3TGXA

Il-21:il21r complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
b'CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVQITDQSGQYSQECGSFLLAESIKPAPPFDVTVTFSGQYQISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-21 receptor
publication title The crystal structure of the interleukin 21 receptor bound to interleukin 21 reveals that a sugar chain interacting with the WSXWS motif is an integral part of the interleukin 21 receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 35
structure length 208
sequence length 208
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tgxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tgxA01
2UYLA 5IVOA 4CMMA 5E5UB 3EO9L 1E6JL 4XPHH 4JRWA 4WFFE 2HWZH 3IAQA 5HYQB 3OB0H 3OKNB 4I18A 4P2RD 1UA6H 4LMQE 1WCBB 2FEDD 4FZEL 1MCNA 2F8OA 4Y4HB 5DJZB 1F97A 2VISA 4WW1A 1CG9A 4F9PC 1L9MA 4KDTC 4LIQL 3QIBC 4XWOC 2J88L 3UPAA 3JV0A 4B5EA 5T1LD 2HKFL 2V2WA 4TUOB 2G75B 1QFWM 3NN8A 3VGEA 5DD1L 1E27A 1AHWB 4OIIH 2IPKA 1ZWIA 1ZHNA 4NIKB 2HT2C 2PETA 3RWEB 1KEGL 1QBML 4OZFB 5TDOA 1MLCA 1XAUA 3OKKA 1JNHB 2A6KA 3ZDYE 4MJ4A 3QXVA 4LCIL 1ZS8A 4AG4H 1JHLH 4CUCA 3AB0B 3F62A 2YD8A 1KTDA 3CFKB 3ARRA 4ZD3H 4AIOA 4XT1C 4MLIA 3X14B 1NSNL 2GFBA 5IEKA 4NBZB 1ZK9A 1Q1JL 3P4NB 3KPRB 1OW0C 3ARBC 1JGVL 2AV1A 1UZ8B 5J6HA 2A2QT 3EHBD 1LWRA 5DQJB 3QCVL 2IQ9H 2BFVL 2VMFA 2VDOH 1G7HB 1I9JH 3MRRA 1CDYA 5I1AB 1K8DB 4KTEH 1W0WB 4PV8B 3PP3H 3DX8B 4HWBH 3JTSB 1U42A 4HAFA 1JGDB 3MUGB 4KHTH 1GXEA 3LZFL 5CGYD 3W9EA 2W0KA 1N3NB 3TV3L 5GRWA 4MAUH 4F7PB 2VDPL 2OM5A 1LEKA 2R8SH 3AAZB 4K9EH 2DKSA 4Q9RH 2NY2D 5KJRL 3BSZH 3QEQB 1HDMA 3JVGC 1YJDC 1YEDA 5C0CA 4O2FA 1SM3H 3PNWB 4JDTH 4LKXB 1I1FB 2C9AA 5F9WB 4URTB 3GJEA 1EBAA 4OGAC 2JKXA 5DZLA 3E3QC 3OJDB 1OVZA 3GMQA 2VR5A 2WWKO 2XWTA 4LVNC 1EO7A 1TIUA 2APFA 3QUXD 5JDSB 2ED9A 1JWSA 5FM8A 3JXAA 5DMYA 2VXTH 3FO9A 4HJ0D 3U7WL 3RIAK 1CIDA 1CQYA 4UBDD 2JELH 4S1RH 3S98A 1AD9A 5J13B 1S7WB 2QLVB 4XAKD 3CLEL 3QAZC 4PRHD 5KZCB 2FL5A 2ZKHL 3CSBA 1OP5K 5JPMA 3HZVA 3UTSD 4PGBA 5T3XE 4R90H 1WWAX 3CVHB 2O61A 4UUJB 1S9YA 3X3GL 4NN5C 4PYGA 1YN6B 3KVQA 3PHOB 5K59F 4QRRD 5I73B 3GNML 2H26A 3KWWA 5E2UL 4MXVE 2DQFB 3EO0A 1G7QA 2J6EA 4PJCF 2P5WA 3O2WL 1ZGLM 5ADOL 2NY0C 4JRXD 1Z3GH 4L3EE 3BKJH 5D6CA 5ALCL 4WGVB 1OGAE 3HHRB 1JRHL 2Z93B 1WBZB 5DDHA 5DZOA 2XICA 4DN4H 2L7UA 3MCLH 3RTQC 5FUCC 1XGPA 1ZHBB 1KCUH 4R96B 3C5ZD 3K2UH 5TE6H 2BNQE 2XN9E 3QFDB 5L2JB 1ZSDB 3AS3A 3TVMB 5JW3L 3KYNB 2AEPL 4Z7WE 3MA9H 3U2SB 2YWZA 2DQJL 1CZ8L 3MV7E 1NKRA 2FX9L 1ZT1A 5IUSA 5D70L 1KJ3H 4M48L 3PWJA 1NCWL 4UNVA 1P6AB 4Q9CA 5I1LB 4G6JL 2ERJB 3ZDZE 1EZVY 3QEGL 4PLJC 5I8OH 4LPTA 4FXGB 5K93A 3MRJB 4OM0L 5FKPB 3MQIA 3ILPA 2QTEA 4GAJL 1I75A 4PJ7A 4TULL 5D7KE 5EOCH 5EZOH 4L9LC 1AGCA 1IGML 1T4KB 3WN5A 4PTUA 1A7QL 2DLEA 5KBNC 5EBWB 4PRHA 4KROB 1N2RA 4N68A 2YN5A 1LHZA 3I6KA 2ZCKH 3WHXA 4OD2B 1V05A 3U48A 1K5NB 4MQTB 5IBUG 4YHYC 3O2VL 5C86A 3MRQB 4ZXBB 1JTOA 4JFEB 1J5OH 1VGEL 1A14H 1IT9L 1MNUH 4Q9RL 4JM2B 1C08B 3IDXH 3C60C 3VFGH 2GKIA 2Z8RA 3QO1B 3RJQB 1NEZB 2HFEA 4N1CA 4IMKA 4JRXA 1J05B 4WO4C 1N0XL 1NLBH 4D3CH 3QDJB 1F6AA 3BUTA 3VXNB 1F3DH 3UPCA 5CP7B 5JXAL 2XQYG 4PLKD 2I07B 2C3VB 2Z31D 3ILQC 5SWQA 4HUUA 2BNUB 3DVNB 1NGZB 1TMCB 2UZXB 3MREA 2OK0H 2EXYC 1I85A 3IRZA 4I3GA 1FVDB 3L9RB 5ANMB 1J10A 5D1QB 1RJZA 1PGRB 4HWZB 2IFFL 3QUML 5GRVL 1D5ZB 3DO3A 3HPLA 4P2QB 5JW5B 3C5ZA 2LU3A 3ZTNH 1DBJH 5LG1A 1ZVYA 4ONHA 3DSFL 2WWKT 5C09E 1WAAA 5KW9H 4CN1A 3C08L 1DE4B 1K3ZA 4LHUD 3ES6B 1TFHA 2IBZX 4GAGH 5L6YH 3LB6C 2GW5A 1K4CB 4R7NA 2ZPKH 5ERWA 5DURD 5CMAB 4Z7UB 1G6VK 3ZT6A 5T33L 3HMXA 1TZGL 3BIBX 3MNZA 1EHAA 2X41A 1MVUB 3QNXB 3NCYS 1NUNB 3N9GL 4I3RH 4PJFA 4F15B 1XF3A 4DJMA 3NOIA 1YUHA 1B0GA 1T1WA 1ZT7B 3L3KA 3TCLB 5FK9A 4YR6A 5LGKA 2W65B 2QL1A 1NCDL 2EKSA 1A7NH 1A3RH 4WY7L 4ZOCA 5LJYH 5AEAA 4DEPC 1MQKL 1RZJH 1FO0H 3ET9F 4APQC 2YD2A 1E4KA 1GGCH 1KN2L 2Y9RT 2ADFL 3BISA 3QUYC 3BPOC 3FB8B 1MQ8A 3FQRA 1BAFL 4EN3B 4NJAL 5JLZA 4U6VL 5B38G 3OR6B 1DJSA 1R24B 4MJ5A 1H3UA 1LK2B 5KAQG 2VDQL 5E8DH 3UC0L 2VLME 3PWVB 2PTUA 3MA9L 4HG4J 3SDXA 1RHHB 3ZE2F 3T0EB 3HPJA 1BEYH 3VG9C 2ZSWB 5I1IH 1BVKA 2WK2A 2ED8A 4LL9A 1ONQB 5I2IA 2CLZB 1CFSA 2F5BL 4BM7A 2DDQL 4P46D 4CAGA 1V3JA 4BA8A 2H2PC 1XGTB 1Z5LB 4DKEL 4Z5RB 3VJ6A 4HZLA 1L0YA 2ITDA 1PY9A 1A47A 4OB5H 5CSZA 3VFSB 4JPWL 1K85A 5GS0D 2KZ1B 4ENED 4H0GA 2B7DT 4RAVB 3H7LA 4D9RD 2BSTA 4ZFOL 3ZE0F 3FN9A 1FSKB 1NCTA 1WBYB 1UH4A 2RFXA 1UVQB 3P77A 1J1OH 4WI8A 4Z76B 4O5LH 4HFUH 2P47B 4YFEA 1IM9A 1AKJB 1YNLH 1ZA6B 1MRCL 1KIQA 4XHJD 3IDXL 3MXVH 4PJIE 1JHKH 5ISZA 3QDGA 5IR1A 1XGYH 1RPQA 32C2A 3U0WL 5GJSH 3VWKC 5FAAA 5TQ2L 3VXSB 1F4HA 1EFQA 2YOCA 5C0EA 3D3VB 2XOTA 3MFFA 3UYRH 3C6LB 5C0DA 4EZMA 3EYFB 4X8JB 1IBGL 3AVEA 5DQDL 1ULVA 1ZXQA 4XPAH 4M6AA 4F3FA 1G9NC 4N0FB 1Q9LA 4ODWA 4KJPD 2VH5H 4OLEA 4KXZH 4Z95L 2WSKA 3BH8A 3OKOB 3WLWC 3PWPB 3ARWA 2DMBA 4U33A 2IFGA 3FTGB 3IAGC 4DUXA 4GAGL 4W68A 3VXOA 2GEEA 5B8CC 4LCWE 5DEFB 4GKZB 1WT5A 3WO4B 3RY6C 2X10A 2DWEA 1RU9L 3T09A 1S5IH 5E00A 3TZVB 4DVRL 2AKRA 1HXYB 4XNXL 4QXGH 3QXDA 2R1WB 4QTIL 1A1OA 4PP2B 4CN6A 5I76A 