G25A 4P29A 3RRMB 2C2LA 5LCWC 1U3CA 2YHCA 4N39A 5FQ6A 3ZXSA 5G04C 1H2TC 3RO3A 3ZYQA 4AP2A 3L13A 1SZAA 3QJZA 2KCVA 1UW4B 2HYZA 4GMJA 3PNTB 2CFUA 3O4ZA 3B7SA 4I6JA 4C0EA 1ELRA 1E90A 3DPDA 5BV1A 3D9JA 2CG3A 1HO8A 1E8YA 3OXFA 4NURA 3MV2B 2JEKA 1HFAA 3I4GA 3TAXA 3E4BA 4ACLA 3MA5A 2IOSA 2OVBA 1OWNA 4XI9A 4HLEA 4BX8A 2C0LA 5G2NA 3IKOB 4GA1A 3L6AA 3T8MA 4HORA 3SBSA 2AXZA 2WXMA 3APCA 4I1AA 1XNFA 4KBQA 4BFRA 4FULA 4A55A 4CRWA 3ZVVA 5FQ4A 4KZCA 2BUGA 4IULA 3KEZA 3CVNA 2LO6A 4FJYA 2AW6A 1INZA 3PUKA 4J8SA 4GMLA 4L23A 2VSXE 1VDYA 3CHSA 3CEQA 1HZ4A 3OXGA 5AJLA 3ZHEA 4ATGA 4JHKA 2WXFA 2YINA 4A1GA 4BWRA 3D9NA 4ANXA 3PH0C 1MHQA 4WNFA 3QDNA 1IYGA 3CKCA 3OTNA 2GW1A 3HVEB 2VQ2A 4A3TA 2WXIA 1GW6A 2L9BA 3CK7A 3Q5MA 3D9MA 4UI9J 3SI5A 1Y8MA 4J8EA 2WB2A 3NQPA 4WWNA 2AVPA 4AJWA 1PY1A 2LSVA 2RG8A 4JA7A 5AENA 3B7TA 1NA0A 2J07A 2XEVA 2XHEA 3NF1A 3KS2A 2I2OA 4FP7A 1P5QA 2WQ6A 2WXNA 2R5SA 3PE3A 4GYWA 1FCHA 3QKYA 5EX0A 4JC8A 4UWLA 4U0ZA 4F3VA 2IFUA 4GU5A 1UG3A 3U66A 4MRUA 3U64A 4XI0A 3FFLA 1L5JA 4HOUA 3FUKA 4WAFA 3FUMA 2OOEA 2WXKA 2IU1A 4F1SA 2KZTB 4ILGA 1Z6TA 2UY1A 5CHEE 3ML9A 4UQXA 3LKUA 4NRHB 3D9LA 2Y4TA 4UQYA 4BX9A 2ILRA 2OVFA 3FUIA 5LOZA 4FHJA 5BNWA 2VGXB 2RD0A 3T5XA 4GZ3A 2PQRA 4B8CB 2LAHA 2PM7A 4B0ZA 3JYSA 3LCAA 4NQ0A 3UT7A 4U07A 1Z3XA 4UWFA 5C1DA 3MGBA 5T8IA 1OWPA 4JHJA 2X6IA 3B7RL 2VGYA 4AV7A 1PAQA 3QNKA 4DK5A 3N71A 2P58C 4WNDA 3UMVA 3ML8A 4U63A 3R9AB 2XQ0A 3MYVA 5KJLA 4JXTA 3UQ3A 4I6EA 5BW8C 3ESKA 3T5VA 3U4TA 4DJAA 4AOFA 3L17A 4A3VA 3CV0A 1UN8A 2KC7A 4ANWA 3AS5A 4URKA 1LF8A 3RRUA 3CGHA 3AU5A 3CK8A 3G2WA 3I3NA 3MEKA 3ONLA 2FBNA 4GCNA 4ILHB 2X6HA 3URZA 2QFCA 4CDMA 2PZIA 4JEUA 4R7LA 4KVOA 3CHRA 3FEYA 1TJCA 3D9IA 2V8SE 3MCXA 3APDA 2KCKA 2WXPA 3UPVA 4EZLA 2KCLA 3D9PA 2L6JA 1JPLA 3LY8A 4MS6A 5LX8A 3B13A 5HQ8A 4K03A 3GZSA 5EKQD 5FQ7A 2R17C 4HOQA 1MQSA 3KD7A 4GYYA 1HG5A 2LAIA 5BUZA 3IBEA 4RG9A 4C0MA 3UX4A 4EZJA 4EZKA 4EECA 4CGWA 4PS8A 3LYAA 4WWOA 3AS4A 4G24A 1A17A 1IQUA 4FU3A 2BF0X 3PRZA 3QC1A 3SHFA 4I1MA 2GRMA 3VLDA 4L1BA 4FA6A 4FHKA 5AIJA 3NZUA 5ARGA 4AXHA 3CVUA 4ABNA 3FEXA 3B7UX 3PS6A 3QARA 3SGHA 3I5PA 3LVQE 3ENEA 2OV8A 3MKQB 5J08A 3K9IA 4J8DA 2XPIA 4AY6A 5E75A 5AYWD 4I2WA 3TXMA 4FLBA 3FULA 4XKBA 5FWQA 4N2SA 1HU3A 3S2AA 2AWIA 3EIQC 2WMNA 1OWOA 2J4BA 1OWLA 1SQMA 2KM4A 3FHEA 4EQFA 4WNGA 2I1KA 4HXIA 2HR2A 3FUFA 2DBAA 2NXPA 4YVOA 3ASDA 3FUNA 2XCCA 3FH5A 3LY7A 5A7DB 4L2YA 2WXGA 1E7UA 1KT1A 2WXRA 2GGFA 3FU5A 1JWFA 3QWWA 5D0OD 3R7RA 4DLOA 4GAAA 3D9OA 1DVPA 2IONA 4WUYA 1NP7A 3CVXA 4APOA 1YA0A 5JJTA 4BT9A 1KT0A 1U3DA 5CCLA 3TG4A 2CFZA 4AIFA 4W9RA 5CMYA 2EQXA 3D3MA 2Q7FA 5HI7A 4N5CA 3CHPA 4GA0A 3TL5A 3FU6A 1PC2A 3VTYA 1QQEA 3DBSA 3PEUB 4HOTA 3PDNA 5M72A 5FZRA 3QB2A 4I17A 2CG2A 3ASFA 3UT4A 3U9WA 3PREA 2C0MA 4PUCA 1JUQA 4GZDA 4FJZA 1WM5A 3ZPJA 1NZNA 3IHYA 3QWPA 3ZEFA 4C9BB 3OAWA 5LP0A 4OYSA 2GRLA 3SNXA 2HM8A 4JL0A 3CVQA 3JCKC 3FH8A 5FZQA 4L7TA 3FWVA 2I1JA 3CHOA 5JJ6A 2MHKA 2A4ZA 4GCOA 4UI9K 2VJ8A 3QAQA 3UUXA 3CQGB 4RSYA 1HH8A 1E8ZA 3CR3A 3FTYA 4GZ5A 4LRZA 4CT4A 2IQCA 4F53A 4B8AA 2X6JA 5AJDA 4MKTA 4APFA 4BY6A 2DCPA 2I6HA 4U0UA 1H2UA 3D9KA 2LNIA 5BT1A 4U0SA 3ZYKA 5FJYA 3BG1B 4N2QA 4LCTA 4EBAA 3RK6A 3SZ7A 5FZSA 4G1TA 3WXXA 4BTAA 3Q4AB 4PS3A 2L0IA 3L08A 4N3CA 4UWHA 1EDUA 1WAO1 2WMOA 2LSUA 3S7DA 4B89A 3MKQA 3MZLB 3LJ3A 2WXJA 3CVWA 2V5FA 2FI7A 5E76A 3FUEA 3JQ0A 3FTUA 3SBTB 1OUVA 4Q96A 3RIBA 4ACKA 3ESLA 3TGOA 4JPSA 4NACA 4N3AA 4H7XA 4O6FA 4QFVA 4Y6WA 3CQCB 5C2YA 2X6KA 4HOSA 4J0UA 3CSTA 2E2EA 3LPZA 4B94A 5JJ7A 1DNPA 3FUDA 2ZU6B 3HHMA 4E6HA 2M63A 3S7FA 3P1UA 4OVVA 3CHQA 4DLQA 3OXLA 4Y6CA 2NC9A 1IHGA 1SZ9A 1E96B 4GA2A 3Q47B 2WVIA 4IYPA 2XGMA 3CVLA 2CHWA 4LEUA 2VSYA 3ONKA 3SFZA 