3TGPA

Room temperature h-ras
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
162
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVEQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVRRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accessing protein conformational ensembles using room-temperature X-ray crystallography.
pubmed doi rcsb
molecule keywords GTPase HRas
source organism Homo sapiens
molecule tags Signaling protein
total genus 65
structure length 162
sequence length 166
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tgpA00
2ZSFA 3NIBA 2YHSA 4GMDA 2GTPA 3CR7A 5JWRA 5DI3A 5FPHA 4BFSA 3D3QA 5EXTA 4NBSA 2IS4A 2QU8A 2HCBA 2OCPA 5LD2C 1JALA 5JHHB 1JR3E 3GJ4A 4FW9A 2CK3D 1ESNA 1H8ED 5E3HA 1VIYA 2ORVA 1PUIA 2XJ4A 4JLNA 1IY1A 4F91B 4AKGA 1W48A 4DJTA 4QNMA 1ZU5A 3F3YA 4DCVA 1OH8A 1W2HA 2ANBA 4YQFA 1VG9B 1E9RA 2JDIA 4CEHB 3IDQA 2AWOA 3C15C 4BPBA 1F2UB 3FOZA 2JGNA 3PR1A 4Z1MA 3VHLB 2ODWA 3AVTA 5FPSA 5J4KA 1CP2A 2QPAA 3MCAA 3UMSA 1E2GA 2DHRA 3TNFA 5KOYA 1E2EA 2ZUDA 2D2FA 4Q7JB 2FF7A 4TMWA 1MV5A 3DPUA 1A7JA 2A30A 1IAQA 3VMFA 2RCNA 2F1RA 4NYIR 1G64A 4ON9A 2I1QA 3VR3A 5IT5A 1Z6YA 3ZS9A 3TIFA 1SVIA 4A9AA 2XNDA 3QENA 4BLSA 1KMHA 3KZ1E 2D4HA 4D80A 6Q21A 1R0ZA 4FCVA 1NLFA 1XXHA 1A5TA 1FX0A 3WMEA 1E94E 2KBEA 3WY9A 5FPTA 2Z43A 5JS7A 3NBFA 1HUQA 1E0AA 1UKEA 3WHKA 4D0LB 4LJ6A 1P73A 3QKRB 4CIDA 3CX8A 4YONB 2OFOA 3VR1A 4F7WA 5KU1A 2RGNC 4AKEA 4QFMA 5HKKD 4NE2A 2WWHA 1HQCA 4ZKDA 4LJYA 2GAOA 3HDTA 1XJ0A 2WSMA 2A3RA 3RRYA 2O8BB 1NVVQ 3KJEA 1SXJB 3JZMA 4TTPA 4EDHA 4IHQA 2QPOA 3LQQA 1E0SA 1KK3A 4TL6A 2FEOA 4AD8A 1E2PA 2OV2A 3P4YA 5FOUA 3K9NA 2P6UA 3BFXA 3P26A 4IFEA 2QORA 3WP1B 4D25A 5JMTA 3GLFB 1HH4A 1PV4A 1GM5A 5L3QA 4G1UC 1IN4A 3TW4A 3AVOA 2WWWA 3KUDA 3MJRA 2V7QD 3DMDA 3MLEA 3NKVA 4OHYA 4Q9IA 5HTKA 3M6AA 5KSPA 3W90A 1U98A 4Z8YA 1KDOA 2OE2A 3B2EA 3B9QA 4Q47A 2UKDA 2YVUA 3NHAA 3BORA 2CE2X 3SYKA 2GJ9A 4CVNA 1R6BX 3QKSB 1FQKA 2O5VA 3O8RA 2FJUA 5DYIA 4HLQB 5FOSA 5CYOA 1Z0IA 3ZIAA 4TQAA 1CJVC 1AM4D 1E2KA 1OHHD 4TLCA 2N1BA 4V02A 1XTSA 3DEFA 4C3ZA 2KI5A 1K6MA 1G5TA 2JATA 4EFMA 4QGHA 2J0VA 3TMKA 2ZS7A 5BW8A 4XSGA 3A36A 3IHWA 2WJJA 2BM1A 4CEIA 4C0QC 2GILA 1OB2A 3SOPA 2PLFA 2CVFA 1T5LA 3NWJA 1OFTA 1BS1A 1BYUA 2ZAMA 2FSGA 3GEEA 2H92A 4C30A 2WPDA 1S1MA 2J0QA 4RKFA 5D3MA 4DIEA 3T1TA 3A1TA 1D2EA 3U3JA 5EXSA 1AS2A 2G88A 2QRNA 1JAIA 2UVQA 3FHOA 1NSTA 2VHCA 3V4FA 4B3FX 4JKYA 4DCNA 3KFVA 1WDTA 4Q48A 3THXA 4XD7D 2GBLC 2ZSAA 3WHLA 4MRPA 5EUMA 5JFGA 4XVRA 1B23P 2MMGA 4AK9A 1TUEA 2RHMA 3MFYA 2ZRLA 3FPAA 1TTTA 5FBLB 4B3CA 4A92A 1TEVA 2LKDA 2Q21A 2ZANA 4OI0A 2CMKA 2R6AA 3SQXA 1AJEA 3KQUA 3AKYA 2G1JA 3MSXA 2F1JA 3BD9A 1R5OA 2P3SA 5JI3E 1S2MA 2IEZA 4DB4A 2I3BA 2YWHA 3KQNA 2RGXA 1EWQA 2LKCA 4LHZA 2H17A 4M9ZA 2BJVA 3A58B 1ZM9A 3G82C 2ZEJA 4QC2A 5G40A 1KYIA 4PSKA 2JLWA 2C96A 4GT1A 2BCGY 4TQ9A 1G17A 4MITA 1N6PA 4PQFA 1JBKA 4TT3A 3B78A 1G8HA 4G3XA 3MJHA 5SZKB 1OLOA 1F2TA 1YZTA 2BMDA 2W6IA 2XITA 2ONKA 2EW1A 4V0OA 3U61B 4AIIA 2P5TB 4Q9HA 3B5JA 5CYPA 1RRGA 1I2DA 1QHYA 1U81A 4JS0A 2BMJA 2SHKA 3W34A 1MT0A 1ONBA 2BC9A 2WJIA 4FWIB 4R2HA 3KXLA 3GJXC 5EP3A 4OQNA 2ORIA 2CE7A 1IXZA 2D06A 2QROA 3ADKA 4H9GA 5JEDA 4EPWA 5AUPB 4S35A 3AP3A 2O8CB 3E1SA 1MO3A 4JT2A 2IX3A 4ASUD 1R8QA 4L4UA 1YZUA 3FMFA 2QBYA 5FBRB 1NI3A 2YYZA 3NG1A 4OQFA 1S3SA 2VHTA 1E96A 3PQCA 3GLGB 421PA 4B73A 3RS3A 4PHFA 4DZZA 5HZKA 2VP4A 3AM1A 4FMDB 1E2MA 2VRWA 4KU4A 1N3BA 4MRRA 3WBKA 1L7VC 1GRNA 3H86A 1TMKA 2WWYA 2BHRA 4XTRA 4OKSA 5FPYA 4TTRA 1VTKA 4JL8A 5DH9A 5L3VA 4NZYA 4BUJA 2VEDA 2J46A 3Q3JB 3BH0A 2EFDB 2J5XA 1YJ5A 1EFRA 2V6IA 1YE8A 1WBDA 1UFQA 4C9BA 3AVWA 2JLRA 1JXOA 1YQTA 2GF9A 4OHVA 3EASA 4MKHA 4N1AA 5TXGA 1NJFA 2HCJB 3G0HA 4UJ3A 4ITRC 4PPGA 1G20E 4AG6A 3ND8A 5FOWA 5AWFC 3L0PA 2KBFA 2VHUA 4F38A 1W36D 2ZRHA 1VYVA 5B57C 1Z28A 4A2PA 3BB4A 4HAWA 4K8OA 4O25A 4DCTA 4GNKA 4JLKA 1AQYA 2J1LA 1H8HD 1G3UA 4LCBA 4XJXA 1KI6A 5FBQB 4JYCA 4PO8A 4MRSA 3GJ3A 1DAHA 4QBFA 2QPTA 5DYGA 2WAYA 3PUVA 4K46A 2BOVA 4Q1DA 1TF2A 3SHFA 1NJGA 1UAAA 1TADA 3BGWA 2ZUCA 1ODFA 1D2NA 1KGDA 2FE4A 3GMTA 2WZQA 3IEVA 1YZLA 4QKQA 1YZQA 2CEAA 1OH7A 1I4LD 4HB4A 2IWHA 4WOPA 4URZR 4W9MC 4M2LA 3CONA 3L8YA 1DARA 4A4DA 4I1UA 1Z07A 2BBOA 4MGIR 2Q9AA 4TL9A 2IYWA 4BLPA 4C0KA 5CJPA 1N6RA 5AK0A 2NZJA 1N5JA 5CK4A 3K0FA 1OXUA 5EZ6B 3TKLA 1S1CA 4MKFA 2BMFA 3CRRA 3T34A 4Q9JA 2OXRA 5JSZA 2DFNA 4B76A 2IYLD 1FNNA 4LV8B 3N2IA 4PC2A 2WM9B 4PZYA 5F2EA 3U7EB 3QKTA 1I4DD 2VPPA 1CR2A 1FOEB 1N0VC 1R0XA 4AYXA 4EPVA 2AKYA 3DL0A 5C18A 5TDHA 4OQLA 5G41A 1AZSC 3JVVA 1C9KA 2IC5A 1G19A 1XEXA 3ZZ0A 5KNDA 4B32A 3QIAA 2PMKA 3IQXA 5EXPA 2VO1A 3EARA 2Q3HA 5JLJA 1RZ3A 2ODNA 4A2WA 2C98A 3UWKA 5KSZA 4M9SA 1NBMA 1NLYA 2EU8A 4A6XA 4P4SA 3AGPA 1E9AA 1II0A 1NIJA 1SZPA 1XCMA 1WXQA 5AUNB 2XTZA 1T8UA 2JJ2A 1G6HA 1KI7A 2L0XA 2RAPA 2ZE6A 4DLUA 4Q02A 1JQLB 2VSOA 3C8UA 3OESA 3TVDA 2CL6X 3P27A 3UMRA 2PCJA 2Z5FA 4R9UC 2OZEA 4P0TA 5FBWB 3EA5A 2ERYA 2JASA 2ZU6A 3MAAC 1T91A 4UKDA 5CITA 5HPYB 3PEWA 1TU3A 4BFXA 2ZYWX 4RZXA 4QNRA 4YDSA 4C0AC 1OJLA 2CHGA 2AFHE 3QPWA 4MDEA 3T1VA 5ANRB 1KDTA 2VP6A 2EFGA 