3TH2T

Mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
198
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mg2+ Is Required for Optimal Folding of the Gamma-Carboxyglutamic Acid (Gla) Domains of Vitamin K-Dependent Clotting Factors At Physiological Ca2+
rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Coagulation factor VII light chain
total genus 46
structure length 198
sequence length 205
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3th2T01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3th2T02
3SDAD 2P46B 5HHME 4WTZG 5TF0A 4L4TB 5IUSA 1ES0B 4F7PA 3VGEA 1Q8MA 1UEYA 4P2QA 2Y6SD 1PQZA 1QA9B 4YBLB 3F6LA 3LDBC 3T0DA 1DDHA 2F5AH 5GRXG 4JO4L 4NO3A 3AC0A 5IW6B 2G5BA 4D3CH 1FN4B 1IC5H 1YUHA 4KMTH 4LOUC 3FOMB 3TM6A 1M71A 1MIEH 3OKMA 2AJSL 2R1YA 2P5WD 1UYWL 3R4DA 1UM4L 1S9KC 3QUML 5J1SC 4BZ1L 2PN5A 3QXDB 5T3XL 3NAAL 2WP3O 5I9QC 1ZT1B 1P7QB 4X6FA 5C09A 1FG9C 2AK4D 1CFTA 4FQ2L 3GMPB 3HC0B 2Y1VA 5DHYA 3BH8B 5B39G 5ICZB 1XIWA 3P9LB 3VE0B 1QR1B 3QUYB 1FNGB 3DX9A 2H2SD 4N8VB 1DBJH 5FEBA 4X5WA 3U36A 5C7XL 3VD3A 1CDBA 3ZE0F 1V7NL 3MV7E 4UOW1 4WTWA 1JNHB 5A3ID 1BLNB 3HNVH 3FQUB 4NN5B 3WCYA 4N0FA 1Z0MA 2ZG1A 5CJ8A 4BH8B 1ZSDB 3W39B 1G6RA 2PXYC 2IPUK 3V6BR 3CC5B 3HC4H 2EDQA 3SDYL 2QR0A 3LKPA 4X7SH 4JY4B 2MMXA 1RU9H 4OF5A 1KPRB 2VYRE 4E42A 1NBYB 5CSBA 3F7YB 3G6JE 3TT3L 1PAMA 4JQXA 5B38B 5KAQF 3VMPA 1OWWA 3P9LA 5DTFA 1OLLA 1GC1H 5F7EH 4Z5RA 3QUXA 5I8EB 4KJPD 3ARXA 4UV7H 4P23A 1GZPB 3VXOB 4KROC 2W92A 1TCMA 5E24E 4XCCL 1KC5L 2R2HB 3ZYOA 4G8EB 4F7MA 4HCRH 5I16B 3EYQC 4HT1L 2VQUA 2R1YB 2RQ8A 5CP3H 5EB9A 1A6WH 2LU4A 5DK2B 4EIGB 1IAMA 3UZQA 1MHHA 1IQDB 3H7LA 4PLJC 1CXLA 1CFQB 1A1OB 4NO0D 3BKCH 4OLWH 3GIVA 1M7IB 4P9HC 4AY0A 2JIXD 4JFEE 1TTFA 3RKDD 2AJYH 2PR4L 3BUYA 3L3JB 5C09E 2IH1A 3W2DL 2VH5H 5CJOH 4U1SA 5I6XB 3QQ3B 5BS0B 3IJSB 1TJHL 3PGCA 2PXYB 1ORQA 3MNVB 4JQXC 4PP1D 2G75A 5F7MC 5HDQL 4NPYB 1A7QL 5A2IH 5ID0A 1MNUL 1NC2D 1P4IL 4X4YA 2YUZA 1RMFL 2ADJB 2NW3B 4U1IB 4OD2A 4MA1C 1NCTA 1QPPA 4LHUB 1A1NA 1IQWL 2ZUSA 5E8NB 4P2QE 4RZCA 1RZFL 3FKUS 3QIBD 3R8QA 1S7UB 3ELAT 2BNQD 3LQAL 3H42H 4NQDA 1KIRA 2AEWA 1B4RA 2J88H 1T1ZB 2GTWB 3DIFA 1A6AB 4XPTH 3G6JA 3C8KB 3CSGA 5D96C 1D5IL 2PKDA 4RFEB 2NNAA 2X41A 5KANG 5EIIA 2X4SB 1FVDB 4LSSL 3B2UC 5AWNL 2YA0A 1X5JA 5IMMA 4JPWL 2WWKT 3MC0A 4QGYA 1DBJL 3U0WH 2EZ0D 1MCWM 3MRGA 5D1QB 3CXDH 1IE5A 5T3ZL 3F62A 1WBXB 1JN6A 4MNGB 4EZMA 1LD9B 1XEDA 3FFCE 4IRJA 3A67H 3U7YH 1L0YA 1MCBA 1X6LA 4K7PL 1KELL 4BSWA 3HE7D 3LN5A 4XPHL 3CVHL 3MLYL 3DNKA 3VFWB 3O3DA 5HPMB 1LVEA 1KPUA 3NA9H 2VKXA 5E5MA 3MA7B 3WUZA 1E28A 2MQ0A 3THML 4GG8B 4X98B 5GJTL 1OAYL 2XTJE 1AHWB 1T0MB 3IRPX 4OUUA 1TVHA 3ZZ1A 1R5IB 4YIQB 1ZWIA 4JFOA 4X80H 4I9WE 1BVLA 4AEHL 4J3VA 3V4UL 2V7NA 1KTLA 4UQ3A 1UM6L 1H5BB 3KYMA 4KJYB 5DZNA 3LN5B 1A6PA 2Y72A 5H35A 2XZCL 1MRFL 2QR0B 3LKPB 1YYLL 3TLRA 1YJDH 4WCYH 5IK3B 1F6LL 3NN8B 2VDQH 5DHXB 4GFTB 3BZ4B 4RQQB 3F65A 2V5TA 4WCYL 15C8L 1G7JB 3GJFH 4BFIA 2CRYA 5DR5H 4QLRA 2R1XA 4A2MA 1LK3H 1KB5A 3IFLL 3D69B 5FUCE 4P2QD 3OV6A 1SJHB 1FZKA 2YD2A 2BY2A 3OKDA 4AIOA 3UTSE 3N9GH 4IOIB 4H1LB 5IHZB 1DBBL 3JWDL 1JTTA 2MHAB 1WZKA 1INDH 3SBWA 1DVFD 2QV2A 4C83A 2P5WA 3FT3A 5C0GA 43CAB 1RIHL 2VZOA 4Z76A 4GKNA 2DOCA 5DJ2A 4WW2B 3E6FB 4NQDD 1LO2L 3NA9L 4OLVL 4QRPD 1CG9A 3NFSH 2AJVH 3I6KB 2WBJD 4P57A 3QUYD 1ZVSB 5D2NC 3JWOL 2WBJB 4MD4A 1TTGA 2DQIH 3ARRA 3EDKA 3T77A 2XYCA 3BFOA 2KZ1B 2O61A 3FQXB 3T0EC 3RGVB 1E4XH 2DQHH 5T1KD 3VWJC 1OPGL 4ZOCA 3TCLA 4LLWA 2WBJC 3HZMA 4ZPVA 4XPGH 5I0DA 1OAZH 1PX4A 4WEBL 5F7KC 3FN3A 3GMOB 1EXUA 5D5ME 4CDGC 4DGVH 3W5NA 3GMQB 4F7CB 2YXFA 2NXZC 3VH8A 2X4PB 4EEEA 3G9AB 2EXWC 4LCUB 4IOIA 4ODSH 3IDYC 2UWEB 3LRHA 4OZHE 4EKXA 4ZO9A 4ZMAT 3EJYD 3O6FA 5DMIL 4K7PX 4UDTB 3U48A 3ECBA 4HKJA 5KSAA 2FH8A 2ARJB 1X5FA 1A7NL 4XXCC 2WMPA 1DL7H 1N4XL 1Z3GH 2FCBA 2W1NA 4PRPE 4YXHH 3BZEA 3RI5F 3VCLB 4KUCF 1SY6L 4ZUUA 2XIDA 3WDJA 1Q94A 4JDVB 4KQ3L 4Z7OE 3AAZB 1QFWM 1JUFA 3A6BH 4JFEA 3QI9C 3O11B 4Y2DB 3OX8B 5FGCE 1F58H 3VFUA 3WFEL 1YEIH 3HE6C 4JKWA 4OUOA 4WVRA 3H7BA 3LEXA 5HGBB 5J7CC 2D9CA 2XKNA 1BECA 4LLUA 1FNSH 2FB4L 3FFCB 1NAMH 1MAMH 5J13C 2E7HA 2WW8A 2YRLA 1CLYH 3IF1A 5JPNB 1G84A 1HKFA 1OPGH 1TIUA 5DHVA 3SOBH 1LE9A 2CIKA 3OAUH 3HRZB 5E2WL 4ZOBA 3SDXF 3MR9A 3WS3A 4DFIA 1ZWIB 3IFOA 4DCQA 5DQ9B 4N0YL 2C1PB 1KPVA 4GH7B 4PR5A 4YUEL 5C08A 5CILL 4PB9H 4WFFE 1TETH 5IHBA 4EI5D 4G6MH 4HAGA 1F3DJ 4NNXB 3RZCA 3CXHJ 3HHRB 4P23D 3H9SD 4YFEA 3A6OA 3NIGF 5DMJB 3E3QC 4KHXL 4KWUA 5KS9B 5F9OH 1EEYB 3O45A 1CS6A 5EC1A 1BBJB 1T0NA 1QPXA 4H8WL 1Q94B 3ZE1F 2OXGA 3RTQD 5I17B 5MI0C 1AI1L 3K1KC 4OAWB 5EU7E 4LCIH 2ZUWA 2YMXH 3DOSA 1UWGL 4FMKA 2H26A 4GBXD 5JMOC 1XF3A 2FLBT 5DI8A 1EAPA 3UJJL 4MXQD 4M4RA 4LAQL 4U7KA 1I8IA 3CU1A 1U8OB 4XAWH 1XIWC 4LNVA 4UIMB 4P5TC 1JNNL 1F4YH 2BVUA 4JQIL 3ZDZF 4YXKL 4C83B 4I1NB 4C55A 4EIZC 1QYGH 1CL7H 1I3RB 3ZE1E 2O5XH 4Z6AT 1WFOA 1HXMB 1T1ZA 5DDHA 5C0DB 1V3JA 2XWTB 1H3VA 2DDQH 2XACC 3DLQR 3V5KB 5ID0B 3GSNH 4U31A 1CXFA 3VGFA 3ULUL 2E7LC 2HJKB 5JHLL 5DQJA 4PGDB 4X80L 1F2QA 4V2BA 4AEIL 5ALBH 5GGSA 1FL5A 2R0LL 3V4PL 