1Y6IA 3CK9A 3G2VA 2AXVA 2MOWA 4GPKA 4I2ZA 3I4RB 2J4DA 2YQ8A 4XE0A 2J08A 5D0QD 1ELKA 1QNFA 3HVEA 1UJJA 2V4LA 3EHNA 4UWKA 4FC8A 3IV0A 2XPZA 1H6KA 2CHZA 3PZDA 3TG5A 4ANUA 4RVBA 4U8HA 3ZW3A 3APFA 5BV0A 4IN3B 5A6CA 3ZN3A 3SD5A 2J49A 1Z3YA 2J9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFU A;  2VYI A;  4H7Y A;  4WUY A;  4XI0 A;  3FFL A;  4G26 A;  4HOU A;  1YA0 A;  3MKR A;  2OOE A;  3RU0 A;  1KT0 A;  4APO A;  4BT9 A;  4I9E A;  5JJT A;  5EX3 A;  3CVP A;  4KYO B;  2JLB A;  3TG4 A;  4U04 A;  4AIF A;  2UY1 A;  4W9R A;  5CHE E;  3GW4 A;  4UQX A;  2Q7F A;  3ZFW A;  3LKU A;  5G05 J;  4G23 A;  5HI7 A;  4N5C A;  2FO7 A;  4GA0 A;  4NRH B;  2Y4T A;  5DIZ A;  1B89 A;  4KXK B;  4UQY A;  1PC2 A;  3PE4 A;  3VTY A;  1QQE A;  4HOT A;  5BNW A;  2VGX B;  3PDN A;  5M72 A;  3SF4 A;  4GZ3 A;  2PQR A;  3FP3 A;  5FZR A;  4I17 A;  5KJM A;  3JYS A;  3LCA A;  4NQ0 A;  3ASF A;  4U07 A;  1QZ2 A;  3RKV A;  5C1D A;  3ULQ A;  2FEZ A;  2C0M A;  4RG6 A;  2UWJ G;  2VSN A;  2VGY A;  3AS8 A;  5G05 C;  3N71 A;  1HXI A;  1WM5 A;  2P58 C;  1NZN A;  2WQH A;  3LY9 A;  3QWP A;  4WND A;  5DBK A;  3ZPJ A;  5CCM A;  3QWV A;  4UI9 C;  2IF4 A;  2XGO A;  2HO1 A;  3GYZ A;  3HYM B;  3R9A B;  1ZU2 A;  5KJL A;  1ZBP A;  4GYO A;  4WNE A;  4JL0 A;  3CVQ A;  5G04 J;  3UQ3 A;  5BW8 C;  1ELW A;  3ESK A;  4CDR A;  5FZQ A;  3U4T A;  3FWV A;  5JJ6 A;  2MHK A;  4BT8 A;  3CV0 A;  3Q49 B;  3S7J A;  2VGX A;  2KC7 A;  5LCW J;  4GCO A;  3ASH A;  3EDT B;  3AS5 A;  1NA3 A;  3IEG A;  4UI9 K;  3UUX A;  4AY5 A;  2Y4U A;  3CK8 A;  4G25 A;  5LCW C;  2C2L A;  3MEK A;  2FBN A;  1HH8 A;  2YHC A;  4GCN A;  4N39 A;  2XCB A;  4GZ5 A;  3URZ A;  2QFC A;  5G04 C;  3RO3 A;  4Y6C A;  2PZI A;  4I9C A;  3ZGQ A;  4YVQ C;  4U0U A;  2I6H A;  2KCV A;  2LNI A;  1TJC A;  2HYZ A;  4U0S A;  5BT1 A;  4ME2 A;  5FJY A;  4N2Q A;  5CCL A;  1ELR A;  2KCK A;  4G2V A;  5FZS A;  4G1T A;  3SZ7 A;  3WXX A;  4BTA A;  4GZ6 A;  3Q4A B;  3S7B A;  3UPV A;  2KCL A;  3OXF A;  4N3C A;  2L6J A;  5FTP A;  1WAO 1;  3LY8 A;  2LSU A;  3MV2 B;  3S7D A;  4AM9 A;  4AY6 A;  5HQ8 A;  3ZHE B;  3TAX A;  3O48 A;  3E4B A;  5ARF A;  5EKQ D;  3MA5 A;  5KJN A;  4HOQ A;  2V5F A;  2FI7 A;  3MV3 B;  4XI9 A;  4BTB A;  3KD7 A;  4GYY A;  2C0L A;  4GA1 A;  4RG9 A;  1OUV A;  2PQN A;  4HOR A;  3RIB A;  4I1A A;  4CGW A;  4KBQ A;  1XNF A;  3TGO A;  4N3A A;  3LYA A;  3AS4 A;  4G24 A;  1A17 A;  4H7X A;  4O6F A;  2BUG A;  4Y6W A;  3RJV A;  3CVN A;  2PL2 A;  4JHR A;  4HOS A;  4J0U A;  2OND A;  2E2E A;  3LPZ A;  5ARG A;  4B94 A;  4CGV A;  2XGS A;  3CEQ A;  4ABN A;  1HZ4 A;  5JJ7 A;  1W3B A;  3OXG A;  3ZHE A;  4BWR A;  4UQZ A;  3S7F A;  4YND A;  3OXL A;  3K9I A;  3Q15 A;  2NC9 A;  1IHG A;  2XPI A;  4J8D A;  3QDN A;  1E96 B;  4GA2 A;  4WNF A;  3ASG A;  3CKB A;  3CKC A;  3Q47 B;  2KAT A;  4I2W A;  5AYW D;  2XGM A;  5KJK A;  2GW1 A;  3CVL A;  1KLX A;  4N3B A;  4A1S A;  2VQ2 A;  3U3W A;  4LEU A;  2VSY A;  5FT9 A;  4J8F A;  3Q5M A;  3CK7 A;  4UI9 J;  3CK9 A;  4N2S A;  1Y8M A;  3QOU A;  4J8E A;  3KAE A;  4GPK A;  4I2Z A;  4XIF A;  2AVP A;  2YQ8 A;  5D0Q D;  2LSV A;  4EQF A;  4JA7 A;  3VTX A;  4WNG A;  3RO2 A;  1NA0 A;  2HR2 A;  1IYG A;  2XEV A;  2DBA A;  3TG5 A;  3GZ2 A;  3NF1 A;  4YVO A;  3KS2 A;  3ASD A;  2XCC A;  4JA9 A;  1P5Q A;  3LY7 A;  5A7D B;  2WPV A;  3BEE A;  3GZ1 A;  1KT1 A;  2R5S A;  3PE3 A;  4GYW A;  3QWW A;  1FCH A;  4IN3 B;  5D0O D;  3QKY A;  3ZN3 A;  5EX0 A;  5A6C A;  2FF4 A;  2UY1 B;  2J9Q A;  4U0Z A;  4F3V A; 
#chains in the Genus database with same CATH topology