4CVWA 4K7PL 2N56A 3HNTH 3WFBL 1YQVH 3GUTB 4X4XA 3WD5L 4PJGF 1DBBH 4YH6A 1HCFX 3SE4A 1X44A 4YBQD 1VDGA 3CSYB 4F7EA 4NUJA 1FCGA 4H1LA 4N9GA 5GZND 3BZ4A 2CLVB 5L0QB 1UM6L 3MGTB 3T1WA 2R1YB 3DIFB 3DI2B 3QNZA 3DJ9A 2AJYH 1JI2A 4WU5A 5E8EB 3PV7A 4FQPA 3SDCD 4HS6A 1TNMA 1FZJA 4X6CA 4PJ7F 5KN5A 5GS2D 4JFDD 4CN4A 4YLQT 5T3XH 1CFTB 1HH6A 1R3LB 3S5LA 3SQOL 5J12C 1K6QH 3P30H 4R97C 4KK8C 2OI9C 2CO6B 5KSAD 1RIHL 4OB5L 3FQWA 3LEVL 2FX8L 4WNQB 2Z35B 2ZNWA 5LGJB 7FABL 2GJJA 3ECBA 4V2CB 4NUGH 5L88L 2AK1L 4PLNC 1A6AA 1NUDA 2GTZA 4JM4H 1UWEH 3HRPA 1AFVH 1FLRL 4Q2ZB 4U1NA 1NC4D 1BJ1H 4JGUA 1LK3L 5JPNB 3BAEH 4NSKA 1S7QB 4WFGD 1CXIA 3WNNA 3MJ6A 4V1DD 3W0WE 1J1OL 5A2JH 4JQIH 3I75B 1I1AC 4LCWB 5IB4A 4PS4L 2O5YH 5C0FA 4EUPH 5E24E 4QY8B 3C6SA 3WL9A 5JW4N 5IV2A 3S4SB 2NY6B 1XF4B 1GC1L 3L3HB 5DO2C 1A5FL 2OTUB 3DHMA 4UDUA 3FFCD 5EOQL 1E28B 4G8GD 4YIQA 4KI5D 1U8IB 1ES0A 3GKWH 3V5KA 1CLOL 1WAAF 4EDWH 1EH9A 2H41A 3RL1B 4F9LC 3PGCA 2H6PB 5K59E 3V6FB 4MA7H 3RFZC 1P4BL 1S7TB 4JFFA 4WDIA 4PJCE 3QBTB 5C07D 3RAJL 8FABA 3HCVB 4JVWA 5BRZA 1DQMH 3DLQR 4LPUA 1LE9A 1Q94A 1KXTB 3B9VA 3ZKSD 4U1IB 1OGTA 4BK5A 3B5HA 3UROR 1I7TA 3BPLB 3R1GH 5MENA 2C3XA 3PHSA 2BVEA 4PJFF 3TBYB 1H5BB 1GZPA 2GQHA 3EDEA 1MUJB 5GGSY 3KLAA 4J2XA 2B1AH 1NGPH 3QIWD 3I6LD 1W72B 3LKNB 4DQOH 2V7NB 1JBJA 3M1BA 1BJ8A 2Y07H 4QT5B 2VSCA 2JK5A 3CFBA 3GSWB 3N85L 5KVDH 4U0RC 5FA4B 4AZ8A 3G6JB 2GCYA 3ZZ1A 1S8DA 1UB6A 4G9DA 4OFYA 1C7TA 3FZUC 1TZIA 1YQVL 4XP1L 5A2FA 1CF8H 3SDXF 5IROA 7CGTA 5ICZB 3QIUC 1HN1A 5GGRY 5DJDA 4BZ1L 5E1AB 2ARJA 1NC4A 3EYOB 3OAYK 1YMHA 3UAJD 2FGWL 1A1MB 4P23B 1X5JA 2DBLH 1A4KA 5C6WH 2AJYL 5IG7B 2X4SB 4PP1D 5C0BE 4LSSL 4AEEA 2P8LB 4RGOL 1P7KA 4EI5D 3WJLA 2HVKB 3FT4B 5IT2H 1GOFA 5GRXG 3DTXA 3REWA 2AEIT 1VACA 5IWLC 1SY6H 1BJMA 4DWHA 3RVXD 4YXHH 4MA3A 5DYOB 5ETUB 1YECL 1YEEH 2XWJA 5HHOE 4G6KL 1U41A 3NIDF 4WWKC 3QH3A 3QI9A 2VUOA 1AQDA 3KDMB 4PGDB 1VPOL 1EGJL 3ROOB 1E4WL 3EOAB 3QUZA 5IGXH 5GRYA 1SEQL 3MRDA 3N1GC 3S96A 2EDHA 1KIPA 1QLFB 4PGJA 5C07A 2KBGA 2BSRB 3UDWC 1I8MB 1TVBB 3B2UD 2VLRD 2K3TA 4QGTA 1IGCH 2YA0A 3BAEL 4P4KC 2AW2A 4RFEA 4YX2H 1NC2B 3MBXH 4J8RB 2XPGA 4RMUA 4N0YL 2HT3D 3UYPA 3HC4H 4YPGA 1BF8A 2W9EH 3ARTA 4JKLA 5C1MB 4YPJA 3U6RB 4HLZG 4KJQD 3CFIC 4AM0A 3JWOH 3RPIB 2IG2L 4OBRA 4MYWB 3W39B 4U1LA 3OXSA 4QHLB 1EX0A 4Z0XB 1QHPA 2WUBH 4LLUA 1Y6NR 5CGMA 1U93B 1IAKA 1WVZA 3V0WH 2A6IA 4MJIA 3WFCL 1WTLA 1BD2D 4LMQI 4KUCD 4XAWL 1KPVA 5EO9B 1BQHA 1IGYA 4X0KA 3MLTB 3V5HB 1LO0L 4M62H 5C6PB 3CXHK 3GSVA 2GSGB 2OL3B 4QF1B 1P7QD 5HJ3A 1HEZB 3V7MA 2B1AL 2Y72A 4B0MM 1NGPL 4WFEE 4MXQD 2M8XA 4U1KB 2DRUA 1JF5A 3RWCA 4U1SB 2YUZA 4UOJA 5C0AD 1JI1A 1P1ZB 1C1EH 2PW2A 5HHOB 1PG7H 4I2XB 4JY5H 5KANI 3MV8A 4X9FA 4XP4H 3G08B 1L0XA 4LVHB 1FE8L 3ZE2E 1KJ2A 2AJZA 3GMMA 4KJWD 1Z9OA 4ZUTA 1UXSA 3MLVL 1D6VH 3V9FA 1MJUL 4X6CF 4H26A 4M00A 3EOTL 2BNRB 1U3ZA 1KLUB 1EZVX 3KHQA 1OT2A 4JFYB 4FQIH 3AC0A 5DEZA 1YMMA 2I24N 4RCAA 4N90E 4NCC2 1I8IB 5CEXB 1YNTA 4NKMB 3CXHJ 2X4RB 3QULA 5DEGB 5E6ZA 2ZCLH 4LP4A 2F5AL 4FQQB 2FDBP 1FPTH 3RA7L 1Q9KB 4NZTH 4KXZI 3BDXA 2QQNL 5AZ2H 1FP5A 3M17B 5FA3B 3RUGA 4U0QB 5ITFA 3TA3D 3SDDC 5EZLB 5C0CE 5JXED 1BX2A 2J12B 3QHTC 3ZE0E 4LHUG 1YEEL 1UJ3C 2C4FU 3WSQL 3VD4A 1J0JA 2EDYA 1HHGA 3BN9D 1N5AA 4LLVA 3O8XD 3GMOB 4NQSB 1Z9MA 2XQBH 3LSOB 5MP6H 4K7FA 3JV5A 3QUKA 1PG7X 1CLYH 5DMKA 4PRPE 1EFXB 4Y2DB 5FCUH 3KYKL 4YGVA 4U6YA 4Y88A 4LCYA 4HH9A 1R3HB 3MBEB 4L8BA 2ZJSH 1B9ZA 5IESH 1WZ1H 2AEQL 5IIEA 1ZVSA 4WHCA 5DMJB 1F02I 2VTFA 5D5MA 3NCYP 1HWHB 3TLRA 2FJGB 3H3KA 3HE6D 2QSQA 1L4IA 4RMTA 1U95A 5IMLA 2P8MA 2YPKA 1X6LA 4F9PA 4DZBB 1VFOA 1RY7B 1FYTE 2P5WE 4KQ4H 4KDTA 3ARVA 1R3IL 5GGTL 5GGVY 3QIBA 1R6VA 4PJ5D 1K2DB 1F4WL 1ZLWK 1FIGH 4DFHA 3HFMH 3U0TA 5IHZA 5IJVB 5HYSG 4PRNB 2J5LC 1KIRB 1ORQB 3D0LB 25C8H 3FO2A 3HMWL 3V0WL 4IM8A 4Y5YC 1PKQA 1A6PA 2JCCB 3VCLB 1J12A 4K8RH 4XP9L 3HNVH 2NXZB 1JFQH 1HHIB 4WI4A 1A9EB 3BZFB 1BQUA 4M62L 1NAMA 2APXA 4PJGE 3KPQA 1S9XB 4JY6B 4MB4A 4XCCL 1BBJB 4K23H 4TSBL 5E8OB 5JORA 5HVHB 4XNZC 3THML 1MEXL 4P9HL 5I8CB 5SV4A 4FQCL 3ARBA 4WUUB 1SQ2N 3UBXI 2N1KA 3IVKA 3HNSL 4YO0B 3O8XA 1LMKA 4YHZL 4JPIA 1AC6A 1G7PB 2I26N 4LLQB 4Y4FB 3L5WA 2Q7YB 4GRLB 5DFVD 3HAEG 4PJ7E 5CWSA 4KFZC 4R2GC 3HG1A 5I75C 4PRPB 4I0PC 4OUOA 4XC1L 2V2XA 3PP3K 1GGBH 4O58H 1FGNL 1J8HD 3Q6FB 4HD9A 1I8LC 2A74B 1DSFL 4NRYA 4GG8B 3ARGB 2E9JA 1D9KD 3HE6A 1ITCA 2P49B 3BEWB 4KPHH 2Q8AL 1OAZL 4M6OL 5EBLB 3JVGA 4NQDA 4LSPL 4HUXB 4HKBB 4MD5A 3JBG7 3MLRH 1LP9B 2IGFL 2JB5H 1YEFL 5A16B 1OF2B 3RU8H 1FYTB 4JLRB 4JPVH 1NEUA 1UB5B 2Z92A 1OAKH 3SCMA 3FMGH 3VGAC 1CXFA 4L1DA 4AIZB 5IW6B 5HHPA 3LD8C 2CKBA 2X7LB 1CLYL 4HMCA 1WIUA 4EQ3A 1CFQA 1GGYA 3FQNB 4KZEH 4HF5L 1C12B 2IADA 1T5XB 3FQTA 3NGBC 4R0LB 5EU4B 1HCVA 5GRVK 4WJ5B 3WFHA 4OFVA 3GHBH 4WFHD 3QQ9C 3ULVD 4POUB 2H9GA 4WI9A 3B9KB 4ISVB 5B38A 1WAAE 4HGWB 1Q72L 4OV6F 3BPNB 3CH1A 5D7LB 4K94H 4PJGB 5FDYA 1WWCA 1IAIM 5ACZA 3WFEL 3FB7B 5DRWB 1OLLA 3ARZA 1BQSA 2X4NA 5GZOC 2XY1A 4FNLL 1P4IL 5FYJD 1AR1D 4LNRA 3G5VA 4RGND 5D1XB 3IDGB 3QZWA 5F7DA 1HYSC 1ND0A 3RWFB 2ICWB 4XGZB 4PJFE 5BJTA 5K9OB 2W60B 1W72L 4OM1L 4EVNA 