4QT5B 4XNYH 5C07A 1R3KA 3NABL 5ERWA 1OAYH 4C4KO 4LLQB 4LSQL 2YPKA 4ZAKD 2BRRL 3BPOB 3S88H 4RWYH 4RGOL 4E42B 1A7RL 1A4JB 1GGCL 3ISWA 1M1SA 1QSFD 1CDUA 1D7FA 4WTXA 4XI5D 4CKVX 3MLYH 1UT9A 4H20H 5HI3C 4TUJA 5TDOA 1OTSD 1NCBH 4M7KL 2XNAB 3QIBB 1H3UA 2F58L 1F45A 3DMMC 2Q76B 4I0PD 3VXRB 4UB0H 1AFVH 4U6HA 1AHWA 2HFTA 3PUCA 1A7RH 5GJTH 4DJMA 4QO1A 1MRCH 2AEPH 3MCKA 1U8HB 1A64A 1HSBB 5A2JH 5EOQL 3QIBC 1KCLA 1FCGA 3QRGL 3WUWG 5TE7L 1GAFH 1F4XL 1N59B 3U1SL 2PXYD 2B2XL 4WGWB 1VERA 3CK0H 4HXBL 1MJ7H 3MA9L 4HIXH 3GSNL 4P2RB 4HIIA 1T5WA 3O11A 2CKBB 4P2OD 3NPSB 4U6XB 1EEZB 1HQRA 1AGFB 1RUQL 4Y4FA 2HT3C 1X5GA 5I1IL 2B8OT 1QYGL 3H6JA 3P0GB 2L4OA 4KHXH 4Q58C 1V5JA 2RHEA 4FQIH 5L6YH 1OCWL 3QFDB 1WEJL 1CICC 4L5FH 1FPTL 3UTSB 4R4FL 1YNTB 1FFRA 5C2UB 1TVBB 2HJLA 5IIEA 5HDQH 3RBSA 1SHMA 5D7KD 4K7PY 4MHHI 3RL1B 4UNUA 1G9NC 1S7UA 5F1SA 3BAEH 3RPKA 3H3PL 4DK3A 2FJHB 1XGPB 3G6AB 3MROA 4OIIH 1IQWH 3V0WH 1U8JB 1E6JL 5FCUL 1JGLH 4JRYD 4MXWL 4NO3B 3DX8A 3TBWA 5B38G 4WU5A 4K3EL 5F7UA 4Z8FH 1OTUD 3QIUA 4MAYD 2QSCH 2JIXB 1E6OH 1FV1B 2X9XA 5LGKA 4YC2B 3BKMH 3HZYB 4U2ZA 3VXMA 3A6BL 4WHDA 1MFEL 2NLJB 3IFNH 1RVFH 4OBSA 3VXNB 2C5DC 3TJEH 3KLSA 2BMKA 5EFIA 5HHQB 2IMNA 4YZFF 3KXFE 1JGLL 1XMWA 5DMYA 5CLTA 5ADOH 3ARED 2N4IA 2N56A 1MCFA 5IVNA 2VXVL 1AGDB 5HYJD 4KRNA 1WZ1H 3K4DA 4NO0A 3OAYH 1R5VB 1SJEA 1P5VA 3VG9B 1RZKC 4LSRH 4WIQA 1PGRB 4TOYH 2CUMA 1DBKL 4JPVH 1N6VA 2EH8L 3AROA 4RX4D 1EAPB 4GMTL 4NKIH 3MXWH 5C1MB 1FO0H 5HDOA 3DX7B 5C0BA 2X7LB 3WE6A 2GAZA 4G8IB 4BJLA 4NN7C 5IB4A 3LVEA 5IR1A 8CGTA 1J18A 1BF2A 1S9VB 1LP9E 3KYOB 5I1IH 3T1WA 2AEPL 5C0RL 2VLKD 1JFQH 4OCWH 5DA4A 1FVEA 1PYWA 3R0MA 5SWSD 1YN6B 4YHYB 4YDIH 2IPKB 4M7LL 3NCBB 2FWOB 4UUJB 1U9KA 1FDLH 4Z7WE 5E0QA 5ITFA 1FL3B 4U1KB 3G5YA 2KDGA 2P5ED 1ZLSH 2FGZA 1AKJD 1LP9F 2VDNH 4XPGL 5DJDA 3UPAA 4RIRA 1KXVC 2AXJA 5K9KB 2C1OB 3O0RL 4R26L 5F21B 5GGRY 4DTGH 1HDMA 3V4PH 1KPVB 4M4PA 2K1MA 3JUZA 5CS7A 3GRWA 2X44D 4M5ZL 3MJGX 1XF1A 4HQQH 4CW1A 5JHLH 4S1SH 3WFCL 4OZIE 3OXRB 1YEKH 5ACZA 3ARFA 4ZNEE 3DO3A 2I60H 1YNLH 2P1YA 5ITFB 4W6WB 1IC5L 5ISZD 3EZJB 1AGFA 2BNQE 3F7QA 5M7QA 5B21A 4PJHB 3V5HA 4LSQH 4P3DB 2NW2B 1EFQA 5CJQH 5IT2H 5M95B 4YE4H 3HE7C 2C3HA 1TMCB 5FUZL 5AG9A 2HLAA 2Z4QA 4R0LA 4MAYA 3SY0A 2R0LH 4XC3H 2D0GA 1BLNA 3HUJB 4K71B 1T1WA 2FH6A 4M1CC 3P11H 4I3SL 3V0AC 1WBYA 5GGTA 3EDEA 4NHUA 4RAUB 2X10A 1UB6B 4Y88A 1HIML 4M43L 2Y7QB 3UP1A 3X14A 1QSEA 1JMXA 3DIFB 2GSGB 2VLJA 3L7FB 5BJTB 1AR1C 2MPAH 3BRDA 2H41A 1A3RH 5ESQB 5FO9B 1IBGH 43CAA 1B0GA 4KKAC 2Q8AH 5GRUH 4QXUL 2EIZB 2ZOLB 1RJCA 3C2SA 4Y1AA 1AGDA 3T65A 3ZSSA 2FYYA 3WIHL 4G8GD 1EEUA 2JK5B 4G42B 4HFUH 2OM5A 4OLXL 1VFAA 1JGVH 1JWUB 4O51B 4XNQA 3PDGA 1KELH 5E2UH 1KLGA 2AXGB 2J6EH 1M05A 3BE1L 2IPKA 1DUYB 2I25N 5BW7A 3CCHB 5IEKA 2GUOB 1S7TB 3QQ3A 3WO4B 1DVFA 5CP7A 4E5XA 3WBDA 3HCVA 1MREH 3QR2A 3S98A 1K8DA 3BN9C 3EFDL 4WU5B 3HUJE 5I8OL 1D5BA 5JIKA 3FT4B 2QL1A 2APFA 4ZUWA 1H5BA 4F37F 5EPMA 4M6NH 3KS0H 5DK2A 4K7PH 3DYMA 1D6VL 4JO3H 3MV01 4RMVA 4ESKA 4K3DH 5BRZD 3P30H 2CSPA 4G80B 4HKBB 3MZGB 2JB5L 3IKKA 2A6KA 2PW1A 3AXLA 4LGSB 1IEHA 2H1PH 5SWQB 3MRLA 1FNSL 5D5MF 2VL4A 3BD5A 5KN5A 1TITA 3MLZL 5JDSB 4S2SB 4DOHB 3WJLC 2YRPA 3QDME 2VIRA 3W0WA 5IK3A 4HKXB 3UBXG 5ENWB 1K4DA 3UO1H 2BSTB 3CVIL 2A9NL 3HG1D 3NCJL 2X70A 3D3VB 2BOBA 3N1MC 5JPMB 3OKYA 3VU2A 4DW2L 5GHWL 1BBJA 4AM0B 1HQRB 4AL8L 3IFNL 5DD0H 5HI5D 4CMMB 4U49A 4Q6IC 1IILE 5EORH 2VWEC 1CK0L 2ZKHH 3T3PE 3TO4D 3D3VD 1I9RH 3CMOH 5C0AD 1IGJA 3IAGC 1ZT7A 5DJ2B 2Q7YA 3FQWB 4OF7A 2LAGB 1S5HB 4M7LT 2Z91A 4JZOB 2AXFA 1HE7A 5F1NB 1JPGB 2AP2A 4FFVC 2C1PA 4NKMB 3IVKB 4XBEH 3QUYA 1KACB 4MYWB 1QFUL 2V5SA 5ICZA 2FJHA 4ODSL 2P43B 1RVFL 3WS3B 3KLHD 4LCCB 4FS0A 5CCKL 5DUPL 2DIAA 5TDNA 5JORA 3OZ9L 1DEDA 4M6NL 4Y8DC 4TNVF 4MXVE 4Z18A 4XVSL 3D25B 1NGZA 4G7VL 4F57H 2ESVB 5ESAA 3GSRA 2XZQH 4PBWD 5A2LH 1UZ6F 2NPLX 2UWEE 4RIRB 3SE3C 1WBXA 4NP4H 1BZ9A 3RP1A 4UTAH 3C87A 4QRUB 2A73B 2OCFD 4G6AC 4KI5D 5K9OA 4LF3A 1ND0A 2BJMH 2CUIA 2NY1B 1RUQH 3GMNB 4WO4C 3MRFB 4U1GC 4TPRH 5DMGC 3BWAA 4BFEA 3HNVL 2VLRE 3RZCD 4NCC2 4ELMF 1BWMA 4EI5A 1U8PB 2X4TA 4MNHB 5CGYD 5J4MA 4H0HB 4PGDA 4OQ1A 3MO1B 4P4RB 3MTRA 3WNMA 3KNBA 3VA2C 1OCWH 1U8QA 1SJEB 2BOCA 3U4AA 3BD3A 1ZT4A 2QADC 3OKLB 1IJ9A 2FD6L 3MCKB 5JOEA 3WNNA 4WHCA 3H9YA 4LSDA 5HXMA 1S7WA 4OD2B 1I8KA 1QLFA 1A0QH 3I3EA 5I16A 1PD6A 4PJBF 4HS6A 4ELME 3K7UA 2DI8A 4CVZB 3RWFB 4OZGE 2K9UA 1LK3L 2VN4A 8FABA 4XP4H 2J12B 5L7XH 4WW1B 4N1HB 4YO0A 5BS0A 3CFKA 1PYWB 2B1HH 4H1LH 3F7PC 4JG0L 2XZAL 4ENEC 1TQCB 1UG9A 5D7IA 2NQCA 1U8MA 4ONGL 1NGYA 5DJCA 5IV2B 3L95A 3KPLB 3IU4L 3THMH 4M5YH 1KEML 4NQCA 3IT8D 5ISZB 3ETBF 1C5DB 2ZCHL 3M8OL 4KPHL 1IZKA 4C54A 1BFSA 3FCTA 2JK5A 2P48B 4OF6A 4PJDE 4LRIA 2BSRB 5J11B 3C2AH 4N0FB 2IH1B 2F15A 3LD8C 4JDTL 4H20L 2HTLC 4NNXA 3RZCB 1LGVA 5FDYA 4QTHA 4PJCB 1GHFL 3RL2A 3VI3E 3P2TA 5C0GB 4LCWD 5J13B 4WJ5B 2J2ZA 4XP1H 1EMTL 2PETA 1NEUA 4WHYH 4N8VA 4LKCB 4YAQA 3DMMD 4DN3L 1FYHB 1MCKA 1HSAB 1S9WA 3PV7A 4FXLA 3HC0A 4PJGE 3P9MB 2KL6A 4PJDF 1OHQA 3S6CA 1ZLSL 3N85H 3RWEA 3WMSA 4OGAC 3U2SB 3L6FA 4HJ0D 4DZBA 3BZDA 1E4WL 