3TGOC

Crystal structure of the e. coli bamcd complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
186
structure length
182
Chain Sequence
DSRYKRQVSGDEAYLEAAPLAELHAPAGMILPVTSGDYAIPVTNGSGAVGKALDIRPPAQPLALVSGARTQFTGDTASLLVENTLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNVISAGLDKSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0169 lipoprotein yfiO
publication title Crystal structure of the beta-barrel assembly machinery BamCD protein complex
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 43
structure length 182
sequence length 186
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06804 Lipoprotein_18 NlpB/DapX lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.50 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3tgoC01
3TGOC 5EKQC 2LAFA 2YH6A
chains in the Genus database with same CATH superfamily
5JO1A 4LA7A 3K90A 2E3MA 4QDDA 1LN1A 2YH6A 3OQUA 3NMTA 1ZXFA 4N47A 3W9KA 4BTZA 2KF2A 2L9PA 2NS9A 1XN5A 2BK0A 3F08A 4JHIA 2E3QA 1IFVA 2NN5A 3KAZA 3KLXA 3RT0C 3FO5A 1LN2A 1VJHA 2M47A 3QSZA 4FPWA 5JO2A 3Q64A 5E46A 2LE1A 2Z9ZA 4LGBA 3TVQA 1T27A 1UW5A 4Z3LA 4N76A 4A86A 3K3KA 3GL0A 4C9CA 3TFZA 4WVOA 1KCMA 2QIMA 3HK2A 3DLHA 4A8VA 3TGOC 3F73A 1XUVA 3NMPA 4IH0A 4DS8A 4A8GA 1H2OA 4QDFA 5JNNA 1FSKA 1LN3A 4GY9A 4QDFB 3WG8A 4REIA 3HM9A 3KDHA 2IL5A 2PCSA 4OICA 2LDKA 3NQNA 4REJA 1T17A 1TXCA 1Z94A 2I9YA 2FFSA 2KEWA 3H3RA 4XRWA 3RD6A 4QIPA 4KPYA 3P9VA 2E3RA 2LCGA 3KDJA 3P0LA 2LEQA 4PSBA 3NI8A 3OJIA 5E4MA 3H3TA 3HO1A 2RESA 3NEGA 4JHYA 3RT2A 3GKEA 4A85A 3OH8A 3W9RA 4Y31A 4M9WA 1LLTA 2EJXA 2K7HA 3UJLA 2VQ5A 4A8UA 4LG5A 3KB0A 4IGXA 4A81A 4BKCA 4A88A 3GTEA 5C9YA 3P51A 1JSSA 4MNSA 3ZVUA 4IGVA 3DLBA 3NS2A 4NCBA 3ELIA 4MAPA 4RYVA 5I9JA 1FM4A 2MOUA 4A84A 2R55A 4DSBA 4LGAA 4BK7A 2Q3QA 3TVRA 2LAKA 4N41A 3CNWA 5E4DA 2LF2A 2QPVA 3H3SA 4Q0KA 1X53A 2RERA 4DSCA 3GTSA 3GB4A 3NJ0A 3R6PA 3TL1A 2ZYLA 3H3QA 2LIOA 3KDIA 3NEFA 4N3EA 4C9IA 2E3NA 2PSOA 3Q6AA 2L8OA 4MA6A 4A87A 2M89A 3QN1A 3Q63A 5E4BA 3UQHA 3NMVA 4JDAA 2GKDA 3NR4A 2REZA 2KTEA 2N4AA 2WQLA 4A80A 2K5GA 2LUZA 2LAFA 2FLHA 4IGYA 4JDLA 4JHGA 3NJ1A 3GGNA 1BTVA 3HXMA 4IGWA 2KCZA 1EM2A 3JRQB 2D4RA 3GL2A 3PUTA 4REHA 3GOBA 4N0GC 4BK6A 5I8FA 3KAYA 3PU2A 4XRTA 1TW0A 3KL1A 1XDFA 2L65A 3KB3A 4IHRA 4IH2A 4QCKA 3HVRA 4NCAA 3HJFA 3C0VA 4A83A 5AMWA 5BRLA 1B6FA 1XFSA 3NMNA 2LGHA 4QDCA 3NJOA 5EKQC 1BV1A 2E3OA 4C94A 1XN6A 4B9RA 2LPXA 4R7KA 3IJTA 3JRSA 4JHHA 4BKDA 3OTLA 2N4BA 2Z9YA 1E09A 3NMHA 1QMRA 3IE5A 1ICXA 2E3SA 4M9BA 2VNEA 4E6FA 3E85A 2A1LA 2E3PA 3UIDA