4XZUA 4M7LL 2CIKB 4HV8A 3K2MC 1I7RA 3RTQA 1DVFC 3LV3A 4HLJA 2Y1VA 3VXMA 4XMKL 3MCG1 3QNYA 4X4ZA 3U0PB 5F7HA 2YPLA 1R0AL 3CXDL 1JNNL 4Y5VB 5DD5H 1EO5A 3M8OH 5K9JL 2R4RH 4LGSB 1UQSB 3UXFA 1KSRA 4XPBL 4LLDA 4X7TB 4H5SB 3SDXE 3WHE1 1HSAA 2G9HB 3WJJC 1B6UA 4MGXA 2D03H 3BKML 4NJ9L 3S36H 1EUTA 2Q86A 2HRLA 5DD6A 3GGWB 4KI1A 1IEAA 4LLWA 1KIUA 4NKDA 3TT3L 5KSUB 3RDTB 4FZ8L 1U8MA 4OFPA 2OTWB 2NW3A 1N59A 4OCRH 1KLFA 4QXTB 2Q87A 3SDAB 3LEXA 4L9LA 3VMOA 4U6TA 2VSDA 4Y0GA 3MOAH 1MWAB 4Y4HC 3F5WB 4NQVB 4TUKL 5LKNA 3HUJA 3SOBH 1G7MA 1EEUA 3Q5OA 2H8PA 3NIDE 5FO7A 4XBGB 5I15L 5J9PA 3VFUB 4LDOB 2QSCL 4HCRL 1G7LA 4UT9H 4NZJA 2VE6A 1K3IA 2DMKA 2DIAA 3P9LB 1FAKT 2A9MH 4L8CB 1AHWC 2NXYD 2YD9A 5BZDB 1FJ1B 4ODBD 5E2WL 5ISZE 4NWTL 4LK4A 1H0DA 1OB1B 4WO4A 1XH3B 3PHQB 1HYRC 4JGMA 3S36X 3Q5YA 1IM3B 1TNNA 1RD6A 4UQ3A 3NPSB 2IH1A 4N8VA 2OCFD 3K3QA 3FMGL 5EOCJ 2CSPA 1PSKL 3RNKB 3D9AL 4G7VL 1NPUA 2X2YA 3MNVB 3T0VA 1TJGH 2HMID 4YDVB 5JQHC 1X5YA 1HIMH 5HTSA 4HK3N 1KPUA 5E8NB 5EUOB 5MEQA 1C16A 4CRPA 12E8L 4MX7A 4ONFL 1FO0B 5D71H 4RGMC 4GUPA 5IF0B 2F54B 2VLKB 2DBJA 5FGSA 1D5MA 4G5ZH 4PREA 5DC4B 2FZ3B 4L8SA 5EC2A 3V7AG 4HS8L 3HS0A 4NHCL 5SX5K 2DM4A 3U9PL 5F21B 1A6ZB 4LLMB 1JYXA 4X5XB 4JFXA 5CEYA 2VXQH 4M8QB 3LDBB 1F3DJ 2NX5D 4ONGL 5BCAA 3JV6B 1I1CA 3SJVA 1PQZB 3GBMH 3DYMA 4A2MA 4HXBH 2P24A 4HIIA 5M7QA 3B6SB 1U58A 3ABZA 1IILE 1SJHB 1SYVA 4L5FH 4E41E 5IQ9A 4LAJH 4F33A 1F11A 5EBMB 5F9WC 1UFUA 1PLGH 4G6ML 5GS1B 4NO3B 3CZFB 3QUYA 5EA0L 4APQA 4M7LT 1IC4L 1K9TA 4TPRH 1JHTB 4FQXB 4NN7B 4I3SH 5F7MC 3OHXB 2D9QB 4C83A 2VDLL 3NH7H 4OTXH 1AIFA 3VRJA 5IKCB 4WHTB 3HLAB 3ZKNC 2ICCA 3BEVB 3GJFK 3TT1H 4HIEB 2AJ3B 4L4VA 3H6JA 4X6CE 5E8PA 3X11B 3BWAA 1VFAA 4OQTA 1UEMA 5I66B 5TQ0H 4ZO8A 3VE0B 2AQ3A 2DQCH 3QPQC 4XNUL 3QEHA 2PXYD 3EYSH 4BH7B 1ZOXA 2E6PA 3MPCA 4F7TB 1KCVH 4L3AA 2UUDH 1G0YR 4A6YB 4JFPA 4RNRB 2ZG1A 4U6HB 3VXPB 2J6EH 2XV6B 2Z4QB 5DD3H 5I73C 3D39D 3QPXH 3Q3GA 4M03A 3TJEL 2VYRE 5GRJH 3QJFB 4QOKA 3HE7D 4DKAA 5ID0A 5I1DB 1DQLH 2NY5C 4CBPA 2PCPB 1RZ8B 3V0VA 3KPMA 1GPOH 3F12B 2QKIA 5GRUH 2QJDA 2YK1L 3STZA 2FBOJ 1RZIA 3WO3B 2H1PH 5C3TA 4OI8A 3MRMA 4RDQG 4UTBL 4U31A 5DMIL 4YHKL 2OP4H 2VQ1A 1X5GA 4ZYKB 3CDFA 3PXHA 2ZNXA 3ZKMC 3MV11 4Q6IA 3QP3A 3TVMC 4GRWB 4OZIB 2NX5A 3O4LE 3RGVD 1DBMH 4XNMB 1RSFA 4M5YH 2EYTA 3F7QA 43C9B 4M02A 4JY4A 5J1TC 2LAAA 5KAQF 3E0GA 3QDMB 1FBIH 1TTFA 1RQ5A 2NY7L 1A3QA 4E41B 2PTVA 2GYSA 2AABL 3O11B 4JFFE 5EC1B 2YEZB 4KKAC 2ERJC 5BRZE 2EZ0D 1W2KT 3P9WB 1NJ9A 4X6FB 5DK0A 1UACL 4BELD 5T1MB 5F89A 4YUEL 4Z8FH 3IKCB 1S3KL 5MENE 4XBPA 3LKPA 2OJZL 5B8CA 3PG2A 4ZSOB 5JHDB 2CLRB 4HEPG 3PWLA 1D7FA 4LPVA 1FL3A 4X99B 3RY6A 1X6NA 4CW1B 2EE3A 4HFWA 4OAWA 1JUFB 3SKJL 2IANA 3KPSD 1M7IB 4ZXBC 1FHGA 3VXRD 3GMPA 1MHCB 1YY8B 2Q1EA 2VN4A 2E9BA 2OTPA 1DLFL 2RR3A 2V9RA 3AM8C 3D85B 1TQCB 1J0IA 3GSUB 1OWRM 4RMWA 1LEGB 4TVPD 1VFMA 15C8H 2VLJE 1A6UL 1D5XB 4IRSD 3UTZA 3IDIB 1IZJA 2MNUA 3MUJA 5H2BB 4OGXH 4ZFGH 1UCBH 3OL2A 3NCJH 3BKCL 5F1SA 4HUVB 3IXAA 1KB5L 2NZ9C 3GMLB 1EEYB 5D7JC 3IDMA 1CICB 4K55A 1F90L 1X5AA 5GISL 4GXUM 4MDJA 4MHHI 5IB3B 1WZMA 3CPLB 3HUJF 4EUPB 4HIJA 5MEOA 3EYSL 3RGVA 4L4TD 4AEFA 2R2BB 3O4LB 1CK0H 2LV4A 4ODTH 3HMXH 4LNVA 1DUZB 5ELIA 3MGAA 1H3PH 3HI6H 4MNQD 5E99L 3TF7C 5GGVH 3WIFB 4OI7A 1AGDA 2ESVA 4G8FB 3CCHA 3GRWA 1CWVA 3X3FL 3GSRA 3UJIH 4F15C 4PRDB 1WBXA 1N7MH 2VWEC 4NKOA 5DTFA 3I85A 3GBLA 3LN5A 2VR9A 1XZ0A 5LGHH 5TGBA 5I74B 3VFOA 4LCUB 5HPMB 1I1AA 3SKOB 3BZEA 4HXAH 1A7OH 2H1PL 4FQ1L 4YHPB 5SWZD 1QOKA 4XTRD 2BVTA 4PRIB 3CFEB 1MJ7L 4M1CD 1U3HD 3GIVB 3FT3B 1D5BB 1LD9A 1T21B 5DQ9B 3O3BB 4EN3C 2ZG3A 4NHUA 1DUYA 1JYNA 4Q9BA 1A22B 1MH5A 4IMLA 4F7MA 5FECA 5HYEA 5AAMA 5DJ0B 5JOEA 4J6RH 4F9LA 3T0EC 1A4JB 4BFIB 1FFOB 1EJ6A 1ZGLP 2C26A 4S1SL 4Z0BH 2UZIL 2A73B 2VLJB 2OJEA 4MJIE 3SDYL 4F58L 5FIEA 4PJ9B 4ZNCD 3L5JA 5KS9F 5E6ID 2R0ZL 4RAHA 2P48B 3IKKA 3CFCL 3QHZH 1I9EA 2HTKD 4M1GH 3BP6A 4IHOB 4ZODA 3VFPB 5A3IC 4HMDA 5ID1A 1GIGL 3EJZD 3L95A 3R0NA 2HMIC 1BOGA 3EOBB 1TZHB 1FNGA 2RCSH 5DC0A 4K3JH 1JGLH 1FSKC 4L4TA 1T1YA 4H25A 2BHUA 1DDHB 3H42L 1KPRB 3Q5TA 4GMSH 1H3GA 3MV8E 1KLGA 2FR4B 3FQXB 1T7YA 5AYUL 5L9DL 3T77B 4ZS7H 1JF1A 5FM5O 1RZFL 3WV0A 1MFEH 1BWWA 4IDJL 4MAYD 2M2DA 3QIUA 5E9DB 5BS0D 4GBXC 3D2UB 5TH2A 1KJVA 2FJHA 1G6RB 4CVXA 5C7XH 4NOBA 3N1FC 1FNAA 2MQCA 3C6LC 2Y5TA 1YMME 3S3SA 5J3HD 4D2NA 1ZHKA 3DOSA 1MWAL 2EEAA 4OZHA 4D9LL 1UCBL 5F3BA 1IQDB 1QKZL 4PJBF 3E6FA 1XCQB 5SWZA 5EORL 3O6FD 1I3RA 2XY2A 4O2CA 2OYPA 4JZOA 3DVGB 4Y19A 4HBCH 3BPCB 2XTJE 4C4KO 4KRLB 3RWHB 3PL6A 2YHGA 2WBJD 1CLZH 1HOCB 4KRPC 4WWKA 1MCPL 1T7VA 3TNMB 4OCSL 1QR4A 1OOAA 2ADGA 3IB4A 3HMXL 2EDBA 2J1KA 3I9GH 2ILLA 3O3DA 3HC0B 4JANA 5ACLA 4DAGH 3MFGB 1H3PL 1I9IL 5GSRB 5FHAL 3O0RL 3OPZL 3H9YA 1KCLA 4IEFB 3FN0H 1T89C 3MROB 1WCQA 3UDWA 3FCTB 3TO4D 4JZNB 2EYRB 3VFVA 1BM3H 3WCYA 2ZZUT 5GS0H 2GJ6A 3BO8A 5J57B 5DJ6A 1Y18A 5EU3B 3DI3B 3JWDC 1CFNB 3VI3F 2B4CH 5EZJA 5JTWA 3QO0A 4NCC1 3H9HB 4KMTH 4P2OC 1VGKA 5CJ8A 5ITBL 4KZDH 4J4PC 4QRPE 5I8KL 3VWJD 1N8ZB 4EDXB 5ADPH 3OAZH 3HI1B 3MRHA 4RMQA 3L3IA 4FQHA 4F57H 3KR3H 3I50L 3ESUF 3H0TA 4ERSH 