1U2HA 3B6SB 5EO1B 2J88L 4AMKH 2YMXL 5A16A 3HZYA 2IG2H 4QRRE 4ZO7A 1NLBH 5GS3A 1JNLL 1AQDB 1S78D 4JZJC 3Q6GH 3U0TA 1OT2A 2E9BA 4LU5H 4X4XB 5C0CA 5L88H 3MOBL 3HZKB 4MNQA 3EBAA 2X9WA 2VXUH 1U8JA 5AZEL 2PW2B 4QRUA 3W0WB 5HHMD 3B5GA 3BEVB 4F33B 5EU4B 1KTKE 5EBWA 3UTQB 5EC2B 4QXGL 1F11A 4PB9L 4XX1G 3T08A 1CFVL 3O6FB 1T0MA 1MY5A 5D9SB 4X9BA 1IGYB 1KTRL 1K2DB 2WQRA 4U6VH 3SBWC 3L9RA 3GEWB 4OM1H 4Q9RH 4YLQT 3OKOB 4PG2C 4LKCA 2NY0C 4G9DB 1EX0A 1YC7A 3PG2A 1QO3B 4NP4L 4U6HB 2HH0H 5C0CB 3MRKB 5JW3H 1P7QA 2CMRL 4X6FB 1OWRM 1U3YA 4JCLA 4WGVB 4OF8A 2XZQL 5H2BA 1A4KA 3GJEB 3QH3A 2VDLH 5D71L 4X8XA 1HH6A 2BERA 1Y6NR 2EDYA 2GK2A 5D1ZA 1Q9KB 3HFMH 4NO5A 5T5FH 5B3JE 4V1DA 2GUOA 1JMZA 5DD0L 1C5DA 1S9XB 2GYSA 4DW2H 4MJ6A 4DVRL 3U2SA 1FE8H 2E9IA 3BKCL 3LS5H 5IVOA 1BQHG 3ULVL 2CLZB 1X44A 5F7EL 4P46A 4XNZB 3MV7D 1DCLA 5T1LA 1RZ8A 4X6CF 5E00B 1OW0C 1U8HA 2B4CC 4JE4B 4HK3J 5IBUB 1HQ4A 5SX4H 1NUNB 1CFTB 4J6RH 1G7QB 4HCRL 1FYTA 1F58L 4XRCA 3MV8E 4PFEA 1AJ7L 4PG2A 4NNPL 5FYJL 5B8CC 5E9DE 3BEWA 1MLBB 4HIHA 4FQXB 5E5UB 1HXMA 5TQ0L 1NCDL 3OKMB 1NPUA 4F7CA 4M00A 2FZ3B 3QWRA 4MA8L 5IQ7L 1Y18A 5K93A 5FB8B 1EO7A 3ARYA 1T0NB 4KY1H 5IV2A 3NIDE 4X7SL 1G9ML 4GO6B 2JLLA 4NJAL 3MV9E 4WV1B 3VXMB 3PE9A 3ZYIA 3PGDA 3N1QC 4HWEH 1MHCA 1F02I 5DLMH 4XVTL 4KAQH 1C8PA 3D85A 3CMGA 3JWOH 1S9YA 4M8QA 3VGBA 3SO5A 5HGAA 1UYWH 2CO7B 2AJVL 1OAQL 1LEIB 4C59B 5KAQG 2YEZA 5IQ9B 2VL5A 1YPZB 4IMKA 1K8IB 3ARDB 5E4EC 3OGOE 3RWGB 2F5AL 2OL3H 2YUWA 2VAAA 4HUXB 4OUUB 4P5TA 1WT5A 5GRYA 2DLFH 3G5VA 1NMBH 4MQ7B 1UJ3C 1INDL 3FFCA 4HFWB 1I8IB 1DBBH 2JJVA 1YEDB 2N7BA 4PRHA 2NY3B 1D5ZB 4KRPD 2OP4H 5DTFB 1AE6H 3O41A 5FCSH 3FONA 5KVFH 4L8CB 3CGTA 1TJGL 1YECL 3DURB 3QFJE 3RNQA 1JPGA 2VLMD 3PV6B 4RGMC 1G9NH 3LKOA 4LRNH 5GGQL 3LSOA 4FG6D 3T0AA 3VXUE 1EK3A 3KR3L 5EWIH 2ZG2A 4XWGL 1TDQA 1SYSA 2JCCA 1UACL 1T5WB 1I3GL 2VMFA 1YJDL 3VFRA 3HC3L 3ULVE 2FX9H 5FKPA 2EYSB 3SGDH 1NFDE 3SJVE 2NXYD 5I19L 3TH4T 2ESVE 3ULUH 5FHBL 3DX7A 4S1SL 2HVJA 3MRIA 5E1AA 4YHMH 4C57C 1A3QA 2WM0A 3T04D 2R0WL 3TV3L 1DQMH 3QXUA 5KTEH 1HSBA 4IDJH 4JFXA 1KN4H 3HG1E 3QEQA 2YN5A 2RAMA 4YGAB 3SDXB 3FHAA 4YXKH 3M1BB 3GMOA 1MCNA 3ULVF 4HIJA 4LKXB 3UJIL 2XNAA 4PRAA 3I2CH 3DVNB 5IG7A 3O3AA 4P59H 2NY2B 4N5ED 1RULH 1KEGH 1B88A 5DA0B 4DK6A 3WFCH 1LE5A 3INUL 3O2WL 3NTCH 1CDCA 3QRFM 3MV9D 4FQCH 1UA6H 1AR2A 1OY3B 4UUJA 1KXQE 5E03A 2BOBB 1LO0L 1ONQB 2FLRT 4HW6A 1B90A 1P7KB 4F3FB 4OM0H 3M07A 5L9DH 3HZMB 4ZPVB 3LN4A 4XCNB 3T0WA 1PKQB 1BEYL 5B3NA 2DQUL 1WC7A 2CPCA 3LQZA 5DMKB 4JDZA 3O8XB 2V6HA 3QUYC 4ODHL 3VGGA 2HWZL 3KPRD 1MWAA 2XRAH 3FTGB 3HR5B 3SDCC 1I7TB 2XY2A 4RAVB 2VUYA 1D5IH 3C5ZB 4PD4K 1YYMH 1HYSD 1CYGA 1ZVYA 4JRXA 4NN5C 1CG9B 4I0KA 2V7HA 4EXKA 1T21A 5IKCA 1MLBA 3Q5OA 1J1OL 3GMQA 4HIHB 3RWJA 3MBED 5E2WH 4KUZL 1IFHH 4XP6L 5C0EA 1BGXH 5F1KC 4NJ9H 4M1GH 4ZXBA 2FJFA 1WLHA 3I50H 4BSVA 5K33A 4PJEE 6FABH 1VKXB 4IIQA 3TGXA 3TZVA 5DHVH 4R8WH 1NAMA 1SQ2N 4QF1A 3SHSA 3BXNB 2BVEA 4JG1L 2X6MA 4NSKA 5CIPA 1S9XA 4GLRH 4XBPA 3QUZA 2OJZH 3RUGB 4NCDA 1CTNA 4D0DB 1J0KA 3QIWC 3DROA 2YHGA 1Q9OB 2XQBL 3LRSB 4WNQA 1AO7B 1EEQA 3NN8A 1Z3GL 4H5SA 4G8FA 4J3TA 3SPVB 2F74A 3EYUH 4L8DB 3S34L 3EOYG 3C5SB 5FCUH 2CDFB 5AYQA 4IM8A 3LS5L 4CN4A 4OIIL 3QDGD 3I75B 2V7NB 3W11D 1CGYA 1RIVH 4KVNL 3I6LD 3TIDA 1U2CA 1OAUL 2WIIA 3D69A 2VDLL 5D71H 5C08D 1MPAL 4LLVB 3VXQB 1G0XA 3REWB 3N50A 4F33A 4NQVA 1T3FA 4RBPH 2EE9A 2PO6D 2FIRT 4U3CA 1ZOXA 2AKRB 4FXKA 3RWDB 3QIUC 1KB9J 1JWSA 1K4CB 1RSFA 3FO9B 5F8RC 1FL3A 3ES6A 2VDMH 3QJFA 3KYNB 1G7PA 5DJYB 3HC4L 2AI0L 3L3GA 5IMMB 5HYJA 3DX6A 5DJ8B 3QJHA 5B4MD 4BH8A 3QIWB 3UDWA 3BJLA 5GGSB 3FAXA 4HK0A 5A43C 5D2NA 4PRID 1VFBB 4PRPD 4M6AA 3WHE1 4X4MA 2HTKC 1EO8H 5FIEA 3GIZH 1WBZB 1SYSB 4D9RE 2JKXA 5D7JC 5C0IB 5E5MB 1IEAA 4F7TB 1HN1A 5LJYH 1KPUB 1YMMD 4Z7QE 3I6GB 3SKJH 2WUCL 1KTDB 4ODUA 1RIUL 3CFIC 5J9PB 4U1LA 4JKPH 1KCRH 3RWHA 3S8WA 4MAUH 4HXBH 5D7LD 3BT2H 1N2RA 4R2GD 3O81A 1W8OA 5DK0B 3O9WD 1KUMA 5GISL 5TFSL 1JHKL 3FHQA 4WO4D 4QTIL 3TCLB 5TE7H 2H26B 5F7YC 1U8IA 5BCAA 1WZLA 4TSCL 2MWCA 3WLBB 1UZ8A 1M7IA 1CT8B 2XA3A 4WFGE 2LABA 2GAZB 3MBXL 4U4BA 4S11A 2ZPKH 5HY9B 5JIHA 4R0LC 1UM6H 1QBAA 5BOZG 4PJEB 2ZUXA 3SQOH 2Z31B 4JDTH 5JLZB 5LXGH 3FRPG 1UH4A 3ARGB 1MCQA 3VXOA 5DFWH 1XZ0A 4FABH 5DRXB 3MRDB 1AXTL 1Q72L 3NBNA 2ZCLH 3K46A 4IOSD 3L3IA 1T1YA 1H9VA 5I1JL 3B9VA 4TNWF 1EIBA 4X4ME 1U8QB 4DFHA 2Z35A 4EOWH 4UIMA 4L4TE 2HTKD 4QRPB 1F97A 2AJZA 4IRSB 1EUUA 2R39A 5DURD 4EI5B 4IRZL 3SKUD 2XI9A 3NPZB 5D93C 2CJUH 4CN6A 4L3EE 3RU8L 4M62L 5JXAL 4FFYL 4JFDD 4YHPA 1CLZH 1QFOA 3MFFA 2V2TA 2ATKB 3UPRA 5JR1L 3P73A 5FUOH 3VD5A 2BDNH 4CAGA 2WINA 3C6SB 4L3EB 5IJKA 3WHE0 5T1DH 1NBZA 4N1EA 4G7YL 3BH8A 2Z31C 5DWUL 5IM7A 4P2OC 3SGEI 4ZOAA 3SEPA 2OI9C 5IGXL 4UDTA 1LP9B 2ZUYA 3ME0A 4R97C 1N59A 1CGTA 2Q8BL 4QWWD 4LSPL 1MJ8H 3JV6B 2H3NA 4I3RL 3PWVB 2KBGA 3BH9B 3EDDA 4AK1A 5F9OL 3P0VL 3EDFA 2AS5M 2L7UA 1JF1A 5TE4H 3EYQD 3Q1SH 2VDOL 4JY4A 2BX5A 1BBDH 3U4BL 2BDNL 1A3LL 1U3ZA 3BP4A 3P4MA 1DQDL 5F9JB 4QNPE 3UTPD 3QXVA 4Z78B 5E8DH 4LLAA 4S1DD 3TA3A 4RGND 5DC0A 2P4AB 3MOAL 2WIIB 4X4ZA 1CIUA 3V7AE 4ALAH 