2ZJAA 2GJSA 3VU9B 2OM2A 3TVTA 4BASA 4DBLC 1DAEA 2F43A 1I2MA 4US0R 2QTHA 3ASZA 3BH6A 3MWLA 4MKIA 1JR3A 1ZP6A 1AS3A 1SGWA 3A1UA 3A37A 3K0CC 3LAWA 1TU4A 3SR0A 2XGJA 4TYYA 4F4CA 2HEIA 2WIAA 1SHKA 2EYUA 5FUXA 1NN0A 1XMJA 2JLZA 3MD0A 2NTYC 1IXRC 5E4FA 1U2RA 3ETLA 4NH0A 1E2IA 3AVPA 4UNPA 1P2VA 2J0SA 3PEYA 4PHGA 3CX6A 4HLUC 2R62A 821PA 2QQ0A 4LGMA 3KJGA 4O2LA 3EAQA 4KI0A 2WJVA 1EFUA 4B3BA 3X1DA 4HB0A 1FMLA 3WYFA 2QNRA 3K70D 3U6KA 2R6CA 1W4AA 1S3GA 1VMAA 3DMNA 5AJWA 2A5GA 4S2EA 5GJVC 5TY0A 2D7DA 4W5WA 1YR6A 1ZMXA 4NYJQ 3U5ZB 4XIGS 3RWMB 5EE3A 1FUKA 2F55A 1RJ9A 3I3SR 4JBWA 4DIDA 4PC6A 1M1YE 4EQ6B 1R10A 4KYUA 1NMZA 5IF9A 5L3RA 4DCSA 1OYYA 3KJHA 2HLDD 3GJ0A 2CNWA 2VA8A 1K5GA 1G3QA 5FOVA 4URUR 5CLQA 1KAGA 3QY0A 2G6BA 4RD4A 3S1AB 3FTQA 1MO5A 4LUCA 2V1UA 4URVR 4PZLA 1GL6A 2QTVB 4OK3A 3SDZA 4WAUA 3WMGA 1YR8A 1GUAA 2PEZA 4Y0AA 4LSGA 1PLJA 2IBMA 2GAAA 3A1WA 1RE0A 1O3YA 1G8PA 4ZDKA 3B1WA 2WJYA 4HAZA 1NNEA 1SVLA 4WZBE 1L8QA 1W0JA 3A4NA 4DDUA 1T0HB 1KI9A 2ODEA 2PX0A 3MUFA 1E4YA 2A2ZA 5EUQB 1QDEA 4BFUA 2ZE8A 4JVNA 3NBZC 2OXCA 3K09A 3EC2A 5JWHA 4C0LA 1KK2A 2ZJ5A 4PSAA 1N6OA 4M8NE 1G1MA 3EG5A 2AK2A 4L9SA 3X1XA 4KJZA 3EC1A 3AEZA 2PL3A 4TLDA 2O8FA 4L16A 1DADA 2BVNA 2FEMA 2FSIA 3GJ8A 3K9LA 4FCWA 4P3YA 2XZOA 5K8IA 3AVQA 2J0UB 4HUQA 5HR5A 2XAUA 2ZS9A 4LX0A 3OFND 3U60B 2ZRKA 1GNRA 3N70A 1U94A 3SJCA 1U8YA 1T8TA 1YZGA 1J7KA 2F9LA 3BOSA 3CWQA 2CK3A 5E7JA 2HYDA 3W6OA 1COWD 1MR3F 2GETA 2ZI5A 3LBHA 3SI7A 1D6JA 1G4AE 1UBCA 2QUZA 5BN4A 4DUGA 4YLGA 2NO0A 1R7RA 4A8JB 3RC8A 2GXUA 1CJMA 3ND9A 4HLDA 4XH9B 1CLUA 4A0HA 4CYMA 1A2KC 3CR8A 1P9RA 3D7MA 3QE0A 4AURA 3PG5A 1GAJA 4JLDA 3QF7A 5FL3A 2IHYA 5FH9A 2OESA 4Q01A 4FCTA 3PXGA 4B6FA 2RGGA 1VCNA 4B71A 4Q7LA 3CRMA 4B33A 1EX6A 1KDPA 2H16A 1OV4A 3J81k 1NN1A 4QM7A 3NTUA 1RRCA 3HYTA 1Q1ZA 2JEOA 2ONJA 1ZM7A 3GFPA 3TUJC 1XD2A 2C78A 2HYIC 1N6NA 4A6PA 3H1TA 4R71A 1NF3A 3A8TA 1QHXA 1XX6A 4I1SA 4WA7A 4OQXA 2VQSA 1KSFX 1VHTA 1UBFA 2DBYA 3GLIE 4IDOA 4KSBA 1GRRA 1XMVA 3CW2A 1OB5A 4AI6A 5DI3B 3ZH9B 4JBXA 4PSVA 1X6VA 1XMSA 1SKYB 2OO7A 3ASYA 1SHZA 3PCRB 5FUWA 2GXQA 4MUAA 1CTQA 1VYUA 3SN6A 2DCUA 5E7MA 4CF7A 1FL9A 3OF5A 2VF7A 4Q1CA 3TBKA 5TARA 4ACBA 1OFHA 3IO5A 2CHQA 2WJHA 1RRPA 2RGDA 1GG2A 3GFTA 4WZAE 3QBTA 1KI3A 2GJAA 1J70A 4YMSA 5LPNA 1XTQA 4JVMA 5FOTA 1GDDA 5FFMA 4QM6A 5JRZA 5KNBA 1CR4A 1Z6XA 1J2JA 2PZEA 4UXJA 4ERNA 4A15A 3SC3A 4CT4B 1W7AA 2E1RA 4CZ2A 1WCV1 2ZXUA 3IGFA 4X8MA 4PQRA 4ESVA 1HYQA 1G7RA 1KY3A 1B0UA 1RIFA 4BFZA 1ZUNB 1ZM2A 3DOEA 2QSZA 1ZINA 1G7TA 2C95A 3FVQA 1M7BA 3VR5A 4EPXA 1X8KA 1NVXQ 2CL0X 2XNSA 4IDPA 1M7HA 5EE9A 2GEVA 4UXHA 4QGAA 3CPHA 1YU9A 3GLHE 4QHYA 5KNCA 2OLKA 3VHXA 3IUYA 3LNCA 2IL1A 1KMHB 2QI9C 4YXWD 2I1VB 3A1SA 2A5DA 1ZNWA 3VQTA 1HT2E 2PJZA 1XXHB 2FFHA 3REFA 3GD7A 1CKEA 1D9ZA 3C16C 1FX0B 2B8WA 1G3MA 2AL7A 2B6HA 4PO9A 4DLZA 5AUOB 4BGDA 3CX7A 1NSFA 4B74A 1DE0A 4LZZA 4OJQA 1KK1A 2WIBA 2OUKA 5HE8A 4BRWA 1OHHA 3FE2A 1CIPA 4LC1A 3GJ5A 1GP2A 5EE0A 1E1RA 1WP9A 3LRPA 3PFIA 1N6LA 4HAVA 2HJGA 4B44A 2QP9X 4V0NA 3B82A 1OPXA 1GNQA 1P6XA 2K5UA 3U4QA 2JLXA 5JEEA 1JECA 2C04A 1U0LA 3HR7A 4CW7A 5KDDA 3RRNA 2IYYA 2QT0A 2ZRMA 4LJ4A 3THYA 4QOSA 2VH5R 1GZSA 4DT1A 2BEJA 1EESA 1OXSC 3T12A 2BJWA 2J45A 2YJTD 3OHMA 4FI3C 3RSLA 1MRSA 1R0WA 4NP6A 4I81A 4URYR 4GPTA 3KUCA 3GP8A 2X1VA 2YNMA 1BKDR 5CJ2A 5L3QB 2ZE7A 3MG9A 4QHSA 1NMXA 2X8AA 3FKSA 2W2VA 4A8JC 5LB4A 4Q4JA 1KSJA 2C5LA 3THWA 2EWWA 3DZDA 1A1VA 3TUZC 4BLRA 2QAGA 3A1VA 1R5BA 1DAKA 2R9VA 5UKDA 4TLEA 5C4GB 1Z2AA 1GIAA 1L4UA 3AF3A 5JJIA 3CPJB 3CBQA 5G53C 2ERXA 2IEYA 1RRFA 4F93B 1X8JA 2ZI4A 4MRVA 5FTMA 3RRZA 3KTAA 3W8NA 3ICEA 2J7PA 2VTKA 3CB4A 4YMVA 1JR6A 1DEKA 2GBLA 4PANA 3LWNA 1U90A 1XP8A 2IYUA 4IOJA 2YZ2A 4C0HA 1ANKA 4LYHA 3CLVA 2DR3A 1YZNA 3TQFA 4CEIB 1IY2A 3EXAA 1QHIA 3RNLA 2ZQ5A 3OE7A 3W6NA 4OYHA 3FGNA 4Q9KA 2WAXA 1G3IA 2DB3A 1II8A 1GRQA 1Z47A 3EZ6A 3FWYA 1NL3A 2ZUBA 1JI0A 4Q7MB 4RCZA 4P4TA 1BIFA 5D3MB 4EJSA 1A82A 2F9MA 3QEJA 4PC7A 2FNAA 5EP4A 1NN3A 2Y8EA 4OHWA 1XCGB 4PAQA 3K1JA 2OBMA 3U3KA 1E0KA 3EA0A 3AF1A 4WXPA 4P32A 4PR0A 4RCYA 1M6NA 1PJRA 1DG1G 3OEED 1QBKC 1XB2A 4W5JA 3THXB 4GOKA 3AF2A 4AKHA 3B85A 3U7HB 1ZC3A 1P7CA 4L9WA 4M9XA 1P2SA 5KPJA 4EFNA 2PT7A 1CU1A 3QF4A 2RGBA 4M0LA 3EX7C 4ZDIA 1NIPA 3CRVA 2VBCA 2N42A 3TJZA 3PUYA 3BERA 4NONA 5BXQC 4MDFA 4TWZA 1P60A 1XJCA 3KX2A 3Q5EA 4RFVA 1SQ5A 1G6OA 4JLAA 4URXR 2R2AA 3OEHD 5D3QA 1Q1BA 3CF6R 2RGEA 1D8TA 1SVWA 2AWNA 2W83A 4A0RA 3L82B 3DOFA 2OFWA 5JJKA 4NL4H 4UNSA 4E07A 3GPLA 1KZ7B 4QJ4A 4GDFA 2G0NA 4FIDA 3TK1A 5KDOA 2ECKA 2IHBA 3GEIA 2IA5A 1X86B 5H70A 1F2TB 2O0JA 4DSOA 3U6BA 1NVUQ 4HZUA 2F6RA 1G291 3LXRA 4KLNA 1VCIA 1WF3A 1GKYA 1U9IA 4KFUA 2FOLA 2C9YA 4JLJA 3IPXA 4I4LA 1W44A 5CLLA 3ADBA 2O8BA 1KMQA 1LB1B 5DE3A 2HUPA 1QHSA 3NEJA 3EPHA 4D26A 3EZ2A 4LDJA 2ZI3A 1HURA 1U8AA 1G9XA 1H8HA 2Q3FA 2QE7D 1OW3B 1UEIA 1OT3A 3WNBA 1S4QA 2WBLC 4TZ6A 2IXGA 4NMMA 2WWFA 5FTNA 4Q7KA 1JJVA 3FMIA 5TMPA 4EPTA 3LXXA 2QBYB 2ZRBA 1LFDB 2ZM5A 2P5SA 3UATA 2MSCB 4AC9A 1QHHA 4FMCB 4ZI2A 3EPLA 1P61B 2QN6A 2HJVA 1NG1A 3U7GA 4JLBA 2VP9A 4NCJA 1LW7A 2AN9A 1Z5ZA 3KB2A 3QPUA 4P33A 2YC2C 