3TGXA

Il-21:il21r complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVQITDQSGQYSQECGSFLLAESIKPAPPFDVTVTFSGQYQISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-21 receptor
publication title The crystal structure of the interleukin 21 receptor bound to interleukin 21 reveals that a sugar chain interacting with the WSXWS motif is an integral part of the interleukin 21 receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 35
structure length 208
sequence length 208
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tgxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tgxA01
3DV4A 5JOFA 2XI9A 5ID0A 1MHCA 5M94B 3F62A 5I75B 3UO1L 1K85A 3T2QA 2D0GA 2QL1A 4KXZH 4ELKB 4M5ZL 3ZSTA 4HV8B 4JR9H 4ONFL 4Y4FC 4IMKC 4NO2B 2I07B 1BOGA 1FC1A 5HYJB 4M4RA 3I84A 3MRKA 1FGVH 4O2CB 3NCYP 4E0RB 4P4KB 3VFMB 4EUPB 2VZ1A 4PG2A 4Q9RL 1FVEB 1EXUA 3QHFH 1X4YA 2VXQH 5DVOA 4RGNB 2GAZB 4U1LA 5DMIH 5E2UH 1YY8B 2YXMA 3HMXA 5J9PA 1AXTH 3CZJA 5EZJA 4QY8A 1JI1A 4GRWB 4HWEL 4H1LB 1MFDL 3QRFM 3WNNA 2HJLB 5ESAB 2G75B 1A21A 4K8RL 1AD9A 1ZLWK 1IAIM 4BZ1H 4Y4HD 3UTTD 3ULVL 4JFPB 4PV9A 1AXIB 4OM0L 5C0CD 2GIYA 1IARB 3ARGD 5C0NC 3FO2B 3MV9E 1CGXA 5D7IF 4N1CA 5BOZG 3NAAH 4WHCA 3N06B 2I5YL 4R4NC 2ZOKA 4S1SH 4YDJB 5DJZB 5HPOA 3DVGA 1TITA 1OP3K 3QSKB 2EDYA 3QB7C 4U3CA 2OJEB 3B9KC 2VDKL 1CK0H 4ZFGL 5FM4A 4KDTA 4XXDB 4P2OD 3LKNB 3HAEH 1JYVA 3QCTH 3UP1A 4Y5XA 1FDLL 3BT2H 3QO0B 4YHNA 5E9DA 3ULSA 1JPSL 4PJEE 5I1DA 3AB0B 1OTUD 1XAUA 3C87A 3C2AL 4NKOB 3V9FA 1P4BH 5MHSE 1PX4A 3MFGB 1N2RB 1CICB 2VDPL 2VDQL 5I66A 4F7EB 1ZT1B 4HKBA 4I9WD 1AGCA 3LKRB 3BZEA 2ADGB 2QQNH 4O5LH 4Y7MA 5BW7A 1DQQB 5D2NB 2P45B 4X9HA 1S5IH 2J12B 5EBMA 4HJGB 4KMTH 4EI5D 3VXSB 2R56H 1T04B 1HH9B 1MPAH 4LSPL 1MLCB 3MV9A 4HDIB 4XWOC 3U48A 3IDGB 2FYYB 5E70A 3S7GA 4KKAD 2A73B 1N6QL 4KZDL 4NN7C 1HXYB 4NSKB 1MFEL 1JPTL 3QUXB 4N8VB 3TZVA 2B1HH 2VKWA 1YECL 2R39A 2YUVA 2DKUA 3VFOB 3VMNA 2DBLH 4PJGB 5F7DB 3UJTL 3W9EA 3OR7A 2X7LA 5D7JC 3MMEB 4Y19E 4OGXH 5I1HH 35C8H 4P3WA 1A9BA 1CG9B 3Q6GH 4P48A 1IGYA 3EOTH 1P7QA 4GXUM 1NGPL 3FB8A 3HE7B 4PJEA 4KK8D 1DEEA 2DM4A 3KYKL 5GRVL 5C0JB 4PJHB 4LOUD 1KGCE 4TVSa 1KOAA 3B3IB 1KJ3L 2YA0A 2COQA 4I0KA 3F8UB 3TF7C 1MREL 1BZ9A 4Y4KB 3QFJD 4ZYKB 4HBCH 4P4RA 4G8GD 5C0AE 1FZJB 1EVUA 3DRTA 3MRLB 3D39E 4I5BA 3V52H 2Y7QA 3PV7A 3AM8A 3RDTC 3PL6C 4FG6C 1MCSA 1MAJA 4NUJB 3S96B 6FABH 2EYSA 2ADFL 4JN1L 1KPVB 1Z2KA 4UOJA 4WV1B 1RI8A 3SDAC 5C0GA 4NUGL 1HKFA 5DC9B 4D3CH 2XA8L 2H2PD 5JPNB 1WIOA 2AJSL 3GI9H 1NSNL 3MRBB 4PJCB 1Y0LA 1IM3B 5CJBA 4UV7L 5C6TH 3SJVD 4LEXL 5A3ID 5JDSB 2W9EL 3FHQA 2FO4B 5FUZH 1MWAH 4IOSD 4N9OB 4AEIH 4N0RA 2YSSA 2GYSA 2FATL 3MTRA 5TE4H 4Y19A 3D2UB 1RUML 5CINH 2OS7A 4N90D 4JRXB 5EOCL 3V4PH 1FV1B 1AIFB 2CUHA 2GCYB 4KPHH 4K9EH 2PXYB 2ZUSA 3QPXL 3PHOA 3VXUD 3DI3B 4K7FB 4Y4FB 1CL7L 4MCYB 3RAJH 4Y5VA 5FO7B 3BRDA 4D8PA 1X5GA 1KIUA 4OZ4B 2BXZA 5C0AA 4NNPH 4WO4C 1C1EL 1TZIB 3MRIB 3D39A 4JPKL 5D5MB 3WIFA 4P5MB 3TJEL 1BIHA 3WEXB 4MNQD 1NC4D 4X7DC 5CIPB 1CFBA 2P7TB 3SGEI 3MO1B 4MD4B 5C2BL 5E8OA 4CADA 2YD3A 4G7VH 1QSZA 3MLWL 3H9SE 1UWXK 4GUPB 1JIBA 4YHMH 3FO0H 3GM8A 1OPGL 3VMOA 3MRPA 1BVKB 3EYVA 3KNBA 4UB0H 5D1XD 1UEMA 5GGRA 1CFVH 3WSQH 2W9DL 3CFEB 1QZ1A 1CU4L 2A9ML 1QKZL 1XGPA 2B0SH 5IMKB 5CEZD 3VFUA 4GBXA 1N59B 4JQVA 3UTQB 4M48H 5AUMB 3P77B 5I2IB 1BFVL 5H2BA 1RJZA 5GS0C 3CNKA 1MIML 3K2MC 3VRLE 4IIQA 4KVCH 3T4YB 4K94L 3IJHB 5D93C 4QHMA 1AQKL 4ORGA 5GGQH 2HTLC 4IM8A 3HRPA 4LHUB 4EVNB 3QQ9C 1RJYB 4PRBB 4N5EC 2WLZA 1OAZL 5IIEA 5EBWA 2NW2B 1VHPA 1KN4H 2N7AA 4CNIA 2XTJB 1J1XH 4OIAA 1RVFL 2HRPH 1I8MA 2UWEB 3WO3B 3GSUA 3BAEL 3PP4H 1I9IL 2BSTA 2AK1L 5CGYD 2QHRH 2JIXB 4CVZB 2NY5C 3E2HB 4NO0D 2BRQA 2IMNA 3H9SA 5DRZB 2AEWA 2FZ3B 4KHXL 1C12B 4ZFZA 4I18B 1O0VA 1C5DA 3FRPG 4M6MH 5F6HJ 2R4RH 5B38A 2DQGL 5F3BA 5KS9F 1WBXB 4X98B 5J06A 3DXAB 2C7UA 1GAFH 3U4EA 3LHPL 4BUGA 4M6NL 2GY5A 3FFCD 2V9RA 3MRGA 1SEQL 1H3VA 1NH6A 2E7HA 4V1DD 4M61B 4G3YL 2AXGA 3K3QA 4L8DB 4AYFA 1K3IA 1ZVYA 1F2QA 3T0ED 3FT3A 4HK3J 3GSNA 3JUYA 3FQRA 5AAWA 1C5BH 1NCAH 1Z0MA 4HJJL 5F9WB 5AZ2L 5EC2B 3G6DH 4WGWB 3T2NH 2JK5B 4MQXC 4OLYH 4BQCA 4P2CG 5ALBL 3PJSB 2X1OA 5CILH 5EUKB 1Z5LA 4XP1L 5GGSA 2KDGA 4OT1H 3I9GL 3QJHA 3UTSB 3ALWA 5SWSE 3RGVA 2PYEB 2AGJH 3MA9L 4HCRH 1S78D 3C60C 2F53D 2NXYC 4JN2A 2HT3C 3GJFH 2AXJA 3RDTB 2W38A 4J23A 4RFOH 1RZ7L 1OARH 1G9ML 5E95B 3GMMA 3ALXA 3TVMC 4QRRE 4JM2C 2IADA 3EYUL 1ZLSL 1GHFL 3S97C 1OAYH 3GFUA 1MI5E 4XCFH 1N7ML 3SPVA 5I1AB 2X4RB 4PJ9A 1YNKL 1KACB 3QQ3B 4AH2B 2Y4SA 1UM5L 2WIMA 4AMKH 1BX2A 3PQYA 1PX3A 1DN0B 3VXOB 3MRRB 4PGCB 1D6EB 2X89A 3A6CL 5F44A 5JXAL 4JZOB 1FNSL 2R1YB 1SYSA 4MA1C 4M93C 4MVBC 2VLKA 5INDA 5DA0B 5DI8B 4ZSOB 1MVUA 4XMKL 4YGVB 1VSCA 5EDXA 5T1KD 3BPLB 4JPVL 4G8IA 1OSZA 5IFHH 2WWMC 5D2LE 3QISA 1XZ0B 3X3FL 1I8IB 2WBJA 4P0DA 1LO3L 4ZODA 1VACA 4XMLL 2XG4A 2CJUH 2MWCA 2OR9H 4OKVA 5H37H 4G8FA 4K7PL 2IPTL 1I7ZB 1F90L 5DEFA 5FM5M 3GMNA 3MYJB 4MAUL 3TO4C 1K4DB 2JJTC 1MHHB 1EHXA 4MWFB 4WENB 3OHXB 3OKEB 4P23A 1ETZB 3RX8A 1W0VB 4XNMA 4NRXB 2BNUA 2XKSA 3INUH 1N64L 3WNLA 4HUXA 1UH4A 1S5HA 1N5AB 