5DRNB 4JDVA 4JN2A 2A6DB 2G60H 3ZKMC 1MHEB 3P4NA 2YPKB 3BGFB 3QNZB 1HH9A 5DC4B 1UKSA 5MEPB 2PW2A 2GKIA 2J8HA 1XCQA 4YAQB 1FORL 1FL5B 3RTQA 1ES0A 1A6WL 5I1EH 1HK6A 5J11C 3CMOL 3MFFB 1YY9C 5IFJB 2NX5B 4OLUH 4ZUVB 5GGVH 3W82A 5IFHL 3WN5A 2WBKA 3EYFA 3W0WD 2DD8H 3I3DA 4QRQB 4KI1A 1RUPL 2EKSA 1A1NB 1MAKA 4HKZA 4NQCD 4JY6A 4X99B 2Q86B 3O3EB 1N4XH 1A7NH 4KK6D 1B0WA 3VD7A 4K94H 3VG0L 1NAMB 5I8KH 1IC1A 1IAII 2B20A 2YA1A 5D8JH 4TULH 5K9JL 3BX7C 3B2UD 1DVFB 4OLEA 4E5XB 3IJSA 4U0RC 1GGYA 1D5MB 3CH8A 3WYRA 4OAWA 3EOBA 3GB7A 2Y06L 4Y16D 2XQYG 1AP2B 2X1OA 3GNMH 1YY8A 4YK4C 4PJFB 5FM5O 2D0FA 4IDLA 1UWXK 4JM4L 4LBEA 4JKPL 3U6RB 2C3VA 3VXSB 4F8QA 1RZGB 1B0RB 3SDDC 2ITCA 1UZ8B 4ORZC 2DLIA 3CFCH 3JWNC 3STZB 3VGDA 1NCWH 5GGTL 3QUKA 2A77L 3BISA 3BE1H 5KS9F 1HXYA 4WW1A 4YO0B 8FABB 3U46A 4BZYA 4O2CA 1OVZA 4ZAKB 3NFSL 2PUQT 4U1MA 4H1LG 3WIHH 3G08A 5DJZB 2DB8A 1J0HA 3J8F7 4NQXA 4OD1L 4Q9QH 3U79A 4PJ5D 1KOAA 3QEUB 4UBDD 2KQMA 1WGOA 4L29B 5KS9E 2JCCB 5E8EA 3BPCA 5FGCB 3V5HB 4PRHD 4XNUH 1FZJA 4NKDA 3VFVA 3X3FL 4BKLB 1NCNA 4F2MA 4XPBH 2VC2L 1HEZA 4O4YL 1BZ7B 4Q7DA 4PBVC 3SDAB 3QFJA 5IHLB 3OKNB 5HVHC 3GRWL 2ZCKH 5ETUA 3EUUA 3MUY1 3OAZK 2Z9TA 3MYJB 1QSED 2MSPA 3C08H 2VDKL 4XC3L 4NKMA 1RY7B 2YD3A 3ECBB 1N3NA 4GOSA 3TZVC 4N8CL 3BWUC 2VLKB 1X7QB 4XTRD 3SKMB 5DRWA 3VRIA 5EO9A 4LLYA 4QOKA 3FO2B 5IBLD 1KJVB 1CWVA 5ICXB 4PP2A 1C1EH 4Y2DA 1MLCB 3GBNL 5JA8B 3RIFK 4P4KC 4OIBA 1OGAE 2OTUA 2F9BT 4JFFA 2EXYD 1E0OB 4M61B 4WWKC 5FYKL 4RRPA 3SN6N 5IMLB 5GS0L 5ETUB 4FZ8L 4DZ8A 1FFNA 4TSBL 4TVPL 3DUHA 5TPWL 3SDCD 2OLDA 4OFDA 4HULB 1C7SA 2RJMA 3CU7A 2F74B 2PO6B 1G7MA 3DI3B 2IBZY 3QFJD 1JF5A 3T77B 3NCYP 5CMAB 2CO6B 2YOCA 3M17B 3LV3A 3MV9A 3LEYL 2FJGB 2DQDH 4JB9H 1FIEA 4JM2D 2Z93A 2ATPB 3WEXB 4KV5E 1FVCA 5B22A 2HFGH 4UT6L 3CX2A 3BP6B 3HPJA 3K74B 4ZFGL 5F3BB 2DMKA 1J1OH 4NSKB 1DR9A 2DRUA 3GUTA 5KBNC 2I5YL 3OJMB 1FAIH 2R4SL 3QQ4A 4PB0L 1KB9K 2UZIH 2B0SL 4XNZC 3BKJL 5F7DA 3QCUH 3ULSA 5CP7B 1A02N 5JXED 2AK1H 4ODWB 4X7TB 2BHYA 4P3CL 4YDVA 5FB8A 2P8PA 2VE6B 1R3JB 4HIEB 1KPRA 5FV2A 4K3HA 1DBKH 5C0CD 1MSPA 4EDWH 1DN2A 3TO2B 1B2WH 4NKQB 2CKNA 1GGIH 3IXAA 1Q9WA 1IT9H 3IDIA 2VABA 2DF3A 2XWBA 3BGMA 5FO8B 1XF2B 5FF6B 3TBTA 3EGSA 1KJ2A 2R9HD 4J12A 1J5OH 2DQCH 4QY8A 4JVPA 4TVPH 1FNHA 3FB6B 1FBIL 4JFDE 2GSIA 4IDJL 1IKFH 1RFDL 1W72H 4LP5A 4XCCH 3UEZA 4O02L 3TYFB 1TVHB 5J89A 5KJRL 3H0TA 3MRJB 4L9LB 4WFED 3D3VE 3WFHA 2AJXL 4PJDB 1NMAH 3AU1A 4DN4H 3PHSA 4PY8J 1AXSB 4XBGA 1WITA 3REVB 2HRLA 3BP4B 3MMEA 2W0LA 3OHXA 1SBSH 4U7MA 3L5JA 2C3XA 3V0WL 4Y5XC 2YPVH 3HE6D 4S0SD 3BHBB 3MLPA 1SJVA 3E8UL 4TVPE 4N0RA 4A6YA 1KLUB 3RVWC 1MEXL 1DSFL 1WAAF 1CL7I 1G6RB 3VWJA 2UVFA 4XCYA 2ADGA 2GJ6A 3LV3B 3MV9B 1DQJA 4HPYH 2DBLH 3B9KA 4LLMA 4XZUB 2C26A 1MELA 3VRJA 4XMPH 3FB7B 2W59A 4HUWB 2VDRL 2XWJB 5JQ6L 4G6FD 4J3SA 3AY4C 1CQKA 3P3YA 5SV3A 2XTLA 4HUMB 3AS3A 3WLWC 4LIQL 4YHYC 5BVPL 3CVHA 5TDPB 3RNQB 1RZKH 5GZOC 4PJCA 1OP5K 4BSWB 5JO5B 4EI6B 3T1FB 4KGJA 4XCEA 2APVA 2CDEA 1FSKC 2VR9A 3GBMH 4N9GB 4OCNC 4PRBB 4LEXL 4S0TD 3ZL4L 5DVOA 3MNZA 2DYPA 1KGCD 2AVGA 1FG2A 4QHUA 5J6GA 1W0WB 1KB5H 3T3ME 4D3CL 4Y1AD 5E95B 2AQ2A 4GG6A 4PJ5B 3FQNA 4YJZL 2E7MA 2IBBA 3BOVA 1U8MB 4K2UH 3V6ZB 4QT5A 4UB0L 4RRPG 4HDIB 1ZTXH 1NJ9B 5E8OA 4O9HH 9CGTA 2GTWA 2V5RA 5F7NC 1F2XK 1JNJA 1F5WA 1ZV5A 4MCYB 1B9ZA 1Z5LB 4CVZA 4JGMA 2W9EL 3AREC 1JZ4A 5DD5L 1DSFH 4EN3B 1IAIH 3FO0H 1P84J 2YR3A 1CGUA 3EYSL 3HE7B 2E6JA 4FTVB 4HV8B 2FO4A 5TE6H 2FSEA 4GMSL 4PJXE 3L95B 4KKNA 4PRIE 1JTOA 5KSBE 3KAAA 1L0XA 3NCFB 5B39A 5E2JA 5F89A 2V5MA 3ULVH 3MRHB 3RDTB 5ANMA 3QNYB 3ZKXB 3VFOB 5IP4A 1RUPH 4JFZL 3O4LE 1FZOA 2HMIC 1EFXA 1P6AB 2HT2D 1IGCL 2FEDD 3QPQC 4O02H 4P5MA 2QQNL 5C9JA 3CVHB 5TDPA 1QBBA 1FFQA 3L3HA 4MAYC 3V4VL 3V7AG 3ZKXC 1ADQL 3CAFA 1P5UA 2OQJB 1QLEH 2VDPL 3GM8A 4KVCL 2VNCA 1F4YL 3HG1A 3CLFL 3RIFF 3V6ZA 2IANE 1AQKH 1Z6JT 2KZWA 4ZUTB 2EE6A 1CT8A 2K7PA 5C2BH 4EDXB 5IFAH 4XXDB 2OMBA 4MNHA 4M6MH 4Y4HB 2J5LB 5C0FA 4ONHB 4FNLH 4BQ8A 3AREB 5FDWB 4NBZB 4XCYB 3CFBB 1JPTL 1QBLH 1KJ2H 1C5CL 1LEKB 2CQVA 2HFFB 1D5XA 2XY1A 1AO7D 3IDMB 3MLWL 3MXVL 3STBA 1C7TA 3NFPA 5GGUA 4ZFOA 2J5LC 5CHNB 4ZXBC 5FAAA 3FB5A 3ARQA 1A7BA 2VXUL 1ROWA 3IJHB 4BM7A 1QLEL 2VDPH 1GOFA 1MFNA 2YD4A 5DS8B 2E9WA 1KCSH 4PY8I 5CINL 4TVSa 2B0SH 3HAEH 1IGJB 2HT3D 1KJ2L 3DRTA 4GRMB 5FYKE 3WXWH 3WO3B 4ORGA 2LVEA 1EJOL 4X9IA 5JXAH 1WZMA 4G8GA 3UTZA 4M02A 1OL0A 1CGSL 4JHAL 3GHEL 1UADC 1JHLH 2OS7A 4BQBA 2DJUA 3QIWA 3FMGH 3I75A 5ADPL 5IW1A 2X9YA 3MGOB 3C6SA 1HH9B 4UNVA 3PHOB 4HUNB 4QY8B 2X4UB 4WI9A 1MY7A 3MCLH 3PDOB 4YDLB 4QNPF 4M8VA 4Z95H 1WCQA 2I9LA 4Z7UE 1X4ZA 1HI6A 3U0TB 2HRPL 5IBTH 5IESL 1JK8B 5E2VH 1M7DB 3S37H 5SX5H 4A6YL 3T8XA 5FYKH 5F89B 2CKBL 1SY6H 2X4RB 2A6JB 2DAVA 1G7HB 1U95A 1OP5H 2GITB 3D1MC 3LRGA 3CZFA 3G6JF 4DKEL 4ZAKA 2VE6A 3TBYB 4L3ED 3LKRA 2AW2A 4X5LA 4XP9L 2NY4B 2ZPKL 4R4NC 1FRGL 4TUOA 4KKBD 4M5YL 5GS2H 3EO0A 3IU4H 5FHAH 4KU1A 2GJZB 4MCZA 4OFYD 4Q6IA 4LVOC 4LPTA 5LCVH 1EDQA 3RL2B 5HGHB 4BELD 2VABB 4ONOA 4PV8B 1I7RA 1G6RH 4DGVL 2BXZA 1BFVL 1ZS8B 2ICEA 1QD0A 1QP1A 3ARFD 1CD9B 1MH5A 1ZTXL 5C0JB 5HHVL 3QDJA 