1BYIA 2XX3A 4OI2A 4E5UA 5HZHA 1F5NA 4JVLA 2WTUA 3ZDQA 1KTVA 1HY3A 3U2QA 2R6FA 1T4GA 2FN4A 3NEYA 2O0KA 2Z6VA 3SJAA 5JJLA 1ZNZA 1FTNA 2R6GA 5IHPA 1YKSA 4L5BA 4QJ3A 1E9EA 1Y63A 2ZRNA 3LH5A 3KQKA 4RD0A 2EFHB 2DYKA 4K81B 1GSIA 1IN7A 1EX7A 4GZMA 2GF0A 1QRAA 2OSBA 1GWNA 2PMDA 4OK6A 4KO8A 4D81A 5HCNA 3N5CA 3FB4A 1E2LA 3LVQE 5H1YA 1LF5A 1HA3A 3IPYA 5EQTA 3ZD7A 2QQEA 5KPDA 5GADl 3RC3A 4N0EA 5E7IA 1G3RA 3QXHA 4HDOB 4KLZA 4BRUA 4EFLA 5FTLA 2FPLA 2VSFA 3T06B 2Q9BA 1NRJB 1WBBA 2IWRA 1OXTA 1KI6B 2GCPA 1Z6GA 1KJZA 3ZJYA 4RD6A 1UEJA 3I92A 2D3WA 3UG7A 1NVVR 2PEYA 4BFWA 2FZ4A 2QEQA 4M1YA 5JI2E 4WIAA 3RWOA 2CJWA 2RGAA 1ZD8A 5A0FA 1SXJC 4DSTA 5TV2A 3D6TB 4C0BA 4DRZA 2JLSA 4FD2A 1FPMA 1VKJA 4TMZA 1OIVA 2V9PA 1E99A 5J4HA 3T1QA 3PJRA 3TRFA 1YR7A 2KSQA 3D8BA 2YWFA 3I72A 4GMXA 4FWTA 3OIVA 4A0FA 1P75A 5KSOA 1S9DA 4ZDWA 4DLXA 5J4LA 5DISB 4GOXA 3A4MA 1G7SA 4IW3B 4DSNA 3KFXA 3BE4A 2BIFA 4A0GA 3KL4A 3RS7A 3OAAD 4R2IA 1VYTA 3M0EA 4DEYA 4W7SA 5JSZB 3R8FA 2VP2A 5CB8A 1SXJD 1IN6A 3TUIC 1N5LA 4AKIA 2ZVQX 1U0JA 1ZD1A 2NO9A 4Q1AA 5B64A 3Q72A 1P9WA 2WVJA 3QG5A 4IFBA 1M8PA 2CLCX 3UK6A 1OH6A 4GL2A 1BOFA 1XEXB 5BYJA 5JBQA 3WNDA 3SE0A 4OK5A 3L43A 3QVVA 4F4IA 3AUYA 3IEUA 5E95A 4Q66C 4IEIA 2EQBA 2A78A 3CUEF 3VTKA 3LX8A 3VNUA 2ZYTX 1U0HC 2CBZA 3D31A 4Q1FA 4QJ5A 3M4YA 2JLYA 4CGZA 4ZO4A 5C46F 4MUBA 4P4SB 1ZRHA 2HF8A 2JJ1D 2ODBA 1II9A 1Z8FA 3RS5A 3RS4A 1CJTC 2ZVPX 1FUUA 1T9HA 3QUSA 1AK2A 1PVOA 2FZLA 5A5GA 1CRPA 3I5YA 4ARZA 3TAUA 2WMNB 4YMWA 2NO1A 3QEOA 1XU4A 3Q5DA 4B47A 3QPVA 3AP2A 3JZAA 3PIRA 4MYHA 2W2XA 1HE1C 2CVHA 2IUTA 4ZCLA 3HP1A 3GJ7A 2UZ3A 4ZDJA 1JJ7A 1TQDA 1Z0AA 3VX4A 1DS6A 3BS4A 1NY5A 2WKPA 1HEIA 2QG6A 3CNLA 1N5KA 1RVDA 3ZVLA 2J7KA 1MOZA 1S96A 4OL0A 3PITA 1XBTA 1KK0A 3TQCA 4RD3A 3GLIA 4IXMA 2Q9CA 2W58A 2ZJYA 4TYNA 4M1WA 1Q1QA 3R20A 4N3NA 1E6CA 3SQWA 2HLDA 4ZIRA 4QBHA 5CIWA 1JB1A 1KI4A 4KAXA 1MO4A 2F43B 5B2ZA 3ZQJA 2JIZD 1QHNA 2QRZA 4TN1A 3PENA 3NDPA 4NYMQ 2HT1A 1MH1A 2Q3MA 5EE5B 4HAUA 3FFAA 4KVAA 4BFVA 3Q7PA 3QXCA 1TQ6A 3ZQ6A 5FUVA 4D4JA 1DOAA 1XTJA 2EYQA 1KJWA 4WZ6A 4XWAA 4BLTA 1P4SA 1Q3TA 5IRCD 4UQOA 2V4ZA 5FI1B 2W6JD 4M21A 4U5XA 4WXRA 1VDZA 3WBJA 4IDNA 4XOIA 3W3ZB 1ZU4A 2GZDA 3H4MA 4MRNA 1UDXA 2VP0A 4I99A 4AYWA 3B13B 4OI4A 1NG9A 4TL7A 4JSTA 2DFLA 3QG1A 4D82A 2OCAA 1ZYUA 2RMKA 4BLQA 1XEWX 2IYXA 3G5UA 1KI8A 1E0JA 1KNXA 4BZXA 2MSDB 1CS4C 1Q20A 1E69A 3L0OA 4HI0E 4LJ8A 2BM0A 3I73A 3NH9A 1P72A 4X8HA 1UKYA 2AXNA 4TMVA 3HU3A 5LDDC 5F9HA 3SHWA 1RJ9B 1ELOA 2UZIR 1UKVY 3KKNA 3X1WA 3GLHA 5AR1A 1HTWA 1E4VA 1SXJE 1KO5A 2AK3A 4L8GA 2ZRIA 4RFSA 1AS0A 1AGRA 2ZRJA 3DM5A 3IKJA 2IYRA 5DNYB 1GNPA 3RVBA 2J87A 4LJ7A 4C0SA 1W0KA 1LS6A 3BB3A 1Z63A 1KI2A 4Q9LA 2B92A 5IK2A 3R9WA 1LS1A 4JMPA 4Q19A 4LHVA 3PUZA 2FDCA 4TQUS 1J99A 2QMUA 1T3SA 4C2UA 3GLFE 3L8ZA 3CF0A 2I4IA 1COWA 1RYFA 1KAOA 1J8YF 1UJ2A 5H8WA 1G4UR 4LY6A 3SBDA 1GKUB 4QL3A 1E9CA 4M1OA 2IYZA 3W8RA 3PEVA 4KCGA 4MGZR 4C7OA 3CZPA 3T5DA 4JZKA 4PC1A 5AJVB 3AVUA 2GJKA 4Z51A 1FFHA 1YZKA 3CPEA 5GVRA 1DAIA 1W4RA 2AD1A 2PX3A 1W46A 2BCJQ 4Q03A 5G3YA 1DO0A 3EIQA 4HYYA 4LRWA 5KYKA 4LBVA 3PUWA 1XJQA 1G21E 3C5CA 1FTSA 4WW0A 3AVYA 5DO9A 1Q1EA 1ZUIA 1AIPA 1IXSB 3Q9LA 4Q4AB 3DDCA 3B1XA 2ZS8A 2GCOA 1XRJA 3E5HA 2LCFA 3QNUA 5IDVA 5J40A 5L3SA 2O8FB 2XSZA 2QM7A 4HUQB 4NKRA 3RRMA 5CK5A 3LY5A 2F7SA 4TSFA 1KNQA 1N6IA 5KHOC 1UBGA 3SFZA 3VU9A 2PH1A 2ZJ2A 5DLQC 5FUYA 2WSSD 2OBLA 4MYCA 4RVCA 3FMPB 1N0UA 3W6PA 4QXAA 2WJGA 4KSCA 4Z54A 1US8A 3ZVRA 4TZ0A 1F3OA 5JRJA 1L2TA 4LHYA 4XSHA 4B2PA 1SVMA 3QXXA 2IXEA 1NBMD 2XTMA 3EWSA 2PJRA 1P2TA 2EFEB 1UM8A 2ZTSA 4H1VA 5FL7D 3A6PC 4XVQA 2FFBA 4IVRA 1DELA 3ZVNA 4Q4HA 3VX3A 4BZQA 4LYJA 4X8OA 2O0HA 3HYRA 5G3ZA 2VYFA 1OH5A 2A5YB 1IQPA 4LYAA 1SKQA 2FX3A 4OI1A 2P6RA 1E1QA 1GITA 1U99A 1ZW6A 5FTKA 4JJZA 3VKHA 2CHVA 4U00A 4HB3A 2YOGA 5K8LA 1TPZA 3T5GA 3EIEA 1OXXK 1XD2B 2ZPTX 4J0QA 3TH5A 1M2OB 1IONA 2GK6A 1ZUHA 2GCNA 4TLAA 3RABA 2E9SA 4ZCMA 3AF0A 4DLTA 1GL7A 2VP5A 2O52A 3VKGA 4MQBA 4PXAA 4KITB 4HEJA 1Z29A 1Z6AA 1Z2CA 1JAHA 1X3SA 1H8EA 3K0AA 2ZIAA 3AKDA 2J41A 4NDZA 2JLVA 3P4XA 3RAPR 1OKKD 1XTKA 2H7VA 1P5ZB 1OFUX 4GP6A 2AD5A 4ZPXA 4B6EA 2Z4SA 1U8ZA 2YINC 5EP1A 4JYBA 1ZC4A 2QT1A 4LPSA 3GLGE 3DHWC 4DLWA 1XCPA 5B58C 2ZRGA 1GOTA 2FSHA 4JL5A 2NIPA 3UPUA 2E87A 2VSXA 4NYIQ 5DN6D 1O87A 3Q7QA 3TSWA 3TSZA 4TYWA 3CWZA 1ZVQA 2FFQA 2WWXA 3BK7A 4PHHA 4CT5A 4DEXA 1YRAA 1AA9A 4MKGA 4ESHA 3VR6A 5FBVB 5DSZA 1XPOA 4U7DA 5CM9C 2VLIA 4DCUA 5JWOA 3C7KA 3AUXA 1F60A 4ZKEA 2VHJA 4CEJA 5LB2A 4DHEA 4JJKA 4KODA 3ZGXA 1QG2A 1C1YA 1DAFA 2YWEA 4DLYA 2PLRA 5ELXA 5BWMA 3K8YA 3LBIA 1TL7C 5EZ5A 5GVSA 5EE1A 1N0WA 4NCNA 3DO6A 4CDGA 2O8DA 5H68A 3T61A 2HV8A 3R7WA 3LW8A 3BH7A 2J0UA 4GFDA 2XOKD 3TSOA 3Q85A 2CLSA 2CNWD 2OT3B 3ZZTA 4B3DA 4JT4A 3B1VA 621PA 4QG7A 3IIMA 1D5CA 4NYJR 1TEXA 5FOXA 1E2QA 1Z22A 2J59A 2GHIA 3AP1A 2O8EA 5HKKA 1IM2A 1UDWA 4HAXA 5JZVA 3K9GA 2FV8A 1MABA 2GA8A 1HV8A 4B2LA 2IYSA 2QGNA 5J5CA 1FP6A 3SEAA 1EFTA 3QOFA 1LF0A 1RC8A 5EXXA 3H0KA 2REBA 2DFKB 3ECCA 5CB6A 3NHBA 1TQ2A 1UBEA 2BBTA 3IBGA 1J8MF 3U4QB 3RLFA 1LNZA 1G7CA 3F0TA 4JL6A 3THYB 2RGNA 1HQYE 2IS2A 2PZFA 4DSUA 