2JB6B 3LS4H 2HJFB 5L0QB 1REIA 1FYTD 2VLRB 4G6ML 4FP8H 3KLAB 1QHOA 2UUDH 3WJJC 4IRJA 3L3GB 4PP2A 3EYFA 5HPMB 5D6DA 3EDFA 3FONA 1LDSA 3WS6A 5ID1A 1KIPA 1V7ML 4U1KB 3I6LD 4IDJH 5ITFA 5JR1L 3RZCB 4J2XA 5J1SC 2LE9A 3FN3A 3MLUH 4UMGA 1J5OH 3SGJA 3CU7A 3CDYA 2Z35B 1LNUB 3GJEA 3L9RA 3Q2CA 4P5TA 5D2LA 3IFPA 4EOWL 2BOBA 5TGBA 1AGBB 5DD1L 2VZOA 1T6WA 5HD8C 3QJFB 1FO0A 1KTDB 7FABH 5C0IB 5DUBA 5FB8B 3WFHB 4DTGL 4YLQT 5C0BE 1P69B 1IGIH 2ZUVA 3PWPA 5EBLB 1LP9B 3CXDH 4YPGB 1Q9LA 1AP2A 5ETUA 3WJLA 4KI5F 4UIKL 5C09E 4HH9B 5K9OA 1FL5B 1WFTA 1YPZB 3O41B 1S9YB 4QF1B 3T2PA 4OLUH 4I3RH 1J8HE 2HJKA 5GRJH 4FFWD 5E94B 1G7MB 2Q20A 2IQ9H 3F7PC 3DETC 4QNPE 4TNVF 2CKBH 3GO1H 4ONHB 4HS6B 3BH8B 3V5HA 5IB5A 5F6IB 5CWSA 4X9GA 4ONGH 1A14H 2IANE 3MR9A 4NHUB 1T21B 4O58L 3U0WL 1A1NA 4CN1A 2VLJD 3SGDH 4LF3B 3CMOH 3C8HA 3BKJL 4UT6H 1LO5A 1PEZA 3BQUC 4XCEB 5DHYA 1BQUA 4MA8H 1YY9C 4XCYA 2VDML 3VXME 4EXKA 5KSAA 1BOYA 3QDMB 4UTAH 3TBWB 1X7QB 2YUWA 3GSVA 1VFAA 1EJOH 1CDGA 5FGBA 1BPVA 2BY3A 2J4WL 5C0BA 3NCMA 5GISL 3SCMD 1J9CT 3GB7B 4X80L 3C60B 1I7TB 4I8DA 3NCFB 4LBEB 1IKNC 1SM3H 3O4LA 5ESVB 5C07A 4IRSD 3VFSA 2FIKA 1J8HA 4KUZL 1K9TA 4LSRL 3BWUC 2CO7B 1P4LA 4HS3B 4LFHD 3UPRA 2QSCL 1VDGA 5EOQL 1DBAH 4K71B 4XZUB 3R06B 3E6FA 4HAGA 4LRNH 1AKJB 5BS0B 2OTPA 4NM8H 1FORH 3X3GH 3KJ4B 4UT7H 4JY6B 4UBDD 3SKJL 3L7FA 4X8JA 5MEQA 3F7YB 3MGTA 4M93B 1IAIH 2C9AA 1GL4B 5IT2L 2BVPB 1PY4A 4XP9L 4ODTL 4RGNE 5DWUL 4PJFA 3KWWB 1E28B 1GOFA 2CH8A 3RWJA 2CIIA 4FTVD 3CGTA 4NN6B 4U1HA 3HPLA 5DR5H 2FJGA 2J6EL 2VE6B 3QEQB 1VFOA 4LFHG 1OL0A 3PWVB 4O51B 4JY4B 3HG1B 3MODH 5CBEB 2EICA 5CHNB 1EA9C 4ZFOL 1D7FA 4OF5A 4LQFL 4UNUA 2IEPA 5T1MA 4PRAA 3OJMB 3HI5H 3VD5A 4PJAA 3WUWB 2Z8VC 1A6UL 4OCSH 4ERSH 1KCKA 3ZTNH 4F8TA 4OTXH 3KPTA 5F1NB 2C4FU 1LDPH 5HI3C 1YEFL 1TCRA 2KL6A 1KJ2A 3ISWA 3L6FA 1B9ZA 1S9WA 1XCQA 2APFA 5IB3B 4NQXB 4HV8A 3L3OA 2VRAA 1R0AL 3JWDL 5MI0C 5LWYL 2A38A 1L9NA 2OTUB 5IBLD 1GPOH 4L8BA 5E0QA 1JGEB 5DVKA 3GSRA 1KC5L 4JDVB 3MOBL 1WBZA 4E0RA 3WHXB 3VH8G 2F58H 1FVEA 4Z77A 3T0DA 2VQTA 4YUEH 3VGAC 1YN6B 3MCLL 3ZE2F 5I8OL 3ULUF 1EBPA 3BVNB 3SE3A 1OLLA 3L3JA 4OCWL 1FLTX 3I75B 4OV5A 4QHNA 1XF3A 4FQIH 1Q9KA 3DGCR 3QIBB 1DVFD 1E27A 1UQSB 3QRGL 4DKDC 5HDOA 3P4NA 5D2NE 5I1JL 1IAMA 3SDDB 3T08A 1ZT4B 3T3PE 4PRIB 2HTKC 3F7QA 3AAZA 4L4VA 2KPNA 2IPUG 3VXSE 3H7BB 1KSRA 4HC1L 1J1PH 2ZOLB 5CZVH 5I71C 4X6CF 4YFLI 3GSWA 4JFDD 1ZK9A 2Y07H 3EYQC 1T7ZA 5GGVL 3HA0A 1IKFH 1B0GA 4HH8A 4JM4L 2AJXH 2OJEA 3DHJA 1AH1A 1QR4A 4PJGE 1INDH 1XIWA 2DYPD 2VAJA 3QFDB 4H25A 3K2UH 3GK8H 3IDNB 1NUNB 5CGTA 3QUML 3QO0A 5EU4B 4MAYD 3RWGA 1OGAD 3CH1B 4QRPB 2LVEA 4PB9H 1EDQA 3HMXH 3C8DA 3PP3K 1UXWB 4LVNB 1I7RB 5D7KE 1EEZB 2BJMH 2EDDA 1HHHB 1N2RA 3QIWA 1S3KL 5TQ2L 3WN5A 4WW2B 4QGTA 3H3PH 1QYGH 5ERWA 1EUTA 5BV7H 3WO4C 4HXAH 3Q5OA 3BQUB 1J1OL 2P49B 1FH5H 4U1IA 1BZQK 4JJHA 3I3EA 4K3HA 4JRYA 4FZEH 3SKOB 1R5WB 3HI1A 4AIOA 4YXHL 1OAUH 4Y4HC 1G0YR 4XP6L 2NLJB 5FOBA 1VEPA 4KKLD 1OB1B 4YQXH 3P9MB 3VXSA 5TQ0L 5SWZB 4HDIA 4A6YL 4WDIB 1QLRA 3TIEB 4G7YL 3QUZD 4M1GH 4ODSH 4N8VA 3OF6D 5FM5O 4PLNC 2FR4B 3O11B 3HCVA 3O2VL 3AS2A 4YE4H 4JGJA 4M7KH 2WUBH 1OD9A 3G9AB 4P2OC 1OAXH 4XRCB 4PJBF 3ECBB 2FECL 5F1IA 1G6RB 2NY4C 1A1OA 1DQMH 1HILA 1CF8L 3GNMH 4NHCL 1H5BC 3GMLB 1NFIA 3B3IA 3JWDC 2VDLL 3ARBA 5EO1A 2VN7A 2I9TB 1PD6A 3B8SA 5HGBB 3ZYZA 3ARED 4JG0H 3FQNB 3QQ4B 3IDYC 4Q2ZB 3NIGF 3O6FA 1A9EB 3S96A 3LQZA 1BF2A 1R3KB 4JFYA 3ARFA 2H6PA 4DZBA 1T1XB 1BVZA 2IH3B 5T1LD 4UU9B 1RSFA 5CD3B 3WLBB 5GIRB 5FEBA 4FA8A 2Q6WB 2YD1A 1LO0L 1RZ8A 3M17B 4Z7OF 4GG6F 4XAWL 1VGKA 1GOGA 4EI5C 2V2XA 1S9KC 5JPNA 3OKDA 2X6MA 5CEZL 5EC1A 4LRIC 5SWQA 1WAAE 3P9LA 4KKAC 1CLZL 1FG2B 3BHBB 4JO2L 4RA3A 3RKPA 5C2UB 4H20L 1ITBB 2FJHB 4WEBH 4BELD 4FQJL 2Y36L 3OR6A 1DBKH 4U0RB 1AIFA 3UMTA 4XC3H 4B0MM 2GCYA 1Q72L 3RVWC 3VFGL 3L3HB 3KVQA 2CDFB 5GGRY 1YYMH 1PKQA 4Z7UA 5E99H 2Z93B 4KK8C 5FYKH 2AEPL 3D9AH 4Y4FA 1DUZB 4IMKA 1UB6B 2X4UB 5FO7A 1A2YB 4LVHC 2DQCL 5ISZD 3HMWH 4KY1H 1CL7I 3RVXD 1BM3H 2O26U 1TZIA 5FUCC 1U3ZA 2XTJE 4GW5B 1D9KC 2E7MA 1FFPB 4HLZG 4JR9L 5LCVH 2UWEE 4K3JH 4OGAC 5JW4Q 4U2YA 4U3HA 2PO6B 1FLRH 2K7QA 1RJLB 1U3JA 4C58B 4X4ME 4Y2DB 2V7HB 5IW6A 1INQA 3VWJB 1GC1H 3WXWH 2VXQL 3QPQC 2H2PC 3KPSB 5E2UL 4WHDA 1B0WA 4QRQA 1J7VR 4N5UA 3MRCA 3DXAE 3I2CH 5HYEA 4MNGB 4DGVH 3UZEA 4HFWA 3E6HB 4Z7QF 5IHZB 2XOTA 1S7UB 4P57A 4YGAB 3RJDA 5IR1A 4BZ1L 3UTQA 1V7NL 4YBQD 4I48B 2DLEA 4L4TA 2B1AH 3RY6C 3DV6B 3B9KA 4F7TB 5D96B 2R4SH 2AK4A 2JB5H 4ZPTB 5F93C 3TEUA 1ADQA 3KYAA 4AENA 1MIEL 2AVGA 4GMTL 5TPWH 4F15B 3ROLB 3QDAA 3NAAL 3UTZB 5J6HA 3OQ3B 5ILTH 4ZDHB 1JNHB 3KPNB 1N0XH 3DGGB 3I3BA 1UACH 1AJ7H 3VWKB 5IF0B 3MV7A 2GITB 4JQIH 5E8PA 5C0EA 5KSBF 1HQ4A 1CK0L 3JBG7 5K9KA 3P2TA 3P73A 3UTSE 4KDVA 5DFWH 3QCTL 5IVZB 2PYEE 2PYFB 5A16A 3BT2L 4PGEA 4F57H 3BDYL 1HDMB 4H8WH 4PLKD 2Z8RA 1ZXQA 1JFQH 1S7WB 3MNWA 1P4BL 4OD1L 3PUCA 3UC0H 2WINA 5GGSY 4CBPA 1NGWA 1ZA3B 1FIEA 2AJUH 2J2ZA 4L3CA 5CLTA 2DDQH 1ZEAL 5KSVB 5MENB 3H9YA 4FABH 5D1XC 2G60H 4POYA 3QH3B 1L6ZA 3F5WB 3G04B 1KB5L 2QQNL 4O5LL 1CD1B 3GHBH 4HQQH 2AI0H 2BNQB 4M03A 1QBMH 1UZ8B 1ZHKA 