3PQYB 4ORGB 1AGEA 4KH2A 4KAQL 3BH9A 5HHXH 2J8UB 1Q9OA 1N64H 5BV7H 4JRYE 3DURA 4FTVB 1IEHA 1FORH 3HAEA 4KTDH 1YEJL 3LQAL 4UINL 2YWYA 5CUSL 5H37H 2NPLX 3RIFF 3DXAD 4O2EA 3QCUH 3X12A 5AUMA 3LCYA 1QACA 3NA4A 4J3VA 1PKQE 3QFJB 2NY3D 5IW1A 4HUMB 4R8WH 2LAGB 1XT5A 1H15B 4NNPH 4CMHB 3DO7B 4JDVB 4L3CA 3DUSA 2R2EA 1OTSD 4QWWD 4KKNA 4PLOB 3I6GA 3ZT7A 4NRZB 4HJJL 1HNGA 2EE9A 4PR5A 5EU5B 3MODL 1JV5B 4Y16D 3STLB 1NFDA 4XXDB 4GW1A 5EUKB 4G7YL 1NLDL 4NM4L 2V2TB 1BMGA 1MFDL 2WBJA 4K3JL 1JGLL 3AY4C 1QLRB 4Y2OA 3LEYH 3WEXB 1Z0NA 1B0WA 3OJVC 4PGEA 1NMAL 3N0PB 4HH8A 5SWSA 3V4UH 5FYKU 2MJWA 1AP2A 1PZ5B 1ZANH 1G9ML 3LS5L 3OJMB 1QRND 3L3GB 4R3SA 4NFDA 1MVFA 5IFAL 4YHNA 3HG1E 2VB5A 1TQBB 2NY6C 3LH2H 4ZAKC 5HVWA 1AXSA 3WFDL 3TCXA 5C6TH 3D25A 2HT4C 4UB0H 3WS6C 5JIKA 4A6YL 1KC5L 1CD8A 1M6OB 2OQJA 2KQNA 1MI5B 1EHNA 4KJYB 4XCFH 5DHYA 5DJYB 4NZUH 5CZKA 3EYQD 1FZOB 2NMSA 1MY7A 4QRPB 4NQDE 5CJXC 5FDWB 1EJOL 3U36A 4HBCL 4PGZA 1J11A 4UV7H 5FF6B 1UJ3A 3BPLC 3E3QE 5JR1H 1LO2L 4TNWK 4UIKH 3G6AA 5GS2H 1SYSA 1H5BC 4FABH 4OFDA 4Q0XH 4OCYH 3I9GL 4JRYB 2FATH 3KPPB 2C4FT 4ZPVA 5CKAA 2VJXA 2JJUA 3GHEH 4C4KT 3OGCB 4KKLC 5LQBH 3ULUC 3BGMB 3MSPA 2YBRB 5DSCB 2O5XH 4S2SB 3JV4B 3ARQA 1FFNB 5C08D 5CD3B 2CRIA 5GGUA 1B2WH 1YYMH 4LSRL 1GZQB 1GGTA 4TSCH 4R4ND 4I5BA 1A9BA 1CI5A 3WXWL 3V2AR 4KZDL 4L8DB 4I9WE 2D7QA 3V4PL 2JB6A 2YUXA 5MEPB 4LSVL 3O6ML 1RJYB 1C5CH 4P23C 1U8LA 2HJLA 3IFPB 1XF2A 4P59H 4P57B 1HINH 5KVEL 2VABB 1IEBB 1RIVH 4GT7A 2YUVA 3LVEA 3H2WA 4ZTOH 1UM4H 1A6VH 1YYLL 2R4SL 1FORL 2QR0A 5C2UB 3QYCA 1AO7A 5FUCE 3CK0L 4ZFZA 5TFSL 4AEIH 1DEEA 3DGGB 1SBSH 2WUCL 1FVCA 2Q6WB 1CXKA 5IB1A 1QYGH 1KENH 3VXME 3C2AL 3KPNB 2VDKH 5IBTH 2YPLE 4PY7A 4D0BB 1REIA 3SQBA 1HZHL 3KPOA 5I1CH 3REVA 3RZCC 1MPAH 4M7JL 1X5LA 2VO5A 2WQRA 4D0DB 1AGBA 5J4MA 1DN0B 1IFHH 4Y1AA 2XZAH 3QQNA 1V7NL 4JO4H 5KSVA 2ENSA 4DVBA 2J4WL 2CDFB 5T1DH 1CE6B 5E08H 5IHUH 3IS0X 5B22A 4GKNA 2P8PB 4YXLH 1J86A 4JCMA 3NZHH 1KELL 3KJ6L 4MD4B 1M05A 4OCNC 5DVKA 5J6GB 1OL0A 1QQDA 1UC6A 2W9DH 1ZTXL 4OZHF 4KKCD 2R23A 4I0PA 5DS8B 2E7LC 1CXLA 3ALWA 3BKYH 5EO0A 3CZJA 4X9HA 2XZZA 1MF2H 1F13A 4AK1A 5C6TL 2W07A 1IGFH 3LKSB 2PO6D 4WCYH 3LRGA 1WK0A 2H3NB 5B3JF 2I5YL 4H8WL 3BW9A 3QUMA 3MRBB 1NBYA 5C08A 4PD4K 3DUHA 3G5ZB 3N1PC 3VA2C 1U8NB 1BVLB 5HDQH 2BVUA 2G2RB 4ELKA 5HGBA 4ALAH 2IEPA 1HQRA 1NCNA 1W0VB 2HN7B 4JHWH 3TIDB 3AGVA 1I4FB 4QHKI 4LCCB 3UTTB 4DGYH 1R3JA 1TENA 4OT1L 3ZSSA 3FFDA 2DJ4A 5L8JB 1TETH 2I60L 4YHML 1JGUL 1ETZB 2L7JA 4Q0XL 1HILB 2P5EA 3P4OA 2FATL 4PJAA 2GSIA 1EHLH 2DQEH 3G5XA 4MQXD 5C2BL 3BJ91 2NY1B 3QQ3B 4WTZA 2R0LL 2VIRA 1KJ2H 2EIDA 2F53A 5D2NB 1U8JA 3T4YA 4PD4J 3NA9L 2XNAA 1B2WL 1AD0A 4TOYL 3O9WC 3B3IB 4YXKH 4CJ0A 4TSCL 1DQDL 2NY4D 5C0GA 2QBWA 1XIWC 1PYWA 4P9ML 1L7TH 2IAMD 3TN0C 5H94B 4HUNB 1CD0A 1QFUH 3QEUA 4OKVB 4LLYA 4FFZL 5KS9E 2EH7L 4BSVA 4GOSA 4AYFA 1C5CL 1JPSH 1M7DA 1YPZA 1NBZA 3RVVC 2BMKB 2VDNH 3DRQB 4S1QL 1VADB 3LOWA 4TUJA 3SJVE 2ZG2A 3NTCL 3IJHB 2NLJA 1D6EB 1F3JA 4XMLH 1DVFA 1H8OA 3TBWA 3VXUB 5D7IB 4G6FB 1DL7H 4EOWL 3SGKC 4N0UB 4P2CG 2W38A 2QEJA 1XGRB 1NFDF 2YXMA 1URLA 3CNKA 4DFIA 5MHSD 5D8JL 4IOFD 5HD8C 5DJAB 4NGHH 4ELMA 1QA9A 1FRGL 1JPGA 1KCRL 3LKQB 4ZFOA 1FV1A 2XZCH 4JFHD 5J7CC 1G6RL 3GO1H 1AY1L 1NAKH 3MJ9H 4Z7OF 1RZGA 4NQCD 3WJJA 4L4VE 2DIJA 3C60B 2H2SC 1QSEA 4GW4B 4LFHD 2EO1A 2VC2H 1EXUB 3QWRA 4MA1B 5L2KE 4KKBD 5GJTH 5HYQA 1OTSC 5GGSB 4WFFD 4XNQB 4M1DH 4PJBE 3HR6A 4RAUB 3OKNA 2ZUUA 3BI9X 3T2PA 3L3DB 3BJLA 4PV9A 1WCBA 4LVOC 1J0ZA 2A38A 3DARA 4Y4HA 1AGFB 4DN3H 5DXWA 4KTYA 3O2DL 1T3FB 1X5XA 3FT2B 2KZWA 5F71A 3K81A 4PJ8D 1FQ9C 3MACL 2E6QA 4QOKE 1OP3H 1Z6JT 2RHEA 2I25N 4L29B 1J1XL 4PUBH 1BP3B 2R2CA 4IS6B 4TUOA 3UO1H 2G75A 3T2NH 5KVMC 2CUHA 1YY9C 2VDML 4H88H 1ZGLB 1AHWA 5GGRB 4G80B 1OSPL 3PDDA 3RWEA 5TE4H 5I18H 2V9QA 2O5ZL 5CEZE 3I3BA 4OZFA 4PJHF 1NAMH 1KFAH 1JNHA 4X9IA 1IKFH 2ITCB 1KYOK 5GHWL 3VI3E 2R56H 4JAMB 5HHME 4RWYH 1JE6A 4KY1H 3CFKA 4LGPB 3B2VH 3HZMB 1JNLH 2HAZA 4O51B 4P2RB 3IJYB 4WRLA 3X14A 4K9EC 5HVHC 1IAIH 1DQQB 1U8HB 3KLSA 3B9DA 4M5ZL 3P4NA 5T3ZE 3KPRA 3GKZA 3KG5A 4XVUD 3BPOB 1UZ8A 2RJMA 3WHE0 2JE8A 4YE4H 1V7MH 1BREA 4NOFA 1MFBH 5DQJA 4Y4FC 4M6ML 1G7HA 3IT8D 5I1AA 2D7TH 4GQ9H 1K8DA 5T1LB 5TPWH 1W0WA 4PV8A 3BUYB 4XAKE 1L7IH 3DX8A 4IOIB 3VG9B 5E2VL 3JTSA 5CD5C 1T0MB 1JGDA 2BRRL 3MUGA 2BCKB 1LO3H 1QFUL 4PJXF 2AI0H 3OG4B 4O4YH 3H9SE 2IANE 1N3NA 4N0RA 3BT2L 4LSTL 5L2KB 1KYOJ 5EPMB 4ZTPL 5GIRB 1JYWA 1YJDH 3AAZA 1RZKC 1RULL 2IWGA 4PJBB 3U7YL 3QEQA 1CE1H 3SO5A 2I9LB 3PNWA 4LKXA 3LMJH 1I1FA 5DZNA 5IEHB 3U82B 2HTLD 4OFIA 1T20B 4MCZB 1CGSH 5DUPH 3OJDA 1IAOB 2X4UB 1MRFL 5KSBB 1MHHB 2HLAB 1J18A 5JDSA 3ELAT 4WIQA 4NGHL 4UU9B 3DHJA 3RQ3A 4DGIL 1N5YL 2EDWA 3ETBF 1S7WA 3NCBB 1H8SA 2XTLA 4KROD 4R0LC 1IMHC 3P11L 3TGXA 3V0AC 4FQLL 1HKFA 5EZIH 5HDBF 3EYVB 4XNYL 1A0QL 1GVIA 3B9KC 5SV3A 3VWKB 4X7FC 3CVHA 3BPNC 5T3XD 5HGHB 4UUJA 4X9BA 5HHMB 1YN6A 3PHOA 3L1OH 4XB8A 2NY2B 5CBAB 1UZ6F 2Y36L 4M1DL 5GPRA 4JM2D 3L3JB 4JE4B 4LAQH 3TYFB 1LO4H 2DQFA 3GIZH 3PWJB 2ESVE 3VA6A 5IM7B 5DR5L 2BSSB 2SEBB 1QNZL 3B4NA 4KRMB 1TCRB 4L3ED 1ZAGA 2Z93A 1BIIB 1CBVL 