5KSYA 2AFIE 3C14C 3E70C 4DT1B 2QZ4A 1VG8A 4DDVA 3U44A 4B48A 2H8KA 1TX4B 3IHLA 3OEEA 1Z0FA 2V7QA 1Z0DA 3W5JA 1VECA 1AN0A 2NG1A 3OIUA 4BZPA 1GTVA 2Z4RA 1P2UA 2F3TA 4PTLA 1CULC 5CDFE 1IN5A 1OYWA 2BDTA 3AB3A 3B1ZA 4Q4JB 3TW8B 3THWB 4IOLA 4TMTA 4PFSA 4PPFA 2V1XA 2NZ8A 2DWQA 2QAGB 4IOMA 3QJYA 4DXAA 2G3YA 4FMDF 1XZPA 3HJNA 1AKYA 1TUIA 2YKGA 4HLCA 4EIWA 1IJFA 4P31A 3SYLA 4PPQA 1E2FA 1E9SA 2VHQA 3KTAB 1G41A 2CLDX 3LLUA 3OEHA 4JLMA 4W5HA 4BQSA 3V4RA 2QP3A 3CNNA 4TYPA 4M4SA 2ZYUX 3E2IA 3P32A 2XXAA 2H1LA 3BFKA 3AKCA 3SBEA 4DUGD 4C4PA 2ZSDA 3EZ7A 5FR1A 4KBFA 3RSOA 4O2RA 1LTQA 2IF2A 2NPIA 2VF8A 4QGFA 4UXIA 3X1YA 3OIYA 4C2TA 4A36A 3WRXC 4JLVA 1II8B 2R8RA 4AYTA 4EJSB 2D2EA 1QVAA 1EG7A 1KO1A 2ZRDA 1KSHA 2ZYVX 4XD7A 4YMTA 5A4JA 2ZJOA 2ZJZA 1OXVA 2A7QA 2PT5A 1P9NA 2P2LA 2QP4A 1KKMA 1Q12A 4I1VA 1Q3HA 2X2FA 3NC1C 1Q44A 2BV3A 4Y0VA 1KSGA 2QE7A 5KO2A 4G01B 1SVOA 2WWIA 3GJ6A 1M74A 1N25A 1BMFD 1YRBA 3VR2A 3AKEA 2NOAA 4I1OA 1RKBA 1XEFA 3QF4B 3LW7A 2FGJA 4E09A 1AGPA 4MYTA 4A2QA 1VCOA 1XEWY 1S0UA 2H5EA 2QMEA 2YV5A 1V5WA 3B1YA 1W47A 4PHTA 1JQJC 4H1UA 3EZFA 1TNDA 1RFLA 2JAQA 5B30A 1NLZA 4C0JA 3R9XA 1T5IA 1JEEA 3HWSA 1XPRA 2WV9A 4XWOA 2FG5A 1ZJ6A 3WRYC 3MWJA 1CR0A 3K0EA 5FPKA 3BBPA 5EJEA 4IRUB 1D9XA 2F1IA 4Q00A 3HU1A 1CEEA 3IIJA 1KKLA 2JLQA 3BAFA 1CBUA 1UPTA 2P67A 3AGQA 4KFRA 2QSYA 5P21A 3THOA 4BE7B 5K8TA 4CEHA 4Q1BA 4GOJA 4KHZA 3U7FB 1F2UA 4HZUB 1ZIOA 1TF7A 2MMCA 3C41J 4G5OA 3NBYC 4US1R 1IY0A 3VNVA 4E03A 1E79D 1W36B 2Z83A 1Q0UA 4ASUA 2ZR7A 3GQBA 4V03A 4YC7A 4RD1A 4GBMA 3QXJA 2YC4C 4B2IA 4DLVA 3WNCA 2D62A 4ACAA 2Z0MA 1DBSA 3NXSA 4NTZA 4UNQA 1QHHB 3K0SA 2IK8A 2V55B 1XPUA 2VL7A 3CKLA 3CM0A 4LBWA 4GRAA 3ONWA 3KKMA 1ZAKA 3QKRA 4MGKR 2JA1A 3ADDA 4IKEA 2BKUA 3IO3A 3QI2A 3I8SA 4IOKA 1W49A 2ORWA 1JNYA 2XZLA 5BQ5A 3V9PA 1PUJA 3LLMA 5KTYA 2YOFA 1N6HA 3B6EA 1M7GA 2FU5C 3OAAA 2JDID 1K8RA 1MO6A 2A5JA 2GDJA 3CH4B 1Q21A 3DM9B 1E1RD 5EP2A 1FQJA 2ZROA 2ZITA 4Z1MD 3FFBA 1SXJA 1IHUA 2ZSEA 1EWRA 2P65A 2B8TA 1Z0JA 5DIFA 5FR2A 3REGA 4V0ME 3QXSA 4FN5A 4IDQA 4D4MA 4DDTA 3FHTA 5JECA 1WA5A 3H84A 4YDHB 1T0JB 2QAGC 4JBYA 4PAMA 4DB2A 3V00A 2TMKA 3LA6A 2AHOA 1E2DA 3H2YA 4HATA 1KO8A 4QHTA 221PA 1V43A 2QY9A 1EFCA 5DHFA 3GLFA 3AVVA 2W2TA 1EXMA 521PA 2ATVA 2AX4A 3VFDA 1ESMA 2FGKA 2R6DA 2H18A 2XNDD 3ADCA 2XJ9A 3DZ8A 3UWOA 1X8LA 4G5QA 4TMKA 5AJXA 4RKEA 2GKSA 3FKSD 2CJWB 3BXZA 4KBGA 2QAJA 1W4BA 5K8UA 2JJ1A 3CZQA 2C9OA 3QKSA 4ZV4A 1UKZA 3NBXX 3UANA 5BN5A 4TMXA 4TYQA 1P3JA 4EJSC 4HAYA 1E3MA 1G8YA 3FDIA 4KV9A 1ZM3A 3CF2A 2GXSA 4JLPA 4ZCIA 2G83A 3K9HA 1KY2A 3O8DA 2ATXA 2GRJA 1CR1A 3BJIC 4TTQA 4LC0A 2J7PD 1GVNB 5AJYA 2XEXA 1SVSA 1KHTA 1NKTA 4LBYA 4PAOA 3AQ4A 4B35A 2GNOA 2G0TA 4IVQA 2BWJA 3B60A 2FPKA 4IVPA 1CRQA 1E98A 3OE7D 2RKOA 3UG6A 2DPXA 2OAQ1 4D2IA 1XDBA 2GWHA 3KKPA 2C9CA 2OG2A 4PQYA 1Z08A 1DVRA 4XTCS 4BEBA 2JIZA 2FSFA 1TAGA 3EIHA 2EWVA 3IIKA 3WMFA 2R65A 4UJ5A 4Q4LA 4B43A 2J9RA 1OF1A 2QL6A 4BEJA 4DVGA 3U3OA 1KJYA 2OAP1 3LQRA 2D74A 1FP7A 2N46A 2W6JA 3LFUA 2OHFA 3QSYA 1SKYE 2G9NA 3ZIAD 4ARZB 1KO7A 1R8SA 1U9IC 2MSEB 2V54A 1WQ1R 1Z3IX 3VKWA 3MWKA 3K0FB 1XZQA 1F48A 4O3MA 4XVUA 4JSYA 2OBNA 2JJ8A 1W36C 1OSNA 3FMOB 5AJZA 2ZRPA 3T1OA 3K70B 1NVWQ 4HSEA 4OHXA 4CRWB 2GK7A 4IJMA 3SS8A 4HDCA 3KDSE 2W0SA 4HDQB 2X2EA 2IF0A 1AQUA 2GVDC 2RB4A 3EPKA 2WPDD 1CF4A 2OCBA 2GEUA 2QA5A 3P20A 4M1TA 2REXB 3F8TA 4LJ5A 1HT1E 3O8CA 2WKQA 4PC3A 4URWR 1JPJA 1YHNA 3NH6A 1XF9A 4L15A 4POAA 3GLIB 2BMEA 3KB1A 4P4UA 4BFTA 4R98A 4LHXA 2Q6TA 4ZIRB 2IYQA 3HPRA 3QVUA 1R2QA 4LPKA 4M22A 5F98A 4M53A 2O8CA 5HE9A 1IJEA 4QRHA 2WWGA 3HR8A 1RPZA 3DVLA 1XTIA 1VPLA 4KYIB 3A4LA 4QBGB 4RSGA 5J4VA 3GLGA 1W1WA 2P0EA 4PPNA 2WMOB 5F9FA 3C4JA 3RDPA 1WE2A 4GI7A 1XXHE 2ZE5A 3DKPA 1XMIA 4RZ2A 3BRWD 1ZM4A 1S8FA 2GESA 4KFSA 2NO6A 2QMHA 3TLXA 3K0CA 4RY2A 5J4YA 1OIXA 1G8FA 3BFVA 1RW4A 3PVSA 5GJCA 3IILA 1XD8A 2FA9A 1YR9A 4TT3D 1SVKA 4DKXA 1L4YA 2IW3A 3UXMA 4KFTA 4Q1EA 3I62A 4G5GA 1ZNXA 2HT6A 4LJ9A 2W6ID 3ZVMA 3U3RA 2AXPA 2IT1A 4HLUA 1LVGA 4JLOA 3CIOA 3NDBB 1DAGA 3GLHB 2JLUA 4NU0A 4F92B 2A9KA 4WVFA 1W5SA 3R9IA 2KB0A 4RFSB 2ZI6A 3EWAA 1FZQA 4G5RA 5SZJA 2V3CC 1BH2A 1WRBA 5M04A 4DWJA 2ZI9A 3ZD6A 5BN3A 2CDNA 5DGXA 3T35A 121PA 1QHGA 1NMYA 2WSSA 3MRSA 1NKSA 1W2GA 4GZLA 4IDHA 1TF5A 3BWDD 1DAMA 3RHFA 2FPMA 3SU8A 2ZJ8A 1EGAA 3IBYA 4FINA 1GILA 2YOHA 2OLJA 2ZR9A 4QBIA 2FMXA 4WBSA 3T15A 1E9DA 3R8CA 4DLSA 2FWRA 5SZIA 5JCZA 3MGCA 2B7BA 2OFXA 3K53A 4IEEA 4B3XA 2ZRCA 3L2OB 2ZJBA 5CM8B 3UKDA 2AKAB 1OFIA 3HPQA 1WMSA 3KXIA 4BLOA 1IOZA 5F3WB 2B21A 4LOAA 5C4MA 4C7OB 2NPFA 5FL7A 1Y3AA 1EFHA 3RYTC 2QMOA 4AY2A 3SYNA 3I4LA 5CIQA 4OQMA 5L8VA 4MH0R 2CCKA 1UADA 4NCHA 3TR0A 3OZXA 1EFRD 3AV0B 2GZAA 3BB1A 4X8LA 4EPYA 1LV7A 4DLRA 3FHCB 3KKQA 1UF9A 1AZTA 2GCOB 2QENA 5L3SB 4G0NA 3OFNA 2C77A 2R44A 4LK2A 4KXFB 1XD9A 3TGPA 2JCSA 2C2HA 5J47A 1Z83A 3CRQA 1QZXA 2J3EA 5CDFA 1VG1A 4NPHA 4LV5B 2EFCB 1KI1A 4EUNA 2IYTA 1KDRA 4V0KA 1XNJA 2HF9A 2IXFA 721PA 1ETUA 4II7A 2QM8A 3W9YA 2NQ2C 2DWPA 4D0NA 1SULA 5BYKA 1OKKA 3KJIA 1DPFA 4ABYA 3M1IA 3KXKA 4US2R 1US8B 5JHGB 1OIWA 2IUSA 3BIFA 2IUUA 3K70C 3KQLA 1BO6A 4E22A 