4I1NB 4CDGC 3QG6A 2VDOH 1YN7B 3E8UH 3LIZH 4KMTL 1SVZA 4ZSOE 2R56L 3KYNB 4M62H 2HMIC 4I4WB 5F3HB 5D7JA 3OKYA 2UZYB 2JE8A 3VRLF 5EC2A 1II4E 4MHHG 1E6JH 3VFWB 4LSVH 4OSUH 4D0DB 5HYSG 3IDXH 3KXFB 1O7SA 4BFEA 2M1KA 2B1HL 1RZJH 4NKQB 2DBLL 4AM0B 4QHUB 1G6VK 4OGXL 3GMPA 3TN0C 5I1HL 35C8L 1DBMH 3Q6GL 5DJXA 1GGCH 5D7LB 1EHNA 4EI6B 3HKFA 1CR9H 1X5FA 4ODVH 2A6KB 5CGYC 2XWTA 3WYRA 3RDTA 2C1OA 1T4KA 1OGTA 3PL6A 4CJ1A 5TDPB 3CFDB 2C4XA 4S2SB 3MRFB 2BCKA 4HUWB 5MERA 3RY4A 3BSZL 1J0KA 5IUSA 2BVEA 3LD8B 3DYPA 1R5IB 4HBCL 2J8OA 3M45A 1L0QA 4PLJD 4UINL 3U46B 3V52L 4OZHF 3SDAA 1P7KB 1MFBH 5I1AA 4NWTH 3QQ3A 4AH2A 5KVEH 4PBVC 6FABL 5C6PB 3GSNH 2VLRE 3HC3H 5JIPA 4OLXH 3GEWB 4JJ5B 3D25A 4ETYA 4DK6A 4NP4H 1KEMH 4J3TA 4MDIB 4WHYG 3T0EC 4XPGH 2A9NH 43CAB 4OAWB 3GI9L 4HUKB 2OK0H 1NGQL 4L5FH 3LS5H 5C6TL 5C6WH 4XH2A 4C56A 4JDTL 3DMMB 5FA3B 1NJ9B 5FUZL 4P9HC 2GY7B 1HIMH 4AEIL 4P3DB 1GGTA 1IEBA 5TE4L 2E7CA 5CINL 4LVHB 5TDOB 5F9JB 3WCYA 2X4NB 3TFKD 3V4PL 4NWUH 4TSAH 1Q9OA 4H0IA 2AKRB 4WO4A 4KPHL 1S78C 2IGFH 1MJJA 1J05A 4Z7NE 4YHLH 2AERT 2V2WA 3AU1A 3MYJA 1CGSL 3WFBH 3S8WA 3ZHKA 4PTUA 1LP9E 2CMRH 3PABB 4JG1L 4L8CA 3U82B 3HZMB 4NJAH 3J8F7 1F5WA 5GZOD 4NNPL 4WTXA 3TNMA 5CEYB 2Z31B 3ET9F 4PG9A 5L88H 2G9HA 2JB6A 2YN5A 3VFVA 1PG7W 2J8UB 2BVTA 4NC1E 1PSKL 2EH7H 4G7VL 1D5ZA 1TTFA 4U1MB 3DI2B 4IRZL 5ITBH 2FL5B 1FE8H 4E42B 5IQ7H 4X9BA 4MXWH 4YHML 4ZPVA 4LNVA 1XH3B 2AXHA 3MV9D 4BQ6A 4WUUB 5EFIA 1NFDB 4UB0L 5IEKA 1CFVL 2D9QB 5EPMB 4OFYA 4W70A 1BZ7A 2FGZA 2B0SL 3LRSA 2DQUH 3SN6N 2VL5B 2VKXA 3QAZC 3DPBA 4LP4A 3TZVD 5J12B 3DHMA 4MQ7B 1J0JA 5JXED 1KJMA 2N7BA 1JK8B 1UT9A 3V6BR 3DTXA 3QDME 4M48L 2ICWB 5I1CH 3QJFA 5I9QC 2AV7A 3CDGB 4BFGA 4P5KA 1I3VA 5J1TC 4UDTB 1FFQA 3REWB 3BE1H 4ODXA 4G8EA 5KJRH 4URTB 1JNNL 2ATKA 5HGDB 1QO3B 5GGQL 3GMRB 2IBZX 3L5JA 5DJ6A 1EAPB 4OZIF 5MHSD 4J1UB 1G9NH 2HT4D 4QT5A 4ODHH 1A6AB 1JPGA 3UPCA 1MCNA 1KN4L 3BDBA 1XGRA 5DRXB 3V95A 3E3QE 1TJIH 3LEXB 4HWZA 1J1XL 1H15B 5GJTL 3BOVA 2HRPL 5LAXB 4ELMA 4L8SB 4N9GA 4RAHA 3U9UB 4U0QB 4NC2B 3TV3H 3H9HB 2QHRL 4PD4K 4R7DA 5FGCB 5HHOB 4UZGA 1MCBA 3LSOB 5T3XE 5LQBH 2G2RA 3OJDA 4LKXB 4JVUA 2X4SA 4GSDL 4BH8A 3HPJA 3CFCH 4M6ML 1U8KB 2R4RL 2V17H 1OT1A 4LF3A 2EH8H 4F2MB 4LDEB 5E6IC 1FO0H 1GAFL 3VXPB 3CK0H 5I1IH 2WBKA 2FWOB 5DGRA 5BQ7B 3BP6B 4YDIH 4YEEA 3SKMB 4Y19D 2EIEA 3HNSH 4LSSH 1KF9B 2HT2C 3FT4A 3OX8A 4HK0B 1ZWIA 1X7QA 2IPKB 5E4IA 4AEEA 2RFXA 3T65A 3QI9D 1NCAL 4ZUTB 3ZLQC 3B5TA 3TN0B 2HFGL 1TZGH 3MLSL 1KGCD 3G6DL 3HG1E 5JIKA 5K93A 3T2NL 5IKCA 4K2UH 4OLYL 3C60A 3W5MA 5EU7C 3BUTA 5CILL 3RL2A 2QKIB 4WU5A 4IJ3B 3KPQA 5C0AD 4D9LH 3ZE0E 4OT1L 1A6TB 3D39D 3O9WD 3TVMA 5DYOA 1K2DA 1FL6B 2QADB 4JM2A 3KHQA 3OSKA 4HS3A 4OIBA 4HCRL 3IDJB 2F19H 1IL1B 3R06A 4YEFA 3LQAH 4J3OC 1OARL 2R0ZH 1AKJA 4YAQB 2NTSP 5BO1L 5BVJB 4MDJB 2VITB 3IETB 3QIUB 3VE0B 3VI3F 4LLQB 3TO2A 1KN2H 5EIIA 4LLMB 1OAYL 5GS2D 4DCQB 5CMAA 2AJVL 4XCFL 2EE3A 1M7IB 4YZFF 2VZUA 3FZUD 1OP9A 4AMKL 2BVPA 5IB1B 5L2JB 5C08E 3SGKC 5KTEH 1JMZA 4GBXD 2KUTA 1JWUB 3C2SA 1KUMA 4U6YB 2C3HA 3Q3GB 5HJ3A 4MSWB 1VERA 1ZVHA 4YDKH 3ZL4H 4DGYH 1R24B 3LAFA 2QEJA 3LN5B 4WW1B 2HN7A 2LU3A 1KPUB 3SCMC 4ZO9A 5IFHL 4PRIE 1U58B 5B8CB 2XIDA 3G5YA 2H3NA 1FZKB 2E6QA 4KJWD 1H9VA 3VDCA 3TO4A 3BIKB 4WFFE 2JJTA 3ARDB 4C4KO 4IRSC 4X4ZA 1EEYB 3D0VA 3GSXA 1FAIL 2APWA 4I0PC 3F65A 3FN9A 1HQRB 3L5HA 2FX7H 1U8IB 3QG7H 1EZVX 1NAKH 4TUJB 1RZFH 4GLRI 3G5XB 1XF5B 3ZDZF 3H9SD 3GMOA 3IJYB 4NT6A 5J56B 5EU6E 2CR3A 5IK3B 1MEXL 1DFBH 5D4QA 3HZVA 3WJJA 4UBDC 2ESVA 2VWEE 5TDNA 4QRPE 4XNQB 1PBYA 4KJYA 3U36B 5I1EH 2GT9A 3B2UD 3QYCA 3VD9A 5D7IB 3LS4L 1GJIA 3QDHA 2ZKHL 3CSBA 5LVEA 3BVNA 1GRWA 2CLVA 5JW5A 4FP8L 5DC4B 5C08A 5EU3B 4X4XB 1NCBH 4NQSB 4YWGH 4NDMA 1CFQA 2P47B 2X4PA 2DB8A 1W72B 3MQIA 1BP3B 5KZCB 4NM4H 4YR6B 4GRWF 4IDJL 1F2XK 1VB9A 5GRWA 3IRZA 1JCKA 4MA3B 3JTTB 3HC0A 5J11B 1KJ2H 2ICES 3QWOB 5FUOH 3Q1SH 5JHLH 1G7QA 2XZAH 4KK6C 4WI3A 3FQTB 7FABL 3SQBA 1P2CB 1MF2H 2MPAH 4N1EA 5C0FB 1FVCB 5F96H 5I8KH 1NCNA 3RUGA 4FQXB 4W6YB 1IGIL 5F7UA 3QFDA 3WFEL 2P5EE 3CXDL 5EU6A 3IU3A 2DM7A 4NKIH 1QSEA 1A4JA 4XX1E 5IBLC 3QNYA 3TNNA 1PQZB 5B3JE 5IM7B 4HGKC 4G5ZH 4JAMA 2XXMB 4PJ9D 1AR2A 1UXWA 2GHWB 4OLUL 4I3RL 3CFJB 1SVCP 1QNZH 1F6LL 4WI2A 4LVEA 5HVGB 2FHCA 4PJ5A 2IAMD 1ZGLM 4MX7B 2CKBL 3GO1L 5E6IB 3C5ZB 2X89D 4DVRL 1RHHA 2CUIA 4YNYB 5GZND 3BQUA 2ED9A 5CKAA 2Y6SC 3AUVA 3WNPA 1BBDH 4NO3B 4ONGL 1A14L 4RGOL 3CFKA 4APQB 4U6XA 3JXAA 4P59H 3TBSB 4X99A 3CMOL 1T66D 1J10A 1G7IB 3OB0H 4UT6L 3GBLA 2WBJD 2VXTH 1NEZA 2Q76B 4MA8L 3ILPA 1RHFA 4WDIA 5SWSD 4UTAL 1LE5A 3CC5A 1BGXH 2VZTA 1YMHA 1CLCA 1IGJB 1SEBA 2BNRB 3ZDYE 1EJOL 3PWNA 4P2RA 1IKNA 3NZ8A 3GIZH 4N0YH 1WBYB 5GRUH 1ZLUK 4YJZL 1LE9A 2P5EA 4QRRD 1LMKA 4JDZA 2XN9B 2X4TA 3CZFA 2O5XH 3ECBA 3TCLA 3BPOC 4LASH 2IPUK 2IG2H 3G9VA 5EO0B 1IZJA 1MI5D 1SM3L 1MHEA 2BC4B 5I8CB 1NEUA 2FECI 4YFEA 3FB7B 3GJFK 4XNYL 4PREB 4FS0A 2XKNA 2ZCHH 4PJHF 1U91A 3ZSSA 1GZQB 2CK0H 5C8JB 4RQQA 4R0LB 4JFQB 5HGBA 1DBAL 4M8QB 4WJ5A 3I3DA 2VISB 3QQ4A 2IQAB 4IRJD 4LRNL 5AZEH 2VDRH 5GQBA 1H0DA 4NM8L 1FORL 2DMBA 4QTIH 1JRHH 3W0WB 2P8MB 