3QUXB 1OGAD 1WBZA 4HX1B 4KKCC 4PGCB 1YEGL 4JG0L 3ARUA 1ZHBA 1C5DB 3RI5F 2D7MA 3NCCB 4KGJA 5D1QD 3CC5B 4PJAF 4R96A 5I18L 5EOTB 5K9KB 1D5IH 5L2JA 2AGJL 3QFDA 3QDAA 1HI6B 1ZSDA 4DKFH 3TVMA 3H9SB 3UTSB 2BNQD 2XN9D 4JQVC 1T0PB 3KYNA 5MERB 5AWNL 1QSFE 2BVPB 2NR6C 1T2QL 3U2SA 4MA8L 5HHQB 2Y23A 3FOMB 4QRRB 3MV7D 4P3DB 2JJSC 1KGCE 3B2VL 1CR9L 3RZWA 2DICA 1PJ9A 5I1LA 3DSNA 2D3VA 2XKNB 2WP3T 4FXGA 3FRPG 3MRJA 5J56B 1RUMH 5FKPA 3RDTC 4YE4L 1V7ML 4P0DA 1FL6B 1MFBL 5D7KD 1T4KA 2D7TL 3I2CL 1OAUL 5EBWA 3ULVH 2VRAA 2DM7A 3QG7H 1N4XL 1U91B 4W4NA 4OD2A 3RVUD 4AEHH 1K5NA 3OKMB 1FG2B 3G04B 3INUL 4ZXBA 4JFEA 4UDTB 5IVXF 5J12B 5JIIA 4R97B 1B4JL 4WW2B 4ELMF 3GSOB 5HGAB 4LU5L 3MOQA 4JM2A 3F7YB 3VG0L 1C08A 2WLYA 1FL5B 4M7ZC 3QO1A 4WTWA 3DNKA 3LN9A 1NEZA 2F19H 1JGEB 3S37X 2XA8L 4BFEA 1RFDH 1J05A 2Q7NA 3HI5L 2HFFB 1OAXL 2CMRH 1SJVA 3QDJA 3WNMA 5LBSL 4S1DD 2Z0BA 3VXNA 5CP7A 5F88B 1CTNA 2C3VA 2CKBL 2I07A 5CBEB 4OZHE 2BNUA 2XG5A 1RUKH 3DVNA 1YUHB 1NGZA 1YEHH 2KL6A 5ESAB 3DMMD 3SGJC 3FQUB 1FVDA 3L9RA 3OKLB 5ANMA 4UMGA 5D1QA 4CDHA 2XRAL 4HWZA 3ARDD 1D5ZA 4Y19E 4P2QA 5JW5A 4Q6YA 3LRSB 4IOFC 5B3JE 2ATPB 1Q0YH 1E6OH 1DE4A 5C09D 1RZJC 2O93L 3ES6A 4X7EC 2MKLC 1K4CA 3ARFD 4JO1H 4NO0B 5CMAA 4Z7UA 2UWEB 3NAAL 4LIQE 2DAVA 4ZFFB 3S88L 4Y89A 4IIQC 4BUGA 2QQKH 2D0GA 2Z8SA 1QFWL 3QNXA 2EH8L 2FIRT 3AREC 4HJGB 4XPFH 1IKNC 1BIHA 2DQTL 3P0GB 3LDBC 2DN7A 2GJ6E 3RWDB 2Z31B 5K9QG 1OWWA 1ZT7A 3TCLA 4Q74A 1FZKB 2W65A 3QWQB 3NACH 5D7SL 4LBEB 2FLRT 3UJJH 5L8KB 4R26H 3TPKA 3FB8A 4NN7C 3OF6A 4EN3A 2DLGA 3PV6B 3LKRB 3OR6A 1R24A 1LK2A 3OKEB 5ILTL 4LHUB 2PTTB 4U0RB 3T1FB 4CNIB 3PWVA 2VLMD 1FNSH 4JDZB 4BFGA 5IFHH 1RHHA 3L7FB 4P5TD 3T0EA 1A3LH 2ZSWA 5DURB 3S37L 2EIZB 2DQGH 5JUEL 3A6BH 6FABH 1ONQA 1X5ZA 2HRPH 2AV7B 2CLZA 5IQ7L 2PR4L 2R0WH 4HGKC 4ZUWB 3TZVD 3RIAF 5AD0A 1XGTA 1Z5LA 5EDXA 2YD7A 4Z5RA 5EN2B 3QJHB 3F6LA 2EDKA 2G60L 5A2LH 3VFSA 1RUML 5AZEH 1S7SB 3RWGB 4PG2A 2Y25A 2PW1B 3EZ8A 5C0NC 1IGIH 1JNJA 1A6TB 1NFDE 4RAVA 4PB9L 4XVUC 4JFOB 2E9IA 1WBYA 2NQCA 1UVQA 4NFBA 2NZIA 4JJHA 2H32B 5E2TL 5FYKL 4Z76A 4HC1A 5CEZH 5SWSE 1ZA6A 1AKJA 4Z7OE 1GAFH 1F5WA 2ZOKA 5HYSB 1J1PL 4P46B 5F96H 4JZJC 3VXSA 3GI9L 3D3VA 3C6LA 2R9HC 4TRPL 3EYFA 4F2MB 2E8ZA 4X8JA 4P4KB 5I76B 1RUQL 2ORBH 2XZQL 1E4XH 4QGYA 5BZWB 1T80A 3K1DA 4N0FA 3ROLB 2FD6H 1UWGH 3GSNH 3EFDL 3OKOA 3S8WA 3PWPA 5F1OB 2XFXB 3HC3L 2CPCA 3FTGA 4NP4H 1S7RB 3WBDA 3ZMRA 5J1SC 3KPTA 4FFYH 2R29L 2JIXD 1BBDH 2YS4A 3V4VH 4OCXL 3BHBB 4H20L 5DEFA 5DHVH 4GKZA 4JO1L 4YWGL 3IF1B 2M1KA 1PEZA 2OR7A 1MCLA 3AS0A 3B83A 4ETQB 3NFPB 4PJHE 1XGUA 2FBJH 3TZVA 2HVJB 1T89A 3FONB 1HXYA 3O3EB 1FVEB 4E9LA 4NN6B 4XPTL 4EBQL 2R1WA 2VAAB 4PP2A 4BZ2H 5LWYH 3EO1B 1CL7L 1MCDA 2X9YA 3OXRA 2K7QA 1MIEL 3GUTA 3OKDB 1SEBB 2V17L 1U6AH 2AJVL 3V6ZB 1TQCC 4JFZL 3CSYA 5ESQB 4KK9D 3CFJA 2ZOLB 4MNGB 2CLVA 2ICEB 4N5UA 4ODHL 3MGTA 2B0SL 2R1YA 3DIFA 4M7KH 4WFGE 5E8EA 1RK0B 2IALB 3DV6B 2AJSL 2KPNA 3EIFA 3ISWA 4DGVH 2P7TB 4XWGH 5IFHL 1CICC 4OQTL 1A3LL 4XVTL 3LIZL 3CX5J 5LAXB 1JZ7A 1AO7E 3D18B 4BSWB 2DYPD 1OSZB 4PJXE 3PGFL 1CFTA 4JHAH 3VXTB 5F7EL 5HXMA 1R3LA 4X7SH 4GKSB 3MGOB 3ESVF 3MLUH 1NBVL 4WNQA 1OTUD 2Z35A 5LGJA 1NGWB 4LPXA 1JPTL 2NYYD 3OAUL 4PRAB 2W0PA 5ACMA 4OCWL 3EBAA 2E8YA 5F7YC 1EV2E 4Y1AE 3A6CL 5LCVL 4BQ8A 5JPNA 3AY4A 4WU7B 4ZOAA 1S7QA 2UY7A 2D4DA 4JHZA 5DJXB 3BYYA 1AQKL 4O9HH 2V5YA 1T1ZB 3MLXL 1EERB 3W0WD 3I75A 4LCWA 5KOVC 2QQLH 3RVTD 3SDCB 2HA1A 5CEZL 1OCWL 5DUMH 4QY8A 5I1GL 2P42B 4UV4L 3CH8A 4JFDB 3S4SA 1XF4A 3L3HA 5KANG 4XC3H 2DQHH 3LS4H 1KCSL 4PJHB 2OTUA 3TO2B 3WS6A 1PG7W 5HDBE 1E28A 3WIHL 5F7FA 3UJTH 1U8IA 4GLRH 2YD3A 5IW3A 3A67H 5KSAB 2BJML 3RL1A 5CINH 2WW8A 2H6PA 4OLXH 1UZ6E 3V6FA 4CU7A 1G9NL 5F8RC 5T3ZL 2BSED 3CUPB 1DBAH 4GFTB 4Z7UF 1S7TA 3BE1H 4JR9H 1FFQA 5CJXA 4JEGB 1QR1B 4YDIL 3HCVA 1FLTX 4HHAB 5CJQL 4PJ9C 4ODSL 35C8H 4U1IA 2DJUA 1RZ7H 2DQIH 2VZSA 3TBYA 1H5BA 2WBKA 1KEML 1T6WA 2Y6SC 4V1DB 1NC2D 1BBDL 1MUJA 1OD7A 4NQTA 4FG6D 4FFWD 3UZQA 2X44D 2P5EE 2FB4H 3AXLB 1W72A 3LKNA 1T03H 4PJAE 1QEWB 2V7NA 4UT7H 2J5LB 4HPYL 4O02L 4QT5A 5D1ZD 4K3DH 4PJXB 4K7PY 2BDNH 4M43L 3FFCB 4ACPA 3GSWA 4G8GB 1UT9A 4XP6L 4Y5YB 1B88A 1P4LB 1VFUA 5FA4A 3G6JA 4J3XA 1V3MA 2BZDA 2F53E 4BZ2L 1F2QA 3OZ9H 5FO9B 3SY0B 4JO3H 2YD6A 3MRNB 5IK3B 2EKJA 1MCCA 1EO8L 5ICZA 4WI5A 2XKUA 3U83A 5E1AA 3PP4H 3BDYH 3EYOA 1CXHA 1A1MA 4N8CL 4P23A 2AQ1A 5IG7A 2X4SA 3EO9H 1E6JH 3RY5A 2P8LA 1VB9A 4OD3H 5C0BD 3E8UL 2HVKA 3FT4A 3S34L 2FIKB 4HT1L 1ADQL 3ZHKA 4LOUD 4CDGC 3CDGB 3P4MB 5F3HB 5FM4A 4R2GB 4LKCB 4AENB 2EDDA 5DYOA 3QIWB 4FZEH 5I75B 1BFSA 2E7HA 4WI2A 5ETUA 2OSLB 4OSUH 4XCYB 2D31B 2RBLA 1AC0A 5FHBL 1MCWW 3B9AA 4LIQH 4OZ4B 3CLFH 4XVJL 5IVXE 4IRJC 3KDMA 4PGDA 1I1RA 4I48B 3S35L 4ELME 2J88H 5T1KB 3JWOC 1GSMA 5D2LB 4P5TC 3ROOA 3EOAA 2HKFH 1CD9B 5FGCB 1L9NA 4RISL 5DD1H 3GRWL 3F7VB 1QLFA 2VZTA 4NYLB 2BSRA 1RUPL 1KEGH 1I8MA 2VUYA 1TVBA 1CL7I 1QSEE 1QBMH 4PBWD 3KJ4B 1WFNA 5J1AB 4X9GA 1KXQE 1MCWM 3ME0A 2WLZA 1NC2A 5F9JB 2BRQA 4J8RA 3U46B 4LCIH 4ZPTB 4EI5B 4JJ5B 3QRFM 3LD8B 4G43B 3W2DL 1SHMA 4UI2A 3VD5A 5B3NA 3TIEB 1T7ZA 3U6RA 1NSNH 3Q2CA 1Q1JH 