3TGXA

Il-21:il21r complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
208
structure length
208
Chain Sequence
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVQITDQSGQYSQECGSFLLAESIKPAPPFDVTVTFSGQYQISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the interleukin 21 receptor bound to interleukin 21 reveals that a sugar chain interacting with the WSXWS motif is an integral part of the interleukin 21 receptor.
pubmed doi rcsb
molecule keywords Interleukin-21 receptor
molecule tags Cytokine/cytokine receptor
source organism Homo sapiens
total genus 35
structure length 208
sequence length 208
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tgxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tgxA01
3QHFL 4N0YH 4S0TD 5IV2A 1AXTH 1UADC 1K5NB 2P5WD 4L3CB 5T5NF 2DJUA 2IQAB 2PYEB 5T5FH 5FF6A 4RZCA 3ETBF 1J8HB 2IAMC 3IFNL 1J1OL 2QADD 1Z2KA 1NGXA 2IALA 2DD8H 3FT4A 5E8EB 3AS0A 1VEMA 1UA6L 3U0PB 3B2UC 4KK6C 3BZEB 1CGYA 2Q8BL 2E3VA 5IB1B 1J10A 5MP6H 3CXDL 1A3LL 3WS6C 5JW3H 4BSJA 4NO2B 4MXVF 3PWPA 2N4IA 1AQKL 1S9VA 5TE6H 5MHSD 1TQCC 3HLAA 3O3DB 2Q8AH 3MR9B 3QNZA 2VITB 4KJWC 2PUQT 1T1YB 4FQXC 4JY4A 5LJYH 4WU7A 2BMKB 3NIFE 2L7JA 1CYGA 4IRSA 3OXSA 5I8KH 1FGNH 4ZUWA 5F7KC 4KAQH 1MUJA 2H9GA 2P45B 3RA7H 2WK2A 3OF6D 2Q6WB 4ORGB 5F7DA 3WD5H 4CW1B 2GKIA 3WFCL 3GMQA 3RWEA 1KYOJ 1MIMH 3BESR 1RD6A 4M7LH 5FUOH 1J7VR 2DQIL 1YN7A 1ACYH 1QQDA 3H0TA 1BFTA 1I7TA 4JQIL 5I15L 3BH8A 4NDMB 4OD1L 1Q38A 1OY3B 4AT6B 3RZCD 2A9MH 3SJVA 1FPTL 2VLLB 3PGFL 3RIAK 3GSRB 2OBGA 4YGVB 3VFRA 5IJVA 3ILPB 4MJIB 1MVUA 4DK3A 1CCZA 1BZ9A 1AO7B 3FT2A 1QSFE 4CVXA 1JTOA 3KPPB 2WSKA 3QUML 1T2XA 1GGIH 1NGQL 1UZ8A 5D7JA 1VESA 5GGSB 4X6CF 4XVSL 2CKNA 4ZO7A 3GSNL 2NY0C 1ONQB 5GGUB 43CAA 4OSUH 3P9LB 2R56L 2BVYA 3UTZB 3LB6D 4XVTL 3WL9A 3FOLB 3VWJD 3GGWB 4I5BA 4HS3B 3GK8H 4YZFE 5FYJU 4HUVA 3UAJC 3VGEA 3WFEL 3OQ3B 1MSPA 2F58H 4FQ1L 1OAUL 2FGWL 4I3GA 4ONOA 5C09A 5TFSL 1OAYL 2ADFH 4H5SB 3HPLB 3QIUB 4R2GD 5CJ5A 4U6XA 2CLZA 2RB8A 1EUTA 2JB5L 2VDRH 1VFMA 4YFLI 5I76B 4L8DB 1UWGL 4JKPH 2G2RB 3L3OB 5LAXA 2JK5A 4AH2B 3GHEH 2PTUA 5I74B 4NGHL 2EICA 1XF1A 5JW4Q 4EOWL 1AHWA 3NN8B 1RURH 4HIEA 4TULL 5EDXA 1IM3A 5KOVC 1IAIH 1A1NA 1FE8H 2YR3A 1XGUA 1WAAE 4KY1H 5F96L 3FQUA 5KVMC 1PD6A 5IG7B 4U33A 3BPLC 4K71C 4M93B 4NT6B 2QLVB 3WUWA 1QSZA 4AL8L 2APTA 4Z78B 5J13C 5IP4A 2BOCB 1WLHA 4Y2DC 1CDYA 2CPCA 1X5GA 3L3HB 3C5ZD 3TBWB 1DEEA 4W4OA 4MXQC 3EHBD 4YDLB 5EU6D 1QA9A 3KPTA 1MCDA 3SOBH 3HZYA 5TE7H 1YEDA 4BELD 2OI9B 4ZS7H 3VXOB 4PJ9B 4NQCA 5E7BA 1IFHL 5KSUA 4ZQKB 3WFBH 1UM6L 3BDXA 3K74B 5C6TH 2RAMA 3EGSB 3QUZB 1NMAL 4X9HA 4RBPK 5FYKU 1ED3B 4X6CE 5C0JB 1X7QA 2V5TA 5IOPA 3U36B 1CGXA 1JGEB 3MRCB 4U6YA 1NC4B 5D1XC 4HUUA 1G0XA 1LP9A 4KUZH 1DSFH 3PABB 5C0CA 4ZOBA 4NN5B 1FFOA 4KROD 4PY8I 4J4PD 2GTZA 4U0QB 1KENL 3PGCA 3WNKA 5B3JF 4HFWB 3DXAA 4KDTA 5JXAH 2ED7A 1CFVL 2COQA 3FB8B 4WHTA 5I1IL 3ARRA 5HHNB 2PR4H 4Q6YA 5T1LA 5CEZL 2BRRL 5DYOA 2HRLA 5F9AC 3F7YB 4N8VB 5BJTB 5EU4B 4P5KB 3B5HA 4ZTOL 5L9DH 3E2HB 1NEZB 3IDMA 1OGAA 2W1NA 4OCXH 3UBXI 5BW7C 4I48B 5I66B 2ZSWA 3GSUB 3VFGL 3VFTB 3AUVA 1C7TA 4FXGA 3K3QA 1ZXQA 4PTTA 4Y2DA 4X99B 2HH0L 4IJ3B 4Y4KD 5F88B 4Y1AD 5TGBA 1FCGA 3LKRB 4UT7H 1ULVA 4DCQA 3MGTA 3UTOA 1EEYB 2FEEI 2ADIA 1A3RL 1EBPA 3PHOA 3SKNA 5IFHH 4JN1H 3WE6B 4OV6F 5ID1A 2B2XL 4X8JA 1QSFB 2VJXA 2AJVL 4PV9A 4JFQB 5JPNB 4P9HC 3H42H 1V05A 1WC7B 1ZE3C 4X6DA 3SE8H 3BRFA 3OKDB 5B39B 4U4BA 1EAPA 4JZNA 1YEIL 3BP5B 3MLTA 4GRLD 3G9VA 3V5DA 3VXTB 2YK1H 5D1XA 4MWFB 4PLOB 3HI1B 3WUWG 3SY0B 4ZO6A 2P47B 1KN2L 4KGJA 1OTSD 4OZGA 4F9LC 4E0RB 2E7MA 4W4NA 2AEQH 3KLAA 4G7VH 2NCMA 5I1LB 4PBVC 1MWAB 3RFZC 1RIHH 3WN5C 1NCTA 3MUJA 3RVWD 3PP4L 1D5IH 4DQOH 1UFUA 5CJQH 2ATPA 4KRMB 1VA9A 5EIIB 3VG0H 3ESUF 2X6MA 1BQHB 3IJSA 3QQ4A 2VABB 3HE6D 1L9MA 3QULA 5E2WL 3TF7C 2ARJB 4YO0B 1L7IL 3NA4A 4WHDA 5BW7A 1Q0YH 3IDIA 5GSRB 2EYTB 4PJDF 4XXCC 2X40A 4TSAL 3O6FB 1U8QA 1D3CA 5F1IA 2Q86B 1U3HD 3QB7C 3BEVB 2R9HD 1XAUA 4LHUG 1NMBH 1IGFL 1FZOB 2X4TB 2ZUWA 5DQJA 3UYPA 1PKQA 2EDJA 3DVFA 1GZPB 2C4FU 3T1FA 2DBJA 5F9WB 3N1QC 4Z95H 3V0VA 1CGTA 2VR9A 1DBBH 3SDAD 2WBJA 2OCFD 5E5MB 1DL7L 3U9UB 5DGQA 5F7MC 2BSTB 1KXTB 3A6CL 2NXZC 2Y07H 4RAHA 5K9JL 4LVNC 1UJTA 3EOAB 5L88H 5DS8A 3ZSSA 2MPAH 2FYYA 3MBEC 1FO0B 1YYMH 4LCWE 2R29H 2BSRB 5IMLA 4RWHA 3EJZC 2H45A 3L6FA 4M5ZL 4QRRE 3LVEA 4LMQI 4FABL 4PJIF 3MGAA 4J3SA 4NKIL 5IQ9B 1KXVC 2FWOB 4X6CB 5EC2B 2G9HB 3RKDC 2AJ3B 2FEEL 2JELH 1D9KD 3STZB 1B0GB 1KLGB 3BD4A 4J23A 2VH5H 2VXQH 1CDGA 5I17B 4MD5B 3IXAB 4NNYB 2I24N 1QBLH 1I9RL 4AEHL 4JPKL 4XMPL 5JNYA 1KIPA 4A6YL 3CAFA 3H9SD 3AREC 3LHPH 1K2DB 5DHVA 1IAIM 4JFFA 4TNWK 1LEKA 1KN4L 2P46B 5CP7B 2E8YA 3O3EB 3BX7C 4Z8FL 1RFDH 1H15B 4XPAL 3BKMH 4H25A 4WTZG 2IG2H 5KSAD 5CJBA 5I1HL 1FQ9C 5TDOB 3HZMB 3WFHB 1PVHA 4EKXA 3T0DA 4MD4B 1OB1B 4XXCA 2IPTL 5CD3B 1T2JA 1ND0A 5IM7B 5JIIA 4KK5C 4Y0GA 4LLYA 1P7QD 1VFAB 3FO1B 5KAQF 1KT2A 2EH7H 3U0PA 1CVSC 2XKNB 3RZWA 3QIBB 1Z9SA 3BO8A 3LSOA 1LMKA 4X7SH 2EYRB 3U9PL 3LH2L 5IB1A 1NGYB 3OKYA 3U2SB 4MA1C 3O6MH 1E6OH 4NO2A 1BGXL 5F6HI 1JZ3A 3PWUB 2DQFB 1MAKA 5CEYB 