1U8QA 1MFNA 2IH3A 4G43B 3NPSB 3MV11 4UU9A 5F7MC 4LCUA 4OCYH 1WZKA 5IMLB 1HHJA 4I0CC 1HHGB 4P5TD 1IAIL 4OUOA 4YBLB 4GRMB 3F58L 1IGCL 1RZIB 4KKLC 1A7BA 3KPSE 3ZKXB 3FB5B 3GSQA 4RSVA 2EE6A 1HYSD 5DQJA 4OIIL 2OXHA 2DQFA 4PJCF 3MBEB 5DR5L 1FG2A 4MNGE 1V3JA 2D0HA 3WV0A 4L3EA 3RWDB 1TENA 2X4OB 3MODL 4POZD 4QCIB 4HIEB 3GBNL 1RFDH 5IVXF 3LV3B 2P42B 5DD3L 4DKEH 2UV3A 3S5LB 4OCSL 2CK2A 2FEEL 4ERSL 4GW1A 3N1GC 4OTXL 1LDPL 3M1BB 4HPOH 1JE6A 2C3VB 2RR3A 5JHDB 4NN5C 1AXSB 5HGAA 3RWFA 4JFXA 4PRNB 4XBGA 3G6AA 4ODUB 3IT8D 4PGDA 1FFPA 2YUXA 3HE6D 5D5MF 4D0CB 1IC1A 4KXZI 4QRUB 1ZLWH 2IBZY 1GPOL 3L3DB 1QRNB 5ICXB 2VNCA 5LKNA 3IVKB 1RK0A 5JLZB 2NXZD 3ES6A 3VDBA 1D5IH 1QFUH 2F58L 4F3FB 2H32A 3FTGB 4YUEL 5DVLA 5DHVB 5F97E 5TFSH 2VERN 1T5WB 1T20B 4EIZC 2E27H 3KLHD 3C8KB 3Q6FB 5MENE 3DUHA 3MNVB 5IQ9A 4FQIL 1OP3H 4JEGB 4K23H 3MGOB 5A2FA 3SO3B 2G5BA 1I1AD 3CFIC 1MRDH 4KTDH 3RTQB 3T3MF 4BQ8A 5L2KB 1WAAF 5JW3H 5C0BD 2XWBA 2ATPB 4G9DB 5HVWA 4KI5C 4HWBL 2YZ8A 1L4IA 3D18A 1OTTD 2EIDA 4I48A 3U2SA 5HVHC 3SKNB 1JV5B 2FCBA 1JZ3A 4RX4D 3NIDF 1ONQB 2JLLA 4ZPTA 5C09D 4WI8A 2DQTH 4OKDA 3H3BC 5IOPA 5DMKA 1YC8A 3WS3B 5CZVL 4NNYA 1J8HD 3HZKA 2CDEA 5A2IH 3DGGA 1ULVA 4YHOH 2CIKB 3X12B 1IKFL 1JPFB 5KBNC 5IF0A 3KXFE 3MRHA 2AJXL 4PJDB 3O6KH 4B50A 4L1HA 4XXCC 4BK4A 4ZTOH 3BJLA 4DK3A 3QZWG 2P4AB 3T2OA 3BW9B 3K2UL 4NZDA 3GK8L 4XP4H 3D3VB 4R4FH 5D7LE 1U8NA 2IAND 3HLAB 1KCRH 3FQXA 1MRFH 5J1AB 3HMXL 3VDAA 2ZPKH 1BLNA 3DIFA 5FO9A 3CVHA 5D9SA 4WFGE 8FABA 2BJML 4JKPL 1NBYA 1TVBA 1SQ2N 4OJFH 4YK4B 5GS1C 1SYVA 3H3PL 5MENA 3T77B 1TTUA 3VXMD 3I02B 1VPOH 4Y4HA 1QYGL 1ZGLB 3KYOB 1A6VH 5BV7L 4HXAL 2FH8A 1FH5L 4UI2A 5C0CA 1ZOXA 2RCSH 2ARJA 1LK3H 1A47A 1ADQH 4FZEL 1TETH 3ZDXE 1OWRM 3VG9C 4L4JA 5D1ZC 5F7FA 3S6CA 1OAUL 4ZFOA 1LILA 4QXGL 1NDMB 4XVJL 4ODBD 4YQXL 2IH1A 3WXVH 2KQMA 4KKCD 4P2OA 3FJTA 3VRJA 4U6VH 3NCCB 1ZVSB 5JW4R 3IKCA 3GIVB 3N9GH 4C4KT 4Z7VB 4OFKA 2OYPA 4ODSL 1H5BA 3VXQB 3HZYA 4TNVK 3RPIA 1I1FA 2AQ3A 3AXLB 4M7KL 2BMKB 32C2B 3BDXA 2WUBL 1KLGB 1EVTC 2A77H 1OAXL 3V5DA 3MCG1 4G6AC 5FUCE 1DQML 4RNRA 4ALAL 4PLKC 4U2ZA 3GNML 2D31A 4KHTL 3MRMA 5HHNA 1IFHH 4LDOB 2XRAL 1FGNH 3DVNB 3DNKA 3VI4E 4MJIB 5CUSL 4RGND 2BSRB 1R5IA 5E8EA 4JG0L 2L7JA 3EZJB 3CLEH 1EZVY 5L7XL 4BK5A 4EI5A 2EDQA 5DK3A 4Z76A 3NFNA 2J8UE 4RAUA 2YPLB 1JF5A 3PWUB 4LRIA 3GHEL 2Q1EA 1A6ZB 2APTA 4L29B 3HTLX 4KK9D 2N56A 4HC1A 1A7RH 3IF1A 15C8L 3WDIA 4Z0BL 5J57B 4WUUE 4LPTA 4XNXH 5DJAB 4ONFH 4M8VA 4O2EB 4LCYB 4ZXBB 1YC7A 3MLTB 4WEBL 5HVFB 1HI6A 1XIWD 4XVUD 1P84K 4ZNEA 4WU7A 3KG5A 1DBKL 4K07A 2AKRA 3B8YA 3QFJA 1M6OA 4H1LG 4IOIA 1UWXH 4POUB 1N26A 1YYML 1D9KA 2DWDB 2HG5A 3CXHK 5E99L 1ZHNB 5K9JH 3D9AL 4PJXE 5DLML 1MFDH 1UH2A 1ED3A 4MD5B 5JNYB 3UAJC 3ULUC 4G9FB 3IFOB 5DJCB 3OL2A 1CICD 3HMWL 4KY1L 2EC9T 4Y89A 1BM3L 1L6XA 3LEVH 3CCHA 1FZMA 4XAKE 3O3BA 4M3KB 5LCVL 4K3JL 4Y5YC 3EDEA 3PGCB 4ZUUB 3CPLA 4A2MA 5KSUA 1FLRL 4KK5D 1YNLH 1P53A 1X9QA 4DKFL 1N8ZA 2YPKB 2DLGA 4WNQA 5FGCE 3SJVA 2R2EB 3DX6A 4HS8H 4Y1AB 2PNDA 5HHOE 4PJIE 5I0ZA 1S9XB 3DVIA 3VG0H 5C0DA 1GC1L 5HDBE 1JZ5A 3WXWL 3VXSD 2VDKH 1J0IA 4XPFH 4ZFGH 2YC1B 3S34H 4ZNCD 4TPRL 2VQ1B 4X7SH 2VUYA 2DWEB 1BJ8A 4D0BA 3OV6A 2M8XA 1M7XA 4U7MA 3RY6A 5D8JL 1FDLH 3I2CL 4D2NA 4DGVL 1Y18B 4DVBA 1YUHA 4XPBH 4Q6IC 3F12A 1B6UA 2VL5A 2OJZH 5J89A 2AQ1A 2X1XR 4N0FB 1SJEA 4WWKB 5ANMB 4JHBA 3X14B 3G5ZB 1XF2B 3TFKC 2IC2A 2OI9C 2X42A 4C83B 2ADJB 2JB5L 2R4SL 2MCG1 1IE5A 2GUOA 5TPWL 2SEBB 5F21B 4PJXA 2PF6A 5ILTL 3BJ91 5D7KD 1IGFL 4KV5E 4J1UA 1N0XL 1NC4A 1X5JA 1T80A 1UACL 1AJ7L 5HYQA 3D0LB 3MACH 4JQIL 4Y4KD 1HOCA 5DRXA 1QACA 1M71B 3LEXA 4OI8A 5AEAA 3UEZA 1WFNA 3ARTA 1EMTH 1YPZF 4RMUA 3CUPA 1U42A 4NQCB 1FCCA 2MKLC 4F57L 3RZWA 1J11A 4H8WL 4PUBH 5D1XA 3ME0A 4RFNC 4N8VG 1LEIB 1JFQL 1TMCB 2FD6L 4NQEE 4UQ3B 1S7TB 5E5UB 4PJIA 5GS0H 3UC0L 4QXTB 1XR9B 4XTRC 2NY6B 1HWGB 1YECH 2V9TA 5KG9B 3VG9B 2DDQL 2WIIA 4M5YH 3TBVB 1KG0B 4FABL 2G60L 4F2MA 4DN3L 3VXPA 2WMPA 4OZGA 4NKDB 4S10A 3KYKH 1NL0H 3GHBL 3R1GH 3BP6A 1L7TH 4HQQL 3TYGH 2AI0L 5JXEC 1HXMB 1T22B 1KJ3H 1QBML 3D2UD 4LLUA 1MREH 5ALCL 1XGUB 3GKZA 1CGYA 2VDOL 3E8UL 3LIZL 3PWLA 4M62L 2HA1A 2NY5H 3ELAT 1IM9B 3KPOB 5BRZB 1MH5B 3TN0A 2CLRA 1ZS8A 2AV1A 4Y4FD 4H26A 5HY9A 1QFOA 3CMGA 4NCC2 1E6JL 1D5XB 3VW3H 4LSVL 3NGBC 4JN1H 2Q86B 3S4SB 2GTZA 2J3SA 4XP5H 3IXAA 4EN3B 1NLBL 2RAMA 1RZJL 4NO0A 3QA3A 5IHUL 3J7HA 2VABB 3TPUB 1FL6A 1YQ2A 1DBML 2K1MA 5E5MB 1N5YL 1FFNB 1BAFH 1F3RB 1KBGL 1CR9L 3IDJA 4NZUH 43C9B 1DBJH 2YD8A 3MUGB 5D6CB 4LEXH 1P7HL 4NQEA 2EE2A 4LCCC 4BQ9A 3BGFC 2XZZA 5EUOB 2B20A 1A3RH 3FO1B 2UYLA 3VE0A 1RIUL 3FFCA 4F7PB 4NQDB 3BP4A 1XGQB 4Q74A 5IROC 2D3VA 1N3NB 1DLHA 1MCJA 4NWTL 5KVEL 3V6ZA 3T0EA 5D7IE 4PFEA 5C0ND 4NBZB 1Q0YH 3LN4A 3TYFA 3HC3L 1TFHA 4OF0A 4OLXL 4F8QA 2EIZA 2WUCH 4JE4B 3AS0A 5A43C 1S7SA 1V3MA 1PKOA 3DUUB 4NP4L 1T5XB 4MSWA 7CGTA 2W0FB 3DUSB 3KDMB 4IMLB 3B9KD 3ZT7A 1JPST 4XPGL 4JPKH 2A9NL 4RZCA 3NH7H 3SDXB 3QI9C 4WW1A 2OK0L 4J8RA 4L5FL 3LS5L 3DX8B 5FKAA 4WFEE 5JMOC 1DUYB 2GK0B 2YR3A 3MV7D 3C09C 1HIML 2VSDA 1JGVH 2GFBB 3MLWH 2DL2A 3O9WC 2XTJD 5DD0H 3GGWA 3B43A 2AXFB 