chains in the Genus database with same CATH topology
5JO1A 4LA7A 3K90A 2E3MA 4QDDA 1LN1A 2YH6A 3OQUA 3NMTA 1ZXFA 4N47A 3W9KA 4BTZA 2KF2A 2L9PA 2NS9A 1XN5A 2BK0A 3F08A 4JHIA 2E3QA 1IFVA 2NN5A 3KAZA 3KLXA 3RT0C 3FO5A 1LN2A 1VJHA 2M47A 3QSZA 4FPWA 5JO2A 3Q64A 5E46A 2LE1A 2Z9ZA 4LGBA 3TVQA 1T27A 1UW5A 4Z3LA 4N76A 4A86A 3K3KA 3GL0A 4C9CA 3TFZA 4WVOA 1KCMA 2QIMA 3HK2A 3DLHA 4A8VA 3TGOC 3F73A 1XUVA 3NMPA 4IH0A 4DS8A 4A8GA 1H2OA 4QDFA 5JNNA 1FSKA 1LN3A 4GY9A 4QDFB 3WG8A 4REIA 3HM9A 3KDHA 2IL5A 2PCSA 4OICA 2LDKA 3NQNA 4REJA 1T17A 1TXCA 1Z94A 2I9YA 2FFSA 2KEWA 3H3RA 4XRWA 3RD6A 4QIPA 4KPYA 3P9VA 2E3RA 2LCGA 3KDJA 3P0LA 2LEQA 4PSBA 3NI8A 3OJIA 5E4MA 3H3TA 3HO1A 2RESA 3NEGA 4JHYA 3RT2A 3GKEA 4A85A 3OH8A 3W9RA 4Y31A 4M9WA 1LLTA 2EJXA 2K7HA 3UJLA 2VQ5A 4A8UA 4LG5A 3KB0A 4IGXA 4A81A 4BKCA 4A88A 3GTEA 5C9YA 3P51A 1JSSA 4MNSA 3ZVUA 4IGVA 3DLBA 3NS2A 4NCBA 3ELIA 4MAPA 4RYVA 5I9JA 1FM4A 2MOUA 4A84A 2R55A 4DSBA 4LGAA 4BK7A 2Q3QA 3TVRA 2LAKA 4N41A 3CNWA 5E4DA 2LF2A 2QPVA 3H3SA 4Q0KA 1X53A 2RERA 4DSCA 3GTSA 3GB4A 3NJ0A 3R6PA 3TL1A 2ZYLA 3H3QA 2LIOA 3KDIA 3NEFA 4N3EA 4C9IA 2E3NA 2PSOA 3Q6AA 2L8OA 4MA6A 4A87A 2M89A 3QN1A 3Q63A 5E4BA 3UQHA 3NMVA 4JDAA 2GKDA 3NR4A 2REZA 2KTEA 2N4AA 2WQLA 4A80A 2K5GA 2LUZA 2LAFA 2FLHA 4IGYA 4JDLA 4JHGA 3NJ1A 3GGNA 1BTVA 3HXMA 4IGWA 2KCZA 1EM2A 3JRQB 2D4RA 3GL2A 3PUTA 4REHA 3GOBA 4N0GC 4BK6A 5I8FA 3KAYA 3PU2A 4XRTA 1TW0A 3KL1A 1XDFA 2L65A 3KB3A 4IHRA 4IH2A 4QCKA 3HVRA 4NCAA 3HJFA 3C0VA 4A83A 5AMWA 5BRLA 1B6FA 1XFSA 3NMNA 2LGHA 4QDCA 3NJOA 5EKQC 1BV1A 2E3OA 4C94A 1XN6A 4B9RA 2LPXA 4R7KA 3IJTA 3JRSA 4JHHA 4BKDA 3OTLA 2N4BA 2Z9YA 1E09A 3NMHA 1QMRA 3IE5A 1ICXA 2E3SA 4M9BA 2VNEA 4E6FA 3E85A 2A1LA 2E3PA 3UIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGO C;  5EKQ C;  2LAF A;  2YH6 A; 
#chains in the Genus database with same CATH topology