 3X2Q E;  4G26 A;  1BI8 B;  4I9E A;  3QK0 A;  3PEV B;  3TWT A;  4V3I A;  1JWG A;  1X5B A;  4XX5 A;  3PE4 A;  1OCC E;  1SA5 A;  5T3R A;  4Q94 A;  5BPP A;  5ENN A;  3ZYM A;  4U96 D;  4RG6 A;  2VTB B;  2EIK E;  5CEA A;  3LY9 A;  2YNQ A;  2NYJ A;  4WNE A;  2R59 A;  2MYO A;  4XZ4 A;  4BT8 A;  3FTV A;  3ZGQ A;  1UJK A;  1MJ0 A;  2WXO A;  4ME2 A;  4G2V A;  4DPR A;  2YHE A;  5FTP A;  4AM9 A;  3O48 A;  5EN5 D;  3C3Q A;  3MV3 B;  3NZS A;  4KVM A;  2E0I A;  1FPP A;  4HFG A;  4DX7 D;  2OND A;  2XGS A;  1QBQ A;  3CLJ A;  4JEH A;  1IQR A;  3Q15 A;  5J90 A;  3CKB A;  4NIK A;  4A1S A;  4N3B A;  4J8F A;  1G3N B;  3EHQ A;  3FTX A;  2XRY A;  2IOL A;  1OT8 A;  4G11 A;  3RO2 A;  1AWC B;  1BPO A;  4EPZ A;  4K5C A;  2WXH A;  1S63 A;  3CIA A;  3UKR G;  4H7Y A;  5CMW A;  3LXU X;  1UN9 A;  5KCM A;  3CVP A;  1EF1 C;  4U04 A;  4FAD A;  1AP7 A;  2WXQ A;  4UWG A;  2Y69 E;  2FO7 A;  1NFI E;  2P2C P;  4KXK B;  3DSW A;  3SF4 A;  1WY6 A;  5KJM A;  4AVX A;  2CHX A;  3J5P A;  3AS8 A;  2WQH A;  4PDX A;  4BER A;  1EPU A;  2HO1 A;  3HYM B;  2L6B A;  3ZIM A;  4L2L A;  1TNU A;  2ETA A;  1EYH A;  3ASH A;  5LCW C;  2DZO A;  2YHC A;  5G04 C;  3ZYQ A;  3L13 A;  3QJZ A;  2KCV A;  2HYZ A;  3PNT B;  3O4Z A;  4C0E A;  1E90 A;  5BV1 A;  4HRN A;  3ZUV B;  3MV2 B;  3I4G A;  4ACL A;  2HE0 A;  3MA5 A;  4BX8 A;  1LD8 A;  2WXM A;  4TXQ A;  4A55 A;  4DX2 A;  5FQ4 A;  4IUL A;  1N4R A;  4FJY A;  1VDY A;  4ATG A;  4JHK A;  2H6F A;  3D9N A;  3QDN A;  1IYG A;  2GRO B;  3Q5M A;  1Y8M A;  1N95 A;  4WWN A;  2AVP A;  2JAB A;  5AEN A;  1N11 A;  2XEV A;  4FP7 A;  1P5Q A;  2QYJ A;  2WQ6 A;  2WXN A;  5ENR D;  2R5S A;  4GYW A;  1FCH A;  5EX0 A;  4JC8 A;  5CER B;  3FUK A;  4WAF A;  3FUM A;  2WXK A;  2R2L A;  1YYH A;  1IKN D;  4DX6 D;  4UQX A;  3W9G A;  3D9L A;  3JUE A;  2VGX B;  2RD0 A;  3T5X A;  2F37 A;  3LCA A;  3MGB A;  5T8I A;  1OWP A;  2X6I A;  3N71 A;  4WND A;  1QYM A;  3C3R A;  4U63 A;  3TWQ A;  3T5V A;  3U4T A;  2KC7 A;  1YMP A;  4ANW A;  1LF8 A;  2BKK B;  3G2W A;  4ILH B;  2GRR B;  2PZI A;  4KVO A;  3FEY A;  4CYM D;  2WXP A;  3V2O A;  4EZL A;  3D9P A;  2L6J A;  2OEW A;  2BKG A;  4GYY A;  4RG9 A;  4EEC A;  4PS8 A;  3LYA A;  4YDW A;  3AS4 A;  1TNO A;  4FU3 A;  3SHF A;  4I1M A;  2GRM A;  1SA4 A;  4HRL A;  1TN7 A;  5E75 A;  3TXM A;  3FUL A;  3JXJ A;  3DSV A;  4GPM A;  3S2A A;  2DYS E;  1SQM A;  3EU5 A;  3FHE A;  4EQF A;  1Z5S C;  4HBD A;  2AJA A;  3R7R A;  2WXR A;  3FU5 A;  1JWF A;  3D9O A;  1O1R A;  3V79 K;  1NP7 A;  5ENP D;  2DVW A;  4W9R A;  5CMY A;  3CHP A;  3FU6 A;  5EYP F;  1QQE A;  3DBS A;  3PEU B;  3QB2 A;  4I17 A;  2P9I G;  4PUC A;  3L9T A;  4GZD A;  3E32 A;  4FJZ A;  3ZPJ A;  1NZN A;  3UKU G;  3ZEF A;  3OAW A;  3FH8 A;  5FZQ A;  3FWV A;  2VJ8 A;  2A5E A;  1HH8 A;  4GZ5 A;  5EIB E;  3HXD A;  4BY6 A;  4U0U A;  2H6I A;  3ABM E;  3C3O A;  5BT1 A;  4U0S A;  3ZYK A;  5FJY A;  3RK6 A;  2ZXW E;  5FZS A;  4BTA A;  5AAR A;  3L08 A;  4N3C A;  2LSU A;  3LJN A;  3JQ0 A;  3SBT B;  1OUV A;  3SY2 A;  1UOH A;  4H7X A;  4HOS A;  4J0U A;  3CST A;  2E2E A;  5JJ7 A;  3S7F A;  4OVV A;  3CHQ A;  4DLQ A;  4Y6C A;  4LSZ E;  1E96 B;  4GA2 A;  3Q47 B;  2WVI A;  1BI7 B;  2VSY A;  3ONK A;  3SFZ A;  3CK9 A;  3DSS A;  2J08 A;  5D0Q D;  3PZD A;  4ZHB A;  3APF A;  4IN3 B;  2FUL A;  5JHA A;  2DWZ A;  4HVB A;  1SW6 A;  3GW4 A;  4GTO A;  3EHM A;  4K0R A;  3HXF A;  1B89 A;  3NOG D;  4ANV A;  1S70 B;  5ANL A;  3FTZ A;  2FEZ A;  2L0T B;  3IHV A;  4N5Q A;  5ANR A;  5DBK A;  3TXN A;  2V0P A;  3GYZ A;  3RRN B;  1MYO A;  3L16 A;  5ENS D;  3Q49 B;  1FVF A;  3EDT B;  3DWL G;  3UIP C;  2XCB A;  4J6I A;  4KMO A;  4I9C A;  5LFA A;  3JUI A;  1O1T A;  3BU8 A;  3ASN E;  3UT8 A;  4ILI A;  4F7A A;  3BG0 B;  2ZGG A;  4IRU A;  