2R1XB 4P2YA 1MFCH 5ESQB 1F58H 5MEPA 4CMMA 4NWUL 2ORBH 3W82A 1OPGH 4R2GB 1HQRA 1X5AA 4ZAKB 2JIXD 1IQWH 2W9DH 3EOAB 4U49A 4JANA 3WFBL 2A9MH 1QKZH 2CMRL 4WFHD 2BVUA 4OF6A 4NJAL 4I77H 2YXFA 3MBXL 5DDHB 5BMFL 2QQLL 3JWOC 1DQTA 3U36A 3IDMA 4WI7A 4RGMB 1YA5A 1NMCB 4X0KA 1F11A 4LLDB 3BO8A 3RVUC 3CDCA 4LHUG 1KB5A 3DXAD 3FZUC 5D7IA 4YO0B 3BEVB 1CGVA 5B39B 2EH7L 3UTTB 2YMXH 3FQWA 4DKAA 2CR6A 5DS8B 4PJ8C 3KS0J 3BXNA 2D03H 5ITBL 1FE8L 1Q9WA 5IQ7L 3BRGC 2AP2A 5HI4D 1W0WB 3ULVE 4WVRA 5DTFB 2R9HD 1KFAL 3BAEH 2OI9B 1OQOA 4X83A 3IGAB 1A7NH 2DQUL 5LGHH 4Y8AA 1JF1B 2ADIA 1BJMA 4OCXH 1CDYA 5JORB 3UTSD 2Q3ZA 2ITCA 2OL3B 5I1CL 1FBIH 3NCBB 4GRLC 1UM4H 5CZKA 2PYED 2BNRE 2Y5TA 1EERB 1U8LA 2AEIT 5KJRL 1MUJB 3RDTD 2ICWJ 3PL6D 1LEKB 1RIVH 4WCYL 1J0HA 2X70A 2EYTA 3FOLB 3CFBB 4ODHL 4J4PC 5I6XB 4EDXB 2XN9E 2BSSB 4DWHA 1T2XA 4RFNB 1XCTB 1JI2A 1TJIL 3IDUA 2AW2A 1A6PA 1UJTA 1DL7H 1HSBA 1S7XB 1X5KA 4HLJA 3PHQB 2ERJB 5HGHB 4K55A 2NY1B 1WVZA 1N6VA 4GO6B 3KGRA 3QNXA 3PGDB 5E6IA 3DBXB 2PW2A 4WW2F 4MLIA 5E00A 2OQJB 1G7LB 5LQBL 4XP1H 1I9JH 1FNGB 3CFCL 3FFDB 1IVLA 1BD2B 4PY7B 4PJBB 3HS0B 2V17L 4X4YA 4YHIB 3QO1A 2XICA 2EH8L 3HNVH 1FSKB 2YA1A 3RKDD 1ORQB 4H5SB 5I1IL 1NCUA 1EGJA 2CLZB 1R3HA 2VN4A 3LKPB 4HD9A 5DJ8A 4YDIL 5FFLA 1DDHB 1KEGL 3VFNB 5DZNA 4LSSL 2R2HA 5TH2A 5M7QA 4FXLA 1MELA 4WO4D 1VADB 4ZQKB 1UXSB 5J7CC 3X11A 5EOTA 2EIBA 1TZGL 3QUMB 1UM5H 3BEWA 1F3JA 3KPLB 4K2UL 1ORSB 4G8GB 3IRPX 1S7QB 3OAZK 2QR0A 4D9LL 4LCCB 3BGFB 5JXAH 1U8JB 2BC4A 3BH9B 1HEZA 1UG9A 1FNSH 1CFNA 3NACL 4S11A 3QR2A 1DEDA 1YEDB 3TIDB 5JHDE 4JVWA 2VLRD 2CDGB 2IAMC 2A6IB 3LQAL 4L9LC 2R0ZL 1CD0A 4K3DH 4HMEA 5B22A 5GZNC 4GW4B 5JW4N 1MLBA 4XBPA 2YA2A 3SGKA 1KN2L 1TQBC 4X6BB 3VRIA 4U1GC 4MJ5A 2ZNWA 4WEMB 5IMLA 5GS0D 4KWUA 4RWYH 2R1WB 1CTNA 4XB8A 3FRUA 4ZFFB 4OFYD 4R96A 1HCFX 5JO5B 3REVB 1CLYH 1K5NB 3FN0L 4A6YB 2OSLA 4NIKB 3SCMA 3QQ9D 1GIGL 4LKCA 1IAII 1JYWA 4R97C 4YDKL 4KC3B 4P46C 3ZL4L 4DGYL 1VENA 2W9LA 1LO4H 2IALA 5L2KE 1JVKA 5E2TL 4IRSA 2HLFD 1N64H 3DX7A 3ZDYF 4I0PA 1OW0C 3NTCL 3G5VB 5FOJA 3FQUA 1MCEA 4GG8A 3IS1X 1A6WH 3O8XC 4DQOH 3STBA 3RL1B 3LV3A 2GJZA 3UCRA 5BCAA 2R8SH 3GMQB 2VAAB 3S5LA 5E1AB 4BFIB 1AGEA 4CVXA 1D5MA 1IRAY 3BWAA 4Y16B 5E4EC 3O3DB 4KMQA 1FFRA 2FEEI 5JHDA 2FX7L 3U0PA 3QG7L 1NAKL 4PJDE 2APXA 1RZFL 1X5YA 1A3LH 1NGYA 4RBPH 4EOWH 3GUTA 1N0LA 2BY0A 5C71A 3D3VE 1I1YA 2WANA 3L3DA 1WSST 1WFOA 4PD4J 5GSVB 4JRWA 4HHAA 4FTVA 3L3IB 4OCNC 5E6YA 5CBAB 5JLZA 1ZLVH 5BXFB 2ITDB 2MJWA 3R0MA 1T0MB 1T5WA 1UVQA 2EECA 5FKPB 2YBRB 3VH8A 2JELH 3Q6FA 3MNVA 2V5YA 3QDMD 4MQXD 4NBXB 1NCBL 5GGTL 5KSBB 3FAXA 4OB5L 2ZJSH 4CU6A 1SJXA 1ZA6B 4NM4L 4TVPE 3CLFH 1FJ1B 3D6GA 5MEOA 3JVGC 2HFFA 3TBYB 4GRLB 3N0PB 5L8LB 4POZC 3C60D 2GW5A 4XPAH 3VGBA 3PP3H 2XWJB 2HT3D 5BOPA 5FUOL 3EFDL 3Q1SL 5JHLL 4S1RL 3C9NA 5FECB 4GQ9H 2XZAL 4JM2D 4B5EA 1TQCB 3EOYG 1CYGA 4PV8A 5KS9A 5ACMA 2W07A 2R69H 4O58H 3QULA 1MF2L 4S0TD 4G80B 2VC2L 5F96L 4BA8A 5DO2D 5I8KL 3BPCA 3IDIA 4YIQB 3QEHA 1NC2B 4HAFA 3DURB 3L7EB 4U6HB 1DCLA 1FFOB 1IEAA 1Z9MA 1AKJD 4HKJA 3RWEA 4CN4A 3BMVA 4HIIA 5T3XD 3FO9B 2YEZB 3D3VA 3HE6C 3LPWA 4NKIL 2H32H 5J1AA 4G5ZL 4LARL 2NXZC 1QNZL 2F74A 1JNLH 3QEUB 3X13A 5K59F 1MJ8L 2HFEA 1CE6B 4NRZA 3KYOA 4U1SB 1CDBA 3VXRB 3WIHL 1RZKL 1I1AC 4WI4A 1QQDB 1BBDL 1V3KA 4GKZB 2YPLE 4F7MB 4IHOB 2VZVA 3RNKB 2NY3B 5C9KA 3JV6B 2KQNA 4P59L 4JFDA 3HG1D 4PJFF 5CP7A 3EO0A 1XF4B 1FZOB 1ZT7B 5EOQH 1MRCH 2YKLH 5DRNA 2DYPA 1GH7A 3EYSH 3L5XL 2DQDL 1BGXL 5H35A 2F53B 4X8XA 1U8HB 1NGZB 1OGAA 2NY2B 3V8OA 3MV8B 3VXQA 3HAEB 3TA3B 5IW3A 2C26A 2VR5A 1PZ5A 2HVKA 4PJAF 5GRUL 5KOVC 3CVHH 2BMKA 4GAFB 3GKWH 25C8H 5IT2H 4G6FB 2ZUTA 4ODTH 2O5XL 5F6HI 3BGMB 4LASL 4WGVB 2WAHA 3V5KA 2IG2L 4W81A 5GGVY 1R3JA 2NQCA 4J3VA 5BZWA 2ZCHL 4G9FE 3B9VA 3DRQB 2Y06L 2PTTB 3IJSA 4NBYB 4R3SB 4U1GB 2BSRA 3OKLA 3GM0A 4NGHL 4D9RE 5C08D 4Z0XA 3WUWG 4GKSA 5FF6A 3QIBD 4NNXA 4JZJB 3MXVL 5AZEL 2VDRL 1B0RB 1CDUA 2J88L 1G0XA 4QTIL 1JRHL 4OD2B 4LQFH 2QSQA 3EJYD 3T8XB 1P4IH 5T1KB 3MRNA 4JFFB 3BKYH 1T1WA 5DEGA 5HD8D 4MD0A 3SDDD 1RZGA 4HX1A 4P46B 4PRID 4YHPB 3PIQB 3VFRB 4U33A 1B3JA 1QEWA 2OCFD 3CSYB 3OF6A 1T3FB 3QDGB 3V0VB 4KI5E 1WLHA 4WFFD 3JWDH 3MREA 1I8LC 1CT8A 2ZUYA 1QR1B 4BSVA 4PTTB 5I75C 2W0KA 1FNEB 4EDWH 3KPMB 2MNUA 4IS6A 2OTWB 2EDFA 1C16A 1IQDA 2A1WL 4QTHA 5E4EB 1WV7T 1XGTB 4R9HA 5A40E 4M7JH 5EU6D 4FFVC 2AS5M 5I8OH 3RRQA 5IJVA 1EO7A 4DKEL 3G08B 3WL9A 4QRPD 5FYJE 1EEQA 3BZ4A 3QUKB 1XEDA 4P4KC 4MD5A 3T0BA 3QRGH 3C5JB 5INCA 1JN6A 1T0NA 4RGNC 3T1FA 3VI4F 2WNGA 3HR5A 1YDPB 3BQUD 1C7TA 1YY9D 2HLAB 5MP6H 3AMKA 2NTFA 1NDGB 4LU5L 4HC1H 4NQCE 1G7PB 4BH7B 3MLXL 2F8XC 12E8L 2F54B 1GSMA 1NANH 4XCNA 2X4QA 4HUVA 1D5IL 1QFUL 1RZKC 4JM4H 5TFSL 3IU4H 3RBSA 4X6FA 4FRWA 2E27L 3MUY1 1EFXB 3GI8L 4ZUVB 1SBBA 1Z6JT 1MWAB 2QJDA 3PWJB 5ICZB 4JFOB 4NZRL 1MRDL 4KTDL 3SDCB 1NFDF 1QRKA 1JZ6A 4ZUWB 2FJFB 4P2RD 4RFEB 1NBZA 1QLFB 3RHWF 1KYOK 2P5ED 2CUMA 5HHQA 5ISZA 4XXCA 3HRZA 4ZO6A 3TM6A 5D71L 5BRZE 2DQTL 4LLWB 2AABH 3D69B 3AB0C 5SX5K 4LNRA 2XPGB 5E2JA 5IB4B 2JCCA 4YHOL 1W2KT 3KS0H 4Z5RA 1C5CH 5CEXB 4PGBA 1DE4B 3NBNA 1CICC 3DO7B 5HHPB 