3TGPA

Room temperature h-ras
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
162
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVEQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accessing protein conformational ensembles using room-temperature X-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 65
structure length 162
sequence length 166
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tgpA00
1T4GA 1Z3IX 1LFDB 2PJZA 3RRYA 2ODBA 3MCAA 4EJSB 1X1RA 1G21E 1I2MA 2YNMA 2QPAA 1WB9A 2ZRIA 3WNBA 1SKQA 2IS6A 2XSZD 1X8JA 2N46A 1JECA 3MMPA 3VFDA 1IJEA 3IQWA 5HKKA 5JHGB 4XVRA 3WRXC 1Z28A 1TQ2A 2RGNA 3ZLJA 4HAWA 4EDHA 1L8QA 3R7WA 3CRRA 2WJJA 5EE1A 1KY2A 1JNYA 1ZC3A 3FKSA 3WY9A 3D3QA 3JVVA 1VYUA 4M1MA 1FTNA 1KSGA 3U2QA 2RMKA 4DCVA 1ZNZA 3LBNA 5FR2A 3HYTA 4FXPA 1EFCA 4P4SB 2QTHA 2XNSA 2IUUA 1BMFA 2P5TB 3LVQE 3KQUA 2A3RA 4NMMA 1XXHE 3X1ZA 4JBWA 2WHXA 3ZIAA 3WBJA 3ZVRA 4CZ2A 2CCKA 2OM2A 4FW9A 4A6XA 2CJWB 4WOPA 2QSYA 4URZR 2B92A 2A2ZA 2ZJBA 2P65A 3Q8XB 4C9BA 4IVRA 5B64A 2D62A 1VTKA 1Z8FA 5L3SA 2ZE5A 3ZYCA 3MRSA 5E7JA 3FGNA 1E2HA 3T1VA 1TUIA 1ZM3A 4QBIA 1KMHB 2QM7A 1CJVC 3T61A 2N1BA 1WDTA 3ADBA 3CH4B 2ODEA 1PLLA 5BN5A 4O0MA 1OFIA 5KPJA 4DWJA 4A8JC 1KNQA 4V02A 2Z83A 1DAIA 4KO8A 3MWJA 1QBKC 4MGKR 4RZ2A 5DO9A 3I5XA 5TB5A 3BH6A 4US0R 2Z4SA 1SXJD 4HB2A 3ZD6A 2GXAA 3FHTA 2EVWX 4RCYA 5DI3A 4B44A 4RFSA 3CIOA 1Z0DA 1CF4A 2HCJB 2IWHA 3U60B 1W0KA 2F7SA 4GRAA 2F6RA 2FG5A 2ZS9A 2JLRA 1DAHA 1D8TA 1E2PA 1W5SA 2NTYC 1P6XA 3QG1A 2HLDA 3OFND 4D4LA 4EAQA 1U8ZA 1R5OA 5F9HA 2WWFA 1ZD9A 3RC8A 2BKEA 1EX6A 1OW3B 4Z8XA 3IUYA 2BJWA 3IO3A 2QQEA 1J7KA 2PL3A 4DVGA 2GEDA 4RZ3A 2C9YA 1CXZA 3AVWA 1KO7A 1LS1A 4KLNA 1G41A 3BE4A 1Z6YA 4HDCA 1W0JA 5KHOC 4OI0A 4HLUA 2GJSA 2AX4A 1W36B 4BLQA 3X1DA 1LF0A 3THOA 4EJSA 3UG6A 5DI9A 5LD2B 4M1SA 3L82B 4M1OA 2IS2A 1G3MA 3LV8A 4GFDA 3TBKA 3O8CA 1IOZA 2NMVA 5A0FA 3QQ5A 4RJLA 3ZVNA 4ASUA 5AR1A 2WOOA 5CDFE 4Q1BA 5JSZB 1DG3A 1TEXA 2V55B 1OYYA 1NN0A 3KDSE 1G3IA 4TLCA 2IUTA 1E9BA 2WKQA 3NEYA 2QGNA 3CNOA 2WWYA 1T9HA 3AF2A 3LBIA 4LX0A 1IN5A 1HH4A 2YWEA 4IHQA 4ARZB 4NBSA 3TW4A 2A78A 1P4SA 4ZI2A 3TW8B 1JAHA 1CTQA 4HI0E 1M7BA 1XD2B 2JGNA 1DAEA 3U3KA 1TQ4A 1JQJC 2GILA 4M8NE 2A9KA 4Q4AB 1CS4C 2YYZA 4LJ4A 4BFVA 1E2FA 3KQKA 3ZVMA 4CEHB 1MRNA 4B48A 2EFEB 4JLPA 1DAGA 4IKEA 2TMKA 3AVTA 1KO1A 3K0AB 3AVPA 4TTQA 2RGXA 1W48A 2C96A 4X8OA 3ASZA 2BC9A 4FINA 1HY3A 4KYIB 1SXJA 2LWIA 4JLNA 2IYXA 1L7VC 2VBCA 3QF7A 1RZ3A 4X8MA 5JCPA 3DZDA 5FOSA 1ZW6A 1CIPA 2O8BB 3AGQA 5E4FA 1Y63A 3AH8A 1JBKA 2NG1A 2CVHA 4QNMA 3GLFE 1ZP6A 4KV9A 2P6RA 2RGAA 4GOKA 1XTKA 4KAXA 3BFKA 3QI2A 3Q5DA 4LJ9A 4XVQA 2SHKA 3VMFA 4V03A 1CRQA 1KAGA 5FTJA 1TNDA 4YDSA 4GBMA 2C5LA 4BPBA 1YVDA 2C9OA 1GL7A 2JEOA 4PO1A 2B21A 2GNOA 3THWB 4KBFA 2O8DA 4UKDA 4DSOA 4OHZA 2WPDD 1A4RA 1OSNA 2XNDD 2H17A 4DB2A 2AWNA 4OJQA 4MDEA 4BZQA 3GLIA 2J45A 5FBQB 1Z08A 3S1AA 4PR0A 1TQDA 2QMHA 1E69A 1SVOA 2JJ2A 2V4ZA 1UDXA 3QG5A 4Q02A 1K8RA 4GP7A 5J5CA 3VAAA 5A4JA 4KI0A 3VR5A 2ZXUA 3QEJA 4AYXA 4UQOA 3VTKA 3E70C 1LS6A 2XNDA 3PXGA 1P60A 3CX6A 1BS1A 1XPUA 4LYHA 1Z6TA 3Q7QA 2WAXA 3TIFA 5EXTA 1AJEA 3JVUA 1OE0A 3I8SA 3U4QB 4PO8A 1A5TA 2J46A 1XFAA 2NOAA 3BJIC 3W34A 1Z2AA 4WBSA 5HKKD 5CB6A 2ONJA 1R8SA 3F0TA 1XMIA 1R5NA 3TUJC 3OZXA 4TZ0A 3QXHA 4TLEA 2J7PA 3LLMA 2NPIA 1VG8A 4J0QA 3FVQA 3EC1A 2XZOA 2P6UA 4HB0A 4WIAA 2RH5A 4BLPA 3BS4A 1HT2E 2HYDA 3TRFA 3GLGA 3SC3A 2QORA 4RZXA 2QEQA 1DO2A 2VLIA 2J41A 3KZ1E 4ACBA 1KO5A 4G1UC 3SQWA 3CLVA 5KDLA 4OYHA 2GHIA 2QTVB 2FMXA 2VSOA 5LBIA 5TARA 1NP6A 2J1LA 1DG1G 2GCOB 1ZAKA 2RGGA 1U99A 4A0FA 1KSJA 1GTVA 2J3EA 4Q7LA 4URXR 2ZIAA 1IN6A 3GP8A 1RC8A 4GSYA 3ZZ0A 1NSTA 2OBLA 4D0LB 2O8EA 1VHLA 3K70C 4B76A 3LXRA 5SZHB 1LVGA 2BEKA 1NN5A 3O8BA 4MA4A 2CEAA 4OHVA 1OH6A 4LHXA 5GJWC 1KYIA 2OLJA 3I92A 1FZQA 2WTUA 3IPXA 1W7AA 4F4JA 1F3OA 2VHTA 1RW4A 4AKGA 3QE0A 4PPGA 1PUJA 2FGJA 4PAOA 2CCJA 1M8PA 3RRZA 2OZEA 1M74A 3W6OA 4DSNA 4B3GA 4ABYA 4M22A 3GLIB 4DLSA 3OF5A 3NH6A 4GMDA 1NY5A 2RGNC 3I8XA 2PEYA 2GRJA 3LD9A 4XJXA 3K1JA 5P21A 2W2TA 1NBME 4IDHA 1DAMA 1MH1A 4MRPA 1P75A 1E2EA 2WJGA 4H1VA 4FCVA 5KDOA 2GAOA 3GLHB 3K70D 5EZ6B 5E95A 1US8B 3EA5A 2H8KA 2CL6X 1KK1A 3VR1A 4Q5IA 4CEIB 1UKYA 3L0OA 2VF7A 3DM5A 4HAYA 1F2TB 2FU5C 2YWFA 4N0DA 2FGKA 4GT1A 3EAQA 3P1JA 3M0EA 3I61A 2IXFA 4HEJA 4ZKDA 5IHPA 1E2LA 3R9IA 4ZIRB 1ZIPA 4TSFD 3KJIA 1OXSC 5B30A 4AYTA 4MDFA 1V43A 3WYGA 2P0EA 3FB4A 3U7FB 4G5QA 4W9MC 3LX8A 1G6OA 2QL6A 3ICEA 3SEAA 4B74A 3GMTA 3QKRB 4GZMA 2HEIA 2ZROA 4JL6A 4Q18A 4DLRA 1NVXQ 3I62A 1R0ZA 3GJXC 4QRHA 4ZDJA 2ZSAA 4Z8YA 4PC1A 4EPTA 5FOWA 5KSYA 1GL6A 1EGAA 4RY2A 4A8JA 1CR2A 3PUWA 1KK0A 1R6BX 1M6NA 5FL7A 2XXAA 1RJ9A 5BN3A 1XEWY 2PT7A 4R9UC 1G7TA 3AQ4A 2QI9C 4IFBA 3X1WA 4O2LA 5FPKA 3A4MA 1YZGA 2RCNA 1LTQA 4HZUB 5B58C 3WMEA 3T06B 3N2IA 3PUZA 2JLUA 2LCFA 2YOHA 4DIDA 2Q3HA 1FNMA 4EFMA 1IAQA 5AJVB 4FCWA 2QG6A 3BORA 1KKMA 1TUEA 3CRQA 1W44A 3RC3A 4WVFA 4LBYA 1SVWA 3A37A 1QHXA 5JWRA 3FHCB 4AKIA 1W4BA 2ZUBA 2GEUA 2ZQ5A 4X8HA 3EZFA 3BB3A 5AUQA 1AKEA 4DUGD 2ZSFA 4NDZA 4RD6A 2CLSA 1IBRA 2JLSA 4URUR 3BXZA 