1YPZF 5HSFA 4XXDB 5H37G 1PSKL 4G43B 2MFNA 2PCPA 1LGVA 1N7ML 4XRCA 1DR9A 4WJ5B 1ZS8B 1BLNA 4NO0A 3OGOE 1U8LB 4X4ME 4D0DA 5D9SB 4ELKB 3GNMH 4ZFOL 5JXEA 3MBEA 4FTVD 4NRZA 5F7YC 2F5AH 4LBEB 3LKNB 1MCFA 2GJ6D 1IGJB 1HQ4A 2ERJB 2HN7B 1XCQB 1TJIL 3G6DL 3HS0B 3C8DA 3MRDA 4TRPL 2V5SA 4QTIL 4GFTB 5E94B 2EE2A 3D18B 2RJMA 4HXAH 4HH9B 4PJIE 1Z3GL 2JCCF 1XF5A 3JV6A 4ZFFB 5EO9A 3IDGB 3SQOH 4WFGD 4K3GA 1Q0XH 4HULB 3DI2B 3LKPB 3EYQD 5EWIH 3GSRA 5D93C 1A7PL 3VXSA 4N0UE 2XFXA 4YXLL 2B7DT 1SJEA 1MRFH 4LLMB 4J1UA 4MLSA 1KTLB 5T33L 5IMKB 1QR1B 1OTUD 4P23B 3KPPA 1TZHB 3PWPD 5TQ0L 3EFDL 2FEDC 4YLQT 2FATH 5E9DE 5L8LB 3Q6FA 3QI9C 5EBMB 3MLYL 4YBHA 1N64L 2FRGP 1IGIL 3A0OA 2XXCB 5CILL 3M8OL 3FFCE 3RPIB 3VRJA 2E6JA 4YAQB 5GGRY 2CJUL 4IRSD 1RQ5A 4UQ3A 4X6BA 4M7KH 4JFDE 2MCPL 3WJJC 3T0EC 3BUYB 1JTPA 5KG9B 4HS3A 3FCTB 1A8JH 4NM8H 4JAMB 3WXVH 3QFDB 2EIDA 3GI8H 5IJKC 1GGYA 3B2VH 1OSPH 1BBJB 3S37L 3V6OE 1IGYA 1F4HA 3P77B 4XBPB 32C2B 3NCJL 5DJDB 1G9ML 5MENE 1DUZA 3GIZL 2VRAA 1IVLA 3FL7A 4NFDA 4UAOC 3L3IB 1QD0A 2G2RA 1CLZH 3SJVD 2GSIB 3L7EB 43C9B 3ZKMD 4FA8A 1YC7A 4HQQH 2BHZA 1K4DA 4KK8C 5ICYB 2C4FT 4YX2H 5HPMB 3P30L 2X9WA 5ESQB 4LCWB 3ZHLA 4FQLH 3O9WC 5FYLL 3MPCA 4QRRB 3VE0A 1S7QB 3NPSC 5IG7A 5D7JD 5DJAB 4DK6A 3MJ8A 1XR9B 3B43A 3MRGB 4BFGA 3IYLW 3QUMA 4OCLC 3L3HA 4D9RD 2VN7A 4Q58C 5T1DL 5DEGA 4LPUA 4MXWL 5C0FB 3U1SL 4NRYB 5JZ7D 3LMJH 2WLYA 1ZANH 2PXYC 4N8PA 5C09D 1CBVL 1TQBB 1JI2A 1KB9J 1P53A 5I1GL 5CGYD 3RTQC 5GS1B 1DTUA 5C7XH 3RY5A 5E08L 1A21A 3QIWC 1PZ5B 1I1AC 4MGXA 2AEPH 3RGVC 1CXEA 1FORH 4P4KB 1DVFB 3U0TA 1K9TA 1WVZA 3WJJA 3T0EA 5FAAA 1NC4A 3D48R 3BVNA 1KB5B 5BVPH 3DMMB 1KJ3H 4AM0A 5JR1H 4XHQA 3SO3C 4DGVH 5IJKA 3IETB 3ZMRA 5DJ8B 4GG8B 5E4EC 4XP5H 3FO9B 4LIQE 5TE4L 1OF2A 4ZXBC 5IESH 4G3YH 3VFWA 2E6PA 4H88L 2BP3A 2Y5TA 3FB8A 1YEGL 1JGUH 2ED9A 2Q7NA 4JY6B 5KSBA 1EDQA 3NH7H 5DA4A 1Q72H 3EFFA 3Q1SH 4YHNB 4LCUB 3K1DA 1BJ1J 1WFTA 3IJYB 4WWKC 1FZKA 4P5KA 3UPAA 5GGSY 4APQB 4QTHB 2YRZA 2OZ4H 4NQCD 3LPFA 1KEGL 4OKVB 3O41A 4ZUVB 1WEJH 3NCFB 4UNTA 3TGXA 2NY0D 1CT8B 3VFTA 4R4BB 3ME0A 4BH8B 1M71A 2IGFH 4PJIB 3N85H 4X9BA 4I2XE 3OV6A 3EAKA 3D85B 4XCEB 3W5MA 2B1HH 2E27L 5CMAA 3UAJD 5C0CD 1MFDH 1BEYL 1A2YB 4KKBC 4N0UB 3BKYL 2PXYA 4YDVA 3SKOA 5IR1B 1FDLL 1UKSA 2OR7A 1MRDH 1WT5C 1EVUA 3MV8A 2FO1A 3WE6A 4LHUD 3CMOL 3TBSB 3RTQA 3DXAD 2B39A 1LO2H 4H8WL 2ICES 3IT8D 1VACA 4JFQA 5LVEA 3KS0J 5E9DB 4M6OL 3QIWA 1TJGH 4KRPC 1QPPA 4K3EL 1CE1L 5JIPA 1MFAL 5CINL 3RGVA 4WO4C 3FFCB 4NKDA 4O2EB 1V3MA 4QF1A 3TC9A 2B4CL 4K23H 5HGDA 1CICB 3DWTA 5IW3A 5GZND 2BY3A 3BZFA 1AGFB 3CSYA 4JFDB 3MA7B 4NNPL 1OGAD 1T7XA 4R7NB 4LDEB 4ZXBA 2BFVL 2KL6A 2VO5A 1X5KA 2W9LA 2DQHH 3REVA 1MHHB 4K7PL 3E0GA 4Y2DD 3MOBH 2ICEA 2YPLD 1FYTA 5MENB 1CF8L 5HDBF 1N5YL 1RUML 1U6AH 1SJHB 3LKOB 5T3XD 1CFBA 3VGHA 2VZ1A 5TDPB 4HWEH 4WWKA 2XQBL 1HKLL 2O26U 5GJSL 2W60B 3WNOA 2ARJA 1CD8A 4HH8A 4P3WA 2IPUG 5C0EA 3M1BA 4ONFH 4OFVA 4FQQB 1ZHBA 3CVHH 3KR3L 4XWOC 2X2YA 4XTRC 1F11B 4LK4A 3M17A 4GBXC 3X11B 4K7PX 5D1XD 3TZVC 3ARDB 1DN0B 4HG4K 3RUGF 1DE4B 4JFHD 4WIQA 1IEBB 1YMHA 1WT5A 2PYFA 2Z93B 3FFDB 5AD0B 2IAMB 4IOIB 5E8PA 4EBQL 1HEZB 1F3DJ 5HI5C 2XTJC 2LU4A 2OLDA 2JB6A 4MJ5B 1BWMA 1MCNA 2BJMH 2NR6C 2VQUA 2V7NA 2Q1EA 2E5EA 5AAWA 3ESVF 1D5BA 4PRIA 4N0YL 4E41E 5D2NC 2EDKA 4EDXB 1C12A 2DS4A 2ZUVA 5T5FL 4X6CA 4LPVA 2ZOKA 1DLHB 3V7AE 4JO4L 4ONHB 4K8RD 3STZA 3QXUA 4FQXB 5C2BH 2FSEA 4TUKL 3KPQB 2OTWA 5DJ6B 2H26B 5HHXL 5I17A 4BQ8A 4MD5A 2PO6B 1UH4A 4G8EA 3UDWC 1LD9B 2EDNA 4NC0B 4DVBB 5MP6L 3FN0H 1OOAA 2EH8H 3ET9F 5EZLA 5JW3L 4YHOH 1BD2E 3LQAH 1IAII 3WCYA 3QJFB 4N0RA 2Q8AL 1NKRA 3RAJH 2ICWI 4NC1C 5CP7A 1WWCA 2C1OA 2K9UA 1ZTXH 1S7RB 3T08A 5FO8A 3CSGA 3AS3A 3Q3GB 5F97E 4TVPE 1CG9A 3WFZA 1JMZA 1C08A 2WBJD 3KPSE 3ULSA 3BPCA 4HW6A 5T5NG 4M9OA 5I8KL 3PIQA 2NQCA 1FGNL 3JTSA 3FO1A 3RA7L 3WEXB 4OLXH 4GBXA 1KCRH 4W68A 1W0VB 3BRGC 4QY8B 1MIML 3SDXE 4M7LL 5FUOL 4PY7B 4I2XB 2JJVA 3CK0H 1PZUB 4GG6F 3PWUA 4JB9H 1H0DA 1C1EL 4LU5H 4R0LC 4XXDA 4G43A 3QCVL 3D5OF 2A9ML 2AV7B 1T7ZA 2VQ1B 4JPVH 2GJZB 4N5EC 4Y5XC 4JFZH 3BWAB 4ELKA 1MRCH 2YWYA 2IWGA 3PGDB 4LBEA 2W07A 5D2NA 3BN9D 5B3NA 1MFCH 4JFFD 3CDGB 1A4JA 1X5XA 1WCBB 3DVIA 2MNUA 3I02B 3EJYD 3C6SB 1KELH 1CZ8H 3CFBB 4OSUL 4HH9A 5B22A 2DQUH 5TF1H 3NIGE 4ZSOE 3DOSA 1T20B 3UDWA 3OKKB 3KDMB 3IDGA 3KYNB 3NACL 2YC1A 1FL5B 5C0RL 2F58L 3TA3B 2EXWD 2I9LA 3SE9L 1EFQA 1CK0H 4P23A 2DQJH 1GC1H 2VDRL 5I8EB 4I1NB 4LAQH 1JV5B 3GHEL 4YAQA 3QJHB 4JPWH 3DI3B 3TV3H 4GS7C 4NO0D 2YD1A 5JXED 2G5BA 3MBED 1S9YA 2OMBA 3UTTE 3DX8B 3O6LH 3B9KB 1A6WH 2XN9A 2CIIA 2XA8H 1IAIL 1JGVL 2HJFA 1G9MC 1AJ7L 4N90E 4KY1L 1HH6A 5KVFH 1S9XA 3DVGB 3DV4A 4UBDD 2B20A 4KI5F 4Y5VA 2GK0A 1OP3K 4XBPA 32C2A 5TH2B 4MQ7A 3PDOA 2J8OA 1AKJB 1ODAA 4E9LA 4Y5XA 4GG6E 3DUHA 4KMLB 1KIRB 1IILE 3L3IA 1FFPB 4RGND 4F7PB 4OF0A 5CCKH 1U8HB 4TSBH 43C9A 1U93A 3VXSD 3SOBL 2APVA 3I3DA 5TE7L 2X1QA 2RFXA 4ZS7L 3FTGA 2HFFB 1FNFA 4YPGB 5HPMA 3BAEH 3O3BA 5C6TL 2YPKB 1S7QA 1A4KB 2LV4A 3D2UB 4WV1C 4Q9BA 5DK0A 2F54A 5K59F 2CKBB 5GIRA 2VLRE 4KUZL 2AXJA 4I8DA 1DSFL 3E1F1 1Q9KB 5C0FA 3WHXB 2VSCA 2VUYA 5K9OA 1BD2B 4PTUB 