4FMBB 4EPRA 3JVUA 1PZNA 3CH5A 5FTJA 3NVAA 3ZS8A 5C2JB 1R5NA 2ANCA 3GCGA 2C99A 2ASEA 2GJ8A 3VAAA 4ZI3A 4RD2A 2D7CA 3I61A 5DN6A 2GXAA 3AF4A 4PO1A 1VG0B 4Q4HB 3WYGA 4A82A 2ZI7A 3HU2A 4MA4A 2XB4A 2VIIA 1ZCAA 3RS2A 5LBIA 2CCJA 3PUXA 3TE6A 3EW9A 2CCGA 2KWIA 3EZ9A 4AG5A 1ZCBA 3ICQB 5GJWC 1A2BA 4GP7A 1EK0A 4TL8A 1E2NA 2AR7A 4JKIA 2X19A 1I4TD 1Q22A 1Z0KA 2W00A 4LBZA 3I5XA 2EVWX 3I32A 4B75A 2KJQA 2F3RA 3FKQA 3TAHA 3WYAA 4JVSB 4LJAA 5HCIA 1N2CE 3O47A 4UNNA 1P62B 1QF9A 1CJKC 4A1FA 4Q5IA 1XFAA 3AH8A 5DI9A 4LI0A 2XOKA 3K0AB 3LBNA 3O8BA 4M9QA 1KOFA 2NO7A 1FMJA 1Z6TA 2WICA 1FW6A 4V0LA 2ZAOA 1F6BA 3SFVA 5TVKA 4U02A 2LWIA 4LWZA 4BFYA 4MGYR 1MKYA 3EPJA 2DWOA 2F1HA 4B34A 2FH5B 2PCLA 1XWIA 3LDAA 3QBVA 2YWGA 4NHOA 1C4OA 2BBWA 4Q21A 3L0IB 1E2HA 1S9HA 2JJ2D 2WKRA 3ZLJA 5LD2B 3AVXA 1T6NA 1DO2A 2V8OA 1G8GA 3CRW1 1N5IA 3DKVA 3X1ZA 2W0MA 2XTNA 3I8XA 4NYMR 4M1KA 2ZRAA 2CL7X 2WHXA 1QG4A 3NC0C 3UIEA 1IN8A 3LD9A 4HB2A 4OBEA 3LVRE 1KZGB 4XWKA 1G5RA 1ZD9A 4D6PA 3QKUA 1Q57A 2IS1A 1VHLA 3SNHA 4NCIA 1WB9A 1A4RA 4CEJB 2C8VA 2A5FA 1R0YA 4LHWA 4EQ6A 1OE0A 4Q4AA 2KE5A 2V6JA 2XB2A 3MMPA 1G18A 4YXWA 1KO4A 4R7ZA 3WXMA 2QTFA 1X1SA 2REOA 2GZHA 3UMFA 2O8DB 4N0DA 1D2MA 1E9BA 1NN5A 3R7WB 1JR3D 3PV0A 3W3AA 1ZBDA 1TQ4A 4EAQA 5FI0B 3B9PA 5KUTA 1JEDA 3S1AA 3SJBA 2RGCA 2FFAA 3KQHA 3B7GA 4IXNA 5GJBA 1RYHA 1W0KD 2DFTA 4ILEA 2IYVA 5SZHB 3RANA 5IK2D 2G1KA 2WOOA 2OEPA 2O8EB 4D4LA 2X77A 2DY1A 1MABB 2Q0HA 1NP6A 4RZUA 4DC9A 4EKDA 2HXSA 3C5HA 2HXYA 1N6KA 2P6NA 2ZETA 1M34E 3RS0A 5KDLA 4NCKA 4YMUA 2BBSA 4B3GA 3SJZA 1K5DA 3QQ5A 1LY1A 3BC1A 4MYUA 2GEDA 3W5IA 2PZGA 5JS8A 4TLBA 4V0MA 1JPNA 1ZNYA 1GFIA 3FYHA 2GVZC 1NY6A 2RHDA 2HDNB 4D0GA 5C1BA 4PX9A 1CXZA 1R4AA 1MRNA 3U44B 1E32A 1JXMA 4M1MA 1W4CA 1HE8B 4UNRA 4F4JA 3CO5A 4LYFA 2IS6A 5JCPA 2OILA 2BEKA 1W5TA 2OCYC 3N2EA 4RZ3A 4Z8XA 3U3MA 3KKOA 1Z06A 1XTRA 3MWYW 3L0SA 4BECA 1BMFA 1ZIPA 3VR4A 3ZYCA 5AUQA 2B7CA 3F5FA 2G77B 2XSZD 2ZR0A 4FMCF 3WP0A 4JIMA 3LO5A 3P1JA 4QGGA 3X2SA 2ZREA 3K09C 3LX5A 4TSFD 1X1RA 4O0MA 2NGRA 4Q18A 2PBRA 1DG3A 2BKEA 3GEHA 1GL9B 4LV6A 1T3HA 5TB5A 1FNMA 1PLLA 1E2JA 1NBME 3I1FA 2CXXA 4A8JA 1E9FA 4PZZA 1W0JD 2XXAB 3OIWA 4G5SA 1G16A 1QVRA 2XZPA 1H65A 1IBRA 1VCMA 2C03A 3LV8A 3PEUA 4OJKA 3GFOA 1CJUC 4GSYA 4FXPA 5DHAA 2ZRFA 3IQWA 2ZU0C 1G5PA 2WOJA 1YVDA 1GKIA 3TR5A 4BWYA 1VIAA 2H57A 4RJLA 3SZRA 4M1SA 1DTSA 1E1QD 1E79A 4AWXA 8OHMA 3ZZUA 4DDWA 4KVGA 2NMVA 1J90A 1PLKA 2RH5A 2ZSBA 4HZIA 1KIMA 4OHZA 3B8HA 1T3LA 4HUTA 3CNOA 1AKEA 2QGZA 3Q8XB 4D4KA
chains in the Genus database with same CATH superfamily
5K3BA 3M83A 1ORDA 5SYMA 5H9VA 1ISGA 1AUPA 1RYEA 3FPLA 1XZ8A 2OHOA 5DX1A 4BCDA 5IWCA 4Q93A 4BFSA 5I9BA 5K7SA 2WTXA 5JDIC 1QANA 4QT4A 1Z12A 4IUDS 2PE5A 3NWOA 4UCWA 1CNMA 5ILQA 5DX0A 2FUKA 2XWBF 1R9JA 2CK3D 6REQB 3L1UA 1H6BA 1H8ED 4XDGA 1FLDA 5E3HA 4OMFG 4PNHA 2OC4A 2ORVA 2K2QB 1WPRA 4J1SA 4YO7A 2JGRA 5HW0A 2WFZA 2XJ4A 1TGVA 1W48A 2GNPA 4I50A 4TKUA 1FVOA 5I6DA 5IJ0B 4QNMA 1ZR4A 1E3SA 5D3ZA 5HOEA 1DWOA 1I4WA 1T1JA 2ZWAA 3ND6A 1N34B 1Y34E 2ANBA 2OXTA 3DP9A 4LN1A 2I3DA 1VG9B 1TJ3A 1YE5A 3USCS 7ADHA 2RD2A 1AURA 1E7MA 2HFKA 3NWPA 3FNHA 3IDQA 2AWOA 4KXUA 3S70A 2K2WA 5TS3A 2P77A 3U7QA 1QJCA 3FOZA 4RVSA 5LQUA 5LXTA 3PR1A 2BFEA 4BNLA 2ODWA 4KIUA 1CP2A 3ES9A 2ZBPA 2WT4A 3DLCA 1T6YA 2D54A 3HMKA 3BGDA 2DHRA 3L0ZA 3CB2A 3NDIA 4CQNA 3ITNA 4DA6A 4Q7JB 4EF6A 5AK5A 1YJCA 3BL8A 3WGKA 1LJLA 2GBFA 4TMWA 5EJ7A 1A7JA 3U09A 1S3FA 4PFQA 1IAQA 4XM0A 3SQMA 1OFVA 5FYDA 3E9DA 3VDQA 1YFLA 1IRXA 1A4IA 3H5VA 2BLLA 2IE8A 2OZLB 1G64A 3NNSA 4X54A 3SF8A 3V1MA 2ID8A 2CUZA 1YAHA 2WJ3A 1T5SA 2ZUSA 3FD8A 1LSOA 1YRQA 4ZAZA 3S68A 1TCUA 3AEXA 4G0PA 4A9AA 4EELA 5I8WA 4A27A 4L5IA 4CR7A 2C0PA 2IHKA 1NF8A 3UKJA 4IO0A 5BSGA 4FCVA 1WXDA 3PD0A 4A03A 3ZWKA 1FX0A 2XVMA 1NYLA 1E94E 2KBEA 1UJMA 2RHBA 1GQFA 2ERCA 5I3ZA 3TTYA 1E0AA 4OHBA 3RJTA 4D0LB 3B5EA 1EM8B 2YCLA 1P73A 5CG2A 1AGYA 1TKCA 3L7DA 3FPFA 4F7WA 2H2GA 3NHKA 5CDGA 4KQXA 2AVDA 4QFMA 5EIXA 3ZLBA 2Y77A 4QU0A 1VKNA 2G40A 4KB5A 4ALMA 2BGWA 2CFTA 1WKCA 2XCOA 5AIBA 5TJHA 3F7OA 1KYXA 3S2IA 4F9TA 4Y6RA 1ONSA 4PIPA 3TTWA 3TLMA 3WJ7A 3DAHA 4HNSA 4IMIB 1MCZA 1M67A 4I2NA 1F1BA 3CR3C 2CXHA 2VUHB 1QMGA 2FR1A 4FZ5A 3U9TA 1YBMA 3K9NA 2FUG6 1GXSA 2QN8A 1Y5IA 1BHO1 4IFEA 4M1EA 3VR5D 3DNFA 4D25A 3O7WA 4CM1A 3WWYA 3GLFB 4ZEWA 4OLBA 1PV4A 1M33A 1R9GA 5LQDA 1GM5A 3OM8A 1U7TA 2DCMA 4QBKA 5F77A 4MS1A 4CDMA 2OSVA 1G5QA 4CQMA 5KNCD 4XB2A 4FFPA 4MAFA 4OFWA 3UMJA 2EW8A 5DCWA 1HYEA 3L7KA 5T4HA 5DNCA 3NTXA 1YJQA 3ONVA 5JCOA 4FOOA 5KSPA 3W90A 5HMMA 2P9BA 1JILA 4ZA2A 3SG0A 3X2EA 2HFJA 2I1WA 2VHWA 3JSAA 3TD9A 4DL9A 4IG4A 2Y4NA 1R6BX 2AI2A 3QKSB 1FQKA 3O75A 1Y3DE 4J16A 4ZO8A 1J2RA 4HXGA 1J0CA 1Z0IA 2PFKA 2RHLA 1U0NA 5BN5B 4D8WA 1PO7A 3ORQA 4TQAA 1WKBA 4D02A 5JADA 3L4BC 4YJHB 5IJXA 2GUGA 1XTSA 3DEFA 4PAWA 3FZEA 3DE4X 4CIXA 1K6MA 4GRIA 1OX5A 1J39A 3R5FA 2V7GA 3A36A 3QWAA 1QZ3A 1H2RS 1H4TA 1WXHA 1YDEA 2GILA 4J0IA 3SOPA 5EIWA 5JAOA 1FMFA 1BYUA 1QIEA 3GEEA 5IVIA 1JTVA 3OUUA 2VZLA 3WBFA 4YQEA 5LUBA 4XKJA 2I76A 5L7TA 1N9GA 4DIEA 3T1TA 1EX9A 1FW8A 3WSWA 1AS2A 1BWQA 3DR3A 2PWBA 4OQZA 3BTVA 