2ZI6A 3T1TA 1KI2A 4KFSA 1E94E 1SVIA 2ZRBA 1N6NA 3SFZA 2B8WA 2ORVA 1TX4B 4DT1B 3U61B 4O25A 1G3RA 5HR5A 1MO3A 3KJHA 2W6JA 1GRNA 1TEVA 2C77A 3CKLA 1WRBA 3A1SA 5D3MB 4LV5B 3TGPA 3SI7A 2QMOA 2LKCA 3L43A 1N25A 3BK7A 1MABB 4PPNA 2IEYA 4BRUA 4KFTA 4D4MA 5IK2D 4V0NA 1EFHA 1E1QA 2J87A 3K0CA 3IIJA 3NKVA 5EP2A 4NPHA 1AGPA 1W5TA 3RNLA 3QIAA 3NVAA 4JMPA 3C15C 4X8LA 5CYOA 4EPWA 4DLUA 1KOFA 1X3SA 1Z0AA 4LPSA 2IBMA 4DCUA 3FMFA 3RVBA 1NY6A 1E4YA 3ECCA 4Q4AA 4LJ8A 3UIEA 4JIMA 4HAXA 1F48A 2EFHB 1OKKA 4A0HA 4QNRA 1AK2A 4POAA 4RD1A 4Q48A 2V8OA 4HUQA 4M9XA 4QGHA 2UVQA 2QBYB 4YMSA 3VNUA 3OEHD 4KODA 1HEIA 1Z07A 5G3ZA 4UXIA 2VP2A 4NCKA 1CJKC 3LQQA 1SXJB 4XOIA 5FR1A 2W6ID 1ZIOA 1MT0A 2ZJAA 2B7BA 3Q7PA 2JLWA 1N5JA 4Z1MD 5IK2A 4R98A 2O8BA 4HAZA 3CR8A 2GJAA 1A82A 4LHYA 2PEZA 2IHBA 3O47A 1OXVA 4LPKA 4Y0AA 2IYVA 1EXMA 1JJVA 2UZ3A 4JLBA 1HQYE 3IDQA 2QN6A 1KKLA 2FH5B 3HJNA 3OEED 1SZPA 3IBGA 3K0FA 1Q1QA 2XEXA 4F7WA 5JI3E 1ZC4A 2W2XA 2V3CC 2ZUDA 5KNCA 5AUNB 2WSSD 1H8HA 1UPTA 1G16A 1HT1E 2VTKA 3RWMB 3IQXA 3UMSA 4QM7A 3I73A 1X6VA 2O8FA 1P73A 3CX7A 1VCIA 2ZSEA 3CUEF 3EW9A 2PMDA 5FOTA 5CITA 3K9NA 4Q7MB 3SHWA 1AZTA 2QA5A 2WMOB 2OEPA 1XDBA 3V4FA 1TF7A 3EZ7A 1FP7A 1R0YA 2PLRA 1CR0A 4LY6A 4PTLA 3OEHA 3U44B 3PEUA 4C2TA 3T5GA 1BKDR 2IYZA 2WMNB 2GAAA 2W00A 3MWLA 4B2IA 4BGDA 5LB2A 3KKOA 1U94A 4JBYA 3WBKA 1OLOA 3R9XA 3GQBA 3TKLA 4MRSA 4LHVA 3DM9B 4KHZA 1U9IC 4DXAA 3ND9A 1U9IA 2HXSA 4NYMR 3DKVA 4LBWA 3HYRA 1P72A 2OT3B 3RS7A 1XMVA 3GJ5A 1L4UA 1XB2A 5CIQA 4AIIA 1C9KA 3MAAC 2R6DA 4JLJA 4A9AA 3SQXA 5FPSA 4BLTA 1MABA 1NN1A 4IDQA 3PUVA 4TLDA 4FI3C 2OLKA 1DTSA 2OBNA 4OHXA 4OQFA 3T15A 4A6PA 2WAYA 2GDJA 4DEXA 1P2VA 4PAQA 2YJTD 4BLOA 4BRWA 2DFLA 1U81A 3K0CC 4B3FX 5HPYB 1E2NA 3QVVA 1N0UA 1OXUA 1XEXA 3CRW1 4XIGS 3KQLA 2JIZD 2WV9A 5JZVA 2KBFA 1NRJB 4LJ7A 2NO0A 4Y0VA 3GJ8A 2HT6A 2HJGA 3QF4B 3M6AA 4IJMA 4P4UA 1UBEA 4V0ME 2AR7A 1ZNYA 3EIQA 1CJMA 2QPOA 2KBEA 1CULC 1ZM9A 3QXSA 5KSOA 1T91A 4IW3B 3AP2A 2ZRFA 5HE9A 4L8GA 1T5IA 2DBYA 2ZJZA 1IQPA 4H1UA 4W5HA 4CT5A 4R71A 2KI5A 1CU1A 2EW1A 2ZI7A 3UANA 1D6JA 2JDIA 2PZFA 1VDZA 1S9DA 2VIIA 4G0NA 3N5CA 3WNCA 1KDPA 3BBPA 1U98A 1YKSA 1NLFA 1JALA 3V9PA 1AQYA 4PQYA 1VCNA 4FMCF 4QKQA 3MWKA 5FTNA 2HT1A 3BD9A 4B3DA 3THWA 3AVYA 2ZVPX 3GLFB 3G5UA 1TMKA 2XTNA 3W6PA 6Q21A 1T0HB 2H57A 1OB5A 4TMXA 1AGRA 3C4JA 2Q3MA 5CLQA 3CF2A 3L8YA 4QG7A 1AM4D 3I4LA 1UAAA 1DEKA 1K6MA 2OO7A 1WMSA 3VR2A 1JJ7A 5CDFA 1FMJA 2J0UA 4OQXA 4WXRA 5SZKB 4YQFA 1KNXA 1IN4A 3CWZA 1UEIA 5JI2E 3FFAA 4B3XA 2CVFA 2FWRA 3LWNA 1KJYA 3ZQ6A 3DVLA 3SJAA 1NKTA 5L3QA 2IL1A 4TYYA 2DHRA 1G3UA 4MGYR 3PVSA 3THYA 1UBCA 2FEMA 5L3VA 2RGDA 3CPHA 2Q9BA 3RAPR 3GPLA 1YJ5A 4D80A 4LC1A 3VX4A 4BFWA 3TH5A 1MOZA 1L2TA 1UJ2A 3PG5A 2FN4A 4EPRA 1ZNWA 5KYKA 5AK0A 5EE5B 2WWWA 3NG1A 1XTSA 4AYWA 1R10A 3QXCA 4TMZA 4DLVA 2A5JA 5FBVB 2BBSA 2WBLC 5C18A 2J7PD 2HDNB 2ATVA 1E0SA 3OEEA 3WP1B 1AA9A 4NCHA 3SBEA 1KGDA 2AK3A 1W49A 3GFTA 4N3NA 2GJ8A 3GFOA 2ZVQX 1HTWA 1RJ9B 4A15A 2FOLA 4Q19A 4M2LA 2XOKD 1M34E 4LJYA 1OXXK 4U00A 3AP3A 1ODFA 4QOSA 3EWAA 4OI4A 4Q9HA 2WJYA 1QG4A 1NVUQ 1YRBA 2F3RA 1S2MA 2VPPA 5L8VA 4BFYA 3C8UA 4Q4HA 2WVJA 1E2JA 2XJ4A 4OQNA 1M7GA 2VP6A 1J90A 1Q1ZA 3LH5A 4P0TA 1OFTA 2IC5A 2AFIE 2JJ2D 5JJLA 3NHAA 1RRCA 3K9HA 1FW6A 4Q1FA 1JI0A 3B9PA 4EFLA 2J9RA 4LC0A 4C0BA 4ERNA 2IUSA 3MGCA 1U2RA 1YR8A 2EYUA 4K46A 4D6PA 1S96A 4TT3A 4YXWA 4LJAA 2W2VA 3C14C 2IYRA 3P20A 1W2GA 4JVLA 3W90A 4GPTA 2JASA 4BZXA 4JLMA 4OK5A 1TU3A 1A2BA 5LPNA 2FDCA 1M7HA 4IRUB 3D8BA 2D3WA 5K8LA 4Q1DA 5JSZA 1E6CA 2E1RA 3B8HA 2ZM5A 1S1CA 3KL4A 1XCGB 4QBFA 2REOA 5M04A 1ZU4A 1ANKA 1FPMA 1XEWX 4BQSA 3SFVA 1CR1A 3K09C 2P2LA 2RAPA 3B1ZA 2QMEA 1Q1BA 4U02A 2D7CA 4DUGA 2IS4A 1JR6A 5IT5A 2ZJYA 5BW8A 2HUPA 1ZUHA 4HLQB 3B60A 1T8TA 1Q44A 1S0UA 4DLZA 2PLFA 2D4HA 4DLTA 1U8AA 5AJYA 4YXWD 5JJIA 2VHJA 3DL0A 2H7VA 2IX3A 2J0SA 3GJ4A 4BASA 2KJQA 2RHMA 721PA 2DR3A 4LOAA 4MH0R 3A58B 3O8RA 5KUTA 2Y8EA 1Q21A 1VG9B 3K0AA 4OL0A 2CMKA 3I32A 1ZRHA 5G53C 1UKEA 2F43A 5BYJA 4C0QC 4EPXA 2QAGC 5GVRA 2J0VA 3BERA 4IDNA 3HPRA 3IGFA 3CF6R 3LAWA 3WMGA 3X2SA 3LXXA 3Q9LA 3QKRA 3FOZA 1HV8A 4ASUD 3A4NA 3B1XA 5DIFA 5DLQC 1EFRD 1COWA 1W2HA 3LBHA 4PFSA 3FFBA 4P31A 5GADl 2QRNA 3X1YA 1MV5A 1KDOA 3K0SA 3UWKA 4XVUA 2ZUCA 1G8YA 4WA7A 5FTLA 3W8NA 4HAVA 2V1UA 1E32A 3EIHA 2DPXA 2X1VA 4ACAA 2BIFA 4KSBA 1KI6A 2IYUA 2NQ2C 4C2UA 2EFDB 2QRZA 1H8EA 2WIBA 4OKSA 621PA 1HUQA 4D4KA 4P4TA 3VHXA 4PZYA 4CVNA 1GNPA 1N0WA 1P9NA 3VKHA 2FFHA 4QC2A 3OAAA 2GVZC 2ZRCA 2IF0A 3B1WA 4YDHB 3SJBA 5LD2C 1KI3A 1W4RA 1IY1A 5FBLB 1GAJA 1DADA 3A8TA 1EESA 2NIPA 1FUUA 4KYUA 4MQBA 1P7CA 1TPZA 1E2MA 2F1RA 5UKDA 4C0HA 1Z63A 3W8RA 2ODWA 4P4SA 4PO9A 3DO6A 1DAKA 4PC6A 5FH9A 2EFCB 5CM9C 4WZ6A 2FSIA 1NMYA 3QPVA 2A7QA 2W0MA 3MD0A 2OXCA 4XTCS 1SHZA 4C7OB 1JAIA 4LYAA 2RGCA 2ORWA 2HCBA 4V0OA 4Q01A 2V1XA 1WE2A 2B8TA 2O5VA 2Q9AA 4JL5A 4JVNA 4ZKEA 3OAAD 3R8FA 2ZRMA 2IA5A 3A1TA 2QAGB 2CK3D 4JLOA 3EC2A 3H84A 4F93B 2ANBA 5JS8A 3UATA 1Q22A 2QPTA 3QKUA 1F6BA 1YHNA 4HUTA 3DMNA 4KXFB 1ZCBA 4PHFA 3W6NA 4XWKA 1VCMA 2ODNA 3CRMA 2GF9A 4HYYA 1G3QA 2OBMA 2P5SA 3TQCA 