2OTUA 4N68A 4G6KH 1H5BC 5E95B 1WWWX 3KPNB 1KC5H 3FQRB 2H32A 3W0WE 3CX5J 2ORBL 5IK3A 1PZ5A 4IIQB 1XGPB 1K3IA 3HMXL 5D70H 3MFFB 3T2NH 1EGJH 3KPSB 2J2ZA 1DVFA 1EFXB 4OCMC 3OKLB 1FG2B 3P4OB 4UILL 4HK0B 5L9DL 1S7UB 1S5HA 1EVTC 5IEHA 3DMMA 4RAVB 3V6FB 4OLWH 4OCXL 4GKOA 4PJDA 1KSRA 3RGHA 4L8SC 1C5CH 3IETA 4GSDH 3BZ4B 3SDXB 4GG8A 5HVFB 3O45B 2A0LD 5GGQL 4K2UH 3RIFF 4LSQH 3KWWB 3K1KC 4KV5E 4NKOA 1G6RH 1T5XB 1C7SA 1ZWIA 4CJ1A 4PJ7E 2GK2A 1ACZA 1A6VL 4XCCH 3DO3A 1I9EA 4JN1L 4JJHA 4ZUTB 4LCUA 3AGVA 4U7SA 1HCVA 2W9DH 3CFJB 2X1XR 5AWNH 5GRUH 2FEDD 3H42L 3PG2A 3J8F7 3SE8L 1A9EA 3NZHH 5HDQL 1E4WH 2ZCKH 2WZPD 3VD7A 4CVZB 3WDHA 1TIUA 2DQGH 1FNSL 3MOAL 4PJIA 3DARA 3WN5B 4ZPTB 1U95A 4ZSOB 4LQFH 3T0ED 2VDNL 1NC4D 1CLCA 2WINB 4L3AA 5K59E 4H8WC 3PWJB 3UO1H 4MHHI 2WLZA 3JTTB 4N0UA 5DRNB 2ITDB 3HB3D 12E8H 2KQMA 5JORB 3VGAC 2OJEB 2BC4B 3EYSL 4MNHB 4HEPG 2R2CA 1EIBA 3MC0A 2B4CC 4NQXB 2KBGA 3ZE1F 3O6KH 1R24A 4U6VL 1D5IL 3LIZH 4DQOL 3LQZA 1EO7A 3QG7H 3FFCA 5MI0B 3FMGH 3VG0L 5A3ID 4DKAA 1EZVY 3IGAA 3UTTB 2VZVA 1VENA 1JHLH 4RBPH 4JDZB 1LE9B 1Q0YL 4L8SA 1QFWH 4OLYH 2NXZB 3L1OH 1M7IB 4CMHC 4LVNB 4LNRA 3BIKA 1YY8B 3V6OA 5E70A 1KJ2H 1NMBL 4MDJA 2UY6A 5CAYB 4GG6B 15C8H 4KTYA 3V2AR 4LQ1A 4X83A 3MNZB 3QDJA 1YPZA 4J2XA 1DBBL 4I18B 3CZFB 3GMRA 3C2SA 5DUPH 3MV8D 3WKMH 5GRVL 3HC0A 2Y07L 1RUAH 3LEYH 1T04A 3MLUH 2X9YA 4M8QA 3RTQD 5L88L 1TITA 4IRJC 1TVHB 4QRQA 3QUYC 2R29L 4JHAL 2DKSA 4FQQA 4ETQB 3ALXA 5HYJA 3RGVD 2D31A 1NSNH 4PBXA 3G6AB 3X11A 2QQKH 3ARDA 4H1LH 2VLRB 1BMGA 1Q8MA 3DURB 1DE4A 2NX5E 4YBQC 1I3UA 2JCCA 4JRYE 3KYKL 2XWJB 1FIGH 1V5JA 2DQTH 2WM0A 3IKCB 5CEZD 1QBLL 4ZXBD 1HEZA 3FQWB 2AXGB 1CL7I 3K2UH 4WU5A 2BCKB 4RMRA 5F7WC 4MJ5A 3OGCB 1EHAA 4YPJA 3OHXB 1FYTD 4OD2B 5J56B 3W0WB 4XNUH 2D7QA 2IG2L 5DGRA 2LVCA 4EDXA 3MMEA 2XT1B 4ODSH 4DFHA 5LBSL 3EZJB 1DLHA 1H3GA 2XZQH 3HR6A 3E6FA 3V5KB 3QXVA 1AP2B 4JM2F 5E2TL 1P9MA 2H26A 3WIHA 4H20H 3CZJA 4IBLT 2EH7L 2UYLB 3QNYB 3IFLH 3E3QE 5C0NC 3T0AA 3X12B 1LD9A 3H9HB 2QQLH 2VAJA 2F8XC 4L8BA 4XNYH 5IBUB 4YFEA 5EBWB 3Q48A 3L3JB 1IC7H 2NLJA 2WUCH 5AUMB 5E03A 1E6OL 2V7HB 2PW2B 4PP2A 1TJHH 3AXLB 3X14A 4PJ7B 2JIXB 3QUKB 1VKXB 1BQLH 3UC0H 2ZCHL 5BMFH 3V5HA 4UINL 4RRPA 2F5AL 4IRJA 3QUYA 2DM4A 1X44A 4WHYG 2ATKB 3BE1H 4LASH 3HRZA 5DMJB 4PRID 3F65A 3HZVA 1FVCA 4GRMA 3GSNB 4QT5B 5KAQG 2NY2C 3JWOH 4I2XA 2P8MA 1OSZB 5BS0E 3MJGX 3K4AA 3SPVA 2GEEA 4H0GA 1E4KA 4X9FA 1YN6B 1J1XH 2VXSH 3SQOL 4P99A 2VL5B 3EO1A 2XQYG 2R69H 5EWIL 3RJDA 5CSZA 3U6RA 5I1DA 1RAMA 2MQ3A 4LSPH 1FNHA 4NN7B 3WV0A 2KPNA 2ZZUT 5IMMA 3PGDA 3ZE0F 1L0XA 3SDDC 1DBKH 5B8CB 3PE9A 2KUTA 3K46A 2FATL 3F7QA 1MCOL 5ECJE 3OKMA 1R6VA 2F53A 2X4PB 1WCBA 1RMFL 4YE4H 2F19H 2DQDL 4OF5A 3KJ6L 1WBZA 5FA4A 4Z7WF 3TBVA 1CL7L 1IAMA 3OKKA 3PF2A 4M7KL 4WW2C 1II4E 5CZVL 4XWOD 3KYNA 4NM8L 3VGFA 1MLBB 3WXVL 3GMOB 1W72B 4FFZH 3QEQE 1ETZB 5E6ZA 3GI8L 3B2VL 1T4KB 1OSPL 3EYFB 2YHGA 5FHBH 3O9WB 1MHPH 4ISVA 5EIVA 2G5RA 1DQJB 1ZA3B 4HZLA 4XVJH 3QEHB 3NPSB 2R39A 1JE6A 4LSTH 5HXMA 3OKOB 4X4YB 4EI5A 5DZNA 1JV5A 2XTJD 2XA3A 4BYHA 3QJHA 3UJIH 1T21A 4HEME 3RVUC 4JHBA 4YX2L 2OM5A 1UG9A 2D0HA 5F9DC 1I8LA 3TIDA 4Y4HB 2L4OA 2NZ9C 2CUMA 4QRTA 1A47A 2YN5A 3GMLA 5LQBH 3TH3T 1NBZB 3CJJA 3DVGA 5GS0D 3OB8A 4L8CA 4HJGA 3H9YA 4Y7MA 1AQDA 3E6HA 4AIXA 4QYOA 1QVOB 3TPKA 4Y8DC 2NX5B 4HWBL 3BPOC 1R5VB 4JRYB 1NGWB 4LSRH 1AKJA 1I1AB 5D2LE 1KIRA 1VFBA 2A74B 1U8HA 2DJSA 4GQ9L 4JVUA 1UJ3B 3F5WA 5D7LA 2DWEA 1ZANL 1G7LA 2H8PB 3SDDA 4YC2C 4OCNC 5H35A 3W39A 3ZYOA 1UT9A 4YPGA 1BVKB 4RRPG 3SO3B 3TCXA 1ZVSA 4P23D 4JQVC 1D5MB 4NSKB 5B38A 4M5YH 1XH3B 5C7XL 3UTPE 4M1CC 3ZE0E 1BFOB 1N0XH 3EDKA 5E8NB 2AEPL 4D0BA 4LEOB 4YBLC 5FOJA 5L7XL 1FORL 4WW2A 2HA1A 2CKBA 2DM7A 3MRRA 5BVPL 3O2DH 4U1LB 1KJ3L 5AZEL 5JR1L 4DGVL 1T0MB 5HPOA 3RBSA 1YEFL 4JR9H 4XP5L 5E8DH 4Q9RL 5GPRA 4O51B 2F9BT 3LV3B 1ZLSH 4G3YL 5IESL 5JHLH 2Y7QA 2BVPB 5AZ2L 3KPNA 4I77L 4I0PA 2J6EL 3F58L 3GBNH 4RMSA 3Q2CA 1JGUL 4Q2ZB 4N5ED 3QG6B 4QHUB 4KZDL 3U0WH 3V52L 3NH7L 2X4UA 4HIHA 4IIQA 1Q72L 3TLRA 4KK9C 3Q1SL 1VADB 2EIEA 2O61B 5A1AA 1UWEL 3FB6B 1QRKA 4NHUA 3ZZ1A 1S7UA 1QUNA 1CFSB 3GEWB 1VEPA 4YDIH 2IBBA 3D87B 1QEWA 1FVDA 5BS0B 2IGFL 2NW3B 5KW9H 3U83A 3B9DA 1OVZA 5DI8A 2AQ2A 3CLEH 1MFBH 4KRPB 2F54D 5H2BA 3G5ZB 2B1HL 1ZHKB 1GL4B 4WO4B 1FL6B 2CUHA 1WZ1L 3RUGA 4XH2A 3VWKC 1UACH 1MFDL 2Z4QA 1F6LL 5JPMA 4R8WH 3R8BB 2CK0H 2DRUA 3WLBB 2W9EH 3CLFH 2OQJA 3NZ8B 4UT6H 2Z92B 4PR5A 4LKCA 2J3SA 1J05B 4BK5A 1HDMB 4LLWA 1TJGL 4ACPA 5EB9A 1JRHH 4NRXA 2IBZY 5HGHB 1FNGA 3TBYB 3VCLA 2HAZA 5ACZB 4OFDA 1DVFD 5DO2D 2OSLB 2DQEL 1UEMA 3D39E 1QNZL 1SYSB 3DMMD 5ADPH 4JM2B 4PRNB 2FX7H 3JTTA 3TYFB 3QEQB 2YPVL 3EBAA 3HMXA 2DQHL 1T66C 4ODWA 5IIEB 4PRPA 1VB9A 5M95B 3CFEB 4RQQA 2BOBA 3ARBA 3FQNB 5BQ7B 1U6AL 3MRIA 3MUZ1 1F4YL 1R3KB 5FYLD 3S97C 3ZDXF 2BNQE 3TZVB 2AERT 1BIHA 2NY3C 3LPWA 5HDLA 3UBXB 3EDDA 3QT2A 2VDKL 1PX4A 1DQLH 4HX1A 4X5WB 3V7AG 1KEMH 7CGTA 3F12A 4GRWH 2FL5A 1JN6B 2YZ1A 1FFNB 4XC3H 1F97A 1LQSR 4WUUE 4LPXA 1KIQB 1PX3A 3D0VB 5BZWB 4G8IB 3HG1A 3K4DA 2YEZA 3CVHL 5BV7H 4NNXB 2RR3A 3ARGB 1H8SA 4WTWA 3O11B 2DYPA 1C5BH 1MIEH 1T6VN 3VWKA 3UYOD 