4O1O A;  3ZHE B;  4HI8 A;  2VTB A;  1TEZ A;  4B93 B;  4PS7 A;  2WQ7 A;  4OVU A;  4Q69 A;  3AG1 E;  3T9K A;  3VLE A;  3CVV A;  4HB5 A;  3G2T A;  3HDX A;  4LER A;  4TXP A;  5KJK A;  3UM3 A;  3JQ1 A;  4E85 A;  4TV3 A;  4LUN U;  4JVS A;  3TWS A;  5KWD A;  3GZ2 A;  3ASO E;  3LVR E;  1N0Q A;  1WG0 A;  2UY1 B;  2VYI A;  3RSE G;  1HE8 A;  3EJN A;  5AQA A;  2IO2 C;  5DIZ A;  3W9F A;  5T4Y A;  1N52 A;  2A5U A;  3ZYL A;  1HXI A;  4G8K A;  5JA4 D;  4PH4 B;  3E37 A;  2VGE A;  1Q2Z A;  2Y4U A;  2C2L A;  3KEA A;  4N39 A;  3HXB A;  5FQ6 A;  1OCR E;  2Y0B G;  5IY5 E;  1N94 A;  4I6J A;  1ELR A;  1D8E A;  3DPD A;  3UM1 A;  4RQI A;  1HO8 A;  3ZNG A;  3TAX A;  3D9H A;  2OVB A;  4XI9 A;  4HLE A;  2C0L A;  5G2N A;  3SBS A;  3APC A;  4I1A A;  3ZVV A;  4KZC A;  4JB8 P;  4OAV B;  3PUK A;  3Q79 A;  3PZ1 A;  4GML A;  4J8S A;  5CEC B;  2VSX E;  3CHS A;  4J8Y A;  3OXG A;  5AJL A;  3ZHE A;  2WXF A;  2YIN A;  4A1G A;  4O60 A;  5KBA A;  3OTN A;  2WXI A;  4U8V D;  5AQ7 A;  4J8E A;  3WG7 E;  4AJW A;  1MZC A;  2LSV A;  4JA7 A;  3NF1 A;  5ENQ D;  2I2O A;  3B95 A;  5CBO A;  1K8K G;  2FO1 E;  3U66 A;  4MRU A;  4XI0 A;  3NBN B;  2KZT B;  4ILG A;  2B6C A;  5ITZ F;  3LKU A;  2Y4T A;  4BX9 A;  2ILR A;  4FHJ A;  4HQD A;  4GZ3 A;  4B8C B;  2LAH A;  2PM7 A;  4B0Z A;  3JYS A;  3UT7 A;  4U07 A;  4UWF A;  4JHJ A;  2OCC E;  4DK5 A;  2ETC A;  3ML8 A;  2XQ0 A;  5KJL A;  4JXT A;  3UQ3 A;  5BW8 C;  4A3V A;  3CV0 A;  3RRU A;  4GTM A;  3ONL A;  2FBN A;  3URZ A;  4R7L A;  3CHR A;  4LNB A;  2V8S E;  3MCX A;  5CBN A;  4GTR A;  3ULY A;  5AQB A;  2GRP B;  1JPL A;  3LY8 A;  3DSX A;  2LAI A;  5BUZ A;  2XEE A;  4C0M A;  3SFX A;  4WWO A;  4G24 A;  1IQU A;  2BF0 X;  1LTX A;  3PRZ A;  3VLD A;  4FA6 A;  5AIJ A;  3NZU A;  5ARG A;  4ABN A;  3V2X A;  3FEX A;  3QAR A;  3I5P A;  3LVQ E;  3MKQ B;  5J08 A;  3K9I A;  2XPI A;  4AY6 A;  3TWW A;  1HU3 A;  3EIQ C;  3J5Q B;  2ZIR A;  5ENT D;  2KM4 A;  4WNG A;  4HXI A;  3FUF A;  4GTS A;  4YVO A;  3ASD A;  2XCC A;  3FH5 A;  5H7P A;  4L2Y A;  2WXG A;  1E7U A;  1KT1 A;  4DLO A;  5D0O D;  4BEP A;  4GAA A;  2ION A;  1U3D A;  5CCL A;  3TG4 A;  3D3M A;  4GA0 A;  1PC2 A;  5FZR A;  3PRE A;  5FIN A;  1JUQ A;  4L9P A;  4LNG A;  4C9B B;  4OYS A;  2GRL A;  3SNX A;  3CVQ A;  4DUI A;  3JCK C;  5JJ6 A;  4GCO A;  3CR3 A;  3FTY A;  4CT4 A;  4F53 A;  5AJD A;  4APF A;  2DCP A;  4G1T A;  4U8Y D;  1BU9 A;  1WAO 1;  4B89 A;  1TNB A;  4QQI A;  2FI7 A;  3UXG A;  4Q96 A;  3ESL A;  4NAC A;  4O6F A;  4Y6W A;  5C2Y A;  2X6K A;  2H6G A;  3HHM A;  4E6H A;  3OXL A;  2NC9 A;  1OCO E;  4IYP A;  3CVL A;  4LEU A;  2B0O E;  2AXV A;  3ZKJ A;  4I2Z A;  4M7C A;  2YQ8 A;  3V31 A;  1ELK A;  3HVE A;  1UJJ A;  3EHN A;  5EID A;  1H6K A;  1OCZ E;  4ANU A;  4U8H A;  3ZW3 A;  5BV0 A;  4DRX E;  1E8X A;  1MX6 A;  2DYR E;  3AJI A;  3ZFW A;  1WDY A;  4G23 A;  3EUV A;  4DX1 A;  3AG2 E;  1QZ2 A;  3ULQ A;  1K1B A;  4C48 B;  3SQV A;  3CHM A;  1ZU2 A;  4KT6 B;  1ZBP A;  1DCQ A;  1S0P A;  2VGX A;  1IXV A;  1NL4 A;  1NA3 A;  3R7Q A;  3IXE A;  4HS2 A;  3Q9N C;  2DZN A;  4YVQ C;  3L54 A;  3G2S A;  2ZIS A;  4FLH A;  3AU4 A;  1TNZ A;  2F0Y A;  4GZ6 A;  3S7B A;  3C98 A;  4F1P A;  3MJW A;  1H6O A;  3ISM C;  1LD7 A;  4JD2 G;  5ARF A;  3B7B A;  4I6G A;  1MX2 A;  4BTB A;  1N4S A;  3TWR A;  4JW1 A;  3RJV A;  3DEP A;  2XS1 A;  2NSZ A;  4CGV A;  2VSO E;  1N4Q A;  2QYU A;  2I9C A;  4D10 C;  4YND A;  1TJF A;  3FUH A;  1HX8 A;  3ASG A;  3BUA A;  3U3W A;  3ZXP A;  1H0A A;  3QOU A;  3KAE A;  4XIF A;  2BTD A;  5FQ8 A;  1NI1 A;  2H6H A;  4AEZ C;  2X6F A;  3C5R A;  1ZB1 A;  5CED B;  4JA9 A;  3AAA C;  2Y3A A;  5EDS A;  3F6Q A;  3MKR A;  