1ZCAA 2ZU0C 3OIYA 3D31A 2GXQA 3RSOA 1J8MF 3EPHA 2VSXA 1EK0A 4QL3A 5FPYA 5GJBA 2XITA 1R0WA 4R2IA 5C1BA 1DPFA 2XZPA 2X77A 4WZBE 5BXQC 3B78A 2QT0A 3QBVA 1F60A 3BB4A 4FWIB 1BMFD 4RKEA 3T12A 4K8OA 1XU4A 3AKYA 4WXPA 3SDZA 2VQSA 2ATXA 2R65A 3H1TA 1XTJA 3ZVLA 2ERYA 1XJQA 3KFXA 3JZAA 4EIWA 2ZE8A 3PCRB 1VYTA 4LDJA 3G0HA 4TMWA 4YMUA 2BEJA 2H92A 1ZD1A 4GOXA 3QY0A 4ON9A 4QJ5A 3SE0A 3PFIA 5HZHA 3SYLA 3FYHA 5C46F 4B71A 3AGPA 3OESA 4G5RA 5FOUA 4FMDB 1N0VC 5FBRB 2JLXA 5FUXA 2ZJ2A 2C04A 2PT5A 4M1TA 2KE5A 1QHYA 4JKIA 4TZ6A 4S35A 2AD1A 2J0QA 1NJGA 2ZYTX 3T1OA 5DSZA 1ZM4A 1KI6B 1G5PA 1J8YF 1SULA 4JT2A 3ZH9B 4UNRA 1GWNA 3MJRA 4HLDA 5DN6D 4PSVA 2WOJA 4EJSC 1ZYUA 4E03A 2CE7A 4MKFA 4PQRA 2RGBA 4OBEA 1JQLB 4PHTA 1ZMXA 1KI1A 5AJXA 3TAHA 1YR9A 2EQBA 3FPAA 4TT3D 3K09A 4D25A 3SN6A 4DRZA 5B2ZA 3REFA 3OIVA 4DSTA 4Z51A 2YV5A 2ZAOA 3GEEA 2YINC 1IY0A 1U90A 2EFGA 5KDDA 1HE8B 4CEIA 3AKEA 4KFUA 2GXSA 1XCPA 1E2GA 4EPYA 2BM0A 1ZBDA 2A5GA 1DS6A 1FQJA 3TR5A 5GVSA 1CP2A 4DSUA 3T34A 3B6EA 1R2QA 1GZSA 1D9ZA 3QKSA 1OH5A 4WZAE 5BQ5A 4LHWA 2ERXA 3UKDA 1KTVA 1KMQA 2G83A 5DE3A 3UXMA 4ZIRA 1E98A 3AVXA 4KBGA 1LF5A 2QT1A 3BH7A 3QOFA 4N0EA 4LJ6A 2MSEB 3R9WA 3I1FA 2QAJA 1Y3AA 4NHOA 3Q3JB 2ZSBA 1ZU5A 1OHHA 1NLZA 2IYSA 3KX2A 1HURA 2BCJQ 2QQ0A 3AVQA 4NCJA 4TYPA 4TYNA 3K70B 2N42A 1N6OA 2ZAMA 5L3RA 2A5FA 4QGAA 1R5BA 2A30A 3AVOA 5CK5A 4NYJQ 1H8HD 5HCIA 1GOTA 3AUXA 2ZRAA 3MSXA 4Q66C 4PSAA 1FL9A 1AS0A 2WM9B 3B5JA 3KUCA 5KTYA 3U3JA 1JR3E 1G64A 1NL3A 2FSFA 4DKXA 5E7MA 3HP1A 3EZ2A 4JVSB 1ESMA 2ZR9A 4DZZA 1XZPA 2G0NA 3SYNA 3HU1A 2GVDC 3ADKA 2OCBA 2OILA 5FTMA 5CK4A 3I5YA 1TTTA 5JMTA 1JXMA 3L0SA 4Z1MA 2CL0X 1VIAA 2W6IA 2GKSA 4L16A 4A1FA 4BUJA 2XB4A 2PCLA 3ICQB 1YZTA 5EE9A 2HF9A 5KOYA 4FCTA 2R9VA 1KZ7B 2FFQA 4M21A 4B73A 4YONB 1NJFA 4NONA 2Q0HA 1GNQA 5EP1A 3P4XA 2ZJ5A 4E07A 1UF9A 3IKJA 3G82C 1KSHA 2Q3FA 4UXJA 1U0LA 2VEDA 1DE0A 4LSGA 1GDDA 4JJZA 2OXRA 5TDHA 3C7KA 1Z6AA 4U7DA 1YE8A 3RS3A 4XD7A 1DOAA 1QHHA 2PBRA 1AZSC 4Q1EA 4PANA 2MMGA 2X8AA 2IS1A 1Q3HA 8OHMA 1KI4A 3KFVA 1PJRA 2G77B 5AUOB 4EKDA 4JLVA 4I1SA 4YC7A 2JLQA 4LV8B 2GBLC 4Q4JB 1YQTA 1KDRA 2DFTA 1RRFA 3A1WA 1IM2A 4PPQA 2XOKA 4DC9A 2R62A 2IXEA 3TUIC 1XXHB 2ZRJA 4L5BA 4EUNA 2ZETA 2I3BA 3T35A 3BAFA 4A92A 5FTKA 5G41A 3U3RA 2X2FA 5E3HA 3GJ0A 4EQ6A 4CYMA 2DWOA 3L2OB 3F5FA 4HUQB 2QBYA 3T1QA 3TUZC 5DNYB 2IK8A 4BFSA 2FFBA 4GOJA 4IOLA 4DDWA 5HCNA 3VR4A 4OHYA 3CPJB 1M1YE 1IXRC 4QGGA 3EIEA 1TADA 2ZR7A 1LB1B 1SXJE 2IWRA 2XTMA 2CBZA 2FJUA 5FUVA 2QROA 2BDTA 2OSBA 4B3BA 4TTRA 1RIFA 4OK3A 2FSHA 4PC2A 4B6EA 2RGEA 5CJ2A 3TQFA 3K0FB 3HU3A 3CO5A 4RCZA 3BGWA 2QU8A 2BHRA 2BMEA 1DBSA 2VA8A 3A1VA 3A4LA 4NU0A 5EP3A 2NO1A 1RRPA 4V0KA 3IBYA 1N5IA 1AQUA 3CBQA 1LY1A 1QHGA 2V7QA 3SR0A 3LVRE 1NBMA 1KZGB 3S1AB 5EUQB 2F9MA 3R7WB 3CB4A 1NBMD 3A6PC 2F9LA 2PZEA 5DYGA 1WBDA 1DO0A 4PHGA 4I1UA 3V00A 1ZVQA 3PITA 3MUFA 4TL8A 2I1QA 2ZRGA 2AK2A 2ANCA 3W3ZB 1NMXA 3VX3A 4A82A 1QDEA 1C1YA 1R7RA 3N2EA 4TQUS 4V0MA 1GKUB 2GZHA 1UBFA 4TSFA 5GJCA 2GK6A 2JDID 1CEEA 2AFHE 1Q1EA 4AURA 3GLGE 4TLBA 1AKYA 1EFUA 2VP4A 2L0XA 4DCSA 3P27A 2RHDA 1Z0JA 3C5CA 4A0RA 3BH0A 4PZLA 1TU4A 3QPUA 2WIAA 1Z22A 2C9CA 2WJIA 1P2SA 2CLCX 3VKWA 4F92B 1E9DA 2ZYVX 2J7KA 4XH9B 2YZ2A 1XJCA 3U6BA 1P3JA 5BWMA 1CLUA 4C4PA 2WSSA 2F3TA 4M1WA 1SXJC 3DKPA 2VH5R 1X8LA 2ZJOA 4PAMA 5AWFC 3WHLA 3MJHA 3OIUA 3C16C 2ZRPA 1VCOA 3CWQA 3RSLA 1RPZA 2O8EB 3GLGB 4UJ3A 4LUCA 4DIEA 3NWJA 2XXAB 2IT1A 1VG0B 2JAQA 4QGFA 1GRRA 4TN1A 4Z54A 1E9RA 1G18A 3QF4A 1MO5A 3UPUA 5JJKA 4I1OA 3I3SR 5FPTA 4M1YA 3N70A 1YRAA 1SQ5A 3KUDA 4URYR 1KDTA 1XBTA 4DEYA 2J59A 4JLKA 2YC2C 4JLAA 1JPJA 2FZ4A 1D2NA 3VNVA 2QY9A 2Q6TA 4G3XA 5DYIA 4IXMA 3DHWC 1U8YA 2QP4A 2CL7X 3BFVA 2VP5A 1JB1A 2GESA 4UNNA 1XD9A 2V6JA 1E9EA 3NC1C 4I81A 4QJ4A 1KY3A 1Q3TA 4IOJA 5JEEA 2OAP1 2VHCA 2XTZA 3PUXA 1AIPA 3UMFA 1G1MA 3TK1A 1KK2A 2ZANA 1O3YA 4ARZA 5KU1A 3EZ9A 3CM0A 3DOEA 1FTSA 1NKSA 2HXYA 2W0SA 3A36A 4D82A 3UG7A 4Q1AA 1JPNA 2GEVA 1E1QD 2MSCB 4DJTA 5JLJA 1W36D 1YZNA 1WA5A 2DCUA 5CIWA 1DAFA 2QMUA 3EA0A 2IHYA 1CRPA 2YWHA 4CEHA 1NG1A 3SJZA 5JWHA 3BC1A 2ZI9A 4DBLC 3FTQA 2XB2A 1XMJA 3IO5A 3KB1A 4OHWA 3K8YA 1EWRA 2KB0A 1R0XA 1XMSA 4I1VA 2A5DA 3GJ3A 4S2EA 5G40A 3RRNA 5L3SB 3BB1A 3FKQA 4MKHA 4ZPXA 2EWWA 3GLIE 3WYFA 5EUMA 1HE1C 3RS2A 3CX8A 3QXXA 1XD2A 5L3QB 1NI3A 2R6FA 2DFNA 3LY5A 1ELOA 2JLZA 3ZZTA 2D06A 3CPEA 2YOGA 4ZV4A 1A7JA 4B47A 3U7EB 1IN7A 3WP0A 4NYIR 1SKYE 1HQCA 4MGIR 3QKSB 1ZUNB 3ND8A 4P3YA 3HR7A 4FIDA 4MRNA 3SYKA 4XTRA 4JL8A 5IF9A 3CNNA 4TL6A 5J4VA 3PJRA 3NDBB 1P2UA 1Q0UA 1XTRA 5TXGA 4Q00A 3SJCA 4ITRC 1AS2A 2QAGA 3TLXA 2UZIR 1IJFA 3X1XA 1OIVA 2VYFA 3B13B 3GFPA 3HPQA 4LYJA 1BOFA 1OH7A 4HB3A 4JKYA 3W5IA 1Z47A 4A2PA 1D2MA 2QGZA 4YLGA 2FFAA 3EWSA 3ZDQA 1Q57A 2R2AA 4FMDF 1FUKA 3P4YA 3EX7C 1X8KA 5ANRB 3B9QA 3RRMA 1V5WA 4BLSA 3K53A 2D7DA 5FI0B 3NIBA 1CR4A 2BVNA 1N6HA 2OHFA 4KVAA 1E96A 3C5HA 1OH8A 3U4QA 3IEUA 4HB4A 3REGA 2CHVA 2HV8A 3O8DA 4IOKA 1BH2A 5CYPA 2YOFA 4HATA 2BMDA 2YWGA 3KKNA 4PQFA 3RABA 1QHNA 4B6FA 1YR7A 1II0A 2GJ9A 1NF3A 4MITA 1RVDA 2G0TA 3HU2A 5DN6A 4ILEA 4Q9KA 3GCGA 1XF9A 4RVCA 