3ROOB 4C59B 4NZTH 4XCFL 2GYSA 3MRMA 5D2LB 1YZZA 5DJ0B 1NH6A 3RWDB 4P9ML 1IC4H 2CDGA 1MCWM 3T4YB 2MWCA 4I18A 3QQ9C 3KLHC 5KVEH 3GKWL 1DDHB 2VL4A 4N0CD 3D69B 4NP4H 5DD3L 5MEPB 4XPFL 5FA3A 1S3KH 3FO2B 4J3VA 3V4PL 2BJML 4NIKB 3K81A 3U82B 1PG7W 4P49A 3P4MA 3SCMB 1VGKB 2XOTA 2C9AA 2EXYC 4YNYB 1BF8A 3FFCD 1QBMH 1I9IH 4MLIA 1B88A 1T3FA 1UCBH 1RV6X 5L2KA 5DFVD 2VLRA 3SBWC 2KKQA 1MQ8A 4F7EA 4X80L 3MV7E 3IKCA 4ENEC 25C8H 2PTTB 2V2XA 2I07B 2YUZA 3FN0L 4J3UA 2EH8L 4HS8H 4YHOL 3LQAL 2BCKA 3R0NA 2BSSA 1NUGA 4ONGH 1IAKB 1N2RB 4JZOB 4XCNB 3T0WA 1YNTB 1IAOB 1ZTXL 4UUJA 3BISA 1KG0B 3QDJD 2Q87A 2I5YH 4BSVA 1H3PH 3CH8A 2RQ8A 4L4VE 1IKFH 3QA3B 4LLVB 3LEVH 3VFUA 4AMKH 3RRQA 1A7OL 4YHKH 4ETYA 3QUXB 4EIGB 6CGTA 3DETD 4AG4H 3LN4A 1QOKA 4OLXL 3X12A 2C3WA 3VFPA 3G5YB 3MUGA 5HYJD 4OFKA 3CK0L 2GCYB 3FQTA 4RGMC 5CP3H 5FCUH 2P8PB 2YUXA 4XMKH 4ZOAA 3ARDD 3FONA 2BXZA 4HDIA 4JB9L 3WNMA 3RNKA 3AXLA 4HK3J 2DMKA 3NAAH 4HKXB 5DXWA 4OCYL 3TH4T 3QWRA 4KGLA 5F44A 2QR0A 3PP3K 4LEXH 5B4MD 4Y8AA 4JCLA 1MCPH 4JFZL 4ODUB 2YD3A 4OF7A 2VR4A 3HUJF 4M8VA 1U8JB 4OGAC 1L0QA 5LGJB 5KVDL 1NBYA 3I50H 5LWYH 1AD9B 5DTFB 3F7PC 4CN1A 1NDMB 4KVCL 3JVGA 3SBWA 1XGTB 2NY4C 1KELL 1KPUA 2DQUL 4KTDH 3D39B 5C8JB 5SWZA 5EZJA 2OL3L 1MI5E 1YN6A 4YUEL 3VFOB 1SMOA 5HBBA 2FO4B 3MLRL 4GS7B 1VHPA 5E00A 4XPBL 4LCCB 1OARL 4TOYH 1WIUA 2J88H 5I1AA 3BSZH 1CK0L 3RY6C 2XQYK 2IC2A 4MJ6A 3CU1A 2DQJL 2B8OT 1GC1L 2CSPA 5HHME 4P2RE 4KJQC 2QKIB 2BNQB 2SEBB 4LAQL 5EIQA 4LGPB 4NQUA 4Y4FC 3G5VB 3WLWD 5EUKA 3TV3L 4UDTB 1UCTA 3SKMA 5DUBB 4NCC1 5GQBA 5ID0B 3I3BA 3BGMA 4IRJD 3QUYD 1BFSA 1XF2A 1A6WL 1HWGB 2VXVH 1Z0NA 2FB4H 2ENYA 5D7IA 4XCYB 4ZFZA 3QPXH 5I1JH 2NW2A 5HYEA 2PW1A 2UWEF 2NY5L 1D5XB 2J5LC 3RX5A 4YBQD 1ES0B 3T8XA 4R3SB 2KZ1B 3NA9L 2EYSB 2XXMB 5DMGC 4AEFA 1CD0A 1T22B 2CLRB 5T3XH 1MNUH 1NCBL 4WV1B 4S1DD 5ALCH 5CCKL 5J11C 3VMPA 4P46C 3RU8H 3OKEA 4P5TC 1KV3A 2AK1H 3L3DB 1YNKH 4OV5B 1V7NH 3BDYH 3BAEL 4OAWB 1V7ML 3IU4H 4FRWA 1T7WA 3T4AB 2WIIA 5MEQB 2F53D 3NCBB 3UTSE 5J57B 2ZCLH 1XF3A 5C0AA 1RJLA 5IBUG 3UEZA 2W65B 3MJ6A 2UV3A 4HF5L 1HHKB 1IKNC 4JRYA 4PGBB 1FRGL 1RJYA 3WMSA 5C0ND 3MV7B 1B6UA 5ILTL 3ZL4H 3UPRB 1EEZA 4LF3A 1SVCP 1WK0A 3C8KB 2VLJA 2JJSC 3U7WH 1UJ3A 3RY6A 3TA3D 3KPLB 4CU8A 3BW9B 4MMXC 4G6KL 3VD3A 1KTKE 5F1SA 1GGUA 3QDGA 4W70A 5DUMH 5FGRA 1KC5L 3ARVA 4PG9B 4POYA 5FYJD 4Y4FA 1OT1A 3IU3B 4EI5D 1MCIA 5E8NA 4JO1H 4YHIA 1F4XH 3GB7B 4LFHG 4L4VB 5D70L 3ARFA 2VKWA 1EGJL 1ZVYA 1DBJL 4QHLA 1B6DA 3CC5B 1CD1A 4U6HB 1MJ8L 4MD0A 4K8RH 1DBAH 5E2VL 2IQ9H 4FFVC 4OLWL 4MCZB 4XNZB 2C26A 4MB3A 5IW6A 1FL3B 2NY2D 3TVMC 4GSDL 1EX0A 4G6JH 4WEBH 5FK9B 4ODXB 5DD0L 3MUHL 4LSQL 2BVPA 2V5YA 4EN3C 2UWEE 1HCFX 5E6IC 3BHBB 2CIKA 4OLVH 3MLVL 1AKJD 1U58A 5E2UH 4P46A 4P5TA 3AS2A 3IAPA 5FO9A 3TJEL 2BY2A 4JVPA 1NANH 3HNSL 4AENB 3BEWB 1IC5H 5D7LD 2W9DL 3ZDZF 4KKAC 5D8JL 3IF1A 4FZEH 5GRUL 4P9HH 3SDDD 5F7NC 3GRWA 4HWBA 3ILQC 3UJTH 2NNAB 3BPNB 2VDML 2DWDB 2QHRH 3NZHL 3TYGH 3MGOB 1KOAA 3VGAB 4NQEA 4U2ZA 2CR6A 1JZ6A 3GSWB 4I3SL 3EYUL 1ZT1A 5BS0A 1IKNA 4XP1H 4CNIB 3P0VL 2B1AL 1YJDL 1MI5B 3SGJC 1JGDB 5DT1H 3PUCA 4X6EB 2JJSA 4FFYH 3VXRE 1OP3H 4OZ4B 3UO1L 3UTQA 4OFYA 5FYKD 5J0BA 1WWBX 4QRSB 5D1QA 4LVHC 5EO1A 1NCDH 5FB8B 4PJHE 4ZUUB 1QG3A 2AK4E 2HMIC 3MTRA 4TNVF 5HHMB 4P2RB 4JQXC 5ICZB 3O6KL 4OKDA 5DHVH 4CMHB 4I0PD 2FJHA 3LIZL 2CDEB 4EUPB 4O2FB 5C92A 3W5NA 3VXQB 3QG7L 4G7YL 4EVNA 1B3JA 4S11A 4TVPD 1A6UL 1DQTA 2PKDA 2P8LB 1YEEH 3TWCH 2NZ9D 3Q5OA 1JHLL 4JFPB 4PJXE 1JPFA 3VRIA 1HKFA 2J6EA 4HFUH 1AFVL 1NAMB 1P4BH 4HGMA 3L7FB 4JM2A 5DHYA 5I8CB 1PW3A 4OLYL 2HFTA 3K4ZA 3OJDA 1RZFH 3B3IA 3KJ4B 3L1OL 3NMEA 1IL1B 1NFIB 1MPAH 3UPCA 1KJ2L 1NL0H 1Z0MA 4JFYA 3HCVB 3HI6H 1FNEB 1DANU 3I85A 15C8L 1INDH 3P2TA 4PS4L 1B0WA 1NUDA 2ADGB 5JOPD 1XCTB 3MROB 3ROLB 2E7LC 2E8ZA 1TENA 5DUPL 4O5LL 5JW5B 1HXMA 2EZ0C 1MJJB 1RUAL 3CPLA 3LEYL 4JGUA 3MLUL 3HHRB 5EOCH 3X3GH 3K8KA 5JOFB 1KF9B 4M1CD 2IH1B 3UTSB 1PFCA 4K07A 5C6PB 2EKJA 1RVFL 3MQIA 1QRNE 1NSNL 4JG1H 1QSEA 4I13B 1FJ1B 3AMLA 4C83B 5F9JA 3ZYZA 5ESVA 2FHBA 2DQTL 4MCYA 1JYWA 3NGBB 1DUYB 4NJAH 1TPXB 5C07E 1A6ZB 2Y4SA 4F37F 3GUTB 4WEUD 5DDHB 3NFNA 1ZMYA 4XBGA 4ZDHA 5FKAA 3GJFA 4HUWB 3K2UL 1TCRA 4PRPD 5DVLA 3DHJA 1I8MA 4RFNC 3BT2L 1J1OH 1OAZL 3V0AC 2QSCL 3Q0HA 1RZIA 1IT9H 5D6DC 4ZFGH 3IJHB 3UZEA 3ARBD 1FAKT 3BP4B 2XZAH 5CHNB 5INCB 3LEXB 4QHMA 1UA6H 3NTCH 4RMUA 1F8TH 3MRHB 4U1KB 3AAZB 3NFPB 2WANA 2XZQL 4Z7WA 1RZJL 3MRPB 5FGSA 3LQAC 2XWBB 2WIMA 4H20L 1CIDA 2D9CA 4N90D 3IFLL 2Z31C 3O4LA 2QQLL 2DKMA 3HG1D 2PTTA 1WTGT 4DZBA 3VJ6A 4XNYL 1DQQA 3MLWH 1TZGH 4HKBB 4JCMA 1ROWA 2WUCL 2UWEB 1MH5B 4GJTB 2DYPD 4X5LA 5EFIA 2V2TA 2E7LA 3BP6A 4XCNA 4UQ2B 3QR2A 2FX8H 1KG0A 4HCRL 1BQLL 1CFTB 4HIJA 3UC0L 5D96C 5BMFL 2EC9U 3FOMB 2GAZA 4J6RL 4RAUB 4N9GB 3SE3C 5IEKA 4MA3B 3C09B 2ZOLB 2HLFC 3FHQA 4LASL 3ZKSD 1LDPH 5F21B 4Z7OF 3O3AA 1MHCA 5ETUB 3GMMB 3KVQA 4IM8A 5C0DA 3TO4C 4IS6B 1Y18A 5D1ZB 4X7EC 1G7HB 5L2KD 2VLRD 3VXRB 5DJZB 4K55A 3F6LA 4QNPF 5CSBA 1J1XL 3QUMH 2R69L 1EEUA 1WTLA 4LSPL 4ODUA 4P2OB 4PJHB 3UCRA 5D6DA 2AK4B 2CLVB 3QFJA 3UBXG 2YRPA 5IFJA 4JLRB 5IBLC 4BFBD 4YWGL 3GIVA 