2KZT A;  3RU0 A;  2DIW A;  3Q7A A;  3DXK G;  4GZC A;  5EX3 A;  3T8K A;  3FU3 A;  4JZY A;  2IO3 C;  4KZ0 A;  4DI4 A;  5G05 J;  3PVL A;  3FP3 A;  3R9M A;  3FDH A;  2UWJ G;  5G05 C;  5CCM A;  1XGW A;  1JCR A;  2QY7 A;  4UI9 C;  4GTQ A;  4U95 D;  4YDY A;  2XPY A;  4GYO A;  5G04 J;  3BQO A;  1DCE A;  3IEG A;  4G25 A;  3RRM B;  3RO3 A;  1KZO A;  1UW4 B;  3ABK E;  3B7S A;  1TR4 A;  3D9J A;  1E8Y A;  2JEK A;  2IOS A;  4GTP A;  3IKO B;  3L6A A;  3T8M A;  4HOR A;  1BLX B;  3KEZ A;  2LO6 A;  1INZ A;  4L23 A;  3CEQ A;  1HZ4 A;  4BWR A;  3PH0 C;  1MHQ A;  4WNF A;  3HVE B;  2VQ2 A;  4A3T A;  1GW6 A;  4UI9 J;  3CK7 A;  2WB2 A;  3NQP A;  1PY1 A;  2V4H C;  3RAU A;  1NA0 A;  2J07 A;  3KS2 A;  2RKK A;  3E30 A;  5CRV A;  2KBX A;  3PE3 A;  3QKY A;  4UWL A;  4U0Z A;  5ENO D;  2IFU A;  1UG3 A;  2OOE A;  5CHE E;  3DXM G;  3KSQ A;  5B3S E;  4UQY A;  2OVF A;  5LOZ A;  2PQR A;  3TWV A;  3E33 A;  2EIN E;  4K5B A;  1N0R A;  5FIO A;  5C1D A;  1Z3X A;  3DEO A;  2F8X K;  1PAQ A;  3JXI A;  3QNK A;  4UUC A;  3NAW A;  4GMR A;  3R9A B;  3ESK A;  3ULE G;  3L17 A;  4K5A B;  1UN8 A;  5AQ9 A;  3AS5 A;  4URK A;  2GRN B;  3CGH A;  3CK8 A;  2QFC A;  4JEU A;  4XEI G;  3UM0 A;  3APD A;  3B13 A;  5HQ8 A;  4K03 A;  3GZS A;  2PNN A;  5FQ7 A;  4HOQ A;  3Q75 A;  3KD7 A;  1HG5 A;  4HLL A;  2P9S G;  4EZJ A;  4EZK A;  4CGW A;  3PZ2 A;  3CVU A;  4AXH A;  3B7U X;  2R05 A;  2OV8 A;  4J8D A;  4I2W A;  5JMN D;  4FLB A;  5D2M C;  4N2S A;  2AWI A;  4ZFH A;  2WMN A;  2J4B A;  2NXP A;  1V54 E;  2DBA A;  1SVX A;  3FUN A;  5A7D B;  3V30 A;  2GRQ B;  4WUY A;  3CVX A;  5JJT A;  5AN8 A;  1KT0 A;  4BT9 A;  2XZD G;  2EQX A;  2Q7F A;  3HG0 D;  4N5C A;  4HOT A;  3PDN A;  5M72 A;  2R03 A;  2CG2 A;  3ABL E;  3UT4 A;  2C0M A;  1O1S A;  1RW2 A;  5B1B E;  3QWP A;  5LP0 A;  2Y1L E;  3SO8 A;  2HM8 A;  4JL0 A;  1S64 A;  4L7T A;  2IEJ A;  3CHO A;  2A4Z A;  4UI9 K;  3UUX A;  4RSY A;  1E8Z A;  4LRZ A;  5EYL A;  4B8A A;  2X6J A;  2I6H A;  1H2U A;  3Q9U C;  1V55 E;  4TUM A;  4N2Q A;  4LCT A;  3SZ7 A;  4GTT A;  3Q4A B;  2L0I A;  4UWH A;  3HRA A;  2WMO A;  3S7D A;  3MKQ A;  3MZL B;  2WXJ A;  5E76 A;  3FUE A;  2P9L G;  1FT1 A;  3RIB A;  4MBG A;  3CQC B;  1DC2 A;  4LG6 A;  3FUD A;  1IHG A;  1SZ9 A;  1Y6I A;  2MOW A;  5HKP A;  2ZGD A;  1A5E A;  3I4R B;  1TN8 A;  3DST A;  4J7W A;  1QNF A;  2V4L A;  4FC8 A;  2CHZ A;  4RVB A;  4G8L A;  2LUH A;  4BES A;  1N9A A;  5BXO A;  1HF8 A;  3DPY A;  5JHB A;  5AAO A;  3FU0 A;  2X38 A;  3G2U A;  2WM9 A;  2VSN A;  3MX3 A;  4EBA G;  2IF4 A;  1U2V G;  4CCA A;  3CVY A;  3LDZ A;  1ELW A;  2J09 A;  3FTW A;  4GB9 A;  4I1O B;  3S7J A;  3LS8 A;  1FVH A;  3CSF A;  3PZ3 A;  4BSX A;  4I43 A;  2XS8 A;  5B1A E;  3PUJ A;  3TJP A;  2WXL A;  3PZ4 A;  2AXU A;  1HG2 A;  2P9U G;  2PM6 A;  4M3O A;  3AG4 E;  5BXU A;  1HS6 A;  4TUU A;  1H19 A;  5KJN A;  2J8S D;  2PQN A;  4DX5 D;  4YDO A;  3LEW A;  4HRM B;  2PL2 A;  3L22 A;  4JHR A;  1E7V A;  4CEM A;  3Q78 A;  1W3B A;  4U7E B;  4UQZ A;  2F8Y A;  3FTS A;  3PNL B;  3VLF A;  2KAT A;  4DI3 A;  1KLX A;  5FT9 A;  1OY3 D;  4MLP A;  3DSU A;  1K3Z D;  2X3M A;  3VTX A;  3C72 A;  3FUJ A;  3ZU7 B;  4TRQ A;  4RLY A;  4WWP A;  3EIJ A;  2WPV A;  3BEE A;  3GZ1 A;  4CT0 A;  1E8W A;  3FY4 A;  3UTM A;  2FF4 A;  2P9K G;  5A23 A;  2IJG X;  1OWM A;  4KYO B;  2JLB A;  1N54 A;  1K1A A;  2V5Q C;  4YDE A;  1OXJ A;  3HIZ A;  5G55 A;  3RKV A;  4XKC A;  4CDN A;  1H2V C;  2OEV A;  1N4P A;  3ZRH A;  3QWV A;  2XGO A;  3P2B A;  3FH7 A;  3DRA A;  4CDR A;  2R02 A;  5LCW J;  3UI2 A;  4AY5 A;  2MRI A;  2XRZ A;  1IHB A;  4P29 A;  1U3C A;  3ZXS A;  1H2T C;  2P9P G;  4AP2 A;  1SZA A;  3HXC