3NGBB 3RPIA 3W39A 5HGGS 5T5NG 4GXVL 4QHLA 5BW7C 3KGRA 4OLUL 3QCVH 4Z0XA 1WUNT 5CHNB 4IOSD 4Y2DD 1U93A 5CAYB 3HB3D 3U9UB 2OMNA 2V5SA 4GQPH 5EO9A 5GXBB 3BP5B 3MLTA 3LZFH 2NTFB 3MRLB 3V5HA 2VLRB 3TV3H 3EDDA 2GSGA 1EEZB 2OL3A 4QF1A 1QLEH 2VXUL 4XVSH 5KJRH 1HEZA 2X1OA 1LGVA 4U1KA 2VKWA 3EZJB 4WFED 3VFWB 4KU1A 4U1SA 2FB4L 1JPFB 1ORSB 5F1NB 5F8QC 1P1ZA 4UT7L 1NGYB 3IDNB 4I0KA 4K3DL 5HHOA 3KPRE 4I2XA 4YHLL 1ZVHA 5IVXB 3G08A 2V7HB 4LEOB 1QSVA 2EXWD 3U7WH 2B2XL 5DJ8B 4U1GB 1OTTD 4JO3L 5BVPL 1ERNA 1TQBC 5FYJU 5H8DA 3U4EB 2HYMA 3CLEH 4M61B 2BNRA 1KLUA 4WI7A 4JFYA 2ZKHH 4LSUL 4QTHB 4POZC 5C9KA 1BD2B 3TFKC 4PY8I 4YK4B 5E6YA 2NXZD 1I8IA 2FJFB 3V6BR 1UWXK 2YD1A 3WUWG 5CEXA 4NKMA 2X4RA 4N90D 4XCEB 5DEGA 3VFTB 1E4XI 3RX8A 3S3PA 4FQQA 3VI4F 1KNOB 4OD3L 3X3GH 1P7QB 2GITB 1Q9KA 5I9QC 2PUQT 3ARXA 3QEQE 3GNMH 3M17A 5FA3A 5E2UH 5EZLA 3NVQA 1Q0XL 4U1HB 2C1OB 3SGKA 4X4YB 5C0CD 5C0AB 1QRKA 4OSUL 3O2WH 5ADOH 5ALCH 4JG1L 2CQVA 3GMOA 3CLFL 4NQSA 3LSOA 1A7PL 1JRHH 3EUUA 4YHIB 4GRLD 1ZLWH 1EFXA 4IJ3B 4Y2DA 4TSAH 4PRPD 2IMMA 3VRIB 2P1YA 3BP4B 3FO0L 3DETD 1FH5L 1AJ7L 3FHAA 4KMLB 5FYLE 1R3HA 3D6GA 3MBEA 4P5MB 2FO4B 5DK3A 4YDKL 3CDCA 3ARGD 5JW3H 4G6AD 3BRGC 1ZHLB 2AEPH 2HLFD 1RK1B 2FJGA 5CIPH 5C0IB 3P40A 4K8RC 2DQJH 1CZ8H 2FX9H 3TWCL 5D70H 1A6WL 3GMRB 4M48H 1KB9K 1NCWH 2AJUH 3TA3B 3SBWA 3F7RA 4PB0L 4DZBA 2LE9A 1OP3K 4X80L 5GGQL 4NDMB 4G6JH 4F80A 2P5WD 3QEGH 1FYTD 3DUUB 2HG5B 3L6FB 3VMNA 4OM0H 1K2DA 3C5JB 4GAJH 4TULH 3R4DA 4RGMB 4AIXA 1S9KC 5IJVA 2EE6A 1IGMH 2YA1A 4PRNA 5CLWA 4OGYL 4LSQL 1A7QH 4MNHB 1KIRA 1ORQA 1O0VA 3JUZA 3D0LA 3T0AA 2Y06L 1CQKA 3HR5B 2JCCA 2EO9A 3PWUB 4Y4KC 3VCLA 2AXFB 5BOPA 3C8KB 1UKSA 1JK8B 1NMBL 3O2VH 3TNNB 1HHIA 3ULUF 1A9EA 4HWBA 2AERT 3BZFA 2W92A 1VGEH 4LRNL 5CZXD 3G6JF 3FN3A 1QLEL 1IT9H 2GUOB 1S9XA 4XVSL 1FDLL 1KULA 4JY6A 1BBJA 1KB9J 2HP4A 5H35B 5E8OA 1UKQA 3BGFB 4Z78B 2P4AB 5I8CA 1RIUL 4WUUA 1N0XH 4WHDA 5D1XD 4YO0A 1VSCA 2MPAL 1C7SA 1G7PA 4PJ5B 5JXAH 4LLQA 3MOBH 4Y4FA 2Q7YA 4GRLA 4LGRB 4I77L 1U3YA 4XI5C 5JO5B 1JZ3A 5L7XL 3GEWB 4PRPA 4W70A 1CDJA 4U2ZA 1KB5A 1A21A 3Q6GL 1EDQA 2C3HA 4L9DA 5GSVB 3BVNB 2IFFH 3QUMH 4GLRI 1B4RA 3Q6FA 2VERN 5B21A 2A74A 4BUHA 3DSFH 4GG8A 3SKUD 4F7CB 3KS0H 1WGOA 3ARGA 3C08H 5IMOB 1Z9SA 1BQLL 3X13B 1FNEB 1SJEB 4JFEE 3BEWA 2VR4A 4NC2B 3CH1B 5EBLA 5T33H 1TZGH 4HUXA 5HSFA 4HKBA 3AU1B 5CJBA 4AMKL 4K94C 4GXUN 1LP9A 4LCCC 5A16A 1OF2A 3GM8A 3N9GH 1FYTA 4JLRA 1UB5A 1V3KA 3QDJE 1OPGL 1HSBB 2B1HL 2X4OB 4G3YL 4AIZA 5IW6A 2DD8L 4GKOA 3RL2B 3SDAD 2CO7B 2X7LA 1NCDH 1E4JA 3FQNA 4WY7H 2RQ8A 1C12A 5E7FA 3OJ2C 4MLSA 4TSAL 1T5XA 1MQKH 4R0LA 3P0YL 5ANME 5EU4A 4WJ5A 3EW3B 5DLML 1FNLA 1UH2A 3R06B 1KN2H 2NY1C 2ADFH 1J8HB 4P2QE 1BAFH 4TNVF 4NJAH 1UXWB 4U6VH 3B9KA 4ISVA 5D2NC 3MV9E 4HGWA 3RKPA 2VDQH 3UC0H 2CJUL 1D9KB 1PBYA 5D7LA 3TBVB 4PJGA 1HKLL 5HI3C 5DRNB 2QHLA 3FB7A 4Z7UE 4I4WB 1MRDL 5DRWA 5B4MC 2AJUL 2F5BH 2DDQH 2AXGB 5D1XA 3IDGA 3PJSB 3RWFA 4DKEH 2ICWA 4XGZA 5K9OA 2VWEE 4Z7VB 1G0XA 2AJXL 2W60A 1L6XA 4NKDB 5HHNB 2CIKA 4JPWH 1KTKE 4OZGB 4TQEL 4TTDD 3ZO0A 4P5KB 5FV1L 5I1EL 2C1PB 1MELA 1D3CA 3P4LA 4N8PA 5IBLD 3U0PA 3VFRB 4ONOA 4Y5VA 2VL4A 4JQVA 4FFVC 5BXFB 1CFBA 1G9EA 4JKMA 1UQSA 3VH8G 1DQTA 4X7TA 1MRCH 2FH8A 2G9HA 3T0EE 2JJSA 4TN9A 1VENA 4YDJB 1RJLB 2ZUTA 4N5ED 4HKJB 5CZVL 4S11A 2V9TA 3U0WH 3MA7B 3GGWA 1S7UB 3FOLB 4OF0A 4MA1C 5TQ2H 4RGNB 3O6LL 5HI4D 4NRXB 4FOMA 5KSUA 3RDTA 1BPVA 5DD0L 1MCRA 2OTWA 3MOBL 1IBGH 4QXTA 5DQDH 3SDAA 1WC7B 2Q3ZA 4KK5C 4QLRA 1MWAA 5D7JB 3HZYB 3F5WA 4NQVA 3F7PC 1BHGA 4Z9KB 3RVWC 4Z95H 4GSDL 4XBGA 4W6YB 1A7BA 3VFUA 3RKDD 3MV9B 5IHLB 2X6MA 2LFGA 4PG9B 1BVZA 4IDLA 4RWHA 3MCKB 3P9LA 4KQ3L 4NT6B 1X7QB 1ZLUH 4OZFH 4L8CA 2O26U 2V5RA 1IM9D 2EC9U 5BZDA 4ZUVB 1FJ1A 3KLDA 5SX5H 3GB7B 1RU9H 5ISZD 1OB1A 4DVRH 1XH3A 3QDGD 4XNXH 3PHQA 4HKZB 3VXSE 2D9CA 2ZP0T 1IM3A 3D3VE 4QTIH 4XBEL 3H3PL 3MJ8B 3HA0A 1CU4L 4EIZC 5I0DA 4NNYB 4QRUB 4K7PH 2LU4A 3RNKA 3WFBH 4QHMB 3WD5H 3CJJA 3SGJA 3MNVA 2HFGL 1U58B 2FEDC 4YDVA 2X70B 1HHKB 5KVFL 5JNYB 4OKDA 5E8NA 2CDEB 5EUOA 1MHEB 2WWMD 5DRZB 3RWJB 1UM6H 3P3YA 3WLBB 3PWPE 4BQ6A 1FO0A 5TJWK 3BESR 5IF0A 2F54A 3SGDH 2VLKA 4MHHG 3GMNB 3KLHD 1VA9A 5DI8B 3GJFH 2FZ3A 3WKNA 4NPYB 3BYTA 1A6ZA 4LLMA 1OAQL 1RUAL 3T2OA 2ZUQB 4HIXL 1NQBA 1U8QB 2YKLL 4X5XA 5CCKL 2ID5A 3SQOH 2W9LA 2JCCF 4G6AC 4M8QA 5DRXB 1X4ZA 2WM0A 3JV6A 4ZUSB 1PQZA 1RIHH 3MYJB 3LEVH 2FX8H 5JZ7D 4OLZH 1RURL 2D0FA 7FABH 4J7RA 3B6SA 2CDGB 1SJHA 5DWUL 4J1UB 5L88H 5EBMA 2AK1H 4E41D 2EDLA 3IGAB 4K7PX 5GS1A 4NO3A 3CZFA 2EC8A 3SKMB 5E5MB 1FLRH 1JHTA 4FQXA 1H3VA 2R0KL 1JRHI 1LK3H 3OHXA 2NTSP 3EHBC 1LO5B 2IF7A 4C59B 1K8IB 5IKCA 4WHTA 2A77L 3HLAA 4PS4H 2IC2A 3BEVA 4PBVC 4UTAL 4HIEA 2AJ3A 5FUZH 3X11A 5HYIA 5I66A 5E2JA 1GC1H 2CIIB 3VE0A 1A5FH 2AQ2A 4GBXB 5EOQH 5CGYC 5B39B 4BH7A 4K3EL 4MQSB 1CLOH 1VEOA 4F7TA 3QISA 5CZXC 3VI4E 3D69A 4A6YA 3EGSB 2YRPA 4RNRA 2NY2C 4U6HA 3VXPA 2Z4QA 1NKOA 3PDGA 1CFVL 1P4BH 3E2HC 1IL1B 4R4BB 2HH0L 4RRPG 3QJFA 1F4XL 5DJCB 4DTGL 3RAJH 5I1DA 3MLSL 4UT6L 2PCPA 1HQ4B 3D5OF 1LP9F 5ICXB 2C7UB 3QUXC 4KRPB 1P9MC 3GSNB 4HJ0C 3F12A 2FHFA 3I02B 4UBDC 1N6VA 