3TH2T

Mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
198
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mg2+ Is Required for Optimal Folding of the Gamma-Carboxyglutamic Acid (Gla) Domains of Vitamin K-Dependent Clotting Factors At Physiological Ca2+
rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Coagulation factor VII light chain
total genus 46
structure length 198
sequence length 205
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3th2T01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3th2T02
2D0FA 2HFGL 3UO1H 4RFEA 2HRPL 5I1EH 4GOSA 5ITBH 4G8GE 5KVDH 3E3QE 1Q38A 1BFOA 3LRSA 4LLDA 3ARDC 5GJSL 2GCYA 3LB6C 5MI0B 3S37L 6CGTA 2O5ZH 5BOPA 1ONQA 3MODH 5HHVL 4ZFOB 2ZSVA 1SY6A 3K7UA 3TJEL 1FAKT 1ZA6A 3O6LH 1ORSA 5C2BL 5EU6B 1AKJD 3TV3L 1QBLH 1F90L 2V7NA 4M62H 5E8OA 4Q6YA 4DN3H 2V2TB 4PJBB 1AD9B 1ED3B 3BH9A 4KQ3H 5H35A 5I75C 5FYLL 5E24E 2YKLH 4O58L 4LPYA 4RRPA 1WCQA 4YBLB 3U6RA 3BZFA 3RX7A 1GPOL 1L4IA 5IBUG 1R3KB 4XCCH 3ARBB 4OZFG 2XQBL 4MD5A 4NQSB 4QRTA 2QHRH 3OJDA 3HR6A 3OZ9H 3WJLA 4ZDHA 1MEXH 1JHLH 4PRHB 1KNOA 4OGYL 4L3EE 3KGRA 1MWAA 5BQ7A 3CU1A 5EBWB 2P7TA 1AO7E 4PV8B 4MJ6A 4RGNB 1YC7A 1NPUA 3EYOB 3OB0K 4NPYB 3EJYC 4NWUL 3D9AL 3QYCA 4X5XA 3QI9C 3X14B 2V5TA 2YWZA 1JGLL 3LEYL 1QSFD 1WIUA 1P4LA 5E95B 2B0SH 1DANU 1NMAL 2YUXA 1P1ZA 2MQ0A 2DAVA 3FCTB 3RU8L 5C9JB 4PJAF 3SOBL 3O4LB 4F7MA 2DTSA 1KCUL 4PR5A 3B9EA 4BSWB 1KBGH 1A22B 1P69B 4PV9A 3ZYIA 1B3JA 1FAIH 4NZDA 3T0WA 2IMMA 3TPKA 2A38A 3B5HA 5CLWA 1N0LA 1X3DA 2WINB 1MRFH 3E3QC 5T1DL 4OJFL 5CSBA 1JGVL 5EWIL 3SKNB 4S11A 1CGTA 4PJBE 2H8PA 1B0RA 1TFHA 2PYEA 4XWOD 3UPRB 3U82B 3U4EA 4ISVB 2WWMD 2Z8WC 3I84A 5K9JL 2HRPH 3TA3A 5I1EL 1L7IH 5GS1A 4M4PA 5JORB 3DUSB 3FO2B 4BZ2H 1GIGH 3TN0A 5EIVA 3KDMA 5GRZA 4ZODA 3TO4D 2VZ3A 3T0XA 2O5ZL 2YPKB 3L5JA 1CS6A 4JFFE 4GSDH 2X70A 4RX4D 1JPSL 3IFNH 5EO0B 4NKDB 2WBWB 1K9TA 1D7FA 4EUPG 3MSPA 1EHAA 4FFYL 3STBA 5BV7C 3HG1E 4GO6B 2GT9A 3OXRB 3ZL4L 2Z91B 1BQHB 3OBAA 2Q8BL 4HWBA 5CBEA 3RGVB 4WU5A 1A6VL 3GBNL 2ZCLL 2AEPL 