 5JO1 A;  4LA7 A;  3K90 A;  2E3M A;  4QDD A;  1LN1 A;  2YH6 A;  3OQU A;  3NMT A;  1ZXF A;  4N47 A;  3W9K A;  4BTZ A;  2KF2 A;  2L9P A;  2NS9 A;  1XN5 A;  2BK0 A;  3F08 A;  4JHI A;  2E3Q A;  1IFV A;  2NN5 A;  3KAZ A;  3KLX A;  3RT0 C;  3FO5 A;  1LN2 A;  1VJH A;  2M47 A;  3QSZ A;  4FPW A;  5JO2 A;  3Q64 A;  5E46 A;  2LE1 A;  2Z9Z A;  4LGB A;  3TVQ A;  1T27 A;  1UW5 A;  4Z3L A;  4N76 A;  4A86 A;  3K3K A;  3GL0 A;  4C9C A;  3TFZ A;  4WVO A;  1KCM A;  2QIM A;  3HK2 A;  3DLH A;  4A8V A;  3TGO C;  3F73 A;  1XUV A;  3NMP A;  4IH0 A;  4DS8 A;  4A8G A;  1H2O A;  4QDF A;  5JNN A;  1FSK A;  1LN3 A;  4GY9 A;  4QDF B;  3WG8 A;  4REI A;  3HM9 A;  3KDH A;  2IL5 A;  2PCS A;  4OIC A;  2LDK A;  3NQN A;  4REJ A;  1T17 A;  1TXC A;  1Z94 A;  2I9Y A;  2FFS A;  2KEW A;  3H3R A;  4XRW A;  3RD6 A;  4QIP A;  4KPY A;  3P9V A;  2E3R A;  2LCG A;  3KDJ A;  3P0L A;  2LEQ A;  4PSB A;  3NI8 A;  3OJI A;  5E4M A;  3H3T A;  3HO1 A;  2RES A;  3NEG A;  4JHY A;  3RT2 A;  3GKE A;  4A85 A;  3OH8 A;  3W9R A;  4Y31 A;  4M9W A;  1LLT A;  2EJX A;  2K7H A;  3UJL A;  2VQ5 A;  4A8U A;  4LG5 A;  3KB0 A;  4IGX A;  4A81 A;  4BKC A;  4A88 A;  3GTE A;  5C9Y A;  3P51 A;  1JSS A;  4MNS A;  3ZVU A;  4IGV A;  3DLB A;  3NS2 A;  4NCB A;  3ELI A;  4MAP A;  4RYV A;  5I9J A;  1FM4 A;  2MOU A;  4A84 A;  2R55 A;  4DSB A;  4LGA A;  4BK7 A;  2Q3Q A;  3TVR A;  2LAK A;  4N41 A;  3CNW A;  5E4D A;  2LF2 A;  2QPV A;  3H3S A;  4Q0K A;  1X53 A;  2RER A;  4DSC A;  3GTS A;  3GB4 A;  3NJ0 A;  3R6P A;  3TL1 A;  2ZYL A;  3H3Q A;  2LIO A;  3KDI A;  3NEF A;  4N3E A;  4C9I A;  2E3N A;  2PSO A;  3Q6A A;  2L8O A;  4MA6 A;  4A87 A;  2M89 A;  3QN1 A;  3Q63 A;  5E4B A;  3UQH A;  3NMV A;  4JDA A;  2GKD A;  3NR4 A;  2REZ A;  2KTE A;  2N4A A;  2WQL A;  4A80 A;  2K5G A;  2LUZ A;  2LAF A;  2FLH A;  4IGY A;  4JDL A;  4JHG A;  3NJ1 A;  3GGN A;  1BTV A;  3HXM A;  4IGW A;  2KCZ A;  1EM2 A;  3JRQ B;  2D4R A;  3GL2 A;  3PUT A;  4REH A;  3GOB A;  4N0G C;  4BK6 A;  5I8F A;  3KAY A;  3PU2 A;  4XRT A;  1TW0 A;  3KL1 A;  1XDF A;  2L65 A;  3KB3 A;  4IHR A;  4IH2 A;  4QCK A;  3HVR A;  4NCA A;  3HJF A;  3C0V A;  4A83 A;  5AMW A;  5BRL A;  1B6F A;  1XFS A;  3NMN A;  2LGH A;  4QDC A;  3NJO A;  5EKQ C;  1BV1 A;  2E3O A;  4C94 A;  1XN6 A;  4B9R A;  2LPX A;  4R7K A;  3IJT A;  3JRS A;  4JHH A;  4BKD A;  3OTL A;  2N4B A;  2Z9Y A;  1E09 A;  3NMH A;  1QMR A;  3IE5 A;  1ICX A;  2E3S A;  4M9B A;  2VNE A;  4E6F A;  3E85 A;  2A1L A;  2E3P A;  3UID A; 
#chains in the Genus database with same CATH homology