1MCBA 4FQ2L 3MRPB 4PJDB 1LE5B 4OD1L 1IGTB 4ZYKA 3MV01 1I1YB 4NQUA 5DHVB 2PXYB 4G42B 4OZIA 3N85H 1ZLSL 2YUWA 4UAOC 3VXRE 4XNMA 2BXYA 1J0HA 3O4LD 4Y5XB 3T65B 43C9A 3JTTB 4YQXL 4EI6B 3QDMA 1X3DA 4P2OB 3ALXA 4XP1H 3D39B 4E41A 3QHFL 4QO1A 2E7MA 1ZEAL 3O11A 4BZ1H 5EC1A 1DP0A 2YEZA 3HE7B 2V5MA 5DK2B 4JFFD 2YD5A 2FGWH 5BRZD 4X6FA 5T1MA 5L8LB 3G6DL 3IKCA 1T22B 4LSSH 3RIFK 4RGOH 5MEND 4ZSOA 5JHDA 2CLRA 3TH2T 4X99A 4PBXA 4X5LA 5IFJA 4CW1A 1JUFA 1YECH 4MXWL 3C5ZC 2DM3A 4OLVL 1M7IA 3ULUE 4G6KH 1MHCA 4KDWA 4N0CD 1YY8A 2X4TB 4WW2C 3G6JE 5HI5D 1VPOH 1EGJH 1DBKL 4PY8J 4JHBA 4CJ1A 1E4WH 4OLZL 3D85A 1SEQH 2WINB 5HGDB 1EVUA 3LQZB 3GSUA 4OFYD 3U79A 1N6QL 1LEGA 4LEXL 3V52L 2FEEL 3IDIA 5J8OA 5J06A 5H2BA 1BECA 1EMTL 4HUVA 3VFMB 5FO8B 3GMLA 1RI8A 1S78D 1EEYA 3WNOA 2WAHA 4OLYL 4YEFA 3D1MC 3LPWA 1WITA 3T3MF 1CICA 4N0YH 5FYLL 4RX4A 5KVGL 5FUZL 2IPTL 4YC2C 5I16B 3V6OC 2CUMA 4FQJL 5IB3A 4ZAKB 3CPLA 3DV4B 1E4KC 1HHHB 4EUPA 2VL5B 5EWIL 2DI8A 3CVHL 2BOCB 2X4PB 1WTGT 3VXQB 4F8QA 2IG2H 1BWMA 3KPSB 2R2BA 4AQOA 3O4LA 4ZS6D 3VXRB 1DUZA 3QI9D 3RGHA 1PW3A 5AAWA 1AE6L 3IDJB 4U4BA 3WIFA 3QUZD 4G8FA 1QO3B 2NY5L 3IFNL 3WFCH 1T7WA 3D2UD 5CILL 3TBSB 4XAWH 1NGQH 4X98B 4IRSB 4JKKA 4PRDA 1LO0H 2YA2A 4PLKC 2Z31C 4JFQB 4LCUA 1MOEA 1MJJB 4GG6B 3SKOA 4YHPA 4FXKB 4PRIA 3CFEA 3C2SA 5F7WC 5IVZB 2OR9L 3BMVA 1JMZA 3GIVA 2IQAB 3FT3A 2N4IA 1D5BA 3NABL 2ZWLT 3VDBA 1T21A 5DQ9A 3O3BA 1T0NB 4KK6D 5EUOF 2QADD 4HWNA 1I3GL 4H25B 5DJ0A 1A1NB 1PD6A 1BFVL 5AYQA 4KVCL 1FE8H 1R3KB 1A4JA 2ZUSA 4BFIA 1FFOA 1A2YB 4MNQB 3RP1A 3MLVH 1MJUH 3PUCA 5BS0E 2VN7A 1MHPL 3EOTH 1M71B 2A73A 2VLJA 4MS8D 1MJ8L 4PJ9A 4NFCA 5IMMB 4MJID 1C8PA 4LF3B 1C5BL 5F6IC 2VZ3A 2A6DB 1YC8A 4IHOA 4AL8L 3VFPA 3ZYOA 2F5AH 5EU6E 3PIQB 4DCQB 3EOBA 3RA7H 2APVA 1TZHA 2VNCA 2FHCA 3BFOA 2QQNH 5ALBL 4LASL 1U3HB 2DF3A 2GK0B 2GTWB 4GMTL 1WWBX 3WSQH 3E6HB 4I2XE 1DDHA 1KPRA 5DMGD 1SVCP 1ZLVK 3KLHC 2FR4A 3FQXA 4GRMB 1ACYH 1OM3L 3T77A 3MV8D 5FKAB 3RZCB 1S7XB 3A0OA 5E9DA 1XR9B 5IP4A 2HJKB 3BQUD 3KYKH 3D2UA 4NQXB 4JGJA 2BNRE 4P46C 5HYJE 1G6RA 2L4OA 2AEQH 5E6IB 3K8MA 1YMMD 2R2HB 1IQDA 3BDBA 3VW3L 2A0LD 1GJIA 1XCQA 5GS0C 5I71C 4S0TD 1CDUA 1MAKA 4ENEC 3DVGA 3BPCA 2B4CC 3RWHA 1YEIL 2XTJD 4MMXC 1HOCA 3SGDI 3TNMA 3O2DA 1R3IH 5GGTH 3E1F1 2VLLB 1J87A 1GOHA 3U4BL 1F4WH 1KBGL 3HC0A 3SE3A 3V79C 3MLPA 1BGXL 4XHJC 5GSRA 3KHOA 4MAYB 5BV7C 4EQ2A 2BVOB 3MROA 5BS0B 3HMWH 3FCTA 4NN6C 4JZNA 2EYRA 2MOVA 1MREL 1NGQL 4XP9H 1QZ1A 1HH9B 5EU3A 2HKHL 1T83A 3QG6B 1CFNA 4GRWF 4OZIF 1U0QA 3IYLW 4QCIB 3H9HA 5EU6B 1M4KA 1SVZA 5KTEL 3WXVL 3O6FB 2V6HA 4EDXA 4JO2L 1SMOA 1N8ZA 4XCCH 4TSBH 4KJPC 3HI1A 1U8PB 3THMH 2W0LA 3UX9B 1MEXH 3OKYA 2QSVA 4P9HH 2GK2A 4FQCH 4OF3A 3HNSH 3PQYA 4ORGA 3KPLB 5F1IB 5BW7A 4YHZH 5I1KL 2J8UA 4RA0C 5E4IA 1AXTL 3RPKA 3QIBD 4FTVA 5JHLL 4JRYD 4XC1H 3O9WB 1ITBB 3BQUA 3IFLL 1XIWB 1EA9C 3FRUB 1T1XB 4NKIL 1FGNH 3TN0B 5HYJB 4LHQB 2HT2D 4RMSA 3TO4B 3QFJA 2JCCE 1DSFH 1QPXA 1P7HL 1H15A 3Q48A 3DO7A 3FB6B 3LHPL 4JDVA 2GT9B 5BQ7B 4WUKL 3MLYL 2Q8AH 4GAFB 1OAZH 1VHPA 4NRZA 4BH8B 4M6OH 5EU5A 4X6BB 1JV5A 3STLA 4YBQC 4JPKL 4XXDA 5EUKA 5DUBB 4LSPH 4QXWA 3VWJB 4ZO7A 4OUUB 3BIAX 5GZNC 1GGIL 2V2TA 5F72S 3SPVB 3QCTL 1QLRA 4HWEL 5E4EC 2IGFH 5IOPB 2OZ4L 1NFKA 1YEFH 3QXWA 3WEXA 1QFPA 4WUUE 2I9TB 4HC1L 1ZE3C 3ARBD 4FMKA 1M1SA 2EIBA 1T5WB 4Y8AA 3SDCC 1ACYL 1PZ5A 4IBLT 3L3GA 3IETB 3QSKB 3O6KL 3UZEA 5DHXB 4HS3B 1IJ9A 3K80A 4FP8L 3ZL4L 3HG1D 4HF5H 1QPPA 3DXAB 3TEUA 3UP1A 1XF1A 1BZ7B 3GSQB 2YPVL 2UVFA 2UY6A 4OLWL 5JOPE 1A7RL 1U8OB 4NQEE 1MCOL 5HI5C 4KGLA 1M6OA 5KSAC 2Z91B 1MI5A 1Q72H 3RWIB 4KJYA 1MIMH 5DJYA 2GY7B 5T5NF 2EIEA 4PJEB 1LILA 2BOBB 3BWUC 3SE8L 2CGRL 3CMOL 1S7VB 1FZOA 3WFEH 5I6XB 2H45A 4QRPA 1AI1L 3I3DA 4Y16B 5IROC 5FDWA 4LVOB 5CIPB 4NQDD 4DW2L 5EFIB 4NM8H 4FNLH 1P4IH 1YN7B 3QWOB 3LY6A 1LP9E 5FF6A 4MJ2A 4P4RB 1OQOA 1I3VA 3IU3B 4AT6B 4G9FE 4RZCB 5D6DC 3PGDB 1W72H 4OM1H 4J3OC 4JRYA 4M7LH 3SCMD 3KPPA 1QRNB 4NO2B 5BO1H 3OGCA 5JQ6H 1JZ6A 3FKUS 2XA3A 4XMKH 3BGMA 3JWDL 2YBRA 5DSCA 1R0AH 3CXDH 4KI5C 4ZS6C 1JNNH 3OGOE 4S2SA 3VDCA 3JV4A 4M9PA 4EKXA 1FFNA 5CD3A 1OARL 3K8LA 3BOVA 5ICYB 1GZQA 4XPGL 5K9JH 3EFFB 4MCYB 4XPBH 3DX7B 5D7LE 1NCCH 4W81A 1PY4A 4L8DA 2F58L 3BKMH 4H1LG 4NJ9H 5MEPA 3Q0HA 4G8EB 1RJYA 4HPOL 2FX7L 2C3GA 1XCTB 5HYFA 3IFPA 1OW0A 1PVHA 4P57A 2NY0D 3TT3H 5I17B 2VABA 1IEBA 1NCBL 4FZ8H 4IRZH 4JB9L 2AK4E 4OIAA 2DQUL 3PABB 2WBWB 1BZ9B 4PRBB 4BQBA 1V3LA 1A8JH 3BIKB 2YZ8A 3GSXB 3MLZL 1UH3A 3QIWC 3RTQD 4TUKH 4NWUL 4RFOL 5C0RL 3DGGA 3ULSB 4OV5B 4MJ6B 1QUNA 4W6WB 2Q6WA 3SKNB 4KC3B 1F58L 2R69L 4HULB 2XACC 3KPNA 4BSJA 5INCB 1NCAL 3VXMD 5H37G 1Q9WB 3S5LG 4D0BA 5I15H 4NQEB 1F8TL 3P73B 2YPLD 4D9QE 2QSCH 4HCRH 3IU4L 2BY2A 4D0DA 1PX3A 5T5FL 1DN0A 1MCQA 3OR7B 3CAFA 4WEBL 2RIKA 2CDFA 2D7PA 2VXSH 5E2WH 1CE6A 4NWTH 4EEEA 1TVHB 1R5IB 2CUIA 1BLNB 3KJ4C 5IMKB 3UAJC 1MFAL 2KH2B 2P8PA 3LRHA 4B53A 4PP1C 4MD4A 4G9FB 5J6GA 4PLJD 3IDYB 4EI5C 3DBXB 3MYZA 3T3ME 3NBNA 3GBNL 2BHZA 4WEMB 5DS8A 1PSKH 3D9AH 3NCFB 4G7VH 3RVXC 4G6FD 1JP5A 2CK2A 3LKSA 3MXWL 2H3NA 1YA5A 2ARJQ 5FV2A 3MZTA 2ATKB 4RMRA 12E8H 1X4YA 2NW2B 5I1HL 