4QOKE 3KPSD 3VWKA 2M1KA 3EOAA 3QHFH 1FYTE 3ROLA 4MA7L 2EEBA 4F58L 1QKZL 4PS4H 1PKQE 2NY1C 2Y07L 2YC1A 1ZEAH 3QWOB 1AD9B 3NFNB 5I15H 2MHAA 5EIVA 5D1XC 4HAFA 1G6VK 2BC4B 1DUYA 3KGRA 1I75A 1MF2L 3OR7B 3BT2L 4YR6B 2OTUB 3O2VH 1U95B 4OLVH 3BUTA 5DVLA 3VRLE 1T1YB 4Z7WF 2WLYA 3ZTNL 2VZUA 5CAYB 4H88L 1M7XA 5JOPD 2OYPA 1NCUA 1RUML 4Y4KD 4ZYKA 2XQYK 4YEEA 4HH9B 3JWDH 4LNRB 3ARGA 1U8OA 3KPMA 5JLZA 1VDGA 3PDDA 3FO1B 1W0VA 5CBAA 1JJUA 3O2VL 5I76A 4MJIE 4PR5B 4RAHA 1MPAH 1XF3B 3OXRA 2Y5TB 4HG4K 2DKSA 2FR4A 2XKSA 1HHKA 2BNRD 3D9AL 2HG5B 2ZSWB 1WUNT 4Z7NF 5LCVL 3U4EB 1FGNL 1YEFL 3BHBA 1S8DA 4LPWA 4ELKA 2C7UA 1A9EB 1U6AH 2NXYC 3QG6A 4QHMA 2WZPD 5C0AA 4FZEL 5F6IB 1E28B 1RUKL 1JZ3A 2AKRA 4P4KD 2E5EA 1T0PB 2DS4A 3IYLW 3T1FA 2ORBL 1IL1B 1ZVHA 5DFTA 3HZVA 4HMCA 5C08E 4V2CB 2R23A 3F12A 1I9EA 4XB8A 1OAUH 3OGCA 4RFNC 1CXIA 4RNRB 3RVVD 4Y5YA 2BFVL 5KW9L 2R2CA 1FBIH 3C60C 3CSYB 5JHDA 1EZVX 1P7QD 3U7WH 5HYEA 1VEPA 3QUKB 1JGDB 3KYOA 1LP9A 1BOGA 1EPFA 5I1EL 4OFYA 2Z91B 4JZOA 2IFFH 5F72S 2YD5A 2ITCB 4JPIB 5JNYB 4JQVC 2ZSWA 5C6TH 2XTJC 1J8KA 1HHIB 3FMGL 3PWJA 2X5PA 4IIQC 2H2PC 3C8KA 4NJ9L 4OF0A 5ALCH 3DX6B 4HK3N 4U1KA 5DUBB 3MRBB 4PTTB 2R23B 5L2JB 1I7RB 2O5YH 1SYVA 2XN9E 3IDJA 1SEBB 1RHHA 4OQTH 5BQ7B 3G9VA 4Y5XA 4OT1H 2I9TA 1FZMB 1J1PH 2EXYC 4WWKD 5CSGA 4HFWA 4Y4FD 4ODHH 5FKAB 4PJ8B 4AH2B 5ACLA 3AXLB 5I2IA 3H9SA 4GAGL 1IAOB 1T2QH 3GO1L 3LB6D 4Y19E 1BGXL 3ZT5A 2W9DL 1CFSA 3QEHA 3W9EA 1H3WM 4JJ5A 4OCYH 2G75B 1I8LC 2Q1EA 4P2RE 5ILTH 5IQ9A 3I84A 4LSVH 3C6LA 4G43B 4MZ3A 4ZDHA 5I76B 2FIKA 1OGAB 4DKFL 3HMWH 2YXMA 3AS1A 3PJSB 5CD5D 4U6YB 1NDMA 1I7UA 1G7MB 3L1OL 2XWBB 2IC2A 5CZXD 1NBVL 2DQJL 2KQNA 2J8UF 2MQCA 3I2CL 1RZ8B 5I1CL 5JR1H 1WCBA 3PL6B 3P4NB 1LNUB 1TTUA 4GW1A 1U91B 4DOHE 3JVGA 2X4QA 1CU4L 2BFVH 3E1F1 3O3EA 3BQUD 3EJZD 1GRWA 4HS3A 1MLCA 4PV9B 2AJYL 2PR4H 3MNWA 5IEHB 3MRRB 2RFXA 2ZJSL 1Q9KA 2DIBA 4EQ2A 5DURB 4PGBB 2DJSA 4N9GA 4GRWB 1UKTA 4XCEB 3P0YH 3BVNA 5JUEH 4D9LL 3TBWB 2OXHA 1WVZA 2NTSP 4OCLC 1LO4L 2A74B 1ZLUH 5LAXB 3SDXA 2CD0A 3QDAA 2D4DA 3QO0A 3ZTNH 5KTEL 4OZHB 4E41D 4LGRB 4GRWE 2ZCKL 2EDDA 4QGTA 4JFZH 5AG8A 5JW4N 3GHBL 1FZKB 3G6DL 2MNUA 5I19H 3QDHA 4HQQL 2D9QB 3QO1A 2V2XB 2R1XB 1HI6B 4B7IA 1J8HD 1PG7L 2I9LB 3QYCA 4HK0B 4LCWB 3U9UB 5CJXA 3P9WB 5EN2A 3RTQC 5C0ND 4GG8A 4WHTB 3BEVA 5T3XD 2Y07H 1NQBA 3B2VH 3LN4B 4ISVA 4XCNA 1RK1A 4WW2F 4RX4A 3O0RH 1IGFL 3V7MA 5B8CA 4LL9A 3ZE2E 4Z7OF 4MXQC 3NOIA 5HHXH 5KOVC 3ZTJH 2IAND 1G7HA 1OB1B 4U1MB 2X4RA 3V0VB 3DVGA 3TJHC 4L8CA 3VFTB 2QHRH 4Z78A 1RD6A 2AQ1A 2CGRL 3OBAA 4HJGA 1MCPL 3KLDA 5ANMB 2V9QA 3C8HA 5HDBE 3CXHK 2OR9L 5GZND 1SEQL 5KVMC 2GT9B 1A9EA 1T7YA 4KMQA 3VXPA 4ZO6A 2C7UB 4LIQH 1JFQL 1I85A 1S7VB 3BIKB 4OCWL 5EU4A 4OGYL 1DDHB 5HGDB 1KIQA 4Z7UA 3GIZL 3GDBA 3HG1B 1QRKA 2HAZA 3OKNA 4AIXA 1S78C 5CGTA 1OLZA 4JFHD 4MXVF 4QXTA 2CDFA 1MCPH 1OAQH 3GBML 1FH5H 2VXQH 4CVUA 1J8HA 2YUVA 5J12C 4YHPB 2DYPD 4ODTL 3DVIA 3KHQA 3QNXB 4LCYB 2Z8SA 4N0CC 3RKPA 2J4WH 3FCTB 3MJ9A 1S7XA 3F7RA 5GGVL 5LGJA 1FQ9C 4HJJL 1NC2A 3WKMH 1UJ3A 3NZ8B 1F4AA 1YEHH 5FYLD 1ZMYA 1I3RA 2AJZB 1C5BL 1R3LA 5LQBH 3HB3C 3LKOB 1QRNA 1A6ZA 4X6DE 1K6QL 1MIML 5GGUB 2I26N 5D7IB 2X4SA 1PG7H 3VFMB 1JBJA 4I77H 4X99A 1RJZB 4JLRA 3KXFB 4X7FC 5D1QD 5IROA 3TIEA 1CD8A 2ZJSH 3GJFA 2NY0D 5E8PB 4DVRH 4ZXBD 2K7QA 2DD8L 1E4JA 2AK4A 4XCFL 3QI9A 5SV4A 2YC1B 1SYVB 2VQ1B 3NACH 3NH7L 3ZDZE 2EDNA 1D9KA 4OLUL 4F9LC 3RWCB 3ZDXE 3K3QA 5SWZD 1VHPA 1ZHKA 5EZIL 1KCSL 5CINH 2H8PB 4QWWC 2ATPA 1MHHB 1YQ2A 3HMXH 4CMHB 2ADJA 1RZIA 3ZO0A 2DQJH 3UPCA 1I7TA 5E4EB 4KROD 4DUWA 4N0UB 3FQNB 2YD7A 1J8HB 4ZFFA 3EOBB 5HYQA 1N64L 3MYZA 2YWYA 5KJRH 2BNUA 2DYPB 1WICA 4TNVK 4G5ZL 2GQHA 1OTTC 5DQ9A 1GZQA 4U1SB 2HVKA 3RFZC 1FNEA 4E41E 4PJAE 4YH6A 4MB5A 1A3LH 2O5ZH 4RGNC 5TQ2H 5DYOB 3VJ6B 1JF6A 1BREA 2ENYA 3ARZA 3L3DB 3CLFH 1DBMH 4NN7B 3P0VH 4AEFA 4LP4A 3GKZA 4ZNEA 1X5LA 2NMSA 3RX7A 2OZ4A 5ICYA 3V4VH 4LU5L 3SE9L 1G7IB 2Y4SA 2BNQA 1R3HB 2XICA 4UQ2A 4B41A 1P9MA 5BRZE 4R96A 3FN9A 3D87B 1UWEL 5I8CB 3RZWA 4MZ2A 3RJQB 2UV3A 4ZTPH 3R06B 4HLZH 4Q2ZA 4YHLH 5ALCL 1BX2B 3S36H 4RFOL 1OTUC 3O8XC 3OL2A 2F53D 5BRZB 3UAJD 4JGUA 4CL7A 4A6YB 5BZWA 4F9PA 2CDGB 1CE6A 5E7FA 3MFGB 4GMSH 4XNXL 5FKPB 1X5ZA 2FGWL 1XR9B 2VKWA 5LAXA 4OQTL 5FECA 2NY3D 2V2TB 4AG4H 4X0KB 1FZJB 3RY6A 1ZGLB 1XF5B 3LH2L 4GQPH 1DQJB 1IAIL 1UCBL 5C9KA 1BEYH 1ZSDA 1IGML 1LMKA 4LFHG 4IMKC 1G7IA 1A4KB 4OTXH 2Z8RA 4D9QD 1JI1A 1BAFL 4RISL 3EW3B 4HX1A 4LHUG 4K7FB 3PWUA 4E41B 1G9MC 3VG9C 5A40E 2GK0A 3QWQB 3QHZH 1T04A 3L3OA 4PY7B 5J56B 2ZWLT 4JAMB 1S9WB 4I13B 1KG0A 1HHHA 4PJ7A 1R0AL 4NC1C 3CIQA 5C3LD 1RV6X 4RWYL 4NIKB 3RWIB 3OTTA 4X6CE 1OP9A 3MLTB 3OB0K 1MJJB 5GXBB 1KB5L 4P9ML 5M94B 4HGMA 3HS0A 4FABL 2Q76A 3VXRA 2J3SA 4LLMB 5DJ6A 1EV2E 1HHJA 5KW9H 2EIBA 5L7XL 4X6BB 4HGWB 3BZFA 4IOFD 5HHPB 3SCMB 3PIQA 5GGRA 1JZ6A 3WEXA 1KCVH 2Y5TA 1FJ1B 4KMLB 1TZIA 3EO1A 5E9DB 5EU6D 1TQBC 3FT4A 1VACA 3D85B 3HR5A 2UUDH 3DBXB 4K9EH 4YPGB 3RNKA 4DAGH 4TYUA 5L8LB 3WJJC 2ICWA 2P5WB 3FT3B 4P2QB 2XXMB 2FIKB 2WSKA 4LVHB 3RWIA 4F7PB 3ZL4H 3BKYH 2FBJL 2RFXB 1OGAD 4AQ1B 4F3FA 3KXFA 3HNTL 3GRWH 4KKLC 