A;  4GMJ A;  2CFU A;  2QC9 A;  3TWU A;  2CG3 A;  2XEH A;  3OXF A;  4NUR A;  3KSL A;  1HFA A;  3E4B A;  1OWN A;  4GTV A;  4GA1 A;  2AXZ A;  4KBQ A;  1XNF A;  4BFR A;  4FUL A;  4CRW A;  2BUG A;  3UIO C;  3CVN A;  5KNG A;  2AW6 A;  4A63 B;  4ANX A;  3CKC A;  3Q7F A;  2GW1 A;  2L9B A;  3D9M A;  3SI5 A;  4ATZ D;  2EIM E;  2RG8 A;  4BET A;  4EHM A;  3B7T A;  2XHE A;  4X8Q A;  4F3V A;  4GU5 A;  3U64 A;  3FFL A;  1L5J A;  4HOU A;  4F1S A;  2IU1 A;  1Z6T A;  2UY1 A;  3ML9 A;  5HS0 A;  4NRH B;  3FUI A;  5BNW A;  4NQ0 A;  3EU9 A;  3B7R L;  2VGY A;  4AV7 A;  4F6R D;  3UMV A;  2P58 C;  2IY0 C;  3MYV A;  4I6E A;  1KPS B;  2QZA A;  2RFA A;  4AOF A;  4DJA A;  5KNH D;  3AG3 E;  1RZ4 A;  3AU5 A;  3I3N A;  3MEK A;  4GCN A;  2X6H A;  4CDM A;  1TJC A;  3D9I A;  1JCQ A;  2KCK A;  3UPV A;  2KCL A;  4MS6 A;  2EIL E;  5LX8 A;  1JCS A;  5EKQ D;  2R17 C;  1MQS A;  3NB2 A;  3IBE A;  3UX4 A;  1D8D A;  5D66 A;  1O5M A;  1A17 A;  3TWX A;  3QC1 A;  2BED A;  1BD8 A;  4L1B A;  4FHK A;  3PS6 A;  3SGH A;  3ENE A;  1TNY A;  5AYW D;  3L82 A;  3SFY A;  4XKB A;  5FWQ A;  1OWO A;  1OWL A;  1TN6 A;  3HXE A;  2I1K A;  2HR2 A;  3LY7 A;  2GGF A;  3QWW A;  1YCS B;  1DVP A;  4APO A;  1YA0 A;  2XZT G;  2CFZ A;  4AIF A;  2EIJ E;  1MX4 A;  5HI7 A;  3TL5 A;  4OAU C;  3VTY A;  2ETB A;  5EIL A;  3ASF A;  3U9W A;  1WM5 A;  3IHY A;  4TXR A;  2P9N G;  1KZP A;  2I1J A;  1X81 A;  2MHK A;  3QAQ A;  3CQG B;  4HI9 A;  2IQC A;  1FT2 A;  4MKT A;  3UIN C;  3D9K A;  2LNI A;  5HRY A;  3BG1 B;  4EBA A;  3WXX A;  3E34 A;  1H6P A;  4PS3 A;  4LNU D;  4BSZ B;  1EDU A;  3LJ3 A;  4CZ2 D;  3CVW A;  2V5F A;  3FTU A;  4ACK A;  3TGO A;  4JPS A;  4N3A A;  4QFV A;  1TYQ G;  4O1P A;  3LPZ A;  4B94 A;  2RFM A;  3EHR A;  1DNP A;  2ZU6 B;  2M63 A;  3P1U A;  3UM2 A;  2KXP C;  2XGM A;  2CHW A;  1D9S A;  3G2V A;  3Q73 A;  4GPK A;  4HNA D;  4XE0 A;  5CRU A;  2J4D A;  3NOC D;  4UWK A;  3IV0 A;  2XPZ A;  3TG5 A;  2LXM A;  4Z68 A;  2LXL A;  5A6C A;  3ZN3 A;  3SD5 A;  2J49 A;  2XEN A;  1Z3Y A;  2J9Q A; 
#chains in the Genus database with same CATH homology
 2FUL A;  5JHA A;  4G26 A;  1E8X A;  4I9E A;  3QK0 A;  1HF8 A;  3PEV B;  4HVB A;  3GW4 A;  4V3I A;  3ZFW A;  5JHB A;  3EHM A;  4G23 A;  1JWG A;  4K0R A;  1X5B A;  4XX5 A;  1B89 A;  3PE4 A;  4ANV A;  5ANL A;  5T3R A;  4Q94 A;  5BPP A;  3FU0 A;  5ENN A;  2X38 A;  3G2U A;  3ZYM A;  1QZ2 A;  3FTZ A;  3ULQ A;  2FEZ A;  2L0T B;  2WM9 A;  2VSN A;  3IHV A;  3MX3 A;  4RG6 A;  2VTB B;  3CHM A;  3LY9 A;  5ANR A;  5DBK A;  4EBA G;  3TXN A;  2IF4 A;  2YNQ A;  2V0P A;  3GYZ A;  1ZU2 A;  3RRN B;  4CCA A;  4KT6 B;  1ZBP A;  4WNE A;  3CVY A;  3LDZ A;  2R59 A;  1ELW A;  2J09 A;  3FTW A;  4GB9 A;  4I1O B;  4XZ4 A;  3L16 A;  1S0P A;  4BT8 A;  3S7J A;  3Q49 B;  2VGX A;  1FVH A;  3LS8 A;  3CSF A;  3FTV A;  3EDT B;  1FVF A;  1NA3 A;  4BSX A;  3R7Q A;  4I43 A;  2XCB A;  4J6I A;  4KMO A;  3PUJ A;  4HS2 A;  3ZGQ A;  1UJK A;  4I9C A;  3TJP A;  5LFA A;  4YVQ C;  3L54 A;  2WXL A;  3G2S A;  3JUI A;  4FLH A;  2WXO A;  4ME2 A;  3AU4 A;  2AXU A;  4G2V A;  1HG2 A;  4DPR A;  4GZ6 A;  3S7B A;  3C98 A;  2PM6 A;  4M3O A;  3MJW A;  3UT8 A;  2YHE A;  1HS6 A;  4ILI A;  5FTP A;  4TUU A;  4AM9 A;  4F7A A;  1H19 A;  3BG0 B;  3ZHE B;  4IRU A;  3O48 A;  5ARF A;  4I6G A;  5KJN A;  3MV3 B;  4BTB A;  2VTB A;  1TEZ A;  4PS7 A;  4JW1 A;  2PQN A;  3NZS A;  4KVM A;  2E0I A;  4HFG A;  2WQ7 A;  4OVU A;  3RJV A;  4Q69 A;  3LEW A;  3VLE A;  2PL2 A;  3L22 A;  4JHR A;  2NSZ A;  3CVV A;  2OND A;  4CGV A;  1E7V A;  2VSO E;  2XGS A;  2I9C A;  3G2T A;  4CEM A;  1W3B A;  4D10 C;  3CLJ A;  3HDX A;  4JEH A;  4LER A;  4UQZ A;  