2DLFL 3MRBA 4ONFH 5HHVL 2YMXL 4KHXL 1HHJB 3G5ZA 1U8NA 1BVLA 1MIML 1OY3B 1UJTA 2G2RA 1HK6A 4YHOL 4TVPL 5IB2B 1J7VR 1W0VA 1IGJB 2HN7A 1EK3A 3TIDA 1I4FA 4Q9QL 3C60D 4HS8H 4NHCH 3U9PH 2IJ0C 8CGTA 1B6DA 3B2UC 4LCCA 3UTTA 4NM8L 1IQWL 3KYMB 4YGAB 3R8QA 4WO4D 3RI5K 4ONGH 2OXHA 2AK4B 1HILA 4DZ8B 5F7LB 2HT3C 4NO5B 3ULUL 1DEDA 2EXYD 5BO1L 5JQ6L 1UYWL 1VFBB 2ZCHL 4G6MH 4KJQC 4Q7DA 2J8HA 5EA0H 3QQ3A 1UEYA 2PO6B 5EUOE 1IC4H 4Y8DC 3NCEB 1J9CT 4JN2B 3KS0J 3P0VL 1I9RL 4QKXB 2VDLH 2F54E 4U1GC 4U1JB 2VLKE 4UILH 4XP5L 4YDLB 2J8UF 3LB6D 3B3IA 4KVNL 3NFSL 4Z77B 3UPRB 1NCCL 2BVYA 3KYOB 5H94A 3VGFA 3BP7B 4HMEA 2E27L 4OKVA 3L5HA 4XNUH 2F74B 4QYOB 4YK4C 4AH2B 4ZO9A 2BMKA 1ZA3B 3NCMA 4L1HA 4XMPL 3DRQA 4NKQB 1VADA 4NZRL 4IRZL 1EEQA 3IJHA 4JN1L 3SJVD 1D6EA 1LDPH 3QRGL 3VXUA 4MXQC 5D7IA 2CRZA 5E70A 4PV9B 4R4FL 3TJEH 4N0UA 2CR3A 1XGRA 5TE7H 4RRPA 4LDEB 4OQ1A 3IS1X 3BX7C 4APQD 3QUYD 4XX1E 5DJAA 1OHQA 1KCKA 2DL2A 3QXAB 5I1JL 4QRQB 3LKQA 3SO3B 3I84A 2YK1H 4IJ3C 5E56A 1YEKL 4KJWC 2G5RA 5DMIH 3CSGA 4UTBH 2NY4B 5F1KC 4YHKH 4TNWF 5CJOL 3SE9L 3C60A 4M7ZB 2IAMB 4L4VD 2LTQB 5FCSH 4GW4A 2IH3B 1EBPA 2VXSL 2MQ0A 1EXUA 3PDOB 1H3TA 3MUY1 1G0DA 4NBXB 5L2KD 2H2PD 5GGSA 4E42B 4XNQA 1FCCA 4RAUA 3L5IA 2I27N 2P45B 3L3DA 4GS7B 1AGFA 1FGVL 2NY7H 3IXTB 3TA3C 1T3FA 5JXEC 3FT2A 5INDB 1MSPA 2AABH 3MLWL 3LN4B 5C8JB 2CD0A 1FZMB 4QOKD 5E7BA 5FB8B 1GHFL 2FH6A 3IFOB 3BN9C 2A83A 1UACH 1ACZA 3O8XC 4YUEH 4L29A 1S3KH 4JKWA 3O41B 3RBSA 4IS6A 2OJZH 1ZGLA 3FAXA 1CDCA 4PIRF 1ZLUK 5GGRA 5DF0A 4G80A 4NQCB 1MFCL 3OMZA 4IIQB 2VITB 5I19L 3L3OB 1MCIA 3QR2A 5CEZD 5KS9A 3SKJH 1BQHG 4X6DB 3AREB 1OQXA 2OL3L 3GJFB 4HIHB 2ITCA 2EC9T 4GRWE 4OZIE 3VWKD 1KG0B 4JAMA 3B5GA 4MWFB 2YSSB 3D48R 5TF1L 4UQ2B 3BXNB 5HHMD 3HE6C 3JSSA 1DLFH 3HZMA 1Y0LB 4GW5B 4O51A 3QDME 4P2RA 3IJYA 2Q3AA 3F58L 1TJHL 1DQQA 1U8HA 1YNKL 3BGFC 1F4YL 4LARL 1A6UH 4PJ8B 5T3ZD 3JUYA 3RHWF 3VU2A 1UM5L 1X5HA 3WLWD 1IC5L 2J2ZA 2DTML 3BKCH 1U2CA 1G7IB 4X6EB 1KB5H 3SCMC 2GAZB 5T1LA 3DX9B 5LXGL 3UYOD 4J3UA 1T7XA 3L5XL 4UILL 2G5BB 4ZSOE 5JHDE 1CGVA 3BUYA 1F90H 4IOIA 4WWID 5GISH 1T0MA 1S5HB 2OMBA 2BCKA 3TYGL 4B41A 1XR8B 5E5RB 3Q1SL 4YNYB 2UVEA 1DQJB 1NDMB 1RZKH 2YRZA 3H9SD 2IAND 5L2KA 3WNKA 5EPMA 3ZKXB 5GIRA 3EAKA 4XPHL 4B7LA 2HWZL 4PJBA 4S0SD 4UZGA 1NH6A 1LDPL 5E99H 2I9LA 3RNQB 5IEHA 1UA6L 1T20A 4MCZA 1IAOA 2X4UA 4RFNC 5TE7L 3X3FH 5KSBA 1MHHA 2HLAA 3G5YB 3H7BB 5JIPA 2JF1A 4UU9A 3RJDA 4ZG1A 1F6LL 2A6JB 5DFVC 4U7KA 4ODUB 1FG9C 4OF5A 4NC1C 4FQ1H 1LEIB 3N06B 1MJ7H 4OIIL 2VKXA 1S9VB 3DECA 3EYVA 5C3LD 2BVQB 1OD9A 3VWKA 4JZJB 5FXCH 5HGHA 5SX4H 2GHWB 3WIHA 1D9KC 4KK8D 4CVUA 5CBAA 5D93B 4AG4L 3L3JA 1JHLL 3TYFA 4S1SH 3DYPA 4ZD3L 1R5WB 2UZIH 5IM7A 2BSSA 2ESVD 2SEBA 4PTTB 4O00A 3SDYH 1W8NA 4F58H 3MRKB 1TCRA 2R0ZH 5E95B 1BIIA 3QUXA 4MD0B 1II4E 1P9MA 3CFCH 3NIFF 4BQCA 3FL7A 4HX1A 4PGCA 4HUWB 2IQ9L 1GIGH 2VDOL 1I9JL 3LKOB 5I8EB 5J11B 1I1AD 1C5DA 4KTEL 1T04B 3W9DB 4PRIE 3HZKB 3CC5A 3TH4T 5EOTA 4BZYA 3P9MA 5TDNB 5K9KA 4HWBL 1KXVC 5DO2D 1DN2A 3ULVC 1HI6A 3UTSA 3H9SA 4KHTL 2BK8A 5MERA 2BVPA 2MFNA 2B5IB 3H42H 1QSFD 4MAUL 5HHQA 3L7EB 5AYUH 2FCBA 5L9DH 3FOMA 4PPTA 4K9EL 4NO0D 2YZ1A 3J7HA 2HJFB 4P3DA 4QRRA 1RZFH 4L4JA 4AY0A 3BSZL 4LP5A 4XCNB 1KGCD 4IDJH 1SM3L 4JDTL 1KT2B 3FO1B 2XKNA 1AR1C 2YC1B 4RGNC 1XFPA 4L3EB 5CSBA 3MMEB 1MWAH 1FL6A 4D9LH 1OGAB 1QKZH 2P43B 2VXTL 3W81A 1Z2KA 3PXJA 5EORH 2ICES 3ARYA 2JELL 4S1RL 1WFTA 1ADQA 1U91A 5D7IF 2Q8BH 4P48A 2W91A 3UBXB 3OKMA 1MLBB 1FG2A 4CADB 1MCPH 1P5UA 1RZKL 3G04A 1U92B 2BNQB 2XN9B 4OCSH 4UDTA 5F44A 2DS4A 1ED3B 4WW2A 3GSOA 4U6XB 3QB7C 3VGHA 5HGAA 4R90L 4Z7WB 3F7YA 5EU7C 4HG4K 1FL5A 4WENB 1V5JA 5DJ2B 4LQ1A 1I9IH 3MV7B 4R6UA 3FZUD 4L8SC 2PYFB 1JGEA 5FHAH 3O0RH 3OPZH 5E9DE 1Z0MA 1JWMB 3QIUD 2HFFA 4TVSa 4K71C 3R0MA 5D72H 5F88A 4A2LA 2NCMA 1Z3GL 3BKJL 3VGDA 5CBEA 1CT8B 4B7IA 5ESAA 1CD1B 4KDVA 4EXPX 43CAB 3FQUA 4DN4L 3OKLA 5ITBH 3MCLL 4XXCC 4G8IB 5I8KH 3X17A 3V6OA 3MNWB 4QHNB 1KCUL 4Y19D 3LRSA 4ZO6A 1EAPB 2ATPA 4D8PB 3I50H 3PL6D 1NDGB 3K2UL 5TE6L 5D4QA 3ZSTA 3BD4A 4WWKD 4OCMC 4KAQH 1QSFA 5F97E 1QBBA 2ADIB 3CFDB 4NO0A 2UWEA 1BFOB 2WIIB 4ZFFA 4OFKA 3K74B 1YEJH 3LQAH 4UINH 2NXYC 4C56E 5CUSH 1I7UA 1KJ3L 1G7JB 3MUHL 1UCTA 2W0FB 2ZUQC 1F45A 4HJGA 3QZWG 5AD0B 2DLHA 1BFTA 3MRCB 3KXFE 1I8KB 2FSEB 4HK0B 4WV1B 3RWDA 5I8OL 2Z31A 2GJ6D 1FFPB 4P4KD 2PKDA 1FZKA 2EICA 3WUWB 2Y7QB 1JN6B 3DMMB 1VESA 4LBEA 4HJJH 5EOCL 1QP1A 2QV2A 5EZOL 3MODH 1SJXA 1VCAA 4G7YH 1NLDH 3ARDB 4JREB 3AMKA 4NM4H 4JVUA 5HY9B 2PYEE 3EDFA 1MFDH 4OF7A 3PV6A 3LKRA 2ZCKL 5F9DC 1LNUB 3EDKA 3NFNB 2NNAB 4RQQB 3OKEA 5C09B 4LHUA 4U3HA 2PTTA 3T1FA 3PQYE 1NMAH 4CNIA 4C57C 4XB7A 4JDZA 2J8UE 3ARFB 3K0WA 1J5OL 3C5SB 3L7FA 3LS5H 1A14L 1G9MH 4FTVE 2EIZA 1YQ2A 1MNUL 5IFAH 2AV7A 2F15A 3VFGL 3WFDH 4BFBD 4ZUWA 2ZOKB 4A6YH 5D9SB 3MJ7B 4EJ1C 5EN2A 3QJHA 4Q6IC 3QFJE 5C9JB 1NLBL 5CFHA 4D3CL 3MRGB 1KC5H 5E94B 1S7SA 5TDPB 1IZKA 3CDYA 3VFNB 3MRFB 3RWGA 2PW1A 2OK0L 3PE9A 1A6TA 1XEDA 5IWLA 3ZYIA 1EJOH 2RAMA 5K33A 4M3JA 2Q8BL 4JFOA 1MCKA 3AROA 3ZTNL 1DBJL 5C0JB 1LO2H 1UGNA 5KSBF 3M45A 2H32A 3V5DB 5KW9L 4F37F 4IRJB 5L6YL 4QRTB