2XX3A 2B6HA 2ZRKA 5EQTA 1Z6GA 1S9HA 1TAGA 2BMFA 1VIYA 5EZ5A 4M9SA 2FX3A 3OIWA 2WSMA 2WWXA 4PPFA 4Q9LA 4ZDWA 1E3MA 1KHTA 3H0KA 5JHHB 4QJ3A 4C0JA 4D26A 1GKYA 5JRZA 4LHZA 1VPLA 4NTZA 2EYQA 4O3MA 2BBTA 2ZRDA 4TMTA 3SS8A 3EPJA 1SVKA 4MYCA 5AUPB 1NIPA 3P32A 2QP3A 4NYJR 2PX3A 3SNHA 1GNRA 3ONWA 2REBA 3H86A 1JEDA 1WQ1R 3VU9B 1OV4A 4LK2A 5FUWA 4AI6A 4D0GA 4C0AC 2QE7D 3IILA 2D74A 121PA 3QEOA 3L0PA 3BOSA 1GFIA 1N6RA 4GZLA 3OE7D 1C4OA 5CB8A 1G7RA 5J47A 4HDQB 2OV2A 5G3YA 3L0IB 4RKFA 3WMFA 2FE4A 1N2CE 2XJ9A 4XD7D 5JEDA 4DDTA 2V9PA 2EWVA 4LV6A 5KPDA 2ZJ8A 4EQ6B 4PX9A 1SKYB 4H9GA 4Q47A 1LNZA 3WRYC 2JLVA 3AF3A 2BBOA 5DH9A 2WKPA 2JJ1A 4LCBA 1QVAA 2BJVA 2GK7A 4NL4H 5JRJA 3FMPB 1TF5A 2QTFA 1E4VA 1IHUA 4C0SA 3WNDA 1NNEA 2AHOA 3ADDA 4E22A 4XSHA 1II8A 4IDPA 2OFOA 2NZJA 4QBHA 2CHGA 4HDOB 2WWHA 2QP9X 4B3CA 4HSEA 4G5OA 1YZUA 5FFMA 1HYQA 2ASEA 1K5DA 2NGRA 4BFXA 1FNNA 4RZUA 1XRJA 1MRSA 2ZI5A 4BZPA 4IXNA 5AJZA 4A2QA 1P2TA 4AG6A 5DHFA 4RD4A 5EXSA 1E79D 2CCGA 3AB3A 1W1WA 3RLFA 1FFHA 1OB2A 1N5LA 4KITB 4G01B 2G6BA 1E2DA 3NDPA 3LFUA 4BE7B 3DZ8A 1P9WA 3TSZA 4LBVA 5KSZA 3GJ6A 3E5HA 2FPKA 3LO5A 4Q03A 2ECKA 3OHMA 2D2EA 3KXLA 4TYQA 1KI7A 2KSQA 2UKDA 1OT3A 2VHQA 2BM1A 2IEZA 3BWDD 3IIKA 3SOPA 3PEYA 2GBLA 1OHHD 4UNSA 3B2EA 4US1R 4OJKA 4JSTA 1N3BA 1TF2A 3SZRA 1KMHA 1GIAA 1RRGA 5HZKA 2WKRA 3B1YA 1E9FA 3E2IA 3V4RA 4LYFA 4M53A 3LRPA 2C03A 3EARA 1COWD 1G8HA 4HAUA 3U44A 2F1JA 3GD7A 4A36A 1D5CA 1G17A 1UDWA 3BIFA 1YZKA 5SZIA 1P62B 5H1YA 5FUYA 2GXUA 3ZS9A 2GA8A 3ZD7A 3EPLA 4I99A 3B1VA 1P61B 1N5KA 2I4IA 2J5XA 3QENA 4URWR 2PJRA 4YMVA 4HZUA 4F91B 2Z0MA 5JCZA 3U5ZB 1FMLA 1LW7A 1GKIA 1NLYA 3NHBA 4B2PA 2VO1A 1E0JA 3NXSA 1W4AA 4Q7KA 3HWSA 2WPDA 1IONA 1ZD8A 4PHHA 4G5GA 1FP6A 1G5TA 3B7GA 1EFTA 3RS0A 2ZSDA 4LI0A 3TJZA 1F2UB 1ETUA 5DGXA 2FPMA 1UEJA 4US2R 1N6PA 4FN5A 1ZM2A 4C0KA 4R7ZA 3LA6A 1U0HC 5FBWB 2O0JA 1M2OB 1XCMA 1QVRA 4KJZA 1UKZA 5CLLA 1DVRA 1G8GA 2F55A 2VL7A 1NG9A 2GF0A 3AP1A 5EXPA 4CDGA 4CEJA 2FPLA 2O52A 4DT1A 1Z83A 4D81A 4FMBB 4BEJA 4DCNA 3QSYA 3W3AA 2ZI4A 4KCGA 5JS7A 5D3MA 3MG9A 1CJUC 5IRCD 4LWZA 1T5LA 3B82A 3FHOA 5KSPA 3W9YA 2DYKA 4E5UA 2WJHA 3FE2A 1XPOA 2GTPA 2Z43A 3M4YA 4UJ5A 1G20E 2YC4C 1MO6A 4PXAA 5LB4A 4B32A 1L4YA 3PR1A 2V6IA 2IYQA 1XPRA 2R6CA 1PLKA 3NH9A 2B7CA 2VP0A 3NBXX 5J40A 3K9GA 5LDDC 3PV0A 3LDAA 1J70A 3U7GA 4AKHA 2JJ1D 2CE2X 2ZPTX 5F3WB 2ZI3A 4MYTA 4UNQA 2YHSA 3RYTC 2JJ8A 2RKOA 3AV0B 4NH0A 3GLFA 4PZZA 1F2TA 1QG2A 2R6GA 4B35A 2OAQ1 3KJGA 4BLRA 4MGZR 5EJEA 4OK6A 2G9NA 2XGJA 2GZDA 4TLAA 1OIXA 2F1HA 2AKAB 1QZXA 3TE6A 4OI2A 3LQRA 4Q4LA 3TSOA 4KFRA 3OE7A 4A2WA 1S3SA 3TVDA 2OESA 3QJYA 4MYUA 1WBBA 1QRAA 4MKIA 2CK3A 1R8QA 5GJVC 2QNRA 2ONKA 1TQ6A 3PUYA 2O0KA 2CNWD 2FF7A 1PV4A 1PVOA 1AN0A 3U3OA 2KWIA 1H65A 2PX0A 1WF3A 5HE8A 2FA9A 3KXIA 1KO4A 3TVTA 1Z0IA 1AS3A 3NBZC 5BYKA 2O8DB 4XWAA 5FOVA 2QZ4A 3H4MA 3AF4A 1IY2A 1E1RD 4MRRA 4AK9A 1IXZA 4O2RA 1FQKA 4JZKA 2ORIA 3EZ6A 4FWTA 1G291 4HLCA 3RS5A 2C98A 3JZMA 5K8TA 3AF1A 2WWGA 3EG5A 3VR6A 4CIDA 4FMCB 1VYVA 1NVVR 4ESHA 2IXGA 4AKEA 1CKEA 3CRVA 3QNUA 1DELA 1D2EA 1KIMA 3NEJA 3ZZUA 1QHIA 3A1UA 2Q9CA 4W5WA 1E99A 3RANA 3ZS8A 4GP6A 1JEEA 5F2EA 3ADCA 1GL9B 4M4SA 5F9FA 1H8ED 1PLJA 3QVUA 4D2IA 4RD3A 2VRWA 4BFUA 4QHTA 4XWOA 2P67A 4C3ZA 2MSDB 2DB3A 3VR3A 3IEVA 1XWIA 3MLEA 3RWOA 4M0LA 4KU4A 4L15A 1Q12A 4CEJB 4JLDA 3KTAB 4JS0A 1G9XA 5BN4A 1P9RA 4TMVA 3Q5EA 1EFRA 1LV7A 1MO4A 2Q21A 1ZM7A 2ZU6A 4M9ZA 4EFNA 2G88A 2IYLD 4F4IA 5DISB 1FOEB 1Z5ZA 2G1JA 1GSIA 5KNBA 3ZIAD 1XTQA 2BKUA 1W0JD 1OYWA 3NC0C 2QE7A 4IFEA 1T3SA 4A4DA 2CLDX 3Q72A 1Z0FA 1E9AA 4U5XA 5IDVA 3H2YA 2PCJA 1A1VA 3GEIA 1XD8A 2X2EA 4QM6A 3PIRA 2GZAA 3PEWA 1CJTC 1NVVQ 4TYWA 4TWZA 3FKSD 3U3MA 2HLDD 3OFNA 1N6KA 1G5RA 3GJ7A 3WYAA 4P32A 3QBTA 2C99A 1ZINA 2DWPA 4Q9IA 2GCPA 1W0KD 1IXSB 4PC7A 821PA 2F1IA 2H1LA 3MFYA 4YMTA 4RFSB 4UNPA 4WW0A 2XSZA 5JBQA 1I4LD 3HR8A 4B2LA 3EPKA 2GCOA 5J4YA 3KKQA 2JCSA 4CT4B 3KXKA 1T3HA 1T3LA 4K81B 5C4GB 1EG7A 4D0NA 4DB4A 1WXQA 2CXXA 2JIZA 2PZGA 4JVMA 3P26A 1OF1A 1OXTA 2NO7A 2ZE6A 2ZRLA 4GL2A 1I4DD 1YZQA 4Q9JA 2X19A 1QF9A 1P5ZB 3LLUA 4QBGB 1GUAA 4BFTA 3TR0A 2GCNA 4GI7A 2H16A 3IIMA 2ZREA 4QHYA 4TQ9A 4B33A 4JSYA 1KI8A 2C78A 4NYMQ 4F38A 1F5NA 4C30A 2ZEJA 4ZO4A 1KO8A 2ZTSA 1E2QA 4ZCMA 2E9SA 2XZLA 2AWOA 1II8B 3LW8A 1PZNA 4LBZA 2ZS8A 2ZYUX 3CZPA 4NP6A 1I4TD 3ZQJA 3DDCA 1IN8A 4ZDIA 3KQNA 2HF8A 4BECA 1G19A 2WWIA 4II7A 4Q7JB 2J0UB 5SZJA 4ZI3A 4DLWA 2WJVA 3EXAA 3SU8A 5C2JB 1FX0B 5JWOA 3PQCA 3AF0A 1K5GA 4UXHA 1SVLA 1G4AE 4CF7A 2BCGY 3LNCA 4Q21A 1O87A 3D7MA 1VHTA 1ZJ6A 2VHUA 221PA 3DEFA 1US8A 4JJKA 4JT4A 4BWYA 1RE0A 1NN3A 3TAUA 2CDNA 3KB2A 2ZITA 2W58A 4LRWA 4GNKA 1XEFA 3AVUA 3QPWA 5TMPA 1ONBA 2R44A 4URVR 1T0JB 5E7IA 3CF0A 3VHLB 5KNDA 2ZR0A 3FWYA 2FNAA 1EX7A 1NIJA 3M1IA 2AXPA 1GG2A 2K5UA 4MYHA 2FZLA 1GP2A 4MKGA 1ZNXA 3IPYA 2O0HA 4G5SA 1VKJA 2OCPA 5FL3A 4NZYA 2O8CB 2Z5FA 2LKDA 1E79A 1PUIA 3UK6A 4L9WA 4CGZA 3VKGA 1KI9A 5FPHA 1X86B 3THYB 2DWQA 3UWOA 3BRWD 3CW2A 3PENA 2CHQA 5CJPA 3THXB 3AVVA 1OJLA 5DHAA 4EPVA 2IYTA 4A8JB 3LW7A 4TTPA 3FMOB 2ZRHA 2A5YB 1XZQA 3L8ZA 1RKBA 3QXJA 4P33A 