4ZS7L 2PYEA 4HIEA 5I1GL 1SJHA 1ZVSA 3HNTH 3I6KA 1J9CT 5BVPH 4X7TA 3TNMB 3QA3A 1WCBB 2JJTC 4U1JB 5D1ZC 3QDGE 2BVPB 5CEZD 1I9JL 3VRIB 4PJFE 1ZEAL 4UILL 4MMXC 3IDUA 2NZ9C 3DBXA 4YPGA 3RNKB 2BZDA 5SWSA 2JJSC 3RWJB 2CDGA 1KN2H 3HI1A 2HN7A 1NMAL 4Y19B 1IEBA 4G7VH 1GIGH 3O2DA 2MTPA 5HY9A 2X40A 4POUB 5IBLC 4XC1L 4UOJA 5EU6B 2OL3A 2QSVA 2EYSA 5IB1B 2A77H 4UIKH 1VFAB 4N8VG 3B83A 5GIRA 3WNKA 1J5OL 5H94A 1ZXQA 3VGAB 1YQVH 4ZG1A 1DQQA 2B1AH 5AAWA 3UTSD 1JE6A 2BVYA 3JTTA 3FB5B 3VFWA 4NZUL 3GUTB 5I74B 5T33H 4XTRC 3VGAC 1NKOA 4PRNA 1QFWL 1QZ1A 1TNMA 3QCTL 2HVJB 5C8JB 1W8NA 5L2KB 4PD4J 3UBXI 3IXTB 1XGRB 4L8SC 3RY4A 2IADB 1RZ7H 2WP3T 1JRHH 3L5WA 3HUJA 3SPVA 2H6PA 2QKIA 1J11A 4DKEH 3CH1B 1OAXH 1I4FB 4OZIF 1ZHBA 3UTOA 3CX5J 5HGAB 3FO1A 4E0RA 5I8CA 2A9NH 3NCJH 4PTUA 2E8YA 4X6DB 3LH2H 1DQQB 2EO9A 1EGJA 4LGPB 4PJAB 3HPLA 2J8OA 4YBHA 3ARSA 3MBEC 4NQVB 2Q20A 5K59E 3QPXH 1HXYB 2OTWB 4CRPA 4CGTA 1OAZL 4YDLC 1DBML 3LS4L 1BM3L 3B43A 1S7RA 3DXAE 1NGZB 2CK0L 1PY9A 5ADPH 3ALXA 4OCXH 3BW9A 4R2GC 3F58L 1QTYT 5MHSE 1I3UA 3D2UB 1A1MA 4QRSA 4W4NA 2EDRA 3MRQA 4LBEB 2BSSA 2HFGL 3QEQD 3WHXB 3IVKA 2NX5E 3PP4L 3MUGB 1WIUA 1PY4A 3K8MA 1VFOA 3S96A 5A2FA 3F7VB 2VDOH 3CD4A 5C07D 3W11C 4FA8A 1VACB 4Q6IB 3LCYA 4QXUH 1AO7A 3UDWC 1FVEB 1X5YA 3W81A 1D6EB 1S7TA 3GSXB 5HJ3B 4OM0L 4XBPB 1J05A 4ETQB 4MQSB 5D7LE 3V8CA 2QLVB 4X6BA 1HHJB 3ARWA 4MDJB 3BXNA 5CEZH 4J2XA 4IRSC 4YQXH 1TPXB 3BRGC 2VN7A 5C2BL 2VLRB 4YFLF 1DTUA 4I0PA 3QNYA 4IJ3C 2VZTA 4HJGB 5DWUH 3S7GA 3QDMB 1MQKL 3N85L 4Y5VB 3CFJA 5F96H 2HLFD 5I0ZA 3RGVD 1L9MA 1NBYA 5TE6L 2P8LB 3RDTD 4YNYB 4QHNB 3KXFD 3EYSH 1K9TA 1OARH 4D0CB 1FGNH 3BDYH 3MRBA 5FK9B 5FUCC 1CLZL 4FXGB 1JGEA 4JFFD 1V05A 5E6IA 3G6AA 2XA8H 2CJUL 5HHPA 5TH2A 1HHIA 1GHFH 1UB6A 1HIMH 4WENB 3P40A 4OB5L 1GZPA 4PJ7F 4I2XB 3SDCA 1KB5B 4I77L 4WUUD 5BO1L 4MCZB 4XPBL 4UV4H 3VFSA 4JKMA 3WNOA 5F7LB 4KK5C 2G2RA 2VXTH 1FV1A 3MJ9H 3MLVL 3WDHA 3QZWB 2XTJB 1P7KA 2BXYA 4OGYH 5DJYA 4U0RB 2LU7A 1DE4A 4M61A 5DO2D 2IQ9L 3PWUB 4E41A 3T4YB 2CUHA 1YEKL 2UYLA 4XP4L 1PZ5B 3OKOA 4M03A 1P6FA 3UJTH 1WAAE 2IQAA 2NR6C 5JO5A 3WLWD 2AQ3A 4YDJB 1VB9A 5I18H 2HT4C 3L6FB 1NCWL 5GGTH 5ESQA 4M1DL 1JF1B 2G5BB 3UTQA 4ZFOB 32C2B 1XFPA 5IWLA 5IM7B 3D2UD 2DTSA 1QA9A 2OK0L 3MGOA 5GZNC 2VDNL 5IW1B 4KY1L 1HHKB 1KXTB 5IJVA 3L9RB 4G6AD 1FO0L 4X4XA 3RVTD 1ZT1A 5C09B 3IGAA 1S9YB 2GY7B 1G6RL 4Q9CA 6CGTA 4Y4HD 1RIUH 5FYJH 5EUOF 4LEOA 4LOUD 4LSRL 5H37G 1U8NA 1YN6A 5BZDB 4JZNA 4KJQD 5GS0D 1A6VL 2BVQB 5MERA 3T4AA 4G3YL 4XPAH 2HT2C 4LDLB 2X70B 1WZ1L 3MGAA 4HWZB 4QRPE 5F9WC 4OKVB 5JPMA 4PJHE 1FFOA 2VQTA 3PV6A 1MJUH 4DVBA 4GRLD 1WK0A 1EHLL 2FSEB 4KRMB 1BJ1J 4LPCA 3QI9B 3L5XH 2X4OB 3MMEB 1FZOB 1GVIA 3HE6B 4IIQB 3TIEB 3BN3B 3FFDA 1Q0YH 1RHHB 3CNKA 4GW4A 5E99H 3S37L 4JFYA 2WUBH 4K94C 5BV7H 1KT2B 4XI5C 1G7QA 1OP3K 3PABA 3WNLA 2P5WE 2BCKA 4Z7QF 1AGBA 3GKWL 3D48R 4MQTB 4UT7L 3M17A 2HMID 3S34H 1K85A 4N0CD 2QQLL 2WK2A 1F6AB 1NGYB 2AJXH 5JDJA 4ALAL 1BQHB 1GH7A 4P4KB 2XQBH 4I3RH 2I07B 4HDIA 2D31B 5INDB 3L7EB 2R29H 4MD0B 1DEEA 1TLKA 3SKNB 2EE3A 4TSAL 2GW5A 1IAOA 4ODBD 4GAGH 5AD0A 1ACZA 2X7LA 4HBQA 1Y0LB 5K9OB 1ADQA 2X89A 4LK4A 4W4OA 4LMQE 3BPOC 4G6KL 3PL6C 4EI6A 2LAAA 1FAIL 3VGHA 1UVQB 3I6LE 4J4PC 2B4CL 5FYJD 1KTDA 1HILA 4J3UA 4ODUB 1ZA6B 1H3TA 3F58H 4R90H 1NGQL 2BVTA 1II4E 1YYML 2X4UA 4Z0BL 3BWAB 3CH1A 3LEYH 3PL6D 4EOWL 4HBCL 4RA3A 2HWZH 3O8XD 4HH9A 1P84K 5EZJA 1QQDB 2X1WL 4NGHH 4PJBB 2DTMH 2P49B 2HA1A 3RU8H 1MI5D 2RCSH 2EYRB 4QHKJ 1EZVY 4AMKL 2NY3C 1NCBL 4M7KH 3RUGA 3WFHB 2AEQH 3RWHB 2W38A 4PGCB 4NM4H 3NTCL 1OAXL 4P9HH 3TYFA 1VPOL 1MCRA 3E2HB 4YHIB 5B8CB 2ORBH 4LVEA 1F42A 4P59L 2QBWA 5KVGH 3SGKC 3FO2A 4NWUL 5FOBB 3QZWA 5GRUL 1RUKH 4NYLB 4FZEH 3MACH 1VCAA 1I7ZB 5I30L 1HWHB 3EYVA 2YD9A 4TSCH 4GQ9L 1LO0H 5FXCH 4F15B 1CICB 5SWSE 3RIAK 4MMZC 5DK3A 5T33L 3SE8H 3SE4C 4JEGB 4PJCF 3IKCA 3DROB 3ESVF 4K55A 5D1XA 2NZ9D 1RULL 3M8OH 4ZUWB 4CU7A 1JUFB 1T66D 1KEGL 5EOCL 2FDBP 2ICCA 5CP3A 3P11L 2VITA 3VD9A 1WTGT 4KTEH 3D3VA 3UJIH 1TJIH 4MJIA 3S5LB 4FXKB 3RWDA 2FD6H 3BI9X 4EUPG 1V3MA 2I24N 4N8CH 1D5MA 4XNMB 3NABH 1IAIM 3GK8H 5FUZH 3ZTJG 4UI2A 5CJQL 3REVA 3OAYK 5KG9A 4UZGA 5KSAB 5ALBL 4I0PB 3VXRD 4LCCC 5SWQA 3NPSC 1NUFA 3FT2A 3TNMA 4NNYB 4LHUD 5CEXB 4XGZA 3QEHB 2VLLB 2PYEB 1KGCE 1RZKL 3NVQA 1QSFB 5C0DA 3V2AR 3U46B 4XXCA 2IAMA 4O58H 5I15L 3BEWB 5JXEC 3NZHL 4D0CA 5DUML 4Y5XB 5MENA 5BS0D 3LKQB 1XF4B 4H88H 1NGXA 4MJIB 4KI5F 3ARDD 1NDMB 3U30B 3Q2CA 3S35H 1AKJB 5GSVB 3V52H 1XGUB 4MNGE 3DXAD 3EZ8A 1H3GA 3BP6A 1I1AC 3LRSA 3LQZB 5DMKA 4ZFOL 4H1LA 1OD9A 5IHZA 1URLA 3QQ9D 1FC1A 1EHXA 1MF2H 1ZA3B 1ZHNB 5CD3B 3U30C 2SEBB 3WUWA 3VXSD 1KLGB 4Z7VE 4M7ZB 5DLML 3OR6B 5HGHA 4PJ9A 1I1YB 3SGDI 5JIIA 1JP5A 2JCCF 1BOGB 4MJ4A 3CFCL 4CVWA 1MWAL 3HCVB 3ALPA 3DRTB 1U3HC 3O6MH 5IMKA 2C3WA 5CZVH 3PNWB 4PJIB 1VGKB 2AJ3A 3OXSB 4XMLL 2Y36L 1T1XB 4BH7A 3F6IA 2IF7A 2PCPB 2R15A 4J1UA 3S36X 1OAKL 4Z7VF 2XWTA 4N0YH 4DCQB 3FONB 1YEJL 1RFDH 1W72L 5EZOH 3GSWB 4R4BA 5FYKU 2H2PD 4WFEE 1OM3H 2VLJD 5MEQB 1HDMB 1WWBX 3F8UB 4I9WD 1DL7L 1HEZB 3O3UN 3MLZH 3MSPA 1JV5A 3MV8A 3VFRB 4JR9H 3ARDA 5MEPA 