5JUEL 1H3WM 5CSGA 3RVTD 1Z5LB 4PGCA 3GJEA 1JF5A 4HMDA 1IMHC 1VEOA 3VRLF 4LRIC 4YE4L 2F19L 2BSED 2XY2A 3WFEH 3MX0A 4XNMB 3MXVL 1ZGLB 1OAUH 3L3GA 4IDJH 4KKNA 5C8JA 3L95B 2DF3A 4PJXB 1NLBL 1RZ8A 1G7IA 3IFOA 1ZK9A 2JB5H 2ZJSH 2ICWB 5ESAA 1GC1C 2VISB 4FFZL 4XWGH 3CDYA 1OAQL 3CU7A 3PNWB 2YD2A 1ZLUK 2W0KA 1MELA 1DQML 4X0KB 4NGHH 5FHBL 5JDSA 4KI5D 4QOKE 2J8UE 5IB4A 1CN4A 5CJ8A 1J0JA 1HNFA 2MSPA 4GAYB 4KKCC 3H7BA 4RISH 3FN3A 3QWRD 2ESVE 1ERNA 2IF7A 3SE3A 2HWZL 1XZ0B 5DD5L 4DTGH 1PGRB 1DANT 3UJIL 5DVKA 3QAZC 2QTEA 2R2HB 1QYGL 3OR7A 4FFWC 5ISZB 2NY5C 1V8HA 4ZAKB 5LQBL 1T1WA 4JFXA 4LFHD 1QRNB 4YC2B 5SV4A 5DJCB 3C5JB 2HLAB 3MV9A 1DZBA 4NKMA 3QEUB 1L6ZA 4D0CB 4HWUA 4LHQB 1UB6A 4R3SA 5SWZD 4LSRL 1JRHI 2EYSA 1CWVA 2MTPA 1ZT7B 1X5AA 4WRLA 5C07B 3QXDB 5F9OH 4YBLB 1UM6H 1KPVB 5JW4M 4QNPE 5EU7C 4JO3H 5D7KE 5IF0B 3WIFB 4PJAE 4Z76B 3W11D 3OAYK 1ADQL 2EE9A 1P4IH 1RJZB 1UM4L 5MEQA 1U42A 1T5WB 2VDQL 5F3HB 5L0QB 1GIGL 1RPQA 4HC1A 3DECA 2YA0A 4U05A 3O2DL 3MCLH 1I4FA 4KJYA 4Z7VE 3QXAA 3SKJH 2V6HA 5CEZH 2P43B 2AJZA 4EIZC 5E8DL 5IROA 3SE4C 1QLFA 2EDXA 4FXKA 3KPLA 1ZEAH 1N0LA 3ULUF 3DGGA 1YMMA 2C4XA 3DUSB 4PJEF 3HC4H 5J6GA 4PG9A 4LDLB 1N8ZA 4ZTOH 1FVEA 2VLME 2IFGA 3KHOA 4MNGE 1P2CA 2L7UA 3U0WL 3R06B 3ZTJG 3RI5F 2YKLH 4M61B 5TPWH 1HYRC 3VFGH 3CMGA 2AXFB 2R4RH 4PJBE 1A9BB 4YDKH 1D6EB 3QEGL 1JNHB 2EC9T 5EPMA 1FL3A 1T89C 1S8DA 2AJUL 2BK8A 1SEBB 5F7LB 3PWVA 5EN2A 1JHTB 1XR8B 3LKQB 1INQA 5E5RB 4OF3A 5KW9L 5C0AD 5E5UB 3GSVB 1OAKL 1F00I 1NGZB 2EIZA 1MFBL 2F74B 3CLEL 3EKCA 4MYWB 5H94B 1CGSH 4JRYD 1JP5A 4YHML 1BZ7B 2VLKA 1INEH 2ZNWA 1IJ9A 5DC0A 2VLJD 2W9EL 3CLFL 4G9DA 4UT6L 5C08E 1M05B 5HHOA 4DWHA 5CKAA 3QDGD 5D5MA 5GJTH 4X9IA 4GUPA 2AABH 3MGOA 3MYJB 1KN2H 1YJDC 4V2BA 4NO5B 4X6FA 1JRHL 4NBYB 4Y4FD 8FABA 4X98B 5IVOA 1H3VA 5T1MB 3RZCC 4KTEH 3ARFD 4OD3L 3WXWH 2DM3A 2X4RA 5K9KB 4HV8B 1JWUA 1P6FA 4KUCF 4AQ1B 4Y5YC 3MZTA 1X5HA 4HUNB 4OZ4A 5ADPL 5DJXA 2FX7L 5ICXB 2OYPA 1KCUH 3SE4A 4BKLB 2BERA 3QO1A 4M6ML 1T1XB 4QRSA 3MXWH 2P5EE 3RIFK 4QOKB 3ALPA 5BCAA 3QXWA 2J8UB 5E2WH 3R1GL 2BNUA 2H1PH 3BIAX 1VFOA 1HHIA 2I60H 5I18H 2W0LA 5JHDE 1QFUH 2CDEA 2ESVB 4P5TD 4O2FA 4QRUA 3LB6C 4RNRB 3VXQA 1Q94A 1SY6A 4TSAH 3WIIH 3VWJC 3HKFA 2YD9A 5KVGH 4NJ9H 1DQLL 3DLQR 5BZDA 1KEML 4XC3L 4JFPA 4P5MA 3ZKND 4ZNCD 3IS1X 5BXFA 1IGFH 3MLPA 4AEIH 3MCKB 3DX7A 3TPUA 4NUGH 3VFSB 4NQED 3ECBB 2I26N 5BS0D 4PV8A 2G60H 3UMTA 1C5BL 1T7YA 4NZTL 3TNMB 3NCMA 2DBLH 1AIFB 4NO3B 4JRXE 1F58L 3K0WA 2DLGA 3MROA 3ROLA 4I0CC 3GMPA 1OHQA 4OFYD 4PUBL 2CH8A 5A2IH 5DURD 1MEXL 5D1QD 5JW5A 1JWMA 4PJAB 1MJJA 1CXFA 3HUJA 2BVOA 3IFPB 4PREB 2WQ8A 5JOFA 3WYRA 1Q9LB 1VPOL 2NTSP 4K3DL 1WZLA 3ULVF 4BH7B 3D25A 2R1WB 3FT3B 3C5ZC 4GW4A 4AEHH 5K33A 3P4NA 1QBML 4V1DE 4ERSH 1UCBL 4A6YH 1U8PB 2ZSVA 3ZT7A 5GISH 4Z7VB 4DZ8B 3RDTB 4S0SD 2RHEA 4JM2D 4M3KB 5EUOE 4D8PA 4Z8FH 4P4RB 25C8L 3Q5YA 4MNQA 3HNTL 2J4WH 2YN3A 5I1HH 5EOTA 3VA2C 1T1ZB 4G8GE 3LD8B 1CFNA 1JZ5A 2IPTH 4CVUA 2R0WH 5FOBB 3LRSA 3MRNA 1KPRB 3IJHA 2KZWA 3P9MA 4L4JA 4MNGB 2A6IB 1A1OB 1RZJC 5INCA 3W9EB 1V3KA 4ELMF 4KKAD 1H3PL 5DRXA 3CFDA 4KROC 3LN5A 3LEVL 2B5IC 3KHQA 4J4PC 5A43C 2R15A 2HFEB 4YHKL 1BGXH 4AG4L 1LO0H 4NPYB 5ANMA 5HYQB 2DIBA 1NCNA 3RWIA 5T1KB 3TBTB 2UWEA 1IQWH 1U8MA 3C6LC 4XMKL 1XGYL 4QLRA 4YH6A 1QSED 2WWMD 5T3ZD 5J7CC 4K7PY 3NAAL 1HI6B 1KTDB 1Q9OB 3GBML 3IDYB 2VDOH 4NUJA 2NY4B 4LEXL 4PRHE 1TJIH 4LHJB 3SGDH 4QTIH 3VI3F 3B9EA 5F89B 5C08B 4RAUA 4N9GA 3RPKA 4JJ5B 5SWSE 3D0LB 1N5AA 1MJ7L 5IW1B 3GSXA 3UTPD 1PAMA 1DLFH 4RWYH 5K9QG 3DUUB 1X5LA 2AEWA 1OW0A 4F33B 1W8OA 4PJ5A 5I0ZA 1BFVL 5ETUA 4JY5H 3DO7B 4FXLA 4DKEH 3EO0B 1A7PH 3T0BA 1F3RB 2VAAB 2UVFA 2XY1A 2IBGA 4LRNH 4LLDB 5D1ZA 1ZKAA 5T33H 4X7TA 4JGJA 3BJ91 3HAEA 3ES6B 5TQ0H 3EFDH 4OZHE 5IHZB 3PQYE 4ODHH 3O4LD 4P3DB 2K7QA 4Z7QE 3MLYH 1BVLB 1K8IB 3TN0B 5MERB 4TOYL 5JLZA 1O0VA 2P5EB 4QHNB 1MVFA 4ZD3L 2J88L 5CILH 9CGTA 3KPRA 3BSZL 4UV7H 5DJ2B 2W38A 1F6AA 5JHDB 5C0BA 2YBRA 4ALAL 1Z5LA 4MMZC 3VD9A 1WIOA 2H32H 1HSBA 5C2UB 1LE5B 2CDFB 4AJ0A 1OTSC 4PB0L 2EZ0D 1A5FL 4XNMA 2AV1A 1AGDB 4ELME 4OZFB 4R97C 3X13A 4MQXD 3K8MA 4BSWA 3MLSH 3NCJH 4A2LA 2X9XA 3QUXD 1NMCC 2AJSH 2DLHA 4UTAL 1PDKA 1T2QH 3C6LA 4R4FL 3N50A 3S88H 4U1IA 4PRBA 3VDCA 3VGGA 4M62H 3HE6C 2Z35A 4GKZA 3P30H 4JRXB 3LCYA 4F57H 1A7NH 1G7QA 3GJFK 5FYLH 3RU8L 1MLCA 4DUWA 3E8UL 1TVDA 3O8XB 1EAJA 1I3RB 2AK1L 2C3HA 1U3HC 1NJ9A 3QFJD 1YNKL 3VI3E 1V7NL 5ISZA 2R9HC 1X6NA 4D9LL 4PFEA 3D3VE 4MDIB 1FV1A 1LNUA 4ZAKA 1ORSB 4ZUSA 4K9EL 2EDRA 1QRNA 5BOPA 5DJCA 1OLZA 2X4QB 3G08A 2HLAA 2ZCLL 4MXWH 5IVNA 4V1DB 3DIFB 3QEUA 3TNNB 3VXUA 4JANA 4D0CA 1NKOA 1G7MA 3TT3L 4M4PA 4F8QA 4XT1C 1CBVH 2ADJA 1MCWW 2CXKA 3RWHB 4WHCA 3GM0A 4OCWL 2EEBA 4CRPA 1RHHB 4FQHB 5I9QC 3PL6C 4OCRL 5ABDE 4G8GB 4O9HL 3PP3H 4MX7A 3BYTA 3V6ZB 4HS6A 4WFFD 3AS1A 4FQJL 1FN4B 3TVMB 5C0IB 1BIIB 4P2QE 4PGZA 3NIDE 3AU1A 5D71H 1LK2A 1F4XL 1T5WA 1UVQB 1PYWA 2A9NH 4EN3B 5HTSA 5E6IB 1G7JA 3LZFH 4PRAB 3P3YA 4P57B 3T3MF 3U4BL 1JK8B 5ACLA 3C5SA 1T83C 2BY1A 4K8RL 3RWCB 2HG5B 1U91B 2IQ9L 5TDNB 3JV0A 1FYHB 3DV6B 1LEGA 2IMNA 3IDUA 4JDVB 1XGQA 1SYVA 3MV9D 4Y16C 5DEFB 1LO4L 4OQ1A 