4IEEA 3TNFA 2IW3A 3F8TA 1G4UR 4BEBA 2GETA 1WP9A 4JYBA 3AKDA 3B85A 1X1SA 1GRQA 4MRVA 2R6AA 5DI3B 1OPXA 4DDVA 5J4KA 2EU8A 2ZE7A 1RYFA 3CONA 5CM8B 1OKKD 2P6NA 5JECA 2BOVA 4L9SA 2P3SA 1B23P 5D3QA 4ZDKA 3KJEA 1Z2CA 4RD0A 3AM1A 1G8PA 2H5EA 1Z0KA 1W47A 4ZCLA 2BBWA 4IVPA 4A0GA 1JR3D 4B34A 2OCAA 4DLYA 1E9SA 2E87A 3C41J 4HLUC 3TSWA 1VECA 4AD8A 3T5DA 4IEIA 3KKPA 5ELXA 4IOMA 3ZGXA 2OUKA 4OQLA 1XNJA 4RFVA 3SBDA 3KQHA 1E2IA 5H70A 3U6KA 4KSCA 1T6NA 4ESVA 4ZCIA 521PA 3WXMA 1HA3A 4AC9A 3AKCA 1W36C 1UKVY 2R8RA 2FV8A 1RYHA 5TY0A 1VG1A 4L4UA 1BO6A 4NYIQ 4GDFA 5TV2A 1II9A 1T8UA 3QUSA 2C2HA 4AY2A 1FX0A 1ESNA 1EWQA 1G8FA 2QM8A 2JA1A 1UADA 1E0AA 4TL9A 1J99A 1R4AA 1QHSA 4PC3A 5EXXA 2QSZA 4GMXA 1SVMA 1NSFA 3NBYC 2XAUA 2OCYC 4M1KA 2BV3A 5K8IA 1E9CA 4DLXA 4LJ5A 1E0KA 1BYUA 1NVWQ 3DPUA 3AEZA 1D9XA 1U0JA 4PSKA 3PEVA 4RD2A 4V0LA 4NCNA 1KSFX 1QHHB 3NBFA 3ZJYA 3ASYA 1S1MA 1BIFA 3WHKA 1GM5A 3F3YA 2F43B 2AL7A 4QHSA 1GILA 1S3GA 2MMCA 3R20A 4Q4JA 3MWYW 1DARA 2AN9A 2I1VB 4IDOA 1XXHA 2QUZA 4I4LA 5FL7D 4OI1A 2O8CA 4W5JA 2HYIC 1KK3A 3CH5A 2DFKB 2FSGA 4LGMA 2C95A 2PMKA 2VP9A 3CNLA 4MUAA 3RHFA 2V7QD 3GEHA 5AJWA 2G3YA 4FD2A 5EP4A 3THXA 3IHWA 3I72A 1VMAA 3IHLA 3BFXA 1N6IA 2YVUA 2AD5A 4HZIA 5B57C 1GVNB 1YU9A 1CBUA 5EE3A 3DOFA 2JLYA 1BYIA 1XTIA 1XP8A 1S4QA 5EE0A 2O8FB 4R2HA 1Z29A 5TVKA 2C8VA 5C4MA 2RB4A 2DY1A 1E2KA 2PH1A 1YZLA 3W5JA 2NO6A 4Q4HB 3SHFA 1GITA 2YKGA 1MKYA 1UM8A 3R8CA 4M9QA 1F2UA 2VSFA 5JFGA 1G7SA 5F98A 2BMJA 4NE2A 3U7HB 3E1SA 2NZ8A 2QENA 3GLHA 1J2JA 1Z6XA 2IF2A 1W46A 3Q85A 3LX5A 1TL7C 2VF8A 4AG5A 4TQAA 4DDUA 1E1RA 2OE2A 5FOXA 5FI1B 4B43A 3DMDA 4C7OA 4Q1CA 4DHEA 421PA 3KTAA 3VQTA 2CJWA 1JXOA 1UFQA 2ZYWX 2BWJA 3CZQA 5H8WA 4W7SA 4F4CA 2AKYA 2CNWA 1Q20A 3QKTA 1OIWA 4CW7A 4NKRA 4AWXA 5KO2A 4D4JA 1Z06A 4BFZA 2D2FA 4JBXA 1NMZA 3AUYA 3HDTA 4B75A 3CR7A 2GJKA 2V54A 1N6LA 1SVSA 2REXB 1ZUIA 2FEOA 3K0EA 3D6TB 1JR3A 5J4LA 1XJ0A 1OFUX 1MR3F 4QFMA 1KJZA 2NPFA 3UMRA 1A2KC 4DCTA 4N1AA 2Z6VA 2AXNA 2WZQA 1XEXB 2ZS7A 3FDIA 3EASA 1I2DA 3J81k 2OFWA 1OFHA 1KAOA 5K8UA 3K9LA 2W83A 4NCIA 3VU9A 2OG2A 1SGWA 2ZRNA 1B0UA 4JYCA 1G7CA 1XX6A 3KKMA 4TL7A 2H18A 4WAUA 2GWHA 1WCV1 2WICA 3TMKA 2IYYA 3RDPA 2NO9A 4CRWB 5A5GA 1SHKA 1YR6A 5H68A 4TMKA 2JATA 2Z4RA 4LZZA 1S8FA 1RFLA 3ETLA 4C0LA 1UBGA 2W6JD 1G6HA 2G1KA 3NTUA 2IYWA 4YMWA 4IVQA 3GLHE 1KJWA 4XSGA 3FMIA 4KLZA 4E09A 3RS4A 2HJVA 2OFXA 4QXAA 5J4HA 1W4CA 4KVGA 4OQMA 4MUBA 5HTKA 4RSGA
chains in the Genus database with same CATH superfamily
1MZPA 2PJZA 1I32A 2FHPA 3SZMA 4F3CA 3HJUA 4EJSB 1WB9A 2IBSA 4EKGA 4BKMA 1FC0A 3WNBA 4BGEA 2XSZD 3M7IA 3E82A 1Q11A 3MMPA 3HTXA 2H4XA 1M76A 2WAOA 3IQWA 2V98A 3GUZA 3WRXC 3AESB 1U8FO 1Z28A 2OWEA 5AM0A 1TQ2A 2BHSA 2F3QA 3I4FA 4S3MA 4ZVQA 4FZ3A 2J3QA 4PSDA 3SYTA 4CMEC 1L8QA 2OCLA 3DOCA 3M1LA 4P5EA 3PA8A 1GVHA 4W1RA 1JNYA 1JZTA 2NYVA 2IHKA 3X3HA 1ZC3A 3OI7A 3PJGA 1VMKA 2VH2A 2QRHA 4R8LA 1ODKA 2EJWA 2VWQA 3UXYA 3PFGA 1QFMA 4C03A 4HWOA 4QUJA 1V3QE 5AHOA 4LOKA 2WNIA 3QEAZ 2C0CA 3D4BA 5FR2A 5JVDB 5IBCA 2QRPA 5JSFA 2PUAA 2P2CA 1FP2A 2ODPA 2P5TB 2YWJA 3U9SA 2VJYA 2N1MA 2A3RA 1XXHE 3ZVRA 5I7AA 3K1AA 3E7WA 1GTRA 1T0UA 4FW9A 4A6XA 3H11B 5K3FA 1M0WA 4YYEA 4ARSA 2B92A 2XH8A 1RKVA 1K88A 2ZJBA 4GX2A 3MELA 4DMUB 3VO9A 3BXOA 3IAEA 2YV4A 4DLKA 3LOQA 4ARUA 1VTKA 2OQ2A 1YI0A 1E2HA 2HF2A 2M32A 3FGNA 4OXXA 1DC8A 2Q0QA 4OHMA 1P33A 1TUIA 4OUDA 5FORA 4LJKA 1ZM3A 3IRUA 4RLSA 1I1OA 1TAQA 3R09A 4RGVA 4TZTA 4ER7A 4HDRB 5KB3A 3N7AA 3BZUA 1LC3A 1YKFA 2N1BA 3LDUA 4HNAA 4TUYA 5HUHA 5KYVA 2ODEA 4A8HA 4RH3A 1OFIA 1HETA 5HGXA 3ESAA 1SZDA 5HA5A 2VXBA 4A8JC 4DWJA 4G26A 3BWEA 4P4NA 3P71T 2YFYA 1KNQA 2V7VA 1A9RA 2YCBA 2HU2A 3QNWA 4E0BA 3HA7A 5F73A 3U81A 3WGVA 2XYVA 3IMFA 3DEYX 3MWJA 4DS3A 2RAFA 2VF2A 2QUAA 3PICA 4EGJA 3V6LA 4FR5A 3QLVC 1ORWA 2GXAA 3FHTA 4LCEA 4RCYA 1C0EA 1ST2A 4B44A 1LLQA 4RFSA 4TKUA 1XMQB 2ARKA 1CF4A 2IWHA 4ZICA 3QLUA 1C9EA 4AZWA 5C32A 2YFHA 1D8TA 1E2PA 1W5SA 4CODB 3K96A 2HLDA 1U8ZA 1U5BA 5JJ5A 2A33A 4G0QA 4LDRA 3C7TA 5GGXA 2YUTA 2H9AA 3WJ7A 1KMIY 1OXMA 1OW3B 2A1TR 3RRXA 5KTPA 4FQ7A 2EKZA 4JUFA 3IO3A 1XN1A 4DWOA 3WI7A 4DVGA 2GEDA 5B6IA 5K99A 5CA1A 1UQRA 2HTEA 1LS1A 2X5NA 2IPOA 2QM3A 4KLNA 3WKCA 3Q3GE 4R81A 4P3KA 1W0JA 4OI0A 1MAAA 3EVEA 3SR4A 1HE5A 1IC6A 2F9FA 1QHFA 2RHBA 2ZATA 3KJQA 4KB5A 3UCEA 3FOWA 1GA1A 4MCIA 4QWMA 2AFHA 3X1DA 3WQSB 4CLRA 2LVBA 1YVEI 3G1UA 1M75A 3IA2A 5FWAA 2JCXA 4DCGA 4PPYA 5C1PA 2IS2A 1ZH2A 1IOZA 1UMDA 2BGLA 2AXEA 2Q8NA 2XMDA 4HQOA 4J7CA 3RREA 2NMVA 4KYTA 2Z8YA 4ASUA 4GLOA 1SMKA 3O82A 5CDFE 3LC1O 1BQEA 3T94A 5JSZB 2H1IA 4MPJA 2B3TA 4DPKA 2YY7A 1NN0A 1ZD4A 2FN8A 3VTZA 2VYVA 2GBFA 3PA6A 1DWPA 1SIUA 4NBRA 1OU0A 4Y2YA 4B6PA 3IT2A 4LX0A 4U1RA 1IN5A 4BNKA 5FCDA 3FBTA 2R66A 1P4SA 3MYRA 3O83A 3LT4A 1JAHA 2ONYA 5AXCA 3GAZA 4MP6A 4OGLA 5CT6A 4YGYA 1DAEA 1H3FA 3UENA 1I10A 2E82A 2MOKA 2GILA 3OJCA 5HILA 2FWNA 3FUCA 5JSHA 4LJRA 1RQNA 3QWAA 4M8NE 4QRDA 2QR2A 4QATA 3V4LA 5TF0A 4AMZA 1E2FA 1FFDA 2OHVA 3C8ZA 3ZVMA 2XCTB 5K8JB 3WNZA 3CKKA 4B3JA 4DDHA 2C7PA 4GR4A 4PTZA 5DT9A 4TTQA 4U7TB 4B82A 3AL3A 1W48A 4MWDA 4YQEA 3ASZA 4BO1A 