2VZ3A 1MCWW 2MJWA 2COQA 2J6EA 1MCLA 1QRNE 2DWDB 4X6DA 4WRLA 5HD8D 4JFEB 1CVRA 3R06A 5IMLA 2X4NA 1I8MB 4AL8H 1LDPH 1OSZA 2ED7A 4HEME 3IU3B 3KPMB 3QUXD 4B7LA 1I1AD 3I02B 5LBSH 5EUKA 3O41B 2F19H 4MAYB 2HRPH 1R24B 5EO9B 1LO5B 2NY7L 2X2YA 1H3PH 3EFDH 4IHOB 2EXWD 2CMRH 2VERN 1BQLH 4QRPA 3VWKC 2BNRE 2ZP0T 5CHNA 2DLGA 5DVNA 3NFPB 4K8RD 1JZ7A 2VWEE 3V79C 5EU7C 3CDGB 5DXWA 1B6DA 4CVXA 4YHKH 3SE9H 5IMOB 1T1XA 3NCCB 5IGXH 4UT9H 3O4OC 4WUKH 2Q7YB 1T5XB 5T1DL 3SKOA 2O26U 3U6RA 1NJ9A 5E8OB 3TT1L 1ORSA 1PX3A 1R5WB 2H8PA 2DQUH 2IANA 5KSVB 5GS0H 5ID1B 3WE6B 1NGPL 3QULB 5EU6E 5F9AC 3MJ8B 3ULUC 2IG2L 1CZ8L 4EBQH 4Y16B 3QDJD 3MNZB 4FQ1H 3W9DA 1E4WH 2CDEB 2CH8A 5H2BB 3VFMA 1MI5A 3PWPA 1LK2B 1N0XL 4P5TB 1MFDH 3JXAA 1RJYA 3OQ3B 2E7CA 2IGFH 1AC6A 1I3GH 2ITDB 2BSED 4NWTL 5C3TA 4I2XE 5D72H 2HFEB 3Q6GL 1JNLH 4U1NA 3NACL 1QSVA 2X1QA 2BY0A 3PIQB 5GGRB 1GPOH 4P46B 3TN0B 4HXAL 4NHCL 5FHBH 4NUJA 3S3SA 1EXUB 5LXGL 2Y25A 3BMWA 4PJEF 4ZS6C 3IGAB 3H9HA 4HLJA 3WD5L 4QHKI 3HC3H 2R4RL 3IJYA 2ADGB 4ZFZB 2ZCHH 5D1ZB 3FOLA 2E7BA 3CFEA 4NCC1 4UOW0 3TVMD 1BD2A 5I17A 3V9FA 4HF5L 2DLFL 3HNSL 4R26H 3X3GL 2Z92B 4O2EA 4GSDH 4KHTL 3TBYA 2X1XR 3IAQA 1Q72H 5GGQH 1MRFH 1WFUA 3ARTA 4MJ6B 5C71A 3DUSA 2FZ3A 2I60L 4G9DA 2OR8A 3H9ZA 1JHKH 3IDGB 3TEUA 3WO4C 2EKSB 5KVFL 4KZDH 4Y1AB 4M5ZH 4PGEA 4M9PA 4LLVA 3VXQA 5D6CB 3VFTA 1A2YB 1XR8B 4JRXE 5JOPE 1VEMA 4LDOB 4XRCB 5CWSB 4NRYB 3GMLA 3I9GL 3OJVC 4JREC 4H25B 4R2GB 3RGHA 2UY7A 3P4OA 1D9KD 5BRZA 4IBLT 4PY7A 3X14B 3P77B 2VDRH 2XWJA 3TN0C 4QCIB 4XAWL 4ONHA 5GISH 5F6HJ 5TFSH 3CVHH 4YHNA 4Y89A 4EN3D 3CDYA 5EO0B 2PNDA 1S5HA 1UQSB 2QHRL 4R90L 4R96B 5HGBA 4BFIB 4Z77B 3SY0B 4PGJA 1NCAL 1Q1JH 3KJ6L 4O5LL 2DLHA 4TVPD 1AJ7H 4FMFA 4NKOB 5DS8A 4I4WA 2VR5A 4JKKA 3ZDYE 3IDNA 2LTQB 4X6CA 4M7JH 2PYED 4G8IA 4ELMB 4Y5VA 4HUVA 1KULA 4LSSH 3GGWA 3FOLB 2DQFB 4OI8A 2B7DT 4O2CB 5KN5B 2ESVD 4GMTH 4NKIL 4OJFH 1VKXA 4K07A 2VSDA 3OF6D 1AH1A 4TSAH 1OF2A 4WO4B 3MRJA 2V17L 2UVEA 4U1GB 2DLEA 4BFBD 2FL5B 3UTTA 3TN0A 4KKBC 1DFBH 2QSCL 2FO4B 3MLUH 4LHUA 3OAUL 4MX7B 3ET9F 1NCCL 2BHZA 5INCB 1YA5A 1RMFH 2HKFL 4UAOB 3QXTA 1NCCH 3F7VA 5FO8A 5KANI 4G8FB 4LLQA 3WLBA 1P1ZA 3MOAH 1KC5H 3GBLA 4RFNB 5BV7L 1YEEH 4GW5A 2WUBL 4PLJD 4WTZA 4Y5VC 3RDTA 1O0VA 5GHWH 2A6IA 4CBPA 5FM5M 1JVKA 4C4KT 4MD4B 4K3EH 4Z8FL 3UO1L 4R97B 5EC1B 1FPTH 4R8WL 4YXHL 1BP3B 4AH2A 3ZDXF 3L3IB 1T22B 4DQOH 2QQKH 4KUCD 4MX7A 4HKZB 5KZCB 2F54B 3MBEA 1FZMA 1O7VA 1BD2E 1J88A 3DRQB 2E6QA 2MOVA 4PB0H 3F5WB 2PF6A 4ZTOH 3LKSA 4AIZB 4CN1A 2C4XA 1A47A 2IALA 1MAJA 2GFBA 3AB0C 3KJ6H 4U3HA 5IW3A 2DI7A 3K2MC 5F3BA 3D39A 2W0KA 3B8SA 1L7IL 4K8RH 5I8EA 3W9DB 1T4KA 3LD8B 1ED3A 2EC9T 4N8PA 4WI2A 4Z7UB 4TRPH 5DFVD 1WEJH 1WTLA 4EXPX 1CIDA 5ELIA 1S5IL 5KSBF 2J1KA 4NPYA 1EAJA 1J0IA 1I1CA 3FO9A 3MO1A 1ZK9A 2IBZX 2BVQA 4P4RA 5FM4A 4D94A 1XAUA 3VXNA 1FG2B 2OX5A 3V6FA 5IVZA 1ZT7B 3BESR 1NLBL 4M1DH 1IFHL 3UXFA 4XP1L 1F3DH 3K2UL 3L5IA 5EUKB 3FZUC 5DFVC 4HCRA 3PWLB 5BS0E 1N2RB 5T3XH 3MV8D 5J06A 5H35B 5F6HI 3MZTA 3GBNH 3DURA 3S3PA 5C6TL 2BVOB 5D5MA 5I8OH 2DQGH 3DETD 3OAZH 4J4PD 1KJVA 3C60B 4RSVA 3BIAX 3KPNA 4CNIB 2CR6A 2ID5A 1IBGL 4OD3H 2IADA 2ESVA 1R3IH 4ONGH 3DGCR 4FQ2H 5ESAB 1XGRA 2ZUUA 3G5VB 4MQ7A 2OJEA 4WFHE 1LO5A 4Q74A 2NY4D 2XN9A 3MREB 3IETB 4NHCH 5MEOA 3MRFA 3G5YB 3DMMA 1QFWI 2NY6D 3V95A 1A0QL 3TBTB 1NEZG 1F00I 1UM5H 4GSDL 4KHTH 2Z92A 4O2EB 4XNUL 3LHPH 3IFPB 4F9LA 4U6XA 2Y5EA 1K8DB 1PFCA 5C6WH 4WHTA 2NZIA 4S2SA 5EN2B 1ZANH 1JNNH 3IB4A 2EDEA 3UAJC 5DQDH 1YMHB 3RA7H 5DVMA 4Y0GA 1WIPA 3H0TB 1BD2D 2OMNA 2Q86A 4CJ0A 3KLAA 3S35X 3O2DH 5I6XC 3WJLA 2ARJA 4HKJB 2ZOLA 1OOAA 1SMAA 7FABL 4BZ2H 3QUMB 3AY4A 3VXTB 5F9WB 2IH3A 3ILQC 3TT1H 1XGYH 4GS7C 4QTHB 4GAYA 1UB5B 3K1DA 2DQEL 1HQ4B 4L4TD 4JM2F 4WUKL 4LCUA 2B5IB 4D9RD 2GSGA 4X9FA 3C6LB 1IGIL 5FA3B 5LVEA 1DUZB 3DO7A 4CU8A 4B50A 5IB5B 4NOFA 1OQXA 4MDJA 5H37H 2NTFB 1A6TA 4BFGA 4LQFL 2AI0H 3TPUA 2VDML 3K2UH 1NMCB 4PUBL 5EA0H 4TTDD 3DSNA 5FKAA 2H45A 4JFPB 2WBWB 4TULL 2JIXA 4KZEH 1N5YH 1R6VA 4OBRA 4DZ8B 1EGJH 3DVNA 3BDXA 1E27A 3BYYA 4JHZA 5AWNH 1MCDA 2R56L 4MA8H 1OGAA 5CILH 3GNML 4YUEH 4G43A 4J8RA 2R0ZH 4QRRB 4F7TA 4M7LH 1T03L 1RIVL 4KVNH 4GAYB 1C16A 3H42L 3LQAH 4Q9BA 1F13A 1BIIB 3GI8H 2NX5A 3KNBB 1F11B 3MLTA 1VFBA 1H3PL 5EH1A 2HKHL 5J1TC 3EYOA 5FA4B 4V1DE 5FGRA 2VLME 5EZLB 1P4IH 5T1LB 4BK5A 5DMIH 3B8YA 3QNZA 3T0XA 3BRFA 1VSCA 5AAMA 2CLVA 5FYKD 2DKUA 3GSQB 5EORL 3A6CH 1F3JB 2OJZL 1GCFA 1U92A 5ID1A 1CDYA 2JE8A 5T5FL 2NY5L 4L3CA 4NO5B 3WS6A 2PTTB 4PPTA 3AUVA 3GJEA 1MFAH 1T7VA 4GAJH 3GMRA 1JNHA 4PRHB 4WEBH 1H5BC 1FORH 1X7QA 5JZ7D 4KZEL 3C60D 1RURL 1FE8L 1AGCA 4W4OC 3CDFA 2AK4E 5CD5C 3VWKD 4F7EA 4GG6E 3MV7A 3KPRE 4WI5A 1QBMH 2FEEI 2VXSH 2GJJA 3HFML 3WNPA 2R0ZL 3O3BB 3QIUD 3BKML 4XPFH 4NHUB 4ONFH 4PJGA 1LQSR 5EBGA 2R56H 5KSAD 3MLXH 4RA0C 1J0ZA 1V7ML 5CJ5A 1VGKA 1WSST 1EGJL 2A1WL 2JJTA 1NANI 5DEGB 4PJBA 1FLRL 3GSUA 2VSCA 5IVZB 2YEZB 5BMFL 5HHOE 5K59F 4QHLA 3VJ6A 2R1WA 4OM1L 4OGZA 2RR3A 1Y18B 1U93B 1PQZB 2HLFC 4ZUUB 3KPSE 1NCAH 1Q1JL 3RPIB 3JBG7 3BZEB 4QXGH 4HFUL 1KIPB 3A0OA 4OLXH 1CDIA 4FQQB 5E6IC 1YEGH 3LB6C 1IZJA 