5DRZB 1JZ4A 4QCIB 3EYVB 3MNVA 1CFQA 4IMLB 4KPHL 4OLVL 4WDIB 1EXUB 4WY7L 5E2UL 2ZUQB 4PRHB 4DUXA 4HSQA 5FO7B 5I6XC 3G04B 1GZQB 3QNXB 2A83A 3MODH 3S5LB 4PJ8B 1IC5L 2GITB 4U2YA 5SWSB 1GGBH 3FQXB 4W81A 3QWOB 3UJTL 1CE6B 5CFHA 5DSCB 4MQTB 3TYGL 1WFUA 5DK3A 2E27H 4LVHB 1U3YA 2NTFA 1BEYH 1JHTA 1XR8A 3LKQA 5FUCC 2OXHA 5CWSA 1HHJB 4LSUH 1U8KB 1FSKB 3PWNA 5DT1L 1ADQA 1NDGB 4OZHB 3TCLA 3PQYB 3PL6A 4M6OH 3P0YL 1ORQB 1CDCA 1Q9WB 4NYLB 1CE1H 2JKXA 4JG0H 3VXNA 1G7PB 1X9QA 3QDMB 3T65B 1J5OH 4AY0A 1NCDL 2VN4A 4FQIL 1M05A 1OQXA 2R0LH 4RA0C 1YMMD 5JO5B 5KSVA 5HD8C 4U3XA 3AY4C 5HGBA 1HHGB 3IDNB 4FZ8H 3OX8A 3C60B 3CUPB 4PRDB 3W9DA 4ELMB 4FFWD 3EYQC 3TWCL 2NMSA 1QTYT 4K7PH 4OF8A 5CUSL 1B2WH 2JJWA 1CDUA 1CF8H 4HFUL 3S3SA 1P4BL 1RUMH 4YHYC 1OTUC 1R3HB 3OAZK 5ICXA 3WIHH 5HYSA 4Y16A 5INDA 3CVHB 5FDWA 4N9OB 1RZFL 3HC3H 3NIFF 2APFA 2VE6B 3GHBH 1MPAL 5TQ2L 2UUDK 1CLOL 1XGRB 3HI6L 4KI1A 3KLSA 5C70A 4IRSC 2VLKD 4YK4C 1S7XA 4RNRA 5ITFA 4AIZB 2P7TB 3REWB 3I2CH 2HYMA 1G9NL 4G9FA 5HJ3A 2AAVA 2PF6A 4GW5B 3X3GL 5HHOD 5I1EH 3D3VB 3ZO0A 4CAGA 1XF4B 4GQPH 4QXTB 2G75B 3MCKA 3VMOA 1T0NA 1X5IA 1RIUL 4NQSB 1JPST 4H26B 3DSFL 5KZCD 4EBQH 1OTTD 3P73A 4EI6B 2ILLA 3C9NB 2DLTA 1JPTH 3BRDA 3BKJH 2GIYA 2ITCB 4B5EA 3OB0K 3VDAA 4NJAL 3SEPA 5EBLA 5GRJL 4HD9A 4WFEE 1RULH 3BOVA 5IB3B 3SDCB 4NZRH 2X10A 5D7JC 4GKNB 4JO4H 4P2QB 1IT9L 1PJ9A 4NZDA 3AY4A 4ZFGL 3GSQA 3QISA 4GXUM 3VW3L 4TUKH 4YZFF 2XZAL 4B53A 4CMMB 2EDLA 3K2MC 5HHXH 1KBGL 4HUXA 2DMBA 4XZUB 4CKVX 3JXAA 3NTCL 1W0WB 1P4LB 1F8TL 1AXSB 3HZKB 2P5WE 1WBYB 1BZQK 2ZG2A 4L9LB 4M6NH 3N06B 1U8NB 3K8LA 5JZ7C 1LEIB 3VXPB 4DZ8A 3KXFE 3RDTA 5CEXB 5CGYC 3MJ7B 3S36H 3RJQB 4U1MB 5MEOB 3MLWL 1TZGL 4QHKI 1JF1B 4CADB 1T6WA 3WFDH 2WQRA 3EYOB 5FOBA 3PV7A 1JWSB 1WAAF 2FZ3B 2WBWB 4OM1H 1X3DA 2FX8L 1RUQH 1U9KA 5FYJH 1AHWC 3MRQA 5E2JA 4MAYC 3TO4B 1SJVA 4QXGH 4Z5RA 1O7VA 4CBPA 4YIQA 1KNOA 2LTQC 4JFOA 4DOHE 5A40E 1A1MA 1LDPL 2CRYA 4G6AD 1C1EH 5HYQA 2C3GA 1GCFA 3IXTA 4DUVA 4LPYA 2DIJA 5HYSG 3QCVH 4M7ZC 4XPHH 5T1KA 4F80A 4WENB 3IKKA 4W4OC 2IADA 3EUUA 3KYOB 2D03L 3T04D 1RZKH 2R2BB 1JUFB 2UY7A 4O00A 2GJJA 3T77A 4WNQB 5DMKB 2D4DA 4R7DB 5F3BB 2A6DA 1ZV5A 4MNQD 5C08A 1JCKA 4U1SA 3DBXB 2HVJA 4E42B 3LOWA 4OIAA 2M8XA 3RL1B 1EO8L 3KPMB 3FJTA 1KB9K 1QKZH 5CBAB 2HRPH 3BXNA 1BWWA 1UXSB 2UZYB 4XNQB 3EO0A 3NACH 2Q76B 1QO3A 5C0RH 1WUNT 2C7UB 2P49B 4IDJL 4S2SB 1OL0A 4LLDA 3SE9H 1W2KT 3MRLB 2OR9H 1ZHLB 4UIMB 4YHPA 3I75B 2CKBH 5D6CA 4D2NA 4C56A 2BY0A 4I4WA 1XIWC 5IHZA 4KDTC 2ZJSL 1UH3A 3QAZB 4XWGL 1MCBA 1HHHB 5FYKH 4HGWA 3TN0A 4F58H 1BPVA 3STBA 4R96A 4UTBL 1BX2A 2Q7YA 2OXGA 1HINH 3WJLA 3I6KB 1T80A 4MAYA 4PJEA 4G42A 4HHAA 4YGAB 5GZNC 4RISL 5SWQA 2YSSA 1JGVH 1AGBA 1I8IB 1OD7A 1AJ7H 2YZ8A 4TVPH 4DTGL 2YD4A 4EZMA 5EC1A 4OZFA 1RZGA 1Z6JT 3L9RA 4UU9A 4FNLL 3B4NA 3UZQA 4Z18A 2IPKB 1FGVH 3CGTA 5IMOA 3VU2A 1E28B 1NAKL 3EIFA 2ENSA 1YDPA 4W6XB 4PJ5D 2IFFL 1G0YR 2FIRT 4LOUD 2LE9A 1S5IH 3UJJL 4OB5L 5D1ZD 1RU9L 1OAXL 3DRTB 3VXRD 2VTFA 1RK1B 2DLIA 4LVOB 5F9OL 5EU5A 2KDGA 1HILB 1I1YA 2A6JB 2FHCA 4RCAA 1BOGA 1REIA 2BVUA 4WW1A 1YUHB 4JO3L 2X4OB 5EU6E 4K9EC 3VXMA 3T3PF 1YEKH 2VR5A 4K3HA 3KPRD 2A6KB 4PP1C 2K3TA 5IVXF 4U49A 1P4IL 1JI1A 1FC1A 5I73C 5C0BD 1FFRA 5J1AA 2O5YL 5FHAL 5DFTA 3TH2T 2P5WB 4GW1B 1AGEA 5IVZA 4LHUA 3VI4E 3JSSA 3S4SB 2QADB 3HE7B 1XIWA 2BVQA 3MRJB 3WS3B 3MCLL 3KXFB 3RWHA 1QLRA 4G8FA 3KLDA 2N56A 2DB8A 4JM4L 3SKJL 4MA8L 1HH9B 2EKSB 2ORBH 3NCEB 1KJVB 3LRGA 2OR8A 3C6LD 4G8GA 1ZEAL 3HMXH 4LPTA 3V6ZA 4GAJH 4Q97A 1N59B 2XNAB 1KACB 3HC4L 5I16A 3RL2A 1A6AA 1G6RB 1MWAL 3FKUS 4UILH 1G0DA 4K8RC 4EEEA 2APWA 1E4JA 3G5XA 3T1WA 4WFHD 4KMTH 2YKLL 5F8RC 1HIMH 5TPWL 3LS5L 4P57A 5GGQH 4DOHB 2YPLA 2IANA 2R4RL 4HXBL 1FNLA 5ISZD 3RWGB 4ZPVA 2EDWA 4YDKL 4F3FB 4RDQF 4RFEA 4ZAKD 3U4EB 4OZIE 3I6LD 3HNVH 3S96A 1QRND 1A6VH 1K4CB 3VXUD 5DRZA 1NEUA 3MRBA 4OF6A 4MSWB 1CGSL 2WBJC 4WI2A 4Y1AE 1ZLUH 2RCSL 3KYAA 5F71A 4YR6A 2F8OA 1INEL 5C07D 2DTSA 5HDQH 4WTZA 4Z0XB 2MKWA 2HFGH 1FBIL 2P24A 5SWSA 5ALBH 4Y5YB 1FNSH 3MOAH 3Q6GH 3QWOA 1AD0B 3F7VB 4O02L 4L4TA 4OZFG 5GJTL 4Q6IB 3T3PE 3PHSA 5DSCA 3NFSL 1KJMA 2VDNH 2AABL 4UDUA 4UV4L 2DL9A 1FO0L 3L5JA 4ZNEA 5IVXE 1WISA 4NQVB 1JGLL 3WDIA 4OLZH 4FQPA 3T09A 4KTEL 1PG7H 3WXWL 1GSMA 2YA2A 2DIAA 3CH1A 2RGSA 1I7RB 3EYSH 2HT3D 3LKSA 3VWJB 4TUOB 4EXPX 1KCUL 5A2LH 3GBLA 1JHKH 4U6VH 3WO4B 3BN9C 1JL8A 1DN2A 4OI8A 1SEQH 4B0MM 1S7SB 2MHAA 3QDMA 3MXWL 5F1NB 1KJ2B 3TEUA 4F7CB 4R2GB 4PJCA 4U6TA 5C9JA 1I1FB 2H1PL 2W0FB 3KPOA 2R0KH 3EJYC 4Z7UF 2I60L 5I18L 3OJVC 1QFUL 5DVNA 2FH6A 4K7FB 1ITCA 3OAYH 3WIIL 1FZJB 5KVGL 3IVKB 1A0QH 1U8OA 4NJ9L 4DN3H 1UC6A 4XX1G 5TJWK 1BREA 5HGGS 2BVEA 1WWAX 5E1HB 2EXWC 1B4RA 1RIVH 2C1PA 3QXTA 3SGDI 1YECH 2F15A 4AEIL 3DRQA 4NUGL 5FECA 5L8KB 2Y36H 3VFVB 1J18A 5E1AA 1TMCB 1GAFL 4BZYA 2G60L 3KYMB 1BF2A 4H1LB 3JV4B 1AGCB 2FX9H 2Y5EA 3VH8B 4QRPA 3I6GB 4X5XB 1G9NC 2DBLL 5JXEC 4G80B 3C5ZB 3C08L 3PL6D 4JHAH 1K8DA 4AIZA 5GGRA 3OR6B 5EU6B 4J12A 5DK2A 2DOCA 1D5ZA 3EDEA 4UT9H 4UBDC 3QZWB 4GW5A 4TNVK 4XGZB 3D3VA 1DEDA 3MRFB 2NY6D 2QSTA 3CCHB 2A38A 2EDQA 4QXTA 4F2MA 3KYKH 3VFNB 4MVBD 5GS0L 1NC2A 