 5JO1 A;  4LA7 A;  3K90 A;  2E3M A;  4QDD A;  1LN1 A;  2YH6 A;  3OQU A;  3NMT A;  1ZXF A;  4N47 A;  3W9K A;  4BTZ A;  2KF2 A;  2L9P A;  2NS9 A;  1XN5 A;  2BK0 A;  3F08 A;  4JHI A;  2E3Q A;  1IFV A;  2NN5 A;  3KAZ A;  3KLX A;  3RT0 C;  3FO5 A;  1LN2 A;  1VJH A;  2M47 A;  3QSZ A;  4FPW A;  5JO2 A;  3Q64 A;  5E46 A;  2LE1 A;  2Z9Z A;  4LGB A;  3TVQ A;  1T27 A;  1UW5 A;  4Z3L A;  4N76 A;  4A86 A;  3K3K A;  3GL0 A;  4C9C A;  3TFZ A;  4WVO A;  1KCM A;  2QIM A;  3HK2 A;  3DLH A;  4A8V A;  3TGO C;  3F73 A;  1XUV A;  3NMP A;  4IH0 A;  4DS8 A;  4A8G A;  1H2O A;  4QDF A;  5JNN A;  1FSK A;  1LN3 A;  4GY9 A;  4QDF B;  3WG8 A;  4REI A;  3HM9 A;  3KDH A;  2IL5 A;  2PCS A;  4OIC A;  2LDK A;  3NQN A;  4REJ A;  1T17 A;  1TXC A;  1Z94 A;  2I9Y A;  2FFS A;  2KEW A;  3H3R A;  4XRW A;  3RD6 A;  4QIP A;  4KPY A;  3P9V A;  2E3R A;  2LCG A;  3KDJ A;  3P0L A;  2LEQ A;  4PSB A;  3NI8 A;  3OJI A;  5E4M A;  3H3T A;  3HO1 A;  2RES A;  3NEG A;  4JHY A;  3RT2 A;  3GKE A;  4A85 A;  3OH8 A;  3W9R A;  4Y31 A;  4M9W A;  1LLT A;  2EJX A;  2K7H A;  3UJL A;  2VQ5 A;  4A8U A;  4LG5 A;  3KB0 A;  4IGX A;  4A81 A;  4BKC A;  4A88 A;  3GTE A;  5C9Y A;  3P51 A;  1JSS A;  4MNS A;  3ZVU A;  4IGV A;  3DLB A;  3NS2 A;  4NCB A;  3ELI A;  4MAP A;  4RYV A;  5I9J A;  1FM4 A;  2MOU A;  4A84 A;  2R55 A;  4DSB A;  4LGA A;  4BK7 A;  2Q3Q A;  3TVR A;  2LAK A;  4N41 A;  3CNW A;  5E4D A;  2LF2 A;  2QPV A;  3H3S A;  4Q0K A;  1X53 A;  2RER A;  4DSC A;  3GTS A;  3GB4 A;  3NJ0 A;  3R6P A;  3TL1 A;  2ZYL A;  3H3Q A;  2LIO A;  3KDI A;  3NEF A;  4N3E A;  4C9I A;  2E3N A;  2PSO A;  3Q6A A;  2L8O A;  4MA6 A;  4A87 A;  2M89 A;  3QN1 A;  3Q63 A;  5E4B A;  3UQH A;  3NMV A;  4JDA A;  2GKD A;  3NR4 A;  2REZ A;  2KTE A;  2N4A A;  2WQL A;  4A80 A;  2K5G A;  2LUZ A;  2LAF A;  2FLH A;  4IGY A;  4JDL A;  4JHG A;  3NJ1 A;  3GGN A;  1BTV A;  3HXM A;  4IGW A;  2KCZ A;  1EM2 A;  3JRQ B;  2D4R A;  3GL2 A;  3PUT A;  4REH A;  3GOB A;  4N0G C;  4BK6 A;  5I8F A;  3KAY A;  3PU2 A;  4XRT A;  1TW0 A;  3KL1 A;  1XDF A;  2L65 A;  3KB3 A;  4IHR A;  4IH2 A;  4QCK A;  3HVR A;  4NCA A;  3HJF A;  3C0V A;  4A83 A;  5AMW A;  5BRL A;  1B6F A;  1XFS A;  3NMN A;  2LGH A;  4QDC A;  3NJO A;  5EKQ C;  1BV1 A;  2E3O A;  4C94 A;  1XN6 A;  4B9R A;  2LPX A;  4R7K A;  3IJT A;  3JRS A;  4JHH A;  4BKD A;  3OTL A;  2N4B A;  2Z9Y A;  1E09 A;  3NMH A;  1QMR A;  3IE5 A;  1ICX A;  2E3S A;  4M9B A;  2VNE A;  4E6F A;  3E85 A;  2A1L A;  2E3P A;  3UID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...