5LU9A 5CXSA 5I9TA 1V96A 3FHOA 1NSTA 2VHCA 2OWDA 3IAS6 3N05A 1TZKA 3A4IA 3V4FA 5LNK1 1WDTA 3ZDCA 2IPNA 3ZEAA 1JIKA 2FSUA 5AW8A 2JL1A 1PFWA 2GBLC 2ZSAA 1MJGA 2YFYA 3B53X 3IQDB 3J7TA 1G2IA 2P9TA 4AK9A 3DF7A 3VO9A 1RI1A 3EFBA 4WCFC 5EIBC 2ZWIA 3PF8A 5EJAA 5AJHA 3JYOA 3U1TA 1XTZA 1WBJB 1GQ2A 3A04A 1TEVA 1YS1X 2LKDA 2PKCA 2UZ1A 1K4MA 2CMKA 2WZCA 3KZCA 3VPDA 2IUEA 4B09A 4EHDA 3AKYA 3KQUA 2HO5A 1X1QA 3HFJA 1LI7A 5JH7A 3N2KA 1OXMA 2P3SA 3R4CA 3Q0TA 3VZPA 1S2MA 2P2DA 2AKEA 2I3BA 2YWHA 4I3HA 1HEYA 1NWCA 4LHZA 1QHFA 5BR1A 2O2SA 4TTJA 2C4KA 3TL2A 4OBWA 5EEGA 2WTBA 3K0BA 2ZBVA 5C7IO 5LJIA 3BIWA 2QRMA 4GT1A 1HZZA 3NIFB 3FDXA 4QEZA 2F3UA 2I71A 3L0CA 1JBKA 3W4KA 1G8HA 4QU8A 4YRQA 2V98A 3VOAA 5JFTA 3JATA 3EGWA 1J6UA 1ZWKA 1FXUA 2DUMA 4O4JB 1F2TA 1YZTA 3AJAA 4X5OA 1SPXA 3A4YA 2UYQA 3AIMA 3R0VA 4AIIA 1K0UA 3RT7A 2P5TB 3U61B 1OAOC 3B5JA 2VAVA 1U81A 2NQTA 1N2CA 1H93A 4JS0A 2ZBGA 4P86A 4S3MA 1ID8A 3R7LA 4BNKA 2JC3A 4PCLA 3TDNA 1X3LA 3INGA 2VNHA 3MJCA 2JGFA 4OQNA 1FDIA 5MN6A 3IKTA 3RE1A 2OV3A 1SG0A 2FVYA 2PKXA 1N9ZA 3GAFA 4QUIA 5C5IA 1NRWA 2X5KO 3JYLA 2J9YB 2P78A 4CR8A 4NX2A 3OF2A 2VHXA 1U5AA 3JY6A 2O48X 4JC4A 5T3YA 4X0EA 1TM5E 1PGJA 3DMGA 1R8QA 4L4UA 1YZUA 3LDUA 3PD7A 4Y9UA 4N6OA 3F47A 1SBCA 2YYZA 4HEHA 3GLGB 4J3FA 3R9KA 1V5EA 4K6GA 4J07A 3SMQA 3C3DA 3JQCA 3CW8X 421PA 5KQGA 4MOWA 4COKA 3MBOA 2RAFA 3PLRA 4O8ZA 5IYZA 3RNOA 4CMJA 2Z5VA 1MX3A 2DBRA 2GYUA 2Y1CA 3CXUA 4KU4A 4MRRA 1XQ9A 5IKXA 3TZCA 3TD6A 1WZIA 4J29A 4QNNA 1SRRA 3G9QA 4OKSA 1A8IA 1BHQ1 1EXNA 5ALTA 2HWKA 3KJFA 3SY8A 2H1OA 4MV4A 1GQOA 2R2GA 3FNIA 2OD9A 1ACMA 3Q3JB 3OCCA 4QQRA 4FHCA 3T9AA 1DKRA 1YJ5A 4IDBA 1C30B 3T3PB 2G8LA 2WLTA 5A5VA 1IZ8A 1UFQA 1JDTA 4C9BA 5HJ7A 2EKLA 2H2HA 2P68A 4UFNA 1JXOA 2X5JO 3E22A 5MDHA 1GZUA 3I64A 4EF4A 4M8IA 1SU8A 2C2YA 4YHBA 3G0HA 1Y81A 2O0MA 4UJ3A 1XZIA 3VBEA 3X1MA 5IANA 4P34A 4AG6A 1C1DA 3L0PA 1J2YA 2P75A 2WZBA 5DBEX 1W36D 1DWQA 1VYVA 4JI0B 2A9QA 3IUNA 4A2PA 2RH8A 3DKRA 1VJ0A 5JLAA 1KRWA 2X4GA 2BD0A 5EWJB 4J8PA 2D13A 4NPCA 5ESRA 1SNYA 4LCBA 4XJXA 3ZY6A 4DQXA 4TPKA 5FBQB 1D2AA 3FYDA 1P1JA 1W9MA 1W5BA 4PO8A 2PG3A 3GJ3A 5FFNA 5E9QA 2YHIA 1ISJA 3QFSA 2QPTA 1K3UB 1PDOA 2N47A 2RKBA 4MXDA 4B0PA 4YUWA 1NP3A 1ZKMA 1HE5A 2WAYA 3PUVA 4MWGA 4Q1DA 1TF2A 1O97D 1WUIS 2BKLA 4H0CA 1UAAA 3CEHA 4DJDC 1PL0A 2ZUCA 4HDKA 1D2NA 1KGDA 3GMTA 4KSYA 5FNVA 3IEVA 1MJNA 3A0UA 2CEAA 4YRTA 3RWBA 3RFVA 2IWHA 4C01A 1UANA 2IRWA 5JARA 4YIHA 3CONA 5HFJA 4ZVMA 3Q1KA 5F7JA 1Z07A 4MGIR 2PUGA 2Q9AA 4TL9A 2IYWA 1YQWA 1L8XA 1MDFA 5AK0A 2JLAA 1N5JA 3CLTC 2AFIB 4ND2A 3TRKA 3TKLA 4MSUA 3MRVA 1S1CA 4N3CA 4CTKA 5G1PA 1V3QE 3GHHA 5IBCA 4TQGA 1KEEB 4JKOA 4HH3C 4Q9JA 1RCTE 2OXRA 4XI9A 5F12A 4D56A 5GWXA 3U16A 1MZPA 5LOVB 3OZBA 1PR3A 1F8FA 1TYBE 3C98A 4BNDB 2O19A 2Q3DA 3WLNA 1JPUA 1QYXA 3HJTA 4AYXA 2AKYA 2ZDQA 3DL0A 3TCKA 4HQLA 4ZMSA 2TRSB 2QYOA 2G17A 2CC2A 2QE6A 4HAOA 3S2YA 4LNUA 1AZSC 2HCTA 3A28A 3HGTA 1DXHA 1EQ2A 4WERA 4QJBA 3G23A 5JXHA 4LWPA 2GBCA 3BD7A 3IKLA 3KLOA 1O77A 1RLJA 4F12A 1GUDA 4G1MB 3OFVA 1RHJA 5IUNC 1PVDA 2IUYA 1JHUA 4ZI7F 1R0SA 3VYWA 2ZM6B 2QVLA 4A2WA 1QF6A 2YWDA 3QLJA 4O5OA 4QX6A 3R5JA 3ZUGA 3MC1A 1G59A 3VNSA 5BYBA 1NLYA 4RK4A 1TUGA 4B83A 1XZJA 3K5WA 4OMCA 5FEUA 4S24A 4EHJA 4C20A 2P6OA 3W1VA 3AGPA 2M32A 1P9LA 3E9CA 1Q17A 1FNSA 1EEHA 1II0A 5CA1B 2VQFB 1ADGA 3CVVA 1WXQA 1Y8QA 2W6PA 4UHJA 4UU1A 3ABRB 3GFFA 1UK9A 4PE5B 5LDGA 2L0XA 4N41A 2GQ0A 5AIAA 3OESA 3THSA 3UMRA 4NFYA 2Z5FA 4D9IA 2O6LA 3N7AA 3EF3A 1TE2A 1EQUA 3EG9B 5G0SA 4BJ3A 1SUWA 5F3DA 1EJ6A 1GDTA 2ZU6A 4I2VA 1FJHA 4UKDA 3PEWA 3LC7O 3GAZA 4JYZA 2I6UA 3EIOA 2C3YA 2W2NA 2RBKA 3B12A 4RMHA 3QOWA 1M6HA 3NANA 2IBTA 2H4XA 1L4KA 3LLSA 4XX1A 3C5EA 1USKA 2VK2A 2QM3A 4MP6A 4D1YA 2CHGA 5FEMA 5F23A 5YASA 1P33A 2IKSA 1YK0A 2J5KA 2G9UA 3ID6C 1KDTA 1JHMA 3ZCRA 4B81A 1WV0A 2GJSA 3VU9B 1X15A 1ZWLA 2Q7XA 4KUHA 1DAEA 1GTZA 1JIXA 1I2MA 4GPBA 1GPUA 1O6GA 1UBRS 2DP4E 3ASZA 3HNRA 4US0R 1VSBA 5JVDF 3C3CA 3LPNA 3DEHA 3RV4A 4TTSA 5A2GA 1C3OB 1CCWA 4JP3A 4BVFA 3WAJA 1WM1A 3K9CA 1LQ2A 1HYGA 2Z58A 3IBCA 3LAWA 2P11A 3F5SA 4WK6A 3ZBTA 3NHLA 5CPFA 2Q1YA 3R7DA 2XHZA 1B6RA 2HEIA 1SHKA 3H1EA 2OAGA 2WSBA 3V8RA 1NN0A 1XMJA 3WLQA 4P3KA 4JP5A 3A31A 2NTVA 3T7RA 1U2RA 3CIFA 1RI4A 2MIIA 3EWNA 4UNPA 3FM9A 4PO3X 4ZXPA 5DRYA 821PA 4PLTA 4QUBA 4LGMA 5MGNA 1DKQA 2APJA 1MNAA 2YFKA 3EAQA 4P92A 4DM4A 5EJ6A 1J4AA 1RYMA 2F1KA 3UK1A 3X1DA 4QUEA 1D2HA 4BNVA 2BP7A 5F2KA 4EJ6A 1FMLA 4RPLA 3K70D 2TMGA 3ZWWA 1AKWA 4CG0A 1S3GA 1VMAA 5AJWA 4AFNA 1YR6A 4JNKA 1P7WA 3D0KA 2C1ZA 1MU0A 2FHSA 4BN4A 1MDBA 2VRCA 5EE3A 2Z9CA 5FQNA 4EGFA 1TTPB 3GHYA 4DIDA 3QWIA 1M1YE 4PC6A 4AZSA 4FDTA 4EQ6B 1R10A 4Q3CA 1NMZA 2I1LA 4UM5A 3VR6H 5B3KA 4DCSA 2WE8A 4YR9A 3AW9A 5IFKA 3JALB 2R8OA 1QYIA 3GJ0A 5KCMA 4W8OA 2O2HA 1W8DA 5DU2A 2IHTA 5FOVA 3HQ4O 4J3JA 5JSFA 2C97A 3P2YA 1X0XA 3S1AB 2G1UA 4LUCA 1BQEA 2V7UA 2W42A 1G98A 1PWHA 4WAUA 1UT6A 1XA0A 3I1YA 1GUAA 1CUIA 2PEZA 3LF1A 1IATA 4UTVA 3I6YA 3FZGA 3FNQA 1D0IA 2FPSA 1G8PA 2XWSA 4PLYA 5IZ4A 2FW8A 5AYVA 1RLMA 1SIUA 3IQZA 4HAZA 3GT3A 4EI9A 3SD7A 1T2EA 1T0HB 1KQOA 1TVKB 3A1CA 4RY9A 5DGHA 4F6LA 