1W19A 2ZVDA 5ERXA 4IQGA 3W78A 1CJSA 2I3DA 2X2OA 1HY3A 4AN0A 4Q4CA 4FE4A 3QF7A 1HT3A 1I0ZA 1TXGA 2ZYIA 5FOSA 1JDJA 3OY2A 4TXNA 2MCFA 2JF0A 1M1YA 4XQ9A 4L27A 1Y63A 2QLNA 2NG1A 4QPCA 1I1QB 4KV9A 4EARA 1AMOA 1SN7A 4TM8A 2D5LA 1QFJA 2FEPA 2ZQZA 3RYIA 2NV2B 2AYYA 4KAXA 2AXQA 3TLAA 1T6ZA 1WB5A 4XVQA 2C57A 4V03A 1CRQA 1WPQA 5FTJA 4YDSA 5EPEA 2WIJA 3D7KA 4DR1B 2C5LA 1F06A 3OF3A 4PO1A 4YH1A 3L7MA 1LA2A 3THWB 4DSOA 2AQ8A 1G20A 2PT9A 2W6ZA 5IKPA 1DX4A 2XNDD 4DB2A 4FBLA 1N5OX 3DDUA 4AY4A 1TQDA 1ULBA 1ACLA 1E69A 1SVOA 2X1HA 2V4ZA 2ZWOA 1UDXA 4CF4A 2A1UB 2BF4A 3H5TA 4Q02A 4WDRA 1K8RA 4GP7A 5J5CA 3VUEA 4C6SA 4CKCA 3OH8A 3VR5A 5KOJA 4KN5A 3KOYA 5KU7A 1IWBB 1RXSA 3SC2A 4F8EA 4JIGA 9GPBA 2W9XA 2JBWA 2JVJA 2PVSA 2J6BA 3ABRB 4QXPA 2PWYA 1AF7A 2JCBA 2FUEA 1DTWA 1UK6A 3BXHA 3T1YB 2XYGA 3U48A 4B7AA 1GY8A 3EDMA 4GDMA 3PXGA 4UTNA 1R6VA 3IMKA 1TKRA 4YMLA 1OAOA 5KBYA 4N8SA 4L4ZA 1UPFA 2X4DA 4D7AA 4S1OA 5EXTA 3ND5A 3TIFA 1EB8A 5KOIA 1I36A 5B7GA 1OE0A 2B9EA 2IZ0A 4Q34A 4KKVA 3U4QB 1SD1A 1A5TA 5JC1A 1NF2A 5EAIA 3IP3A 4Z1OA 4GKVA 1XCOA 3MXOA 1C7JA 4ONEA 2FFJA 5HW0A 5IARA 3PC6A 2OQVA 2AMYA 1RAFA 2GUWA 1B1AA 3HYCA 1XA0A 3MM4A 1P2GA 4TLEA 2WSYB 3N2KB 3LLMA 3CLHA 1LPMA 1IM5A 2AGVA 2OHIA 4LJSA 4H0FA 2PSFA 3PD0A 4HB0A 2YJNA 1WMFA 4WH0A 5LMCA 4G6ZA 2EF0A 1YCGA 4K0RA 2XLCA 3IDSA 4OB8A 3NTQA 4ZT5A 3WIUA 5JS2A 3SF0A 3SC3A 4ZYWA 1CFJA 4E5YA 4HPXB 2H2GA 1T5OA 1RYYA 3RJTA 1FYVA 1VZ3A 3T3EA 1D6SA 3TNYA 3U26A 5KMGB 4RV4A 2AJTA 3AETA 4RA9B 5M5BA 4IIUA 2JFQA 2H0QA 3WXBA 5CB4F 4G1UC 5HJ5A 3UJ7A 5ALSA 1ZN8A 3EBOA 3L7LA 2VJMA 5KDLA 4E5VA 1EXWA 1UWLA 3ETJA 4ZOCA 5M7EA 5DGTA 4ENTA 2J1LA 1DG1G 3FDFA 4MMXB 3TD6A 3IVRA 3C43A 1CUXA 1U99A 3UB3A 4A0FA 1KSJA 1JHOA 1TFRA 2EBFX 4J2OA 4Q7LA 4YRTA 3HVIA 4FYWA 2O3JA 3JWJA 4IS2A 3RG8A 4URXR 4FU0A 5I4KA 1CY6A 2R1TB 4D0LB 3HI4A 1QLWA 1LX6A 3IKVA 4ZC1A 6PFKA 3IELA 1FX1A 1LVGA 3KQYA 1D4ZA 1D4FA 1NN5A 5KJEA 2CEAA 4OHVA 2VOJA 5LQSA 1HGXA 3CVOA 3BGOS 3T8YA 5BNZA 1WV0A 4LHXA 1JUDA 1R3DA 1ML4A 1GGKA 2OLJA 2FR8A 4NIMA 5GJWC 1VXRA 4UE3S 5SY9A 1SIBE 3JV7A 5BRJA 4AKGA 2VPXA 5KYYB 1YIAA 1NJ1A 3EGDA 1SNYA 3K5PA 5EZYA 1T0IA 1KYWA 2QLFA 4DUZB 2H2AA 2XQJA 2OZEA 2HA4A 3BWVA 4RVDA 4LF5B 4DSNA 4B3GA 2ZSIA 5LP6F 3C6YA 4RK5A 4M22A 4JKOA 3GLIB 3ANYB 4DLSA 3RIEA 2HPZA 3UFXA 3WJ2A 3BSWA 3T6KA 4DADA 4PRKA 1C3VA 3NIDB 1QPZA 4D6XA 2PEYA 3DWGA 4XRRA 3Q11A 4DLBA 4EMTA 3CJTA 4X85A 3K1JA 5P21A 1PEDA 5CM2Z 3L84A 1UMKA 4U39A 1P75A 1UJMA 4EFDA 2WJGA 2FW9A 4H1VA 3NWEA 3GDWA 1YNOA 1E8MA 2QLMA 3FI0A 1JLMA 1K92A 2Z8XA 3IPCA 2GAOA 4HVTA 4L3VA 4D44A 1P1BA 4CHTA 5J2TB 3LGSA 1KZ1A 4A03A 3MGAA 3VR1A 4Q5IA 1YRWA 1XVTA 4RK1A 1UKYA 2X9VA 3QVWA 4AZ3B 4DW8A 1F2TB 3Q7TA 4EHAA 5MN4A 4JGGA 2UZAA 1OX4A 1M2NA 2JS7A 4CN8A 2EZ4A 2LIPA 3DHNA 3I61A 3VNRA 3NWBA 1Z2PX 2DBZA 4HEJA 5C1DA 3JALB 3PF8A 3N1UA 4TSFD 1E4OA 1QMGA 1RAHA 1T0PA 1Y8ZA 1C8VB 1WPXA 4R8MA 1Y8QA 2YZ7A 5B30A 4AYTA 1AMUA 1V43A 2NUTB 4MDFA 2P0EA 2FPGA 2HY7A 4JR1A 2EX1A 3NRCA 1R15A 1R0SA 1G6OA 2QL6A 3CHYA 4KQHA 3ICEA 4B74A 3GMTA 4JL6A 3OE5A 1TC2A 2F1OA 3RU2A 3PYMA 4EA9A 3TECE 5LDHA 3JWPA 3GEBA 3AHGA 1QV9A 2ZSAA 4JDPA 4PC1A 1E3TA 4RK0A 1AK9A 2Q50A 4LDPA 3QVLA 5ITSA 4R83A 3CV3A 3DL2A 4WA8A 3SLRA 3JQEA 3SEQA 3L05A 5ARCA 1BD3A 4YJGA 1I51A 2FETA 2PT7A 3FLAA 3FUTA 1G7TA 4R9UC 3UGKA 5LSAA 1YZGA 2Y9PB 2E2WA 1BS2A 5KTNA 5E9AA 3RWBA 1M0SA 1MIOB 3NVKI 1X7XA 4MB0A 3VSDA 1IJBA 2BUBA 1XQYA 4WACA 1XNHA 3WMEA 1QUEA 4A1OA 2JLUA 2LCFA 1QIEA 2Q3HA 1TJ4A 10MHA 1SCNE 3JATB 1T36B 3CRQA 1PVDA 1VJ0A 4LBYA 3W2EA 2PXXA 2VCHA 1SVWA 1JBQA 4AKIA 1W4BA 5REQB 4ZC8A 4M7PA 3BE8A 4RM3A 3U37A 2NUPB 3BB3A 3B8EA 3DZKA 4OYYA 5AUQA 4BL5A 4DTCA 5K0BA 3GUHA 2ZSFA 4YX9A 3T1TA 5BSMA 5K6TA 3BXZA 2ZI6A 4WKNA 1QU2A 2BW0A 5BMOA 3LUGA 1N6NA 1UUFA 2ORVA 1TB4A 4FDUA 1TX4B 2P91A 3I2YX 4MIOA 2C4MA 3LP8A 2ZWVA 5CGZA 1EK1A 4OLHA 5TEVA 3DV0A 1JAZA 3VHQA 4C5CA 1ATIA 1GRNA 4M60A 2VZEA 4ENQA 4PN7A 3O2NA 2UUBB 3U16A 4TV8A 5IAGA 4GG1A 4YJ2A 2Z6UA 2HC9A 1OA0A 2OD2A 4RNDB 4WNAA 3FPFA 1UC9A 2NQTA 4D41A 5TR9A 5A5FA 5IK2D 2ASVA 1EFHA 1E1QA 3K0CA 3OJEA 3IIJA 3NKVA 1RHUA 1BVRA 5EP2A 5J2TF 1PSZA 5K3CA 3TLCA 1CQZA 3T7RA 4BLUA 3QIAA 3CN7A 3C15C 2FQXA 4LWOA 1KOFA 1Z0AA 2GZ1A 1CC1S 3AR7A 4JR2A 1NW8A 4LPSA 3O4HA 5F33A 2I6FA 3OOHA 3HBLA 4JEMA 3ECCA 2VUHB 3M9XA 3TO5A 2JAXA 2XEDA 3HV2A 3AEKB 1DBPA 2HDHA 4R3UC 2I67A 3ESRA 1F48A 1RKQA 1PI3A 4GM4A 4F9EA 2Z1MA 4POAA 3ZTYA 4EVSA 4OHYA 1AQIA 1UJCA 4II3A 4C07A 1PNVA 5DBGA 3R9KA 3DVRX 2PBZA 3KR1A 4AT1A 4NXMB 4W5QA 2TMYA 1CJKC 4NG4A 2OTCA 2YVQA 1G8JA 3W2GA 4C7VA 3O9MA 1HFJA 3DEJA 5SY6A 1JIUA 3ROMA 1EUZA 4EHKA 2O8BA 2HA0A 3QM1A 1EP2B 3W2FA 4B6QA 2BAGA 3KQMA 2IHBA 1ZNQO 3M2TA 4Y0AA 1TAHA 1H2EA 3OKPA 3RNLA 2UZ3A 5HZMA 2JJMA 2J5RA 3IDQA 4H6VA 3V7UA 2FH5B 1AUOA 4ZQBA 5AVUA 5DM60 3IBGA 4N0QA 4CWAA 4NS1A 4IDDA 4EFKA 1KRWA 2ZUDA 3K20A 1TO6A 5IUJC 1G16A 2AF3C 2FYTA 1ESCA 3IVGA 3UMSA 1GAEO 2Q1WA 1WDKA 4QYMA 4YN3A 2VRCD 4CUKA 3B2QA 4XAQA 3CX7A 3IESA 1FDOA 1VL6A 4I9FA 2ZSEA 3PUKA 4FTWA 1Q1NA 1T2FA 2JAPA 3EF1A 2YQ4A 4G0MA 2PMDA 4KAFA 1Z8DA 4NLLA 4Q7MB 1F0KA 2WE8A 3BXGA 5FNVF 