3RNQB 4ZTOL 3DX9A 1MVFA 1X44A 4YXHH 1FVDA 4O02H 3D85B 4PR5B 2JJSC 3ZT6A 3VFPA 4R4FL 2UZIL 5TQ0H 4OQTA 3RGHA 5GS1A 2VLJB 1KCRL 1IAOB 1TVHA 3OKOA 3O4OB 1LK2A 4XGZA 5D2NC 1LEIA 2EDKA 1S7TA 1UJ3B 2FB4H 4TUOB 3BI9X 4LIQE 5EUOE 4DJMA 5KN5A 4XX1G 1ZMYA 4OJFL 5KG9A 4GT7A 1M7DB 5D1ZA 1RUKH 4Q7DA 3P11H 4NO5A 2ICEA 2V9QA 4S0SD 4BM7A 3DWTA 4LL9A 1ADQL 3QUXC 1TETL 3NA4A 2VUOA 1LHZA 4YH6A 5HI3D 5IMOB 2HVJB 3OXSB 1PYWB 4UIMB 3OXRA 1XGUA 4PRHE 1E4KC 1XR8B 1H8SA 4TUKH 1YYLH 4AG4H 3HE7C 1P1ZA 3SDYH 5LGJA 2Z91B 4U6VL 4NJ9L 2X40A 3N9GL 4JLRB 4KTYA 3O45A 4ODWB 4KV5F 3CX5J 5TE6L 1WWBX 4Y4KC 4LSTL 1BIIB 1V3LA 3CVIH 3FMGH 2YUZA 5EO9A 4U1NA 3ZE2E 3EJZD 4OGZA 3ULUE 4Z7UF 4LPCA 1A4KB 1LO0H 1FP5A 3OKMA 2A77L 2PO6D 1S8DA 1ZHBB 3RVTC 3RIFF 3UBXB 2A83B 4Z78A 1WCBB 1VGEL 4ENED 4Y2DD 5IWLC 1XFPA 4N0UB 1C08A 4WV1C 1WCQA 3PXJA 4NKMB 4HKXB 4HKZB 3H42H 1FGNL 3VWJD 1F4AA 4F80A 2ZG2A 3KPSD 4E5XA 1U93B 1SMOA 4F7PA 1MCDA 4Z9KB 1KNOB 3CLEL 3HFML 5CP3A 1ZSDA 3VXNB 4PJ7A 3EKCA 1T0PB 2AEPH 4HWBA 4F9PC 3EYQD 1B6DA 5FA4B 5DEZA 3LKQB 4NPYB 2DQCH 4PRHA 3P4OA 4DZ8B 4QHLA 2X9WA 3M8OH 5H94B 1WT5C 1A7RL 2PXYC 4P2QE 4RMTA 4XNXL 3DX8A 3S37L 4PB0H 2NZ9D 3THMH 2Q7NA 4CRPA 3PGFH 3W9DA 3QDJB 1YJDC 4LPUA 2R1XA 1YMMB 3JV4A 2WZPD 4FFZH 3VGGA 1RMFL 2OMBA 4LGSB 4JPIA 1SMAA 5DFTA 1F00I 2APVA 4C59B 2DL9A 5K9JL 4HF5H 4Y5YA 2NX5B 4M1CC 1KB9J 1UCBH 5FM8A 1ZKAA 2WK2A 3ZE1F 5DUPH 1Q94A 5CFHA 4UQ2B 3EHBD 4UUJA 3BP7A 3LKOA 3C6LB 3LEVL 5MEND 1V7NH 4CMHB 4Z18A 4LLDA 2XNAA 4AT6A 3ORJA 1OT2A 3MFFA 5HHXH 4PRDA 1MAKA 4P9HH 4GKNB 4NQVB 1YNLL 4X6CA 2NW3A 4S1QL 1MIEH 4GMTH 4X5WA 5B39A 3WMSA 3IS0X 4MNHA 1KIRB 4HS8L 2M2DA 4NRYA 4Q6IA 3VG0L 4E41E 1QPPA 2W60A 4PS4L 5ELIA 4XPFL 3S34L 4BSWB 4P2QA 5L9DH 1BD2E 4X7SL 4PJBE 1AGDB 4NQTA 1DR9A 1ND0A 3TJHD 3TBTB 2NY4D 2V2TB 3U79A 4XPBL 3BDYH 3ZKMD 3KXFD 1CFSA 2OJZL 2G5RA 3ROOA 4FXGA 4OD1H 1R3LB 2XTJC 3I6KA 4LPWA 4B7IA 3OGCB 3H6JA 1HH6A 1EHLH 5D7LD 4MAYB 4JKKA 3NIGE 4TULH 1ZEAH 5D1QB 2OM5A 2H2SC 3WDJA 1LQSR 1S7RB 1WC7A 3E2HC 4WFGD 1U8OB 1KB5H 2ZG3A 1P6FA 3KPPB 4X7TB 3L3KA 3P4MA 4I18C 3MACL 4HG4K 1JHTA 5GJSH 4DUXA 5ACZA 5E8NA 2D7NA 4HIHB 4Z7OE 4GG6E 1HSAA 4F7CA 1U92B 2YD4A 5EZOH 3V79C 5KANI 1EMTL 1M1SA 1JHLH 3MROB 5HGHA 4PUBL 1K8IA 2A6DB 3PGDA 3EO1B 5GS0L 3MA7A 3STLA 2UVFA 3VD7A 4E41A 1GYAA 2ZUXA 1O7VA 5I16B 2BDNH 5JXEA 2EKJA 4M5YL 2X09A 1BD2A 1IGTB 2JJVA 3HUJB 3L5WB 4PJBA 5HI4C 5F9WC 2R9HC 3QUZB 5I1LB 3JTSB 3ULVF 3RVWD 3DMMD 1CTOA 4YFDB 4KKNA 1X5XA 2VL4A 4YFLF 1NL0L 3R1GL 1L7TL 3TYGL 1OSPH 2WM0A 5I30H 2YRLA 5BVPH 3BSZH 1D3CA 2RBLA 4J12A 4EJ1C 2Q3AA 4MXVE 4UINH 5ADOH 2NY5L 1D9KD 4QOKE 5DURB 1T1ZB 1UXSA 3SE9H 4OGAD 2OZ4A 2ZNXA 1P84J 1MY7A 4TOYH 5FK9B 4ZO7A 5FGRA 3T0WA 5DJYB 3UTPE 3VW3L 3PE9A 4R26H 3MLVH 5FO8B 4XP5L 1VEOA 4LCCA 4GG6A 3PDOB 1IAKA 1I1CA 3CXHJ 4CW1B 2W65B 2Z31D 5IW1B 3QPQD 1MCKA 1BAFL 1G84A 1QOKA 1NGQH 4NZUL 2GSIB 5IROA 1DBJL 4LLYA 3Q5YA 1HE7A 1LGVA 2YD2A 4YDVB 4OM1H 3EOBA 4JDTH 5KW9H 1F4XH 4Z7QE 1MNUH 2ZCKH 5E56A 1FQ9C 1JUFA 2ZG1A 1A3RL 3K8KA 4LVOC 3KYMA 1EGJH 2X05A 5IVXB 4U05A 3LKSA 3O3AB 3BPLC 3W39B 1KLUA 4M7ZC 4L3AA 4NCDA 5IMMB 2XQYG 3RKDC 1Q0YL 2I9LB 3FL7A 3TLRA 3QI9A 5IEHB 2WUCL 4R4BB 1CGSH 4JG1H 5KSBE 1AGFB 3QXAB 4LMQE 1K4CB 1JWMB 5E1HB 3O9WA 3NH7L 4QOKA 1WUNT 5CSGA 1FIGH 1ES0A 5I15L 2L7UA 5I76A 3UZVB 4KFZC 5J6GB 1FL3B 1PSKH 5IG7B 5DRWA 1JGDA 4NYLA 1JGVL 1CE1H 4RAVA 3ARWA 3GMQA 5IV2B 4RRPA 5DD0L 4XAKD 2H45A 3MLPA 1MFCL 4IRZH 1F58L 5T3XL 3O3DA 5IFJA 1JHKH 2ORBL 2ZCLL 5C9JB 5L0QC 1I4FA 1IQWL 3RBGA 5F9AC 5HHOD 4JZNB 5SV3A 4EKXA 4X6EB 1NUDA 4ELMF 3P40A 4I77L 1NCCH 5EBGA 5CS7A 4PJ8A 3RZCC 5HDLA 4HUUA 5D70L 5CBAA 1QSFB 4AIXA 2HMID 1T0MA 1LVEA 1JNNH 1AHWB 2EXWD 2PUQT 2YMXL 3C5SA 5FCUH 2YD6A 3Q5TA 3KR3H 2D03L 1NPUA 3VXRE 4KUCD 4XI5C 3RI5K 1B90A 5CD5C 2ZSWA 5GJTH 3TN0D 4JREB 1LEGA 2HLFC 4JO4L 5DT1H 2VIRB 1U8PB 2XFXB 4GRLA 3WE6B 1WITA 5F8RC 1AQDB 1A7NL 3VJ6B 5I17B 5LGHL 2LTQB 2PCPA 4TSCH 3STZA 4OCXL 4PPTA 2EYRA 5EZLA 3NFPA 3FCTA 5DJ2B 5FECA 1VCAA 5HTSA 4J4PA 2QADD 1FBIL 1A7QH 1MCWM 3RWIB 4GSDH 1UM4L 2EKSB 4OZHE 3MRDB 4NC1C 3SE4C 3I6GB 3MV8E 2R2BB 3RPKA 4AZ8A 3DURA 4NQED 2UY7A 4R90L 1FFOA 1RIVL 3GZKA 4PJDF 5LJYH 5ENWB 4FQHB 4CDHA 2CRZA 3FO9A 2YEZA 3G6JB 5BJTB 5F6IC 3QIUD 3IFNL 5E6ZA 3C6SB 4BZ2H 3U0TB 4JHZA 1LD9B 1DL7L 1J0ZA 2R0LH 4GKOA 2F5BH 5DMJB 3V0AC 2QSVA 1A7PH 2DTSA 1A0QH 3FOMA 2HFGH 1BWMA 3MLSH 4DUVA 1U8MA 4JQXC 2O61A 2NNAA 4U1SA 4Z7WB 1G7HA 2PKDA 1KPRB 1I9JL 4N0CD 1ZLUH 4OCMC 4JFFE 3WIIL 5JOFB 1CIDA 3U6RA 2FSEA 4GS7B 1MHCB 4MJ6A 3JV6A 5ID0B 1A22B 3HNVL 3PXHA 1UB5A 2GJ6B 1FZOA 4V2BA 3IAPA 4UDUA 3F7VA 3QDGE 3SEPA 5JMRA 1F4YH 3WD5H 4FQLH 3E3QC 1B2WL 3ARDD 1DJSA 5BO1H 3K7UA 1EUUA 3RWCA 4OZHA 1BOGB 4XHJD 5KVDH 3R8QA 3MRKB 4BKLA 2AJVH 4K71C 5DO2C 3HC4H 4Z7VF 1A1MA 4FFYH 1EXUB 5FCSH 4U1LB 3DROA 2ENYA 3KJ4C 1MCFA 5J9PB 1QFHA 3JUZA 2IAMA 5EZJB 4LCWE 4L9LA 4QY8B 3QUYC 3MOAH 4B41A 2VLLA 4LVOB 5F70A 4ZOEA 4U1JB 1YEKH 3O6MH 3FB6A 4HWNA 1BVLA 5F8QC 1GZPA 1AD9B 4TVPH 4JHAL 3HR6A 2DAVA 5BV7B 1OF2A 4PV9B 4M7ZB 4K3DL 4NN6C 1HINL 1X5HA 2FBJH 4QYOB 4MCZB 4PRPB 5SWSA 5C70A 2ZOKB 