3ZV6A 2PX0A 3MUFA 1E4YA 3Q0IA 4FYHA 6ABPA 2GZ3A 4HN2A 1A3CA 3LL7A 1CZKA 3CZAA 3CZRA 4BFUA 5FB3A 1ST2A 2OXCA 3K09A 1M10A 2AZDA 2H1FA 1UM9B 3Q0EA 4TX1A 5BSTA 3AR8A 3CLSC 2C4TA 3F49S 2AN4A 4KPUA 1HFWA 4QD3A 3CS3A 1G1MA 5TF0A 1I2AA 2GEJA 2GFQA 2RE8A 3G0BA 5AKZA 2C2MA 4L9SA 1YL6A 1VJCA 1QQ5A 4KP7A 2AN3A 4Y67A 4PGAA 4CTNA 1V1RB 2DR0A 1C3LA 3A7EA 3GO4A 2F8MA 1R4NB 2FSIA 4YBZA 3U7IA 1M66A 5JCPA 4QASA 1T5DX 4KWIA 1K6JA 3JD2A 4I6JA 4KH0A 3VYTB 4LX0A 3C3PA 1JZQA 3GIWA 1H42A 2HEGA 2QWXA 1XYGA 4BNZA 1GN8A 3OM0A 5HXAA 1OLSB 2A1UB 2FKAA 3MWDB 3MYRA 3UWMA 3C3XA 3IX7A 3W8EA 1L5MA 4EY6A 5JANA 4L9AA 2JFUA 3BHNA 4MQEB 4Q1VA 3LY8A 1J7KA 4K8RB 1D07A 4KXNA 4N8EA 3QBEA 4TRJA 5CT5A 2WYUA 4LKOA 5E7JA 2HYDA 5TPWA 1RWMA 1COWD 2GETA 1XQVA 2I6QA 4IIVA 4W9NA 1PQPA 1VGRA 3N87A 2P69A 2R79A 3BA6A 1A76A 4YRSA 4F45A 3PJFA 4X62B 5BVHB 2Z56A 1JFSA 3ND9A 3VU8A 4XH9B 1GLGA 3T8YA 3PDHA 4PLVA 3H4VA 4B1FA 1RAFA 3BFPA 4KXLA 3RTGA 3QE0A 2BHSA 3PG5A 2QPLA 2FETA 3DLIA 3K0KA 3QF7A 5FL3A 1FP2A 4QWWA 3TIVA 1UPAA 4FCTA 1AMOA 3UMCA 1PZHA 1Y4UA 2CUKA 2YICA 2ZOSA 4X45A 3CRMA 4IRXA 2H1WA 4B33A 3LTNC 3E5MA 3GRKA 3J81k 1LBSA 1NN1A 2JJQA 1XRQA 1T36A 5EYPA 4AJLA 3HYTA 2JEOA 4J0CA 2ONJA 3M7IA 1SCBA 2PJUA 3GFPA 4IP0A 1N6NA 3URMA 1UJCA 3O03A 4L22A 4CR6A 3TMYA 4OJNA 1C0EA 1XRLA 4LYGA 3ACCA 1KFKB 4G37A 3P9IA 4GGOA 3WRXA 3CVOA 5ICEA 1N4DA 1KP3A 1UBFA 3WDMA 2ZBUA 2ICAA 3BN3A 4TUYF 1IIBA 2CNOA 1FYXA 1GRRA 4L51A 4BE9A 1QUEA 5DI3B 3HN6A 1IPEA 2IELA 5DK6A 5HFNA 3NYRA 2QRHA 2H3HA 3PNKA 4AJHA 4PSVA 3RSQA 3LZDA 3DUFB 4E5VA 1SHZA 3PZBA 2HRCA 5LKRA 2UVDA 2WF6A 3KALA 3OHPA 5DCYA 1JDJA 1PHPA 1BG6A 2YV3A 4OGGA 5KYUB 1ZHHA 4M1QA 4F1KA 1PS8A 4H6XA 3AEYA 4G0ZA 4Q1CA 2HSJA 3D81A 3TBKA 2JFGA 4AMGA 3LZ6A 1OFHA 2RK4A 3UC9A 1ZJWA 5MHTA 2CHQA 5HIIA 2FOIA 3RVMA 4B3HA 1AZLA 3GFTA 3QBTA 1X1BA 2PX4A 1IQRA 1J70A 5MGBA 1GDDA 2GPYA 4EVSA 5FFMA 5JRZA 2JCBA 3VXKA 1CR4A 3PHIA 4MS4B 1VKRA 4AJJA 2PKWA 4BNTA 4A15A 2UYCA 4BO2A 3SC3A 1GFZA 2E1RA 1WCV1 4Z3KA 4PYNA 4X8MA 4PQRA 1I01A 3FGZA 4W7IA 4ESVA 4ZJYA 3ONFA 1B0UA 1RIFA 3O90A 1T9CA 1Z5NA 1BXRB 3VZCA 5IVDA 1NR5A 4EO4A 3M3DA 1ZUNB 3LC0A 3VNAA 3DOEA 3K2IA 4EY4A 3G5MA 2Z3ZA 3GRCA 2DF8A 3PFWO 2W2KB 3RFCA 1G7TA 1FYVA 3ZZMA 3PFGA 2P8SA 1XZLA 1DV1A 3K9QO 1VXOA 1M7HA 4PG6A 4KE9A 3RVOA 1QF7A 1PQYA 2PMCA 4P22A 4QGAA 1TT5B 4KAJA 1KS2A 1GPNA 4HLNA 4RMGA 2P4UA 3IE2A 1BU5A 2IL1A 1BCRB 3LSTA 4S1PA 5JSYA 3TGLA 1YI1A 2I1VB 3IODA 1Q0LA 1ZQ9A 1ZNWA 3RK0A 1HT2E 1EPUA 2PJZA 2FFHA 1YBVA 1F4PA 3JQBC 3GD7A 2ENWA 4CKBB 3VSAA 4DDKA 3KUUA 2B8WA 3W2HA 4ARSA 2P4QA 1BOOA 4PGHA 3UKOA 4BE4A 3COJA 4LF8B 2FDXA 4PRZA 3CX7A 3CX4A 4MW2A 5KOHB 1GA6A 3I2IA 2YDYA 1OREA 1DE0A 1SIWA 1KK1A 5HE8A 5HQJA 4BRWA 4G1VA 4CLOA 4LDAA 4L85A 4BO5A 1J2TA 3ZY4A 2BTQA 3EVEA 4I6GA 2AGVA 4D9MA 3GDHA 4YRFA 3TTXA 4P3NA 3H9EO 4M1ZA 1RAGA 2HJGA 4KVZA 5EC8A 2K6GA 2QP9X 3TZHA 5BW5A 4GMGA 2TECE 1N4AA 3AERB 5F7ZA 2I6TA 4IS2A 2K5UA 2JLXA 2QN7A 2O8NA 4XUDA 5FPQA 2J8ZA 1M5TA 2E7ZA 5KDDA 1D5WA 2IYYA 1U6JA 3FZQA 4H27A 2BEJA 3CUSA 2UV8A 3T12A 1JTEA 1V4BA 2BJWA 1FDWA 1VM6A 1W96A 4NBLA 4D74A 3IV6A 2PZAA 1R0WA 2GD2A 3R6GA 1B2LA 4NP6A 4I81A 1FU4A 1Y5RA 2AOUA 3AYZB 1CDEA 3H18A 4TN5A 4WY5A 1KARA 3E9NA 5CJ2A 5L3QB 4D9BA 1NX6A 4IF4A 5DM2A 2QK4A 3OLWA 4E2XA 1MENA 2GZMA 3WRVA 3THWA 3EF0A 3DZDA 3TUZC 3ZC3A 3SYMA 3G89A 4KOAA 1JEYA 3A1VA 4IXTA 1R5BA 3RGGA 3MJTA 1RXYA 5UKDA 2H9YA 1L4UA 3AF3A 1IU9A 1VKHA 1Y1SA 1YS7A 2MSKA 3ETHA 4O29A 4GDMA 5G53C 3RT9A 3WIEA 5FTMA 2ZI4A 1PZGA 3HY3A 3ICEA 4F60A 2VZ9A 2WM8A 3CLUD 4GXQA 1NUQA 2IOQA 3CB4A 3LY9A 1NJ1A 1JR6A 1VI6A 1XYYA 4K2HA 1TCCA 1U90A 2Y4OA 2YZ2A 5DHUA 3NT4A 3ZW9A 2Q5OA 4DRXA 3CLVA 3OTHA 4I5EA 3TQFA 1TZBA 1IHDA 1QBGA 2HDOA 2P4HX 4LFCB 5FWYA 4CEIB 4PF1A 4N5HX 4FUTA 2I2XB 4G97A 3AJEA 4TZKA 4F1JA 5AVUA 1JIVA 1QHIA 1E5DA 1XL1A 3NR2A 4OYHA 4RLQA 3N6XA 2BFWA 2AZXA 1JIUA 4D43A 1II8A 1RTKA 3GCDA 1NVMB 1F4VA 4Q7MB 2J85A 5TQ0A 3RG8A 4P4TA 4EJSA 3RYIB 4F4DA 4XIYA 3QEJA 1M54A 5JD4A 2F8LA 1F9EA 3K1JA 2FK7A 2OBMA 3VU0A 4I36A 2C8KA 1E2BA 3OKPA 3ZU2A 5J1SB 3DFZA 3OEED 1QU2A 3UHFA 1QBKC 4W5JA 1V1MA 3COWA 3SKVA 3FMGA 4GOKA 3AF2A 4AKHA 3EBOA 1ZC3A 1P7CA 4L9WA 1P2SA 5LLDA 4GO1A 2RDMA 2ZAIA 1CU1A 3IA7A 2HQBA 3ER8A 4C3UA 2JIOA 3DMRA 1E3JA 1QVZA 1VMDA 4E31A 1LX6A 2N42A 1ZXBA 4NONA 3X44A 3AF6A 5CW2A 3WK6A 3B3QA 1UP7A 4MDFA 1P60A 3BWMA 2H4WA 3KX2A 4G4JA 4O2BB 2PQMA 4R6XA 2WRZA 2XUIA 2COEA 3UC5A 3JWJA 4JLAA 3UAZA 3IESA 3T5TA 5EIEA 2B0JA 4HF7A 4IJVA 1DIRA 2ZBEA 3D8TA 2RGEA 2Q5EA 3VOSA 1LV8A 2W83A 2IITA 4GMHA 4NR0A 2VF5X 5C34B 4ZYWA 3DOFA 5U4XA 1EM8A 2ZYDA 4ZVUA 2B36A 2VXCA 1NAHA 4REQA 3H19A 4QJ4A 4EKIA 2OD2A 3UAVA 1ZZGA 2QTGA 3TK1A 4BHTA 5AI0A 5AM1A 4O63O 3AY0A 1Z7BA 2O0JA 4XB6B 4GLLA 4HZUA 4PLWA 3ELUA 1C2TA 1VCIA 1WF3A 4GWKA 1GKYA 2VCEA 2VJMB 4GQAA 4KFUA 2WE7A 3IBFA 1RYZA 3HKDA 3SZUA 4LDZA 3JU3A 2EQ5A 5CLLA 2PYIA 4HDMA 3O8OA 5DE3A 1LB1B 3FVWA 4OHUA 3WR5A 3WWOA 5FKJA 1W1UA 3ML1A 3ZCXA 3EPHA 1W75A 3MJVA 1E6LA 2ZI3A 4LDJA 5HRCA 4NZPA 5DPMA 5EKSA 2E85A 1EB8A 3AUSA 3ESAA 4Q16A 1HURA 5CR9A 1LDEA 1P77A 3T3NA 1U8AA 3FY4A 2BR3A 3IALA 3P9XA 1H8HA 2Q3FA 4JUIA 