1U2ZA 3P0EA 5EIAA 1GDHA 1LD3A 3PPIA 4QO7A 4X9XA 1X7HA 4XR9A 1XDBA 3V4FA 2OZLA 5AKXA 1ZMRA 4YTEA 2JZNA 3D3WA 1JVNA 2PZBA 3OT1A 2GM5A 4R1SA 4U7PB 3WL7A 3U1VA 1CDEA 1LDGA 1UXKA 1F7UA 1CR0A 2XMRA 3D5QA 5AXAA 5CA1B 2JPDA 3QYFA 4LY6A 3UMYA 1MZVA 1UODA 1GSHA 2NU6B 3PEUA 3T0FA 5LR6A 4TVSA 2IYZA 2W00A 5IYZA 3ENKA 3KKOA 4GMGA 4MV7A 5LB2A 3PB3A 4JASB 2GHTA 1OLOA 2UYGA 5D00A 3C3BA 4LHVA 2FEXA 1X87A 1CB7A 3JTMA 3L8DA 4XWYA 5G0VA 1NX6A 5JU6A 4H7DA 3ND9A 3VDNB 2OPBA 4YPVA 4TV9B 4JU8A 3AFGA 4NYMR 3DKVA 3SK0A 1VBMA 2IXDA 3TOZA 1YZVA 3WDLA 3ZV7A 3RS7A 5IJ0B 1XMVA 2IIPA 2KQUA 1VOTA 3GJ5A 3T4EA 1WLSA 2BF7A 2R6DA 3G7NA 1GNVA 3VU0A 1TMGE 2AN3A 1F1JA 4A9AA 1BWRA 1VLZA 5FPSA 3HJFA 4BLTA 1MABA 1NN1A 5CBPB 4TLDA 1DTSA 1ICIA 1JZQA 4YAUA 3G2LA 2FEWB 2OBNA 4MW5A 2J33A 3T15A 2BR5A 2GDJA 1P2VA 1HORA 4J8PA 4KBYA 4BRWA 4EELA 1PT8A 4R84A 3K0CC 5A06A 3HDHA 4CMAA 5F7XA 2ZULA 3EZNA 1OXUA 3PYXA 4CU2A 2J5BA 2RH8A 3EDCA 1BU8A 2LBPA 2NXJA 1NRJB 4OHRA 4XPIB 3W4IA 4BNTA 4ZAXA 5A3SA 4Y0VA 5ALOA 2J3KA 4KR2A 1SCIA 2HT6A 3ZZMA 1HXHA 1K6XA 3M6AA 4P4UA 4P80A 2BZGA 1ZNYA 2REQA 5JV5A 5G4KA 1QQ7A 1NBIA 3LHKA 2IUFA 1TJ3A 2QPOA 3H1BA 3L49A 3O92A 1N7JA 4J0DA 1ZM9A 5DYTA 2YCLA 5KSOA 1T91A 3NKLA 2YXDA 4KIWA 3GOQA 3AP2A 3MW8A 4J29A 4G23A 5HE9A 3AUTA 1T5IA 3OM8A 2F3UA 1QRTA 1A9ZA 5JD6A 1KC1A 2NVUA 2AJ8A 5IT4A 4H1UA 1ADFA 4IUDS 5C8XA 2HJWA 2I65A 4JBNA 2ZI7A 4FGUA 1PYOA 2JDIA 4WHMA 2I6QA 2BFDA 1HF3A 2PZFA 4LVUA 2YMMA 1ULAA 3A2MA 1JKJA 2YWDA 3FRJA 3N5CA 4G0NA 4QPNA 1KDPA 2VBGA 3ESDA 4IJQA 5ICFA 1DDIA 3I0ZA 2Q6LA 1Q92A 2X4GA 3IP7A 1AQYA 4HV4A 2WVHA 4FMCF 1RAGA 1IH8A 1RYBA 1NWCA 2Q1YA 2WD8A 2C1ZA 4AN1A 2PWPA 3BTUA 3ASVA 4NU8X 4ZHQA 2HWWA 3THWA 3GLFB 3WWDA 4QEDA 1X7ZB 2WT4A 1XKLA 2O20A 2YRWA 3KVOA 3MF4A 2H57A 3W6PA 6Q21A 5C51B 1OB5A 1SQ6A 1TECE 4TMXA 1L5SA 2Q3MA 2CNLA 3KYCB 1Z4MA 4K6OA 3L04A 4PO3X 4XDYA 4P53A 5CLQA 1YKGA 4Q3NA 4QG7A 3I4LA 1K6MA 1ZA1A 5PNTA 3UC9A 3ESYA 3GO4A 1WMSA 4FYYA 5DPMA 3WIBA 5AKHA 5GP1A 4DJEC 2G9VA 3HRKA 1DFHA 1FMJA 1MC1A 2J0UA 2WYIA 4BMCA 1NA5A 4YQFA 3MWDB 1WCXA 4W99A 1WXIA 1IN4A 2FPPB 2GR9A 3EVTA 3ROZA 4B3XA 1IZ0A 1YDWA 4AJPA 2H1FA 1DIBA 3I2JA 3ZQ6A 2X1LA 2P2GA 5DNWA 3D6VA 2JZOA 2YR0A 1SPXA 4R9NA 1LQ2A 5L3QA 4Z7OB 3ORFA 2J31A 5CMLA 4WNYA 2Q5OA 3PVSA 3O2JA 3ORQA 4U9IS 1O97C 1UBCA 3MMZA 4HNSA 3JWIA 3RASA 3W5UA 1RM0A 2FEMA 3DF9A 1WXGA 1ZQ1A 4YAJA 1PYDA 1R12A 2Q9BA 2WHPA 1FSZA 2WZCA 1Y4UA 4D80A 4MJ3A 1DWQA 1PN3A 1WHSB 1YVUA 1ZCZA 3VX4A 3ACBA 1ZH0A 3TH5A 2WUEA 4HYQA 4H15A 1NW9B 3B7PA 3Q4GA 3N87A 3ER6A 4C5AA 3W0LB 2QTWB 1AXGA 1W52X 3IALA 1M6VB 3MGGA 4ARAA 2BHLA 1DLJA 1XHFA 2I6SA 2V3WA 2Z2YA 3QHAA 3QXCA 3NANA 3V4ZA 1I2BA 3EUWA 5AVJA 4BNJA 1JG6A 2BBSA 2UUPA 4XI9A 2J7PD 1OVGA 3PC7A 1WEKA 2ATVA 4TROA 3TFWA 2Y99A 4FHEA 1JU9A 1YVPA 1PKXA 4QUDA 2P79A 3GFTA 2IYNA 1SCKA 3OCWA 4ALNA 2Q3DA 2XA2A 3J7AC 2AZMA 1N2IA 1YCFA 2FOLA 3KC2A 3AHIA 3TTXA 1ZEMA 3QEMA 3LLVA 3VC3A 1IBLB 5JDCC 3Q8MA 2A9PA 2O2GA 3P9QA 1ZUWA 2FPIB 4RQAA 2XUOA 4O3FA 4QOSA 3IP6A 2YDXA 1M33A 2DLDA 1W30A 4OI4A 1PX0A 4Y1RB 3WKBA 1D5WA 3TTWA 2D8MA 1QIIA 1NVUQ 3KFLA 3L0BA 1GXSB 3OOYA 1WXWA 2XR1A 5IC6A 4D5GA 3DMYA 2HPVA 3PHHA 2VPPA 4G0UA 4O4IA 5L8VA 2PLNA 3HYSA 2D2IA 2XVMA 6YASA 4WTOA 1D1QA 1KFJB 1E2JA 3EMDA 5KAPA 2POQX 3ETDA 1U6JA 1E64A 2R1TA 3AERA 4ZPJA 5LYJA 4X60A 2HL6A 1BHSA 4UHBA 2R60A 1Q1ZA 2AFIE 2JJ2D 1N4DA 3QNMA 1WHTB 1AKVA 3GFVA 5JJLA 5CUQA 1SBYA 4QIHA 5LL6P 4RSMA 1M2EA 1K9SA 3BQ9A 1RRCA 1FW6A 3C24A 4BVHA 1J97A 1AUVA 1DQYA 2XE7A 3ETEA 4ALJA 1LDBA 3GC6A 3N28A 1NDUA 3EH1A 4D6PA 7MDHA 2EDCA 3QWHA 2LR0A 4FR2A 3VNBA 2C2WA 3BXXA 4IV5A 2XLBA 2H1CA 1UJ5A 1W2GA 3P20A 4J7AA 4L9AA 1T8WA 4DM3A 4GPTA 2JASA 1JEQA 4KXUA 5BUCA 1NKVA 3F5DA 4OK5A 2H2IA 3KCNA 3GPIA 2WF8A 4HAIA 3TNFA 4IRUB 1K27A 2FDCA 1TGYA 3USES 5J2UF 3DLPX 3BMCB 4ZOLA 4Q1DA 1K66A 4CG1A 1S6YA 2G1UA 3HBNA 1C9JA 1SFRA 1Z4JA 1S1CA 3KL4A 4RTNA 2ZM5A 4QBFA 5M04A 3JRWA 1ZU4A 1GCUA 2QDKA 3EIXA 4QAQA 4MJ7A 1GLVA 3GRCA 2P2LA 2VAVA 4M6WA 2PZMA 1BFDA 3OHPA 4L2IB 3OT5A 2QN1A 2PA3A 4HLQB 3TW8A 4WN3A 1GTMA 4CFZA 3RVMA 3FSJX 1FTYA 3VJKA 4DLZA 2LDXA 4F2DA 3MOSA 1QIJA 2Q46A 4EJMA 4E5SA 1EVJA 1M34A 1V25A 2QD2A 3O8LA 3GPBA 3RS8A 3CVWA 2B4RO 4MQUA 4EEZA 1H6AA 1E77A 4FBMA 4FLFA 3FPHA 3LWZA 2CNOA 3STXA 4AZ0A 1VB3A 2Z5LA 2BFEA 3H3XA 3K0AA 1NX9A 2JLAA 3D4OA 3EF3A 3M83A 1LBSA 4OL0A 3MJTA 3CIFA 5JAMA 1ZRHA 3WGNA 2GFHA 3RVPA 4M0KA 3OPYI 1D4OA 3CXUA 1J8VA 1E7QA 1EBFA 3HPRA 3X2SA 5KX5A 1I7SB 2HMYB 4CL8A 1G8MA 1QX3A 1ZG3A 2FPWA 3HG7A 4UBIA 2ZIXA 3A4NA 3GJTA 3BFPA 5ALIA 5DX0A 4WESA 3AKZA 1W2HA 3LBHA 5GADl 1XVLA 4P31A 1ZKDA 2VZ9A 4FKMA 4U2EA 4ZQIA 3FW1A 1KDOA 3H1AA 3VYUB 3UWKA 1BWQA 3FHLA 4XVUA 5KSWB 2I4TA 1Z0ZA 2V1UA 3EIHA 4LDQA 2EHDA 1PDVA 4ACAA 4KSBA 4YJFA 4WUTA 1I4WA 1KI6A 2NQ2C 2YYYA 3WYCA 1RCFA 4F4DA 2EFDB 2QRZA 4GOOD 2WIBA 4X95A 4OKSA 1I2ZA 1FVOA 3C7AA 3VHXA 1GNPA 1H1LA 3IAM6 3BXPA 4QC2A 1Y4DE 5B7QA 2DXIA 2BE9A 3BHMA 3B1WA 3KHUA 4YRRA 3SJBA 3OP4A 1J42A 1KI3A 2QVLA 4O4LA 5L4NA 1H4QA 3JZDA 1G4HA 4MUEA 1GAJA 1DADA 2KM1A 5FBLB 1P7ZA 1OAKA 2JAWA 3OKAA 1XYYA 1UBSB 2AG1A 3MWGA 4HH3C 1V96A 