1QFOA 4H26A 2C3VA 4RGNC 4ERSL 2Z91B 4EI6A 2FJFA 5J12B 4L29B 1G6VK 5GISL 4XP9H 2ITCA 3BH9B 4L9DA 4OCSH 1JPGA 2VZTA 4YHLL 4KROB 1JZ2A 2PTVA 4JE4B 2B5IB 3PJSB 4Y16D 4MS8D 1BBDL 3J7HA 1K5NA 5IB3A 2J4WL 4L3CA 2IQAA 2PYEA 5LBSH 3S5LG 1J8HA 3H9SE 1P7KB 2H41A 3GSOB 1ZT4B 4P2QA 2R0WL 2NXYD 3RP1A 2UVEA 2DM2A 2P1YA 5E2TH 5E8EA 1HYSD 2H2PD 4Z7UE 5HVHB 3BZEA 1AXSA 4GRWF 2DJ4A 3MLXL 1U8NA 4G9FD 1O7SA 4LLQB 4YHZH 1LO0L 3O3DA 1FH5L 4OZIB 3QIUC 3MR9A 3L5WB 2VITA 1T1YA 4POZD 1GPOH 2ZCHH 2BMKA 1IQWL 1S78C 4KC3B 4UINH 4Y4KB 3EYOA 4Y1AB 5I74C 5LGHH 3QP3A 2LAAA 4NZUL 2GSGB 2VDOL 4F37K 1ZA6B 2CQVA 2Q6WA 4ORGA 4CW1A 5D7SH 1WGOA 5GGVH 4KFZC 4LCYB 5D7KD 2AKRB 5FEBA 5B21A 5HD8D 1QSVA 5I71C 1WBXB 4FTVE 2QEJA 1NCWH 1EMTL 2A0LC 4O2CB 3FRUB 4M7JH 4HBCH 4WI5A 4M93C 2GJ6E 1DLFL 4RWYL 5IVXB 1I8KB 4NDMA 1C16B 4GRLB 4AT6A 4JY5L 4G6MH 4HIXL 2VLLA 4DKEL 3NBNA 3N1GC 4YGVA 4L1HA 4JZJB 3IDXH 4M1GL 4LRNL 3ILPA 4MJIA 3PHQB 3C2AL 1AI1H 4YDLC 1VDGA 1AO7A 4TVSa 2OI9C 3QH3B 3KNBB 3RDTD 4ODHL 1MCOH 3NABH 3HI5L 5DMKA 2E7CA 1KGCD 4R7DA 5DR5H 5GGSA 1RMFH 2DQDH 1JPSL 3CFKB 1ONQA 3KJ6H 5GGUA 4UV7L 3RL1A 3QUZC 3WNPA 3P9LA 3UTZA 1CL7H 5CBAA 3FOLA 3GGWA 1JNJA 5CZVH 3CX5K 5A2JH 4R9HA 3S35L 4NN5C 3HE6B 4S2SA 4O58L 5BO1L 1X5YA 2OS7A 1ZHNB 3EOBB 2HVKB 3WBDA 3HB3C 4H5SA 4GRWE 3HPLA 2R1XB 2NY1D 3QIUA 4QGTA 3MLSL 2R8SL 2P42B 3N9GL 1H3TA 2AJSL 1R0AH 5I76A 4L8DA 5IHLB 1T2QL 1U3HB 1R3LB 3L3OA 1RK0B 4UI2A 4AH2A 1UYWH 1PY9A 5T1KD 3S88L 1GVIA 5L6YH 1A6PA 3HPJB 5A3IC 3O3UN 2GUOB 4M62L 2DQCL 4IHOB 3NN8A 5EU3B 3BQUB 2D0FA 3GDBA 4F57L 4WI7A 1WSST 1HQRB 5C0GB 1A7NL 3E2HC 3SDAB 3T0VA 2YUWA 4FMKA 3SJVE 1U92B 1S7VB 3S35X 2AGJL 5C08D 4NT6A 3IDJB 2A1WL 4Z78A 2Y72A 2BOCA 3GRWH 4HWBH 1Y0LB 3GO1L 5DF0A 3TBWA 1GGCH 2OJZL 4GQ9H 1PQZB 3WUZA 2H6PB 1D9KB 4FOMA 3VXOA 4PJ9A 1LP9F 1TTGA 4XBEH 5ADOH 4XAKD 1J0KA 2XWTB 4C56D 4ZQKA 4D9RE 2FLBT 5GSVB 2YD6A 1S7TB 3EGSA 3VGDA 3QUZA 4JVWA 2X4OA 4PLNC 2V17H 3TN0D 3H9SB 3W81A 1PY4A 4UNVA 1ED3A 3QQ3B 1TLKA 3MREB 3HMWL 5C09E 5L7XH 3BYYA 5I1KL 4RX4A 5C0JA 1U8IB 1UB5B 2QQQA 3U36A 3ULUD 3MRCA 1JGEA 4M43L 5I1CL 5ITBL 4MAYD 4BQCA 5AEAA 1F2QA 1NLDH 5AZEH 4Z7UB 3PABA 5D71L 1L6XA 5KSAB 2A9NL 4GW1A 4XNXL 5J6HB 1YEFH 1HWHB 3P4LA 4HLJA 4PPTA 4PGDB 3LZFL 1QACA 5E99L 4Q9RH 3PWLB 2VZ3A 4HFWA 1JYNA 3HE7A 3OSKA 3MNWB 1HSAB 4Z7NE 3MRJA 2DDQH 4HPOH 3KXFA 1P7QB 4DVRH 5AZ2H 1D7FA 4I77H 3TO2B 2J6EH 3F58H 5HHNA 1HH9A 2EKSA 3ARWA 4KZDH 3V52H 2YA1A 1X6LA 3F7YA 1N59A 2JJTA 1UWEH 5EO0B 4N8VA 3RNQB 5BJTA 5EU4A 5JW4N 4G6FD 2FR4B 1G6RA 2E6QA 1U2HA 1NEZA 5KS9F 5LXGH 4I48A 1YEJH 3PV6B 5I66A 4DKFH 3MODL 3GSUA 1GGBL 4FTVB 3VXMD 4X99A 5L2JB 2HP4A 4NBZB 3BMWA 3BKCH 5KANG 1LILA 2GJ6B 2HT2D 5F88A 4NQCE 3LKRA 3QCUH 4F3FA 1M6OB 1WZ1H 5IV2B 2D7NA 1WZMA 4DGIH 1UEYA 1EEYA 5FF6B 1K4CA 4RZCB 4LSUL 1W8NA 2Q3AA 1VFUA 1XIWD 3TT1L 1NGXB 1QSFA 2IALB 3GZKA 5JPNA 5FM8A 4OZGF 5T3ZH 1HE7A 1WC7A 3FT4B 4KUCD 1LP9E 3OKDA 4Z0XA 5B39A 1CI5A 5C0CE 3BP5A 4JG0L 1TNMA 4KKLC 1A3QA 1N3NB 1J5OL 3VXTA 4G8GD 2BHYA 35C8H 3GJFH 1B4JH 3ZTNH 2R0LL 4MWFA 3HI1A 1F42A 2DQEH 1KLUB 1S9VB 3KAAA 1RUKL 3SY0A 4HJ0D 1QNZH 3MCG1 1A64A 3QNZB 4E0RA 4FZ8L 3ZHDA 4JY4B 2YPVH 1NPUA 4PLKD 4MB5A 5SX4H 4GRWB 4IRSB 3OXSB 5I1LA 4WEMB 2OK0L 1B2WL 2IAND 1MWAA 1MUJB 2H9GB 3WIHL 3LDBB 5F7DB 5JA8B 1OGAE 5BV7B 1F4YH 3HC3L 2AVGA 3GMQB 3GHBL 1MOEA 4LIQL 1FNAA 5EIIA 1BQHA 2VDKH 2VABA 1X5FA 3BZDA 1QQDB 3H0TB 5AYQA 4CJ0A 4YO0A 1I7TB 5GSRA 2EYTA 3BH8B 3UROR 1WAAA 5T3XE 3SJVB 1FZJA 3SDXF 3O6FA 1NBQA 2Q86A 1EBAA 3VFRB 5KS9E 4OLUH 3BEVA 4PP1D 3I2CL 4AIOA 5IJVB 5SWSD 4JREB 1MVUB 3QIBC 5I1EL 3S4SG 1BZ9B 4TTDD 4CVXB 4L4TD 1FZOA 2X4TA 4TQEL 4WGWB 5JIHA 2Y06L 1GZPA 4XCFH 4X6DE 1UZ8B 3W2DH 4P9MH 5D7JB 3U46B 1BOYA 4XPTL 4IOFD 3ULVD 5F70A 5E5MA 3GKWH 4CVWA 3MLZH 3JV4A 1IQDB 3U9UA 43CAB 5DD3H 2BSTA 1JPTL 2X41A 3VH8A 4XPFH 1UKQA 3BKJL 3I6GA 3ARUA 3EOAA 4N8VG 1JZ7A 3WL9B 4JFHE 4KHTH 3V4PH 4I5BB 1FO0A 4HUMB 4ODBD 2I25N 1E27B 1NEZG 4OZGE 2BSRA 4HUVB 1RULL 2ERJC 2KQNA 1URLA 1IZKA 1MY5A 5IQ9A 2FWOA 4NZRL 3QDMD 3NIGF 5EC2A 5C09B 3RWJB 4CU6A 2BDNH 5GS0C 1TQCB 2G9HA 2AJ3A 3IAGC 1AR1C 4U6XB 1B0GA 1KLGA 1A02N 2ICWJ 5DFWH 2VB5A 4X80H 3IXAA 4NNYA 5LAXB 2JK5B 2J8HA 4L29A 4M6NL 5GS2D 1AY1L 5IT2L 1AHWB 1K2DA 4NFCA 4HIEB 3CIQA 1IM3B 4D9QD 1A1NB 1A22B 3O3EA 5GRYA 4P23C 1XGUB 1H15A 3FQUB 3S36L 5B39G 4HPYL 5TDOA 3HZMA 5IFAH 3IRZA 1TZIB 4NWUL 3WFHA 1ZOXA 3WUWB 4HK3N 4MD4A 3WFDL 1OB1A 5CD3A 5IM7A 4QRPD 1PKOA 1A7OH 1NGPL 4M7ZB 1OPGH 4OM1L 1KCVH 1PKQE 1VFAA 1RUQL 5FYJL 1DEEB 4QXGL 1YC8A 2XKNA 3QIBA 1QA9B 2EYRA 1NGYA 3HZYB 3P11L 3U2SA 1S7WB 4NQCB 3D3VD 4MA7H 4Y5VC 2DQFA 4U7MA 5KSUB 5CEYA 4LP4A 1FP5A 3L5WA 4ZO9A 4OCYH 2NY0B 5F1KC 3O2VL 4XPHL 4WJ5A 3S36X 1NC2D 3OAZH 1ZS8A 3ARSA 2R1YB 1U8LA 5D9SA 1X7QB 2ZUXA 5IOPB 3VDBA 1BQHG 4OQTA 4U6YB 3LKNA 4HUUB 1IGJA 1LP9B 1RZKL 2UUDH 2HN7A 5KVDH 1XCQA 5C0CB 1KCSH 1FFOB 3HS0A 5F72S 4OM0L 4TSCH 5E94A 3CVIH 2GTZB 3D18A 3PGCB 2X4NB 4KVCH 2PYED 3LRHA 1J8HD 7FABL 1KLFA 1MREL 1QKZL 3FRUA 2XIDA 3L3KB 4P2QD 4WHTB 4Y88A 4ZFFA 2HRPL 2OL3H 4JFFE 5T1LB 4YUEH 3CFIC 2EEDA 2F8VA 1N4XH 3MLRH 3LKPA 4UOW0 3RQ3A 1CGVA 