4PQEA 1OW3B 1EHYA 1OT3A 5FXMA 3K1AA 3OZSA 3HCFA 2OHJA 4TZ6A 4P81A 1SXPA 1O96A 2IXGA 4GR4A 3FMVA 3G7UA 2WWFA 1WO8A 4Q7KA 3FMIA 5FTNA 1MA0A 5TMPA 4DNQA 1MP0A 1X14A 2ZJ0A 3HBAA 1RCFA 1KJNA 4AC9A 4IG9A 4FMCB 1I4OA 1SCUA 2G8NA 5IN5A 1ZLYA 2YFQA 2HJVA 5E3JA 3U7GA 2NP7A 5K6RA 4UM9B 2R11A 1SM4A 2EZUA 2AN9A 2VBGA 1A2OA 4J94A 1Z74A 3CZ4A 2XGGA 3GNLA 4K88A 4JQOA 2Y05A 4OTZA 3ASVA 1PZMA 4QPJC 1HY3A 3N3BC 3UJNA 1T4GA 2FN4A 3NEYA 1O0SA 4GQIA 1SKMA 3BWBA 4Q3AA 1CY7A 1EK2A 3L6CA 3IAEA 5EIOA 2Z2ZA 3C6MA 1ZNZA 2Y67A 5A0VA 2R6GA 4IIUA 4MP8A 2XUOA 3H0CA 3KHSA 1KYVA 1E9EA 2OQIA 3BIOA 4GLFA 1M1YA 4ZU1X 4RKQA 1P2FA 4E6EA 2VDLB 2WP8J 3EVGA 4EUFA 5BSHA 3R4VA 2PMDA 1DJLA 2OBYA 2FWBA 4N12A 2J31A 5HBRA 3FB4A 5EVJA 5H1YA 4XR4A 2DSTA 3IPYA 3OTQA 1XAJA 2X13A 3TXYA 3ZDXB 1D3AA 3QXHA 1TVEA 2B4KA 2VZ0A 3OX4A 1DBWA 1HDZA 2WUEA 3IUBA 2ECFA 4J0FA 4KLZA 3V4PB 5FTLA 1IYZA 4RC9A 1WBBA 3ROEA 2Y1XA 2HTFA 3ANSA 1KI6B 2GCPA 3I2HA 3N76A 4MI9A 5HF6A 3T7KA 1Y7HA 1WCIA 3EXFB 1KJZA 1G0OA 3MCVA 1G55A 3NS7A 4RD6A 1ULUA 3WXBA 3IL2A 1ZESA 1LRKA 3IQFA 2QEQA 2I65A 2DX7A 1PEKE 1RDFA 2CJWA 3V1UA 5A0FA 3A9WA 4DSTA 4UQLA 2HV9A 2SNIE 3DGFC 4LNHA 3D6TB 4C0BA 1WMAA 2BZ1A 2DHEA 2RBGA 1YI0A 3PF9A 1OIVA 4DJFC 1O6FA 4AROA 4K9MA 3I72A 2KSQA 1N1GA 3CY6A 3VSBA 4ZAGA 2GN2A 1P75A 2PNJA 2RIRA 4MNTA 4O08A 1S9DA 3V2GA 4BFLA 4DLXA 5BR8B 5CX1B 1XVUA 1PJQA 1G7SA 1EVEA 4IS3A 1M0SA 5AVWA 4YJ3F 3C3MA 3NOQA 5EIAA 5BRNA 2QVYX 4C4AA 2CFSA 2IUFA 4ESEA 2JFBA 3MF4A 5JROA 1VYTA 2C4MA 3NO4A 1EH5A 4PINA 5DLPA 2BRUA 3ZCVA 4J9UE 4BNHA 3ADPA 4GGMX 4D9EA 5AVZA 1WDLA 3IURA 4MMXB 3D8SA 4AKIA 4AMUA 3TVYA 1ZD1A 5C4IA 2R47A 4Q1AA 1DFHA 3ZGYA 4IFBA 5TGTA 1JVNA 2B7LA 2UYHA 3D6MA 2C31A 1UFKA 5HF9A 1OH6A 1RIIA 5HKAA 4GL2A 3WYNA 1BOFA 5BYJA 1R3DA 4FDLA 3L7NA 3SE0A 3QBJA 3IEUA 1Z0SA 3MMZA 2FZKA 2I29A 3LQYA 3NTQA 5BNZA 5JUWA 1E9VA 4W5NA 4RORA 2WHRA 3I5AA 4AMZA 1KFBB 2ZYTX 1UDCA 3ONDA 3RSCA 3UOAB 4QJ5A 1Y7PA 2JLYA 3I42A 4GZ5A 3CG0A 4ZO4A 2JH3A 3M4JA 4R2WA 1X8XA 1IVYA 4IFIA 1ZRHA 2AMJA 2QLLA 1CJTC 1SHTX 1FUUA 4HEA6 5BMVF 1AK2A 4CIYA 1NQVA 4BRSA 3TSYA 4ARZA 1E3QA 4ZMRA 2WMNB 1NGSA 4NOLA 3DBIA 4YMWA 3VSDA 3ZY3A 1G60A 4B47A 2CMFA 4L9RA 4L08A 3AP2A 3JZAA 4WINA 3PIRA 1ABFA 5LJLA 3A9UA 1QQ6A 2IUTA 3BMOA 3VVBA 3H75A 3HP1A 2JFZA 4NJMB 5C7LO 1S4MA 2AJCA 1A7KA 3UT6A 5DNUA 1Q77A 1YHZA 4PONA 1U4OA 1V37A 4KQEA 3AIKA 3PHHA 4X71A 5B36A 1XC7A 4YROA 1NY5A 4EJFA 3M49A 1KY4A 1HEIA 2IYNA 2QG6A 2DPLA 3DO8A 3QW4B 4WKBA 1N5KA 4BAUA 5IJZA 1ZA2A 3KPJA 1RVDA 2FN3A 2V7TA 5B1SA 3WS7A 1UP4A 2VDUE 4O4HA 3DDHA 2C42A 3Q2IA 4AS1A 4JCCA 3EQ7A 4IXMA 4D3YA 2Q9CA 2W58A 3BGOS 2OO3A 3MCTA 2N3ZA 4B17A 3R20A 2JCXA 2BT4A 1DMRA 4CIAA 4MA0A 2D0OB 5KTMA 2L82A 1JB1A 4KAXA 1WMBA 2F43B 3FCCA 2P7IA 4F21A 1WP4A 2QRZA 2HJWA 4TN1A 4RH3A 2GK4A 2VTBA 3MLBA 1MH1A 1XDWA 1DRKA 4IDEA 4RANA 4C7JA 3FFAA 1UQTA 3B6KA 4KVAA 3QXCA 4R83A 3NFYA 4B4UA 4BFVA 5FUVA 5BORA 3FUUA 4KN5A 4WZ6A 3GRVA 4FT2A 3JASB 4XWAA 1G38A 4HQKA 5ALUA 2V4ZA 5FI1B 4RTNA 2Q2WA 3PGJA 1FLAA 4BO9A 4M21A 5K0TA 1FJXA 1BMDA 1TYZA 3WBJA 3PGVA 4GXRA 2OHHA 1BW9B 2QD1A 4ND8B 3ORRA 2CXPA 2PWZA 4OPMA 4N9QA 5AXAA 2GZDA 5GY7A 2DQKA 5IAKA 1T8RA 3K8OE 1UFVA 4OSEA 3ZV7A 2VP0A 4I99A 4MLCA 5LU8A 4OI4A 1DX9A 3DHYA 3IMGA 4HX2A 1TAUA 2VQDA 4KIWA 1CJBA 4PFJA 3RKSA 4Z3OA 4D82A 2Z95A 3GUVA 3QH4A 3D5TA 1N5OX 1ZXLA 2BJHA 1OROA 3UHJA 1OZGA 1XEWX 2GKOA 1JI3A 3LQ4A 1VPWA 5MN5A 2XODA 4UU7A 1KNXA 4BZXA 2BEUA 2WYOA 3CVUA 3A1EA 3PGA1 4GC5A 2Z2JA 1RXIA 4QOIA 3PGLA 4AY4A 3ZLVA 1FY2A 3PDCA 2BM0A 4UBJA 1P72A 4X8HA 1UKYA 1ZN9A 4IQ0A 3WMRA 1BEZA 4PYKA 3NIWA 4IH4A 3TJRA 1SXJE 1E4VA 3TCXB 2IH5A 1JKXA 1Z8NA 4HXFB 4HRYA 2C2KA 3EJWA 1AGRA 2ZRJA 3IKJA 3G0OA 1K63A 1GNPA 2C5FA 1A7AA 3JARB 4AZ0B 3AM4A 4LRSB 5M2QA 3RVBA 3HJFA 4LWOA 3CO0S 1KDZA 4WLOA 1IB0A 2WG0A 4R69A 1EESA 1LX7A 1IN1A 1XZEA 3ISTA 1Z63A 4Q9LA 5IK2A 4HYTA 3PC3A 1H3NA 2VUTA 4JMPA 4Q19A 4Y2VA 5FBZA 4S05A 4C2UA 1S2DA 4FONA 3VNRA 1XZCA 3ZNPA 2VPTA 3Q9SA 2EKPA 1JQ5A 3SHOA 4PTZA 2WFMA 1FBNA 1XMPA 3Q41A 2ZJFA 4K86A 3LNTA 4RE6A 5LD2C 1DWUA 3MT0A 1E9CA 3V2UA 3KVRA 1TC2A 1GGJA 3IB3A 4JN6B 4NQZA 3PEVA 1YIDA 4MGZR 1UBUS 4RSMA 4OHPA 3PA8A 1Z5VA 1NA5A 3KEOA 2B2NA 4A8PA 4DQVA 1U11A 2GJKA 1FFHA 1YZKA 4I1YA 4LVUA 5K4AA 1W4RA 2OB2A 4P80A 1FU8A 1T9ZA 1RQGA 5G3YA 5CNJA 1DO0A 3L06A 1KYTA 4URFA 4XX0A 1O8CA 5HSGA 1HEUA 2A67A 1NAIA 1Q2UA 1G21E 1TFRA 4GYYA 3C5CA 5BVGB 2OHIA 3AVYA 3BAZA 4N65A 3R0ZA 3UPTA 3WFJA 4KNVA 4X00A 1YIOA 5J40A 1KZYC 1BDIA 3W4JA 4YASA 2X9QA 2Y1DA 4RTLA 3EY4A 2XSZA 2QM7A 2IY7A 4HUQB 2A8YA 4UHEA 2QN3A 1TZCA 4ED9A 2WW8A 3LY5A 2BKVA 1J09A 1KNQA 1N6IA 2FW9A 2XUHA 3NJRA 4UDYX 4X85A 5ERGB 5KHOC 5AVQA 4AWBA 3VU9A 2PH1A 2ZJ2A 3PJDA 5HTOA 1FSSA 3E58A 4YAKA 3LHKA 2PNFA 4RVFA 3FMPB 2VNSA 2VNIA 3FZYA 3R0XA 3ZBUA 4ZHQF 1PAUA 2ZXFA 3PC2A 4OB7A 5KNDD 2ZUFA 2WJGA 3IP8A 1US8A 1TOAA 1F3OA 4D8YA 1L2TA 3DVAB 3GMDA 3AMVA 4J2OA 4JJ6A 4AX8A 1ZH4A 3NMUF 3IQGX 1ETHA 3O1HB 4PN7A 1QTQA 2YQ5A 1ZJ4A 3EWSA 3N2GB 4PS1A 4YEDA 5KKNB 3OHSX 4DLNA 1UM8A 1CT9A 2FN9A 4EX7A 4J6FA 4JI2B 3RU7A 3ZE9A 1IUNA 4HGQA 2J3DA 4LYJA 1DTWA 2O0HA 5G3ZA 4H4EA 2H4ZA 2A5Y