4YND A;  3FTS A;  1IQR A;  1TJF A;  3Q15 A;  5J90 A;  3PNL B;  3FUH A;  1HX8 A;  3ASG A;  3CKB A;  5KJK A;  3VLF A;  2KAT A;  3U3W A;  4DI3 A;  4A1S A;  1KLX A;  4N3B A;  5FT9 A;  4J8F A;  1H0A A;  4MLP A;  3QOU A;  3KAE A;  3FTX A;  4XIF A;  2XRY A;  3JQ1 A;  2BTD A;  2IOL A;  5FQ8 A;  4TV3 A;  2X3M A;  4E85 A;  4LUN U;  4JVS A;  3VTX A;  4G11 A;  3FUJ A;  3RO2 A;  4TRQ A;  4AEZ C;  3GZ2 A;  2X6F A;  1BPO A;  4EPZ A;  2WXH A;  4JA9 A;  4WWP A;  3EIJ A;  3LVR E;  2WPV A;  3BEE A;  3GZ1 A;  4CT0 A;  1E8W A;  3CIA A;  3FY4 A;  2FF4 A;  2UY1 B;  2Y3A A;  5EDS A;  2VYI A;  5A23 A;  4H7Y A;  5CMW A;  3LXU X;  3MKR A;  2IJG X;  1UN9 A;  2DIW A;  1HE8 A;  2KZT A;  3RU0 A;  1OWM A;  5EX3 A;  4GZC A;  3CVP A;  1EF1 C;  2JLB A;  3EJN A;  4KYO B;  3FU3 A;  4U04 A;  5KCM A;  4FAD A;  1N54 A;  2WXQ A;  4JZY A;  4KZ0 A;  4UWG A;  4DI4 A;  5G05 J;  3PVL A;  2FO7 A;  5DIZ A;  4KXK B;  3HIZ A;  3SF4 A;  5T4Y A;  3FP3 A;  5G55 A;  1WY6 A;  1N52 A;  5KJM A;  4AVX A;  2CHX A;  3RKV A;  2A5U A;  3FDH A;  2UWJ G;  4XKC A;  4CDN A;  1H2V C;  3AS8 A;  5G05 C;  3ZYL A;  1HXI A;  2WQH A;  5CCM A;  4PDX A;  1XGW A;  2QY7 A;  3ZRH A;  3QWV A;  4UI9 C;  2XGO A;  1EPU A;  2HO1 A;  2XPY A;  3HYM B;  4PH4 B;  3P2B A;  3FH7 A;  4GYO A;  5G04 J;  4CDR A;  3ZIM A;  4L2L A;  5LCW J;  1EYH A;  3ASH A;  4AY5 A;  3IEG A;  2MRI A;  2XRZ A;  2Y4U A;  4G25 A;  4P29 A;  3RRM B;  2C2L A;  5LCW C;  1U3C A;  2YHC A;  4N39 A;  5FQ6 A;  3ZXS A;  5G04 C;  1H2T C;  3RO3 A;  3ZYQ A;  4AP2 A;  3L13 A;  1SZA A;  3QJZ A;  2KCV A;  1UW4 B;  2HYZ A;  4GMJ A;  3PNT B;  2CFU A;  3O4Z A;  3B7S A;  4I6J A;  4C0E A;  1ELR A;  1E90 A;  3DPD A;  5BV1 A;  3D9J A;  2CG3 A;  1HO8 A;  1E8Y A;  3OXF A;  4NUR A;  3MV2 B;  2JEK A;  1HFA A;  3I4G A;  3TAX A;  3E4B A;  4ACL A;  3MA5 A;  2IOS A;  2OVB A;  1OWN A;  4XI9 A;  4HLE A;  4BX8 A;  2C0L A;  5G2N A;  3IKO B;  4GA1 A;  3L6A A;  3T8M A;  4HOR A;  3SBS A;  2AXZ A;  2WXM A;  3APC A;  4I1A A;  1XNF A;  4KBQ A;  4BFR A;  4FUL A;  4A55 A;  4CRW A;  3ZVV A;  5FQ4 A;  4KZC A;  2BUG A;  4IUL A;  3KEZ A;  3CVN A;  2LO6 A;  4FJY A;  2AW6 A;  1INZ A;  3PUK A;  4J8S A;  4GML A;  4L23 A;  2VSX E;  1VDY A;  3CHS A;  3CEQ A;  1HZ4 A;  3OXG A;  5AJL A;  3ZHE A;  4ATG A;  4JHK A;  2WXF A;  2YIN A;  4A1G A;  4BWR A;  3D9N A;  4ANX A;  3PH0 C;  1MHQ A;  4WNF A;  3QDN A;  1IYG A;  3CKC A;  3OTN A;  2GW1 A;  3HVE B;  2VQ2 A;  4A3T A;  2WXI A;  1GW6 A;  2L9B A;  3CK7 A;  3Q5M A;  3D9M A;  4UI9 J;  3SI5 A;  1Y8M A;  4J8E A;  2WB2 A;  3NQP A;  4WWN A;  2AVP A;  4AJW A;  1PY1 A;  2LSV A;  2RG8 A;  4JA7 A;  5AEN A;  3B7T A;  1NA0 A;  2J07 A;  2XEV A;  2XHE A;  3NF1 A;  3KS2 A;  2I2O A;  4FP7 A;  1P5Q A;  2WQ6 A;  2WXN A;  2R5S A;  3PE3 A;  4GYW A;  1FCH A;  3QKY A;  5EX0 A;  4JC8 A;  4UWL A;  4U0Z A;  4F3V A;  2IFU A;  4GU5 A;  1UG3 A;  3U66 A;  4MRU A;  3U64 A;  4XI0 A;  3FFL A;  1L5J A;  4HOU A;  3FUK A;  4WAF A;  3FUM A;  2OOE A;  2WXK A;  2IU1 A;  4F1S A;  2KZT B;  4ILG A;  1Z6T A;  2UY1 A;  5CHE E;  3ML9 A;  4UQX A;  3LKU A;  4NRH B;  3D9L A;  2Y4T A;  4UQY A;  4BX9 A;  2ILR A;  2OVF A;  3FUI A;  5LOZ A;  4FHJ A;  5BNW A;  2VGX B;  2RD0 A;  3T5X A;  4GZ3 A;  2PQR A;  4B8C B;  2LAH A;  2PM7 A;  4B0Z A;  3JYS A;  3LCA A;  4NQ0 A;  3UT7 A;  4U07 A;  1Z3X A;  4UWF A;  5C1D A;  3MGB A;  5T8I A;  1OWP A;  4JHJ A;  2X6I A;  3B7R L;  2VGY A;  4AV7 A;  1PAQ A;  3QNK A;  4DK5 A;  3N71 A;  2P58 C;  4WND A;  3UMV A;  3ML8 A;  4U63 A;  3R9A B;  2XQ0 A;  3MYV A;  5KJL A;  4JXT A;  3UQ3 A;  4I6E A;  5BW8 C;  3ESK A;  3T5V A;  3U4T A;  4DJA A;  4AOF A;  3L17 A;  4A3V A;  3CV0 A;  