4JZJA 4XPBH 4FQCH 2NYYD 1OARH 3PHQA 4OIIL 1QBBA 4LLMA 4HC1H 2OR9L 1KTLA 5IMKA 1QR1A 2CKBL 2FHFA 1NFDF 4P3CH 3VH8G 1TZHA 3IDMB 3QH3A 5HI3C 1OGAB 1K3ZA 2JE8A 5DD1H 5EBMA 3BPLB 4K71B 4U1HB 5FYKL 3OB0H 4F58L 2VZUA 5J13B 4FXGB 4Y2DB 5FXCH 3RPIA 4KXZI 1HINL 3ZDYE 5TGBB 4FG6D 4DCQB 4P4KC 1DVFC 5DO2C 3MGTB 1NUNB 2P4AB 3BUYA 5KG9A 3FCTA 1CVRA 5KS9B 4JAMA 1DQDL 3DMMC 4TVPL 1IC1A 2ADIB 2D0GA 3PHOB 3QFDA 3SKNB 4KV5F 2NY5H 1BBJA 4X8JB 2R1XA 3H6JA 4PV9B 3P77A 5DJDA 4PJ7F 4EJ1C 1FGVL 2ZUSA 3D1MC 3NA9H 2ZNXA 2FLRT 1EAPB 4JZNB 1NCBH 3MLTB 1R3LA 1DFBH 1RK0A 2X7LB 4UMGA 3V5DB 2GSIA 1JZ8A 3L7EA 5IHUL 5D1XB 1S5IL 5ICYA 4MJID 5GRZA 1AO7D 1GOGA 3BQUA 3A6BH 4LCWA 5ESQA 3AFLA 1V7MH 4OZGB 4APQC 4E41B 4QRRA 1T03H 4RGNE 5DJAA 3RVVD 1TNNA 3VXSE 3KLAB 1YEKL 3CFCH 1HK6A 4OBRA 2IJ0C 1XR9A 3MRGA 4PYGA 2A77H 1EH9A 4HF5H 4BQBA 1FRGH 2PETA 1I85A 5AG9A 4ODVL 5ILTH 2ATPB 2CUIA 4NRYA 3IJSB 3QULB 4HMEA 4N0CC 3QIUD 3V8CA 3IDIB 1EEQA 4CU7A 5GS1A 1B9ZA 1NFDE 1U8QB 5F1IB 4MB4A 1S78D 2Y23A 4GAJL 3QQ3A 4DN4H 5I19H 1DBJH 4P4KA 4U31A 1MJ8H 3OZ9H 1PKQB 1KB5A 5DFVC 5E2VH 3T1FB 3V0VB 4KMTL 1J12A 1SY6H 1HIML 4PGDA 5DJ8A 5DEZA 5EZIH 1CGWA 2WBJB 5FGBA 4XP6H 3FO9A 3ZSTA 1TDQA 5IWLA 5DD0H 1KXQE 3DX9B 3CXHK 3VG9C 3WKNA 3V6OC 4IDLA 3B83A 3RWFB 2FYYB 3MLVH 4Y19E 1F5WA 4MAUH 3TJEH 3HNVL 1CS6A 3L6FB 2VZSA 2FGZA 4JY6A 3O0RH 3HNSH 3OWEA 2K7PA 4X4MA 4YHNA 4PBWD 3IJYA 3L5HA 4XP4H 5D8JH 4APQA 2FR4A 4L3EE 4PJ9D 4QTHA 4JKWA 5I8OL 2VDMH 4OKVA 4JPIB 4R4ND 4ZUVA 4M00A 4WFED 3DETC 2HFGL 3PV6A 4U3CA 5KJRH 3QUZD 1CT8A 5ALBL 4R4BA 5BOZG 4BH8A 4HT1H 4I3SH 5JNYB 3EYUH 3Q6GL 4IOSD 4RFOL 4RX4D 3P0VH 2B1AH 3TIEB 3D85A 4XCEA 1YJDH 4JFFB 5CBEB 1LEKB 1BJ1H 1M6OA 3ARDC 3H3PL 4JN2B 1GXEA 4H25B 1A2YA 4OLZL 5IR1A 4RDQG 1PG7L 5B4MC 1CR9L 2HT4D 2O5XL 3TBSA 3HE7D 3V4UH 4YEEA 1ND0B 4ZS6D 1I1CA 3T0EE 3KXFD 4LLYB 4X4XB 3PXJA 5E9DA 5GHWL 1JHKL 1KT2B 1MAML 2XKSA 3BO8B 3LSOB 1SEQL 4G7YH 1N3NA 1A6UH 4OJFL 4O2EA 3V8OA 1CICA 2R0KL 5IKCB 1KLUA 3OPZL 4JFDA 1AGFA 4Z6AT 3MA7A 1OGTB 1UWXK 2PCPB 1AFVH 3CX2A 4YFLF 2Z0BA 4XRCB 4R7NA 1MHEB 1A0QL 4DN3L 3KS0H 1P9MC 2X1OA 2PO6C 5KSBE 2VMFA 1BLNB 4NO0B 1PG7X 4D0DB 5BVJB 4PJFF 1MHHA 3MBEB 4NRZB 2FBOJ 1RIVL 5MENA 1HQ4B 1YECL 4TTGA 2CRZA 3LKOA 1SJHA 4PS4H 3MRDB 4BQ9A 2Y36L 5TDPA 3THML 4O5LH 2FX9L 1H9VA 2W60A 3WLWC 1XF5B 1QSFD 4RIRB 5DZLA 3JV6B 4U0RC 5DRWB 1P69B 3Q5TA 5EO9B 4RGNB 4S1QH 4FQ2H 1L7TL 3VXSB 3AREB 2XFXB 1RVFH 1F11A 1SJEB 1TETH 3MV8E 4UT9L 2IPUK 3ORJA 4J1UB 4WI6A 1DN0A 4XAWL 1E0OB 1KTRL 1IEBA 1QLEL 3L5IA 3Q6FB 3U46A 3FFDA 2Z93A 4W6WB 5AD0A 2IAMA 3V6BR 4IOIA 1E4KC 4M1DL 3VRJB 4S1DC 2GY5A 1IQDA 2PNDA 4XP9L 3BT2H 1OAZH 4UQ3B 4X6BB 2QSCH 4OCSL 1NFDB 3HAEH 1E27A 2V9RA 4YXKH 3WS6A 5CEZE 4MA1B 5CGTA 3RWJA 4PYHA 2AI0L 4YXHH 2J1KA 2ZWLT 1IGYB 4ONHA 1RZJH 1FYTE 4FQXA 4LPWA 1F3DH 1DUZB 5HHQB 3KPQA 5DJ6A 3FRPA 4MXVE 4PGJA 2PO6A 1OT2A 3HN3A 3O6FD 5HI4D 4LARL 4MJ2A 4DVBA 1K4DB 1EUUA 3B9VA 3H2WA 3N1MC 3TA3C 4YHZL 1BAFH 3QJFA 4PJFE 3H7LA 4Y19B 4KQ3H 3BGFC 5DQ9B 1S7RA 4LSVL 3VE0B 5I71B 4HCRH 2QBWA 4KHXH 4TUJB 1LO5B 1W72L 1GPOL 1YEHH 3H9ZA 3Q3GA 3MJ8B 4EI5C 5CP3A 1FAIH 1TZIA 4BZ1H 4J6RH 4L3EB 5AYUH 5LGHL 5GRXG 4A2MA 3QUMB 2DL2A 3I9GH 3S9DB 5D93B 4OTXL 2Z8SA 4KKLD 3WEXA 5DEGB 3B9KC 5D7SL 1I8LC 5GGVL 3OAUL 4X7CC 2WUBH 1W0VA 4QY8A 3V0WL 4GXUN 4PY7A 1NCWL 1CQKA 1S7WA 5D2LF 3L5XH 4HBCL 3QI9B 4M7JL 4D94A 4XC1L 4XVUD 4GLRH 4B7IA 2EDEA 4OFIA 4PD4J 2X5PA 4PRIE 3BDBA 4G6ML 1RZKC 2AV7A 2VQ1A 2GJZA 3A67L 3U79A 3IDXL 3BWAA 2R1YA 1AI1L 5CS7A 3U0TB 4NFBA 3T0EB 1E6JH 3BVNB 4YWGH 2VNCA 1GH7A 5JUEH 4AM0B 2QL1A 1I3GL 4DKDC 1PLGL 3CDGA 3BP7B 3NABL 5DR5L 2X4NA 4BUGA 1OF2B 3I02A 3C6SA 3MXVH 3VFWB 3CFBA 2Y5TB 3L3KA 4UAOB 1NLBH 1T20A 1R3IL 3GMNB 3KDMA 2P44B 3I3EA 5KSBB 3QIBD 3EFFB 1FL5A 4X4ZA 3TA3A 1OAQH 1FZKB 1DQMH 1S9KC 4IRZL 5DJYB 3O41B 1R0AL 5I8EA 2DKUA 4U1HA 3U7YH 4I0PC 5HHPB 1UYWL 2HWZH 5DD5H 4EQ3A 4OGYL 1M71B 4P2CG 2BZDA 5L6YL 4IIQC 5DQDH 5CZXD 1QYGH 3DX8A 3B9KA 1EJ6A 2EDFA 3N0PB 5CMAB 1EO5A 1AC6A 1SM3L 3FRPG 2PXYB 4YDVB 5IB5B 3SKOB 5KS9A 3NVQA 4MZ3A 2XTJE 3MV8B 4HJJH 5GZOC 3MJ9A 5CIPB 1AR1D 3RTQB 2FDBP 1EHXA 3GRWL 1VACB 3MSPA 5TH2A 3QIWB 5D2NE 1GGCL 4J8RB 4LNVA 1FFPA 2Z8WC 3RGVB 4F7PA 2X7LA 4KDWA 3SQBA 4TYUA 4NKDB 3HRPA 2EDOA 4QF1B 2XRAL 5HGDB 4XBEL 5ADOL 2HFFA 3BZFB 3CSYB 5KTEH 3OG6B 1ADQH 4LCIH 4E41A 4OGXH 5E4EB 4DGYL 2YPKA 4ZXBB 1UM4H 5SX4I 2VYRE 2V17L 2D9QB 4P2YA 1A4KA 1DCLA 3D2UA 3REVB 2VDQH 2ICEB 1GIGH 4UOW1 1FYTB 3ZLQC 5B3JE 4NC1E 4KJPD 3P0GB 2Y6SC 1NLDL 1Q9KA 4UIKL 5IHBA 4WWKB 4M7LT 3WHXA 4R90L 5JW4R 1CU4H 1BD2A 4PTUA 4U1GC 2DDQL 4HPOL 4PJFB 4DVRL 1YY9D 3FQRA 1IEAB 1MCSA 2XN9E 5C0EB 4S1RL 4CGTA 4ORZC 5J3HD 1CDIA 3M1BB 1AE6H 2O93L 1ZHBB 2VWEC 3ARBC 1XGPA 3TJHD 5GGTA 3M17B 3MFFA 3ZHKA 1A7BA 3KPSA 4OI9A 5MI0C 1EFXA 3OKLA 1KCLA 1FG2A 3P4OA 2LU3A 4HK0A 1O5DT 3BQUD 4RAVA 4LCWD 3V6FA 1YMHB 3QEGH 5LXGL 2PYFB 1YEJL 4QRRD 1IZJA 4HIIB 5E8PB 4DKFL 3BZ4A 2AJUH 3SDXA 3QHZH 3O45A 1JJUA 2JB6B 3BKCL 5SX5K 3KWWA 1OAKH 3DX9A 2VUOA 3QCUL 3RWFA 3U7AA 2V7NB 4YJZL 3DYMA 4YHMH 1T5XA 4O4YH 1D5BB 4PRIB 1PEWA 2Y1VA 4DGIL 1C12B 2GI7A 5F8QC 1X4ZA 4ZUT