3LMJL 5F9OH 1FAIH 1JRHI 2NY0B 4FQ2H 3TPKA 2F54E 4RWYL 3BP5A 4P46A 3DVGB 4HZLA 3NA9H 4WFED 2B7DT 5IBTH 1WWWX 1FYHB 1CLYL 4OZIE 4RISH 2Z92A 2QQQA 3RU8H 2V5TA 1OW0A 5DJDA 4M9PA 4G42A 4Y5XB 5F7KC 3O8XA 4LQ1A 4QRRA 5T3ZE 3BISA 4YHNB 5E9DB 3ULSB 1MEXH 1K8DA 1C8PA 5I1DB 1LO4L 2D4DA 3BZFA 4JO1H 1MI5A 2ZP0T 4FQQA 4GOSA 3EFFA 4FQXD 4RDQF 1TDQA 2P5WE 1A6WL 4DQOL 2ZKHH 5I66B 2BZDA 2R8SL 3BGAA 4LCWA 1AGCB 5EU5A 3BZEB 3IXTA 1OCWH 4H0GA 1JGLH 5HHMB 5E6ID 1A3LL 3C5ZD 5EBMB 3QIBC 5GGUA 4HGWB 1D5BA 3MV9B 4K8RD 3EJYC 5ECJE 4MMZC 5AYUH 3ULVD 3N1QC 3V4UL 4APQD 2A74A 4M7LH 2HT2D 1F3DJ 3SDDC 3VXTA 1PJ9A 1JZ7A 1A3QA 4KVNH 3TZVB 4OZIA 3W9EB 3K4AA 3LH2H 3OR7B 3JVGA 4ZUSA 2X7LB 4RIRA 4OQ1A 2JELL 1A9BB 3WFEH 1ROWA 4ZUVA 1IGYB 1P7QB 4ZOBA 1XT5A 1AD0A 3FB8B 4PJEB 2ZJSL 1S9VA 1DEEB 4RFEA 2V6HA 3CLFL 3VCLA 1ZHLA 3OKKA 2ZUWA 2BVQB 2B39A 3PDDA 4ZG1A 4KROB 2P5WA 1BZ9B 3OB8A 4OF7A 4XPAL 4P4RB 2XN9D 3DRTB 3V8CA 4I5BB 2Y7QB 4ISVA 4DVRH 2VWEC 1YEHH 3VI3E 3HE6A 4GQ9L 4LVNC 5T5NF 3NN8A 2EYSB 3VFTA 3K1KC 4RGOH 1F42A 1I8KB 2XV6B 1DE4A 1AE6H 2DMKA 2R69L 3MRJA 4LP5A 4YZFE 2E9WA 1F8TH 4HLZH 1TPXB 4WUKH 2CRMA 4WW2C 1G7JA 3L95A 2EZ0C 5C0GB 1OTSD 1T89C 1NAMA 1VKXA 2IFFL 2LU4A 1Y0LB 3QZWA 4P9ML 3LPFA 5TF1H 3S3SA 1AFVH 5JA8B 1I1AA 4F33B 1HHIA 2FRGP 1JNLL 2H8PA 1INEH 1UA6H 1JWSA 1GVIA 4Y19B 3KLSA 3QHTC 3LB6C 3DO3A 5ICYA 4RX4A 2HKHH 3MBED 5F89A 3V6FA 5K9QI 1QVOA 3PHOB 5C09A 1U9KA 3BD4A 2NYYD 4I0PD 4QHKJ 4Y5VB 5FYJH 3V6OC 4XNYH 1A64A 4D8PB 1F6AA 1MCHA 1BQSA 5C0AB 3ZDZE 3BPNB 2DRUA 1DQJA 3D39B 1MRCL 2YKLL 1H8NA 3AGVA 1XGYH 2HP4A 3EYSL 2ZZUT 3LEYH 5IESL 3KLDA 2IANA 1NQBA 1X5LA 4OQTH 3TH2T 5CAYB 5JHDD 1DQLH 1UM6H 3QUYB 5HYJE 2P43B 3QDJE 4GAGL 4PY8J 4QRTA 1YMME 3CVHL 3F58H 25C8L 3GKWL 1IGCH 3IAQA 1WTGT 3KNBB 4LDLB 5GGRB 3VXMA 5J13B 4OIIH 3O3EA 2MHAA 2NX5E 2YZ1A 4JCMA 4GRWE 4PBXA 5E8DL 3N85H 5IBUB 3K4DA 2YWYA 4MYWB 3VFUB 4GBXB 4LSQL 1TZHB 5EUOF 2A6JA 5AWNH 5GGTA 5H2BB 1RJZB 1KJVA 3S5LG 4G6JL 3GBNH 1NCDL 4IIQB 1KELH 3O2DA 3RTQD 5DD3H 4QHMB 1P4IL 4ORGB 5L2KD 3BKYL 1I8LA 4UNVA 4KK6D 2DJUA 2E8ZA 5IIEB 5EBWB 2RJMA 4LAJH 4U0RC 2O93L 4ELKA 1I8MB 4AQOA 3GSUB 1BBJB 4FXKB 3SDXF 2UY6A 4NO2A 2I07A 1Q0XL 2CRYA 4EDWL 2BX5A 2GKIA 3U7WH 5HYJA 3H9SB 5B3NA 4O2CA 4P4KA 5CJOH 3VFMA 4EUPA 2WQ8A 3EJZC 4ZFZB 2R0WH 4M7JL 3D3VD 1CD9B 4LIQH 1C5DB 2GAZA 2PO6C 5B38B 1YY8A 3MPCA 2C7UB 4ENEC 2X44D 2Y6SD 4Y2DC 4H1LA 3U4EB 5CP3H 3TC9A 1RURH 4IEFB 3MRGB 2HJLA 4RBPK 1UWEL 5DZLA 5ESAA 2OXGA 3VWJC 2G75A 2ED7A 4HWBH 2AXGB 1MFAH 4JFPA 2NZIA 3WIHA 2XQBH 3FT3B 3GSNB 4RMWA 5MP6L 4GAJH 4TVPD 3FO2A 1ZLVK 5BZDB 3UXFA 1KIRA 1WFUA 1IT9H 4OLWL 4WHYH 3S88H 4YDJA 5DJZA 5GGSB 1L7IH 2FX9H 2L4OA 3IU4L 4JPWH 4EEEA 5D96C 3QJHB 3LVEA 3RGVB 4XXDA 1GGYA 3LKNA 4P3CH 1AGDA 2EDJA 5CZXC 4F15C 3NZHL 3ULUH 2X9YA 3TBTA 2NZ9C 3PNWB 3VWKC 3IFLH 4PJHE 4NKOA 3GMMB 3QCVH 5F1KC 4F9LC 4QRSB 4JKPH 5C92A 2IADB 5F88B 3OGCA 5EZIH 1CICA 3WLWD 5EIVA 3SPVB 1FC2D 1ZT1A 2VO5A 4PJ9B 4F7EA 2AABL 4KRNA 3BRFA 2JJSA 2HYMA 4D94A 5I73B 3LKRA 4MB3A 2ADGA 3KPPA 1BX2B 1C5CL 2B8OT 1DQQA 2Y25A 5D2NA 3EHBC 2Y9RT 3PQYB 3FHAA 4JGUA 1SYSB 4O02L 5DXWA 4KAQL 4QXGH 1X6LA 2VLKB 4HJGA 5INDB 4XVJH 1MVUB 4L9DA 1T04A 1HH9A 1MLCA 2YPLD 3MROA 4G8IB 4PJCE 1E4WH 1OSZB 3U7YH 3IDGA 2FYYA 3EO1A 2FB4L 2CO6B 2WBJB 2A73A 1IC5H 1HXYA 2DJSA 4NSKA 3QUXA 2VXVL 3VFOA 1J18A 1VACB 4PJGA 5F7DA 5HXMA 3B5HA 1UZ6F 1RUKL 2L0DA 3L5WA 3MMEA 5IVXE 1I9RH 4JRXE 3P11L 1CG9A 4OKVB 4G8FB 3TJHC 1D6VH 2FEDC 1E4KA 4ZXBD 5CJXC 4UILH 5DEFB 3GMNB 1EO8L 3HE7A 3ZKMC 4ALAH 5C0JA 4PJHA 4HMDA 3RIAK 4KHTH 2R0KH 4AY0A 4BUHA 5DQDH 2W59A 4OV6F 2XRAH 4P23B 5CUSH 3FKUS 4Y4KA 2VZ3A 4XNMB 5TE7L 4ZYKA 2BNUB 1FZJA 1MJ7H 4TUKL 3MRLA 5D5ME 1YYLL 4AG4L 1S5HB 3SDYL 3WNOA 3DOSA 4NUJA 5L7XH 1ZANH 4AEHL 4G9FD 3U30B 1A7OH 1BEYH 4BJLA 3LD8C 4D9RD 1RAMA 3GHEH 1KPVA 5AAMA 5IWLA 4PP2B 3EYFB 3CVIL 3FMGL 2VLME 4WV1A 3EBAA 3FONB 5ID1B 1AO7B 1KIPB 3ZHDA 5ITFB 2O5YL 15C8H 4Z0BH 3MRBA 4PJCA 1IM3A 3AMLA 3T3ME 2C3WA 3L9RB 3GJEB 1F4HA 4P5TB 5D2LB 5JDSA 4YDVA 3IFPB 2BOBB 4EIGB 2FO4A 5TGBB 3U4AA 3H42L 4OCLC 3V7AG 4F9PA 4KI5D 3D2UA 3NIDE 1FO0B 4JRXA 1FV1A 1QSFE 1HN1A 1N4XH 5DUBB 2FHBA 3DMMC 1WT5A 2PXYA 2XT1B 1FRGH 3EO9H 4UOW1 2EDRA 4K7FA 4WWKD 3PWPB 5DLMH 1IILE 4HPYL 3O2WL 4FQCH 4MCYA 1Q9LB 1AP2B 2OZ4H 5ETUB 6CGTA 1NFKA 1EIBA 2D0FA 2V7NB 4OZ4A 2ZUQB 5K9OB 3M8OL 3MRIA 5D5MA 4P5MA 1R5VB 5FYJD 3WEXA 4MXVF 2HJKB 5FYLE 4PB0L 1KYOJ 3THML 5CIPA 4DKFH 2P7TA 3LY6A 2LVCA 3LRGA 4WI6A 1T7VA 3QHZH 3MO1A 4MD4A 3PGFL 3VGEA 1E4XH 1I1RA 2AQ2A 2I60H 3UYRH 3V5HB 5AG8A 3S36X 3P0VH 5JIHA 4GUPA 5CWSB 2Z31C 4FFZL 5FDWB 3UDWC 3LCYA 3MR9B 2B4CL 1FNLA 2PW1B 1A1NB 1BVKA 4TPRH 4NQCD 3SBWC 1AC0A 1KENH 2MKWA 4HF5L 5D8JH 3AFLA 1WAAA 4OZFB 1UCBL 1LO5B 3CFEA 5DHYB 5DUPL 3G6JE 5IMKA 4XCYB 5LXGH 5KSAB 5D1ZD 1N59A 3MZGB 5T5NG 5AUMA 3P77A 5DK2B 5I2IA 1RD6A 1QLEH 2I25N 2P44B 1QSFA 3GSVB 1VFAB 5HHXL 4P9HL 4TNWK 4HFUH 1E6OL 1LO2H 2C1PB 3T4YA 2XXCB 3IJHA 4UNTA 4LHUA 4WWID 5J12C 1HZHL 1PEWA 3QEGH 3P4LA 4EVNA 1RJYA 2H1PL 1IGFH 4PRBA 3U9PH 3ZKSD 1IGMH 5DC0A 2NW2A 1CCZA 4GXUN 4YHYB 5C07B 3O4LB 2FIKB 2NPLX 