4RGNB 5DK0A 5DEZA 4MS8D 5T1KA 3RA7L 4I3SH 2PYFA 5IR1B 3MUHL 15C8H 3BP5B 3QRGH 4Q0XH 1I1AB 3CDCA 4JO2L 3QIWD 4RZCB 1V8HA 5L88L 5E2TH 7FABH 5IT2L 2UUDK 5GS1C 3K4ZA 3X13B 5IKCB 2FHFA 2HFEA 1TJIL 1NLDH 4P5KB 5D4QA 1Y0LA 1FFPB 4EUPB 4GKOA 1JYXA 3N9GL 4DGIL 2YK1L 2P24B 3LIZH 2R2HA 3QHTC 5CKAA 1WV7T 4XVJH 3DTXB 5C0NC 2DI9A 4GAFB 4JQVA 1HHGB 3V5DB 3U1SH 3IFLH 2R0KL 3O6FD 3PGDB 3MLRH 3GFUA 4OFIA 2NY2C 3TBVB 1A5FL 4EN3C 4XHQA 2ICWB 1Z2KA 4ZQKB 3RUGF 4KK8C 2QSTA 3KR3H 3MACL 5DEFB 2A6DA 3QAZB 3MRKA 1R0AH 3TVMC 2ZOKB 2H9GA 4JFFE 3EJJX 3CC5A 1FHGA 2EEAA 5DEGA 3X17A 2A0LC 5I73C 4HIIB 5MEND 1T7ZA 1XGPA 3V4UH 1UJTA 3C2AL 3CUPA 3QAZC 5F9JA 1K2DA 3RWFA 5GPRA 3TBSA 5DJ6B 1NGXB 3J7HA 1GPOL 1SJXA 3QUMA 4IRSD 3ZYZA 4K2UL 1KEMH 3HUJF 5EOCJ 1YNKH 1S7QB 1TVBA 1WWCA 2HJLB 2OL3L 5IJVB 2BRRH 4KKCD 2C4FT 3UTSA 1RPQA 3T2NH 3U9PH 2GJ6E 4JO2H 1RHFA 5F1IB 3UYPA 2EE2A 4GT7A 2HT4D 3DSFH 4RAUA 3JWOC 4NM4L 1QR4A 1D9KC 4Z0BH 4HC1L 3RDTC 4NKOA 2X05A 1IGTB 4MJID 4XVJL 4XVTH 4JFHE 4ACPA 4ODXB 4D8PA 5F9DC 5C09D 2Z31D 4WDIA 4HUVB 3WJJA 4WWID 2IBGA 4NJAH 3AAZA 2O5XL 4NN6C 1XR9A 3E3QE 2BJML 4LHJB 5HVWA 1T83C 5I1HH 4MLIA 4HBCH 3MREA 1UXWA 4UTAL 4J7RA 1BZ9B 5I73B 4MD5B 5A16B 1JL8A 3AFLA 3T3PF 1J0JA 4L3AA 3K81A 3GSRB 5GS0C 4F57L 4DZBB 1MFEH 2E7LA 5F1IA 2ZZUT 2EEDA 3P9MA 1NC4B 3W2DH 4POZC 5FO7A 4G6KH 2BNRA 5IF0B 4XBEL 5EUOE 1UH3A 1YPZA 4EVNB 4R6UA 3SOBL 3KS0J 3D5OF 2D3VA 3JWDC 2HKFH 3GMLB 5IW6A 1I1AA 5ABDE 3GKWH 1EEZA 2NY7H 3ZKMD 4GAJL 4ZD3H 2ENSA 2AV7A 3EHBC 4PREA 4HT1H 3O8XA 2F19L 4HS8H 5INDA 2VTFA 5F7HA 1UGNA 5HDBF 2NY5H 2DJ4A 1YEEL 5DUPH 3VFOA 2AJUL 4HS8L 1CN4A 3MRGB 1Q0YL 1S9VA 3JV4A 4KDWA 2X4QB 1WT5C 4OLWL 1YZZA 4P57B 3W5MA 4K3GA 3SE3A 1JZ5A 4JR9L 4MA1B 3G6JB 5CGMA 1J1XL 35C8H 5LQBL 3KDMA 2DM2A 1KFAH 3MPCA 3WFZA 4LKXA 5I74C 1XF4A 4QYOA 1CK0H 2VQ1A 2ZKHL 3BAEL 3GSVB 1EFXB 4PBXA 2FHBA 2D4FA 5DDHB 4U1NB 4HZLB 4KC3B 1A1MB 3HE6A 4QRSB 5D96B 3VDCA 2ITDA 3WXVH 4X6DF 3S9DB 1DANT 2CLZA 4PJAF 5D7LA 4JPIA 4YBQD 2H32H 2BMKB 4UTBL 1QSFE 5EFIB 1X4XA 4ZQKA 1FC2D 2R1WB 1NBQA 1MREL 5F1OB 3GSXA 1T1WB 2KH2B 3T0EE 1A6VH 3Q6FB 4M1GL 3LEXB 5I66A 1HYRC 2V2WA 2KKQA 3BUYB 3L3JA 1I8LA 1WF5A 3VFNA 1MJ7L 4GLRI 5T3ZE 4FQCL 2AAVA 1BQSA 4U1LB 3SDXE 4QXTB 4NRZA 3TA3C 2XN9B 1MIEL 2NY1D 5EBLB 3TESA 1P53A 5EOQH 1AXIB 1N5YL 1RIHH 2APXA 4I0CC 4LVNB 2A9MH 2GT9A 2NYYD 3I9GH 3DXAA 4FZ8H 4CDHA 1WAAA 1I7ZA 3Q48A 4O58L 1A2YA 3CSYA 3NIGE 3HR6A 3O2DL 2R0KH 3MUZ1 2UZXB 1UWXH 3VFUB 1Q0XH 2OI9B 4FFZH 1XH3A 3L3GB 4YEFA 4DGIH 1LO2H 4P99A 2YS4A 3C5SA 5DJAA 2DWDA 4YPJA 1AQDA 4HMEA 1N26A 4K3JH 3GJFK 1FGVL 3MJ9L 3MLVH 4MSWA 5GIRB 2B1HL 5D1QA 1UM5L 3AU1B 5D7KE 4ELKB 4PG9B 5EOCH 2APBA 2WBJA 4FQ1L 2J8UA 1FO0A 3TIDB 1AE6L 1NFIB 2OP4L 3DX9B 4YC2C 3MRNB 4Z0XA 1NGPH 4UAOC 4PJCE 4KKLD 5DHYB 3SO3B 2LQRA 1OARL 1AKJA 5GSVA 4L1DA 2AABL 4YE4L 3OJ2C 1W0YT 3OXSA 4GBXA 2DMCA 1Q9LB 2FX7L 3IDIB 2W65B 3RGVA 3UJJH 1DN0B 3VH8B 5F97E 5BXFB 4XPHH 5ISZA 2AEQL 1I1YA 3U0PA 5HHQA 1F3JA 4J4PA 2QEJA 1JYWA 1TCRB 2NTFA 1UEMA 5DEFA 2O93L 3KPLA 3VCLA 2VJXA 4OZGB 3LPGA 4D0BB 1JRHI 1I85C 4JFPA 3CFKB 1F4WH 2D7NA 5F7DB 1Z9SA 2O61B 4PJFF 3V5DA 5FV1L 3T2PA 3DWTA 1JYNA 4TRPL 3MV11 1JGUL 1C16B 4WU7B 4ONFL 5MEOB 3PP4H 5F6IC 4J3OC 5JW4M 3CFDB 3QWRD 2O5YL 2FYYB 5FO7B 1XIWD 3BN9D 4LASL 5IG7B 2A83B 1OGTB 4XMKL 2P8MA 3CXDL 4NFDA 5EUOB 4JFYB 4XGZB 2Q6WB 1G9MH 1P7HL 1MCJA 1MWAB 3FTGA 2YRZA 4MWFB 1ETZB 4S1RL 3TC9A 4IRJD 1NAML 2EICA 1YMHA 4JO1H 3QUXB 4JDZB 4N1CA 4JPWH 3FJTA 5I1KL 1A14L 1JHTB 3OKEA 3OMZA 5ADOL 5IEKB 2ICWI 3L3OB 5I1LB 1EA9C 3UZVB 5TF1H 3RZCC 3E6HB 4KXZH 3TJEL 1A6TB 3VRLF 1YN7B 4W70A 3SCMD 1CLOL 4Y2DC 1O5DT 4PRHE 1I4FA 3Q3GB 1DP0A 2XT1B 4IMLB 4ZAKC 1HOCA 4HGWA 1A14H 3P4MB 3V6FB 1J1XH 35C8L 3V6OE 4Z76B 5ESVB 3OF6A 3TWCL 4S1RH 1YJDC 2EO1A 3O3BA 4YK4B 1JWMB 3P4OB 1ACYH 2YD6A 4DUVA 1QFWH 1T4KB 4Y5YB 1HILB 2XG5A 3BW9B 3SDAA 2Y6SC 3G5XB 1XR8A 4JM2C 4JN1H 4FFVD 4HD9A 3RVWD 2OTWA 1I1RA 3JZ7A 4RCAA 2EYRA 1N0LA 3LZFH 4FOMA 4ZOEA 1INEL 3TT3H 2FATL 3PWPE 2B5IC 2BP3A 1J7VR 4BUGA 1VFMA 1KLFA 3O6FC 4Y19D 1U92B 3KYMB 4KJYA 2HFFA 3IDMA 3WUWB 5MI0B 1M6OB 1P9MC 5C0CE 5ENWA 2HVKB 4I3GA 3KPQB 4I48A 4RFEA 1CFVH 3OWEA 4GKZB 3NMEA 4MLSA 4ZS7H 3WIIH 1KN2L 4WWKB 5I1AB 1GC1L 2AERT 1HHGA 5B4MC 4EDXA 5KSUA 3PHQB 4P2RD 2C4FU 4M48H 4PJXB 4X98A 5I1HL 1WIOA 4ZYKB 3SDAC 3GK8L 1OT1A 1UFUA 1JTPA 2BVPA 4DAGL 1SMOA 3HRPA 4XP5H 1T22A 1CDGA 3ULUF 2XZCH 4F37K 1H8SA 2IPUG 4OZFB 3TFKC 2FNBA 4RMQA 4M43H 5I18L 2Y23A 3MA9H 4HIXL 2JTDA 4FFWD 1UM4H 2QADD 4LMQI 5KVDL 3S97C 4OCRL 3QBTB 4WHYG 4W81A 1GAFL 5IMKB 3HI6L 2F8OA 5J57B 3Q6FA 5DO2C 2H9GB 4U1IA 2NW3A 3RVTC 2EDOA 4DVBB 5JHDE 4RGOH 4C56A 1F6AA 1ZLUK 2EDBA 1R3KB 4XP9H 4JG0H 4ERSL 2NNAB 1A5FH 3PGFH 1LO3H 1S7XB 3GSUB 2CXKA 3HI6H 3CZJA 5DJXB 1P1ZB 5D7IF 4BZ1H 2V5YA 3BZFB 1FNFA 4I8DA 3E2HC 3PXJA 1CICA 2IALB 4KPHH 2W0PA 2R2EB 4PJGB 4PJ7E 3EJZC 5I75C 2DTML 3JTSA 3MBXH 5IESH 1CE1H 1WWAX 5T3XE 3BDYL 1OW0A 3MODH 3X13A 3HNSH 3DPBA 3QUZD 2BNRB 1QSFA 1G1CA 2BOCB 2DQGL 1C12A 1K5NB 5E70A 3BP5A 4KK9C 3CZFB 4JRWA 4AEIH 3IF1B 5JPNA 2GITA 3WD5H 3GZKA 5HBBA 2CRMA 2L7JA 3S36<