1UN8 A;  2KC7 A;  4ANW A;  3AS5 A;  4URK A;  1LF8 A;  3RRU A;  3CGH A;  3AU5 A;  3CK8 A;  3G2W A;  3I3N A;  3MEK A;  3ONL A;  2FBN A;  4GCN A;  4ILH B;  2X6H A;  3URZ A;  2QFC A;  4CDM A;  2PZI A;  4JEU A;  4R7L A;  4KVO A;  3CHR A;  3FEY A;  1TJC A;  3D9I A;  2V8S E;  3MCX A;  3APD A;  2KCK A;  2WXP A;  3UPV A;  4EZL A;  2KCL A;  3D9P A;  2L6J A;  1JPL A;  3LY8 A;  4MS6 A;  5LX8 A;  3B13 A;  5HQ8 A;  4K03 A;  3GZS A;  5EKQ D;  5FQ7 A;  2R17 C;  4HOQ A;  1MQS A;  3KD7 A;  4GYY A;  1HG5 A;  2LAI A;  5BUZ A;  3IBE A;  4RG9 A;  4C0M A;  3UX4 A;  4EZJ A;  4EZK A;  4EEC A;  4CGW A;  4PS8 A;  3LYA A;  4WWO A;  3AS4 A;  4G24 A;  1A17 A;  1IQU A;  4FU3 A;  2BF0 X;  3PRZ A;  3QC1 A;  3SHF A;  4I1M A;  2GRM A;  3VLD A;  4L1B A;  4FA6 A;  4FHK A;  5AIJ A;  3NZU A;  5ARG A;  4AXH A;  3CVU A;  4ABN A;  3FEX A;  3B7U X;  3PS6 A;  3QAR A;  3SGH A;  3I5P A;  3LVQ E;  3ENE A;  2OV8 A;  3MKQ B;  5J08 A;  3K9I A;  4J8D A;  2XPI A;  4AY6 A;  5E75 A;  5AYW D;  4I2W A;  3TXM A;  4FLB A;  3FUL A;  4XKB A;  5FWQ A;  4N2S A;  1HU3 A;  3S2A A;  2AWI A;  3EIQ C;  2WMN A;  1OWO A;  2J4B A;  1OWL A;  1SQM A;  2KM4 A;  3FHE A;  4EQF A;  4WNG A;  2I1K A;  4HXI A;  2HR2 A;  3FUF A;  2DBA A;  2NXP A;  4YVO A;  3ASD A;  3FUN A;  2XCC A;  3FH5 A;  3LY7 A;  5A7D B;  4L2Y A;  2WXG A;  1E7U A;  1KT1 A;  2WXR A;  2GGF A;  3FU5 A;  1JWF A;  3QWW A;  5D0O D;  3R7R A;  4DLO A;  4GAA A;  3D9O A;  1DVP A;  2ION A;  4WUY A;  1NP7 A;  3CVX A;  4APO A;  1YA0 A;  5JJT A;  4BT9 A;  1KT0 A;  1U3D A;  5CCL A;  3TG4 A;  2CFZ A;  4AIF A;  4W9R A;  5CMY A;  2EQX A;  3D3M A;  2Q7F A;  5HI7 A;  4N5C A;  3CHP A;  4GA0 A;  3TL5 A;  3FU6 A;  1PC2 A;  3VTY A;  1QQE A;  3DBS A;  3PEU B;  4HOT A;  3PDN A;  5M72 A;  5FZR A;  3QB2 A;  4I17 A;  2CG2 A;  3ASF A;  3UT4 A;  3U9W A;  3PRE A;  2C0M A;  4PUC A;  1JUQ A;  4GZD A;  4FJZ A;  1WM5 A;  3ZPJ A;  1NZN A;  3IHY A;  3QWP A;  3ZEF A;  4C9B B;  3OAW A;  5LP0 A;  4OYS A;  2GRL A;  3SNX A;  2HM8 A;  4JL0 A;  3CVQ A;  3JCK C;  3FH8 A;  5FZQ A;  4L7T A;  3FWV A;  2I1J A;  3CHO A;  5JJ6 A;  2MHK A;  2A4Z A;  4GCO A;  4UI9 K;  2VJ8 A;  3QAQ A;  3UUX A;  3CQG B;  4RSY A;  1HH8 A;  1E8Z A;  3CR3 A;  3FTY A;  4GZ5 A;  4LRZ A;  4CT4 A;  2IQC A;  4F53 A;  4B8A A;  2X6J A;  5AJD A;  4MKT A;  4APF A;  4BY6 A;  2DCP A;  2I6H A;  4U0U A;  1H2U A;  3D9K A;  2LNI A;  5BT1 A;  4U0S A;  3ZYK A;  5FJY A;  3BG1 B;  4N2Q A;  4LCT A;  4EBA A;  3RK6 A;  3SZ7 A;  5FZS A;  4G1T A;  3WXX A;  4BTA A;  3Q4A B;  4PS3 A;  2L0I A;  3L08 A;  4N3C A;  4UWH A;  1EDU A;  1WAO 1;  2WMO A;  2LSU A;  3S7D A;  4B89 A;  3MKQ A;  3MZL B;  3LJ3 A;  2WXJ A;  3CVW A;  2V5F A;  2FI7 A;  5E76 A;  3FUE A;  3JQ0 A;  3FTU A;  3SBT B;  1OUV A;  4Q96 A;  3RIB A;  4ACK A;  3ESL A;  3TGO A;  4JPS A;  4NAC A;  4N3A A;  4H7X A;  4O6F A;  4QFV A;  4Y6W A;  3CQC B;  5C2Y A;  2X6K A;  4HOS A;  4J0U A;  3CST A;  2E2E A;  3LPZ A;  4B94 A;  5JJ7 A;  1DNP A;  3FUD A;  2ZU6 B;  3HHM A;  4E6H A;  2M63 A;  3S7F A;  3P1U A;  4OVV A;  3CHQ A;  4DLQ A;  3OXL A;  4Y6C A;  2NC9 A;  1IHG A;  1SZ9 A;  1E96 B;  4GA2 A;  3Q47 B;  2WVI A;  4IYP A;  2XGM A;  3CVL A;  2CHW A;  4LEU A;  2VSY A;  3ONK A;  3SFZ A;  1Y6I A;  3CK9 A;  3G2V A;  2AXV A;  2MOW A;  4GPK A;  4I2Z A;  3I4R B;  2J4D A;  2YQ8 A;  4XE0 A;  2J08 A;  5D0Q D;  1ELK A;  1QNF A;  3HVE A;  1UJJ A;  2V4L A;  3EHN A;  4UWK A;  4FC8 A;  3IV0 A;  2XPZ A;  1H6K A;  2CHZ A;  3PZD A;  3TG5 A;  4ANU A;  4RVB A;  4U8H A;  3ZW3 A;  3APF A;  5BV0 A;  4IN3 B;  5A6C A;  3ZN3 A;  3SD5 A;  2J49 A;  1Z3Y A;  2J9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...