1DC7A 3LPAA 5KJFA 1P7CA 2CMHA 2VOEA 2B4YA 2F62A 1A9PA 3NTOA 1PV1A 2YS6A 3DO6A 4MW6A 4Y2PA 3NNSA 5CM9C 4TRRA 5REQA 2WI8A 1NMYA 3GJYA 4IIJB 4N65A 4EG1A 4UTVA 1EFKA 2Y6UA 3OLWA 4YCNA 2HPHA 2HRCA 3T54A 5C52B 3RTEA 1V95A 3W06A 2ONZA 3VSAA 3PE6A 2V6BA 1E3JA 1QYXA 3IJPA 1JAIA 3G9ZA 2C3UA 4J6EA 3HY4A 3QJ5A 4V0OA 3CE9A 4ZV7A 4CV2A 4EHFA 3CVUA 4Q01A 4OLAA 1WE2A 2B8TA 3OX4A 5D6NA 4EUHA 1IEXA 2BDEA 2NSYA 2X4IA 4P3XA 4L76A 1U3WA 1VBNA 3BK1A 2VNKA 3OAAD 3P9NA 4BWVA 2JFUA 4RMJA 1UMBB 1IUPA 4WWHA 2DETA 2C07A 4QYIA 4P7FA 3F6EX 1Z5WA 2CK3D 3IIEA 3RC2A 1VPTA 2P3QA 1RRVA 1OLXA 4CM7A 2ZSUA 3D0RA 3IKLA 4QU0A 1E62A 1FYXA 1UBTS 2P6MA 3F47A 4G2NA 1UAGA 2R8ZA 4EG0A 3WKEA 3KU1A 2GCGA 5BN5B 1FLNA 1JQ3A 3T5AA 1A9YA 1A4XA 3PKIA 4DZTA 1MB2A 1DSSG 4PHFA 3TMYA 4XWKA 2GF9A 3ZI4A 2JD1A 4KMMA 1SUWA 4KX5A 1N2SA 3OIYA 4MVJF 3RSOA 4IIBA 1M2OA 1CQXA 1Q6ZA 3HE3A 5GJBA 1EK0A 2ATCA 3ZE2B 2XITA 2WW8A 4FFPA 2C42A 1E2UA 3ICPA 3QVSA 4KACA 2IUEA 5BXQC 1U2DA 1F0YA 2G25A 4L8VA 4ZJZA 1JLLA 1SOMA 4DYDA 1F60A 3BB4A 3BK2A 1BMFD 3G23A 4FWIB 3IRVA 4IQ4A 1XU4A 4K8OA 1NVMB 4XE5A 4WXPA 4WL0A 3INNA 5H4GA 2W2KB 5AI9A 1X80A 5CFPA 3G0IA 1XTJA 3ZVLA 3Q1KA 4WXHA 5CEFA 3CX4A 4G1MB 4YP0A 2AHRA 2AG8A 2BSQA 5T3YA 4TMWA 3X2FA 5CRIA 3VOAA 2ZT8A 5DLYA 4QJ5A 4GOXA 2FEAA 3NAZA 3QY0A 1PJQA 1VPDA 4C21A 4O2BB 2NZVG 3A4VA 3FYHA 5C46F 2ZYHA 2PX4A 3W3AD 3OZIA 3WMXA 2I1WA 2QNBA 3F9RA 3AONB 5FBRB 4ZD6A 4AO8A 4GI1A 4WUVA 2AMVA 1GKKA 1K7XB 2QXUA 1QHYA 4N7BA 1T1GA 2LIVA 5CGQB 3ZV3A 3ENQA 2NU8A 2NU7A 4TZ6A 2J0QA 5C53B 2ZYTX 4ND8B 4QODA 4B6GA 3S2UA 3F1LA 2ENUA 1SULA 5AO9A 1E60A 2A9OA 3FVTA 2Z08A 4FR0A 5DN6D 4KRFA 1MLDA 2WOJA 4EJSC 1ZYUA 2XE8A 4MR9A 1TM1E 2CE7A 3AHFA 3Q88A 2VHEA 5AW7A 3IPRA 3UJ8A 2QTBA 1KI1A 4MV3A 4INAA 4YLYA 3GARA 4CKXA 3TLMA 3I04A 1FBTA 2QRQA 1J2YA 4RTLA 4TT3D 4X6XA 1GGMA 3F7MA 1Y3BE 2ACVA 3U3ZA 4F96A 3K09A 3PLNA 3U3XA 3DAFA 5B2ZA 5IN5A 3RVQA 1NW7A 4AJHA 3EGOA 3BF8A 4B2YA 2HDWA 4PW0A 1YTUA 2YV5A 1L7AA 1RQ2A 4UVIA 4B83A 4CL3A 1W4ZA 5EIHA 4BOYA 1MXFA 5CHYA 4IBOA 5CCBA 1IY0A 1E1DA 2R84A 2X41A 4R1OA 3A11A 4Q4DA 4U9HS 5DMXA 3AKEA 2MYPA 1V1MA 1XCPA 2ZIVB 4EPYA 3F73A 4HZGA 1ZBDA 4WECA 1DS6A 1A9XA 5BNFA 1F6WA 2GWRA 2CSXA 2PYDA 5GVSA 3QXGA 3DQZA 1CVIA 2B1QA 4WLFA 1R2QA 5KZMB 1AGYA 1D9ZA 3H42B 3HJBA 2MINA 1FDIA 2DT5A 1NV9A 1XDDA 4J2TA 3UYKA 3KWJA 5CD1A 1Z7WA 2G83A 5DE3A 3UXMA 1E98A 2JGAA 1H9BA 3HZRA 4GM1A 1LF5A 2E4AA 3DYBA 3OWXA 3T9DA 3JTEA 2H51A 3BH7A 4MUKA 4FFWA 4LJ6A 1ZXXA 1YO6A 3HA5A 3DMTA 1KRXA 1C29B 3B53X 1ID8A 4A26A 1Y3AA 3Q3JB 2ZSBA 1ZU5A 1U7WA 3FCXA 2IJGX 3EN0A 1BZYA 1HURA 1O6BA 2BCJQ 2OLEA 3A4TA 2Z6QA 1N6OA 1PZFA 3DULA 3R3ZA 4KE7A 3P45A 2A5FA 4KQEA 4LF8B 2A30A 2JIQA 3DTTA 4IMJB 4ZTUB 2Z2KA 2HIHA 3AUXA 1UBOS 2ZRAA 3LI2A 4FX5A 5AKKA 5BWBA 4PSAA 3D4PA 4HMPA 1AS0A 5AOCA 2UVPA 3GZTB 4RDHA 3W9SA 1ABBA 3UN1A 3K9WA 4CMJA 4DKXA 5E7MA 4ZHSA 1FU7A 2C9BA 3H05A 2Q28A 2G0NA 3BRQA 3W04A 3B52X 2GVDC 4D6YA 2OCBA 2DGDA 2Y4NA 4HL6A 4U3JA 5FTMA 3IQZA 4QUIA 4ABTA 1CNEA 3QX9A 3RRFA 3TOCA 4MR8A 5HUJA 3SC2B 3QIVA 1AURA 3KD2A 1TTTA 1GCIA 3V2GA 3V2HA 2GPBA 2V7WA 1ZRMA 4DIFA 1VIAA 4TTSA 4KG7A 1IEVA 2HLHA 2PCLA 5MDHA 3KG2A 3S1LA 4Z6KA 3SVTA 3ICQB 1E1CB 5HUQA 2HF9A 5KOYA 2VAPA 1SELA 1DKUA 3BTSA 4NSNA 4PBTA 5ER9A 2VPTA 2K2WA 2PMBA 3PGJA 4I9GA 4JX8A 3HB7A 1UCFA 3HEAA 4OSPA 3R4VA 2ATEA 5C7YA 3TDNA 1GNQA 1UDRA 2I2DA 2ZTUA 5EKDA 4KGZA 5K3DA 3HGMA 1KSHA 1SBTA 3Q8XB 4UXJA 8MHTA 4K03A 3LBAA 3OZFA 5IVIA 5HWSA 3C7KA 2JKYA 2IDZA 1FFXB 1WWKA 3DO5A 1FXWA 3RS3A 4KNYA 1DOAA 2PBRA 3BAZA 2C97A 4NV1A 1Q3HA 1PIWA 1NUTA 3UBTA 1GNTA 1PJRA 1QZTA 2G77B 2NVWA 1K3TA 1MT3A 3F2VA 4JN6B 4YC7A 1MEOA 4I1SA 1B8VA 2KW5A 3DQQA 4LV8B 1DHRA 3UK7A 4C7BA 1WOYA 1E6KA 4L73A 4IIXA 1N92A 3A1WA 3ZBQA 2XOKA 3SIWA 2R62A 1WG8A 2IXEA 4ZJYA 1XXHB 1ABEA 2ZRJA 4AMGA 2I3BA 2PM8A 1USIA 5EHGA 4FM9A 4DIMA 1EDOA 2DAPA 2G5PA 1RQLA 4D3YA 1UZLA 5FTKA 4PG6A 4X3CA 2QYSA 2V7EA 2X2FA 5E3HA 1YDFA 2VTVA 3GJ0A 1DAPA 2XGOA 5EMMA 2Q5EA 4INPA 1PGPA 3L02A 2C2BA 3L2OB 3Q1LA 3OX1A 1E1KA 1IYZA 4HCJA 3P97A 5IW8A 3VDXA 2P9YA 3COPA 5EJAA 1MQAA 2BFOA 3I1YA 4M46A 4BFSA 2FFBA 3KPVA 1ULHA 3T3PB 4PTYA 4FC7A 4V24A 2QWXA 2VZLA 4M0PA 4XJSA 1AQJA 3PGA1 1M1YE 3EGWA 4RY8A 4EMSA 1OWPA 1X70A 4WKCA 1TADA 4V1CB 2Q5HA 4CM1A 1PG5A 5BW6B 2QTTA 2XTMA 2CHFA 1V1RB 1W6UA 2CBZA 3LSYA 4I55B 4QUEA 2BDTA 5B3AA 3S55A 1GAQA 2OSBA 3D8TA 3BE5A 1KQFA 1RIFA 2CT8A 2Q07A 1G42A 2C1XA 2FDXA 4AMBA 4B6EA 2RGEA 2V0CA 3QVMA 5GZ3A 3EODA 3FSEA 3KSBC 1IG0A 2O07A 1XLTC 4R2LA 3TQFA 1ZOSA 3TQRA 4HMOA 3KV3O 4CQMD 3AHJA 1BXRB 2B8EA 2R8PA 3A1VA 4LSWA 3A4LA 1G5HA 4REQA 3I6BA 4NBNA 1JT9A 2NO1A 3OT4A 5EP3A 5C8YA 4P38A 3WVNA 2QXYA 3L6UA 1IMJA 4GEGA 4FE3A 3WNVA 3V80A 2PXHA 2EEPA 2FW0A 3PNPA 4R9RA 3K3PA 4JP2A 1OQAA 1T10A 1KZGB 4NNOA 2F9MA 2VG8A 2PZJA 2JGDA 3CB4A 5CXUA 2ICAA 3FOAA 4C2AA 1DO0A 5CR9A 1Z2DA 1ZJZA 1DEHA 3CG0A 3X2EA 5AI4A 1GNSA 2LCIA 3R0QA 3AERB 3BDVA 2AK2A 3VDRA 4Q3LA 4AF6A 3VX3A 2W6PA 4EX6A 1QDEA 2CHUA 1R7RA 3T1NA 3HKCA 3O03A 5F5LA 3TD2A 2VXYA 1Z7BA 4NWIA 3TVYA 4H1WA 1UC5B 3E7XA 2IOFA 2RBEA 1OWMA 4YY3B 4B4UA 1GYPA 1SKBA 2GK6A