5BRZD 5L9DL 4XNUH 5DF0A 1J8HB 5I19L 4OZGF 2W1NA 2A0LD 1KXQE 2EXYD 2OR8A 2UWEA 1P4LB 1U8PA 3UPRB 4G6AD 2GJ6E 1BQLH 3JWOH 3GSOB 4OF8A 2XQYK 2JIXA 4O4YH 4CVZA 4EN3D 5GS2H 3OTTA 4X4MA 2FD6H 4Z95H 1JF6A 4DAGH 5DRZA 2DN7A 5B4MD 2FZ3A 1C12A 4I18A 1F3DH 4L8SC 1EHLL 1MAMH 5T33H 3L7FB 4X8JB 4TULL 5MEQB 1MCWW 2Z8WC 3MGTB 2VH5H 1WBXA 1WWCA 1SY6L 4X98A 3OG6B 3DXAA 4DN3H 3TT1H 3K1DA 3KPRB 2H9GB 4PJFB 5GJSL 2W91A 1H3WM 1H3UA 3RWJB 2CIIB 4KTEH 1J8KA 4M61A 4M1DH 3UROR 4L8DA 2FJGB 5EZOL 5ALCH 1FNAA 4LAQH 1JHLL 4R8WH 1IJ9A 3S4SG 1Q38A 2EXWC 3D5OF 4OFDA 1RULL 1Z9LA 4KQ4H 2JK5A 3PJSA 2K7PA 4LEOB 5EUKA 5I1KH 5T1MB 4PRAB 4PRHD 4PJAB 5GPRA 1NLBH 3KJ6H 4Q9QL 2BDNL 3ARZA 5IHUH 3UTSA 4NZTH 4PRPE 2FO1A 1V5JA 4YDLB 3JZ7A 3OAZH 1TCRB 1N5YH 2PYEA 1KJ2B 1KBGH 2GJ6A 3AY4C 3H7LA 3L6FB 1EX0A 1S9WB 1XCQB 4ORZC 4IJ3C 3L3OB 1OSPL 2FLRT 4LCIH 3UAJD 5I30L 3ULUD 3SQOH 4L8BB 5BVPL 2QADC 4FMKA 1EBAA 5E9DE 3EDKA 3GSRB 1RIUH 4R2GD 5E2WH 4ZAKD 4RMVA 5ADOL 1TNNA 1WBZB 2X4RA 3SE9L 3S3JA 4YX2H 3MJ7B 2D7PA 4Z77B 3A6OA 4TOYL 3RVVC 2I27N 4K3GA 2R23B 2B4CC 4HK3N 3L3JB 4R26L 3MLVL 3ZO0A 4OV5B 3BX7C 3QIUC 4QHNB 1XF3B 1Q9KB 4GAYB 3VXOA 1DN0A 3MRRA 4PGCA 1D6EA 2ZSVB 4JZOA 1E27B 2R1YA 1T1YB 2D2OA 4KJQC 5DI8A 2KH2B 4U1JA 4ZSOA 3P4NB 1NLDH 4YGVA 3JWNC 5HHME 1PVHA 5ADPH 4OM1L 3AAZB 5KW9L 4L4VB 1F4XL 1MNUL 2ZCKL 1XZ0A 2VR4A 3UJJH 1I8IA 3BD3A 2KKQA 3OAUH 4N0CC 4QYOA 1EGJL 4P2QD 1EK3A 1UGNA 4MCZA 4PRPA 1OD7A 3GSWB 3SHSA 3FAWA 1B0GB 4HSQA 5B8CC 4HXBH 1AI1H 3EYOB 5E7BA 4EXPX 1I7ZA 2APBA 2VTFA 4J3XA 1XIWB 4H25B 3QWRA 1K4DA 3ARDC 1MHHA 4MWFA 5EH1A 3MBXH 3OHXA 2DF3A 3OKEA 5BMFH 1ETZA 2QQLH 3RWGB 4AJ0A 1W0VA 4XHJC 1OY3B 4NRXA 5LBSH 3RIFK 1YPZE 5EWIL 5B39G 1FIGL 1N5AA 1J0YA 2MCPH 3QIWB 2HJFA 3WN5B 1F02I 1R6VA 4QLRA 2VLRA 1BFTA 5C3LD 3KLAA 4TRPH 5FYKE 4CVUA 5ERWB 1CE1L 4J7RA 1QSVA 3L3GA 3K4ZA 5HPMA 4U1IB 4Q9CA 3O81A 4XTRD 1RY7B 2WQRA 1JHKL 4JRYB 4U1KA 5IB2B 3RZCA 5D72H 1CDJA 3HI1B 4ACPA 4HG4J 2NY1D 1KFAH 5FOBB 2Z35A 1LNUA 4MZ3A 2Q8BH 1MCRA 4HGWA 5HHVH 5AG9A 4E41D 2F5AH 2LAAA 2QV2A 1AGBA 1NCCL 2DLFL 1QLRB 2E3VA 1BD2D 5KVGL 2WW8A 4TTGA 1KTDA 5C0IA 4PP1C 4X6DF 5J11C 5FB8A 3WFHA 3HCVB 5CJQH 1KCVH 4AK1A 4WCYH 1MCLA 5EBLA 2NCMA 1LP9A 5FCUL 4YPGA 2EDEA 3KR3L 4CUCA 1RUQH 5F1IB 1A1OB 1HILB 1G9EA 1O5DT 2DKMA 1PY9A 4HH9A 1FL5A 1YPZA 1NFIB 3O41A 1S9YA 4QF1A 2BVQA 4FQXC 1RQ5A 3ARBB 3K0WA 3MYZA 5DT1L 5EO1B 3TESA 4MA7H 3NPZB 5E94A 1G7MA 2X41A 1AR1D 3SE4A 3S9DB 4JY5H 3LDBB 2RQ8A 2ICCA 2E8YA 2UVEA 5EIQA 4TSCL 5EA0H 3ARYA 4ONHA 2QHLA 4HS6A 3O6FB 3BH8A 5BS0E 3LQZB 2XY1A 4JFYB 3ARFB 2H6PB 4DZBB 1A7QL 1YEEH 1I8KA 3U4BH 4NHUA 1T21A 1WQVT 5SX4H 3OBAA 2CRIA 1K6QH 1RZ8B 3C5ZC 4N1HB 1VGKB 5E24E 2V2XB 4XCEA 4W68A 3OKDB 5D7SH 5GS3A 4K8RC 4JQXA 1KEGH 4BZ2L 5IGXH 3QDMA 4M02A 5EC1B 5SWQB 3ULVC 3P9LB 4APQC 3TBWA 5T3ZH 2R0LL 4F33A 2F5BL 2DS4A 3QEQE 3P9WB 1A7PL 1A0QL 3P30H 5A2LH 1M05B 3GB7A 3OWEA 3OR6B 1MCOH 2D7TH 1I7TA 1PKQB 3CH8A 4N8CL 2ZWLT 4Z7UB 1SBSL 4F37F 3OG4B 4LBEA 3BMWA 5ESVA 4QOKD 2VB5A 3NACH 1EPFA 3S37X 5CSZB 3UTPD 1CVSC 4WY7L 5DMGC 4XZUA 2D7OA 3LZFH 3HHRB 1F4YL 3WD5L 4FQLL 1DTUA 5BS0A 3TH4T 1NAMH 4Y16D 4TQEH 5KVDL 3Q0HA 4JY6A 5FV1L 3QUYA 3U1SL 4R0LC 3F7YA 2FHFA 4YXLH 3RVUD 4DFIA 3HC4L 2DLIA 1JMXA 4FFYL 1OTSC 5IW6B 1INQB 2BXYA 3UZQA 3FN0H 1GIGH 3KWWA 2Z8SA 4PJ8D 4QRQB 1IZKA 1E28A 3NPSC 2PETA 3MRCB 3MOAL 5DUMH 4HFWB 2VE6A 4GMSH 1YEKL 3O6ML 3QEQA 4GH7B 5E2TH 4YBLC 4P57B 4TVPL 3MLZH 1TZHA 3PWVA 5DA4A 5IR1B 4FQ1H 4MJ4A 4O51A 4JY4A 3NTCH 3ZKXC 3HG1A 4L4TB 2YN3A 1B4JH 5CBEA 5JZ7C 5CLWA 4RRPG 5CHNA 5GHWL 3B9KB 3NIFF 2AK4B 2FDBP 4HMCA 3MBEC 4AENB 2FBJL 1OHQA 3WUWA 5J6HB 2BK8A 2NYYC 5F9OL 3EW3B 4FQ2L 5F1NA 4GRLD 5T1DH 3I50H 3MV7B 3NA9L 4LK4A 5E8PB 1X4XA 2GI7A 5IBTL 5C0EB 2BHZA 1HQ4B 4RISL 5DHXB 5K9KB 3RU8L 5IB3A 3P73B 4NQXA 5FHBL 1BBJA 4FXKA 4J4PD 2OTUA 3TWCH 5A16B 4PGEB 3EJJX 4RA0C 1JGEA 4JDVA 3EAKA 4JO1L 3MNWB 1NC2D 2WINB 3WHXA 2Y23A 1QFWM 1NGWB 4L3CB 2ARJQ 1YN6A 4NQUA 1QPXA 3I75A 5GGTH 3QIBA 4UT9H 2YHGA 3NCYS 3JV5A 4OB5H 1UQSA 3O2DH 1SHMA 5GRYA 1KIQB 1OCWL 1J12A 3PQYE 1JGLL 1YNTB 2EO1A 3SDDA 1ZHKB 1ZT4A 4XMPH 4PRIA 4NN7B 3QG6B 2VLKE 3VXRD 3SO3C 5D7JB 1U95B 3H7BA 3X17A 3RTQC 1LWRA 3HNTH 1ERNA 1KT2B 3EFDH 5SWZE 5DD6B 4S1RH 5BZDA 5AYUL 2NY3D 2ZOLA 4M7LL 1RUAL 2EDBA 4KMLB 5SX5H 3RJQB 4KVNL 4QEGA 2VC2H 4LSDA 3LH2L 3V6OE 3S36H 3BN9C 1NANI 3GMPB 2YRPA 1I85C 5GRVK 5IVNA 1DLFL 4EUPH 5DJXB 4KRPC 3IDNA 4KDWA 2P1YA 2EDXA 1EFQA 5KOMC 3MJ6A 5EU4A 3PNWA 2XWTB 4N68A 2C1OB 1T4KB 1OGTB 2ED8A 3CH1A 3PL6B 4QRPA 2NY2D 3MV8D 3TA3D 1FCGA 1I7RA 1Y6KR 3A67H 4LARH 2BCKB 5MERB 4GRWH 4QRSA 1EEZA 4H1LH 1HHHA 1DANU 5F88A 3LN9A 4G6FD 4WW2A 1JZ4A 1MJ8H 3SDAB 2J1KA 4QXWA 1T89A 1YEHL 5I8EB 3WIHH 3P0GB 1RZKH 1ACYH 1MHPL 1WWAX 3ESVF 2VR9A 5F7WC 1AE6L 4M6AA 3D25B 3QT2A 1R5WA 3SKOA 1F8TL 4WUKL 4YK4C 1GCFA 2NLJA 2Q87A 3AC0A 1AO7E 1OB1A 5JQHC 3P9MA 5SWZA 4JFFD 4XH2B 1MCPH 1OOAA 5TF1L 3L5XH 3TIEA 2DQDH 4C56B 4F58H 4U4BA 3HAEG 1AFVL 2HRLA 2ENSA 4P46D 2X5PA 2BVYA 4K94C 1IEBB 1F13A 1INEL 1UA6L 3V6OA 3QDGD 2FR4A 3O11A 4L1DA 5JQ6H 3NABH 1CGUA 3O8XD 1Q9OB 1CXLA 5FGSA 4WO4B 4XRCA