15C8H 1GPOH 2WNGA 2EC8A 3QFJD 4WCYH 4GKSB 5LWYL 3OR6B 1T22A 1KN2H 5GRJH 1LD9B 4G9FD 3BYTA 4EIZC 4UT9L 5TFSL 1IC7H 2KZ1B 2YPLE 2YXFA 3RPIB 1KJ3L 3HLAB 4FQCL 4LCUA 5KN5B 3O4LD 5CJ5A 4MDJB 3BIKB 2GI7A 1V3KA 3VGDA 4D3CH 1QSEA 4PLJC 4JFED 5CJOL 3CFKA 3NIFE 4L4VB 1H8NA 3C5ZC 1G7MA 4AEHL 3MLSH 1IZKA 4Y4FA 3BI9X 4H8WC 3UDWC 5ANME 1U95B 1NH6A 2A77L 4YHNA 5F3BB 1RZ8A 2BDNH 4UIKL 2BMKB 1CU4L 3SDXA 3PDGA 3SOBH 2VLLB 4HULB 4KVNH 1T5WB 1GGIL 1R5WB 3X11B 3NAAL 1EEZB 3G5VA 1MCLA 5I2IA 1L6ZA 4DFIA 3BKYH 4R2GB 5FO9B 3HNSH 3LKQA 1RZ7H 3UTSB 4EN3C 4I0KA 2FWOB 5D1XB 3CUPA 2FX7L 3RRQA 2Z92A 5L2KA 2G2RB 2DWEA 3S5LB 1KEML 2NW2B 1V3LA 3H7LA 4DEPC 5BRZA 1F6FB 1O7VA 3LDBC 1QYGL 1NMCC 1HDMA 3QDGB 1UKTA 3VWJD 1TNMA 4XNZB 4IRZL 4LARL 1ZHKB 4ZNEA 1T2JA 1LNUA 1X7QA 3GSVA 4NSKA 1QRNE 4Z7VA 5AZ2H 1NGXA 2JIXA 3T08A 1OCWH 1FL3B 3NH7H 1YEGH 2IALA 3WYRA 4FXGB 1T66C 2AW2A 5DHXB 5HHME 4Z76B 1U93A 3FT2B 4C57C 2BC4B 2KQMA 1NDGA 5EIIB 4UB0L 5ISZA 2HLFD 1KJ2A 3E2HC 3QIUD 4DQOH 5GS0H 1AGEA 2JB5H 1OGTA 1NL0H 2ED9A 2YR3A 3LIZH 5GGRB 2XZQH 2FCBA 4XI5D 3UJJH 5J9PA 5E8PA 4PG9B 1KG0B 2E3VA 3DETC 1FZKA 2ATPA 1KENL 1KIPB 2XIDA 2YBRA 3G9VA 1NCBH 4R26L 4ZUVA 3MR9B 1IGMH 3HNTH 2C5DC 3QI9A 4PJ8C 3VGBA 3UTSE 1E4WL 1LVEA 4NGHH 5CILH 2YEZB 3VFPA 4PJIA 1H3GA 2GUOA 4D3CL 3O2DH 3AY4A 1NEZG 5CFHA 4AH2B 2B1HL 2HKFH 1MRCH 2OK0L 2OZ4A 4B5EA 5D7JB 1IJ9A 4Y19D 2QSVA 3QUZA 2HJKB 2W65B 3MREB 2BVQB 4P5TC 4D0DA 1EHXA 3N9GL 4GXVL 3TYFA 1HXMA 5C0AE 5DSCA 1MJUL 5CCKH 3BH8B 3QJFB 4F58L 3CFDA 3R06A 4O51B 4XPGH 1FIEA 4ODUB 2DQFA 3LSOB 5E99L 2MMXA 1BD2A 5SWQA 2XFXA 1H0DA 1L0XA 1U8HB 3TIEA 5ID1A 3P77B 4HHAA 2AEQH 1T2QH 4LVOB 4NQEA 2QEJA 5IMOB 1G9NC 4HT1H 5DYOB 3O8XD 3VXRA 3X13B 3BVNB 4ZQKB 1KCRL 4KTEH 3L95B 2Z0BA 3IXAA 3G08A 5DSCB 1RMFL 1T1YA 4MNGA 3PP3K 1RK1B 2YMXH 4LLQB 4O2FB 1P4LB 4XCEB 4DGYL 1PJ9A 2DI8A 3QWRA 5DS8B 4QXGH 5BV7L 1T1WB 4X9IA 5BOZG 2VDKH 3ZE2F 1T1ZB 3BSZH 4UDTB 1XCQA 2XWBA 4F33B 5AZ2L 4AMKL 3DETD 1BREA 4NUGH 1F4WL 2JJTA 3EYOA 4LIQH 3NH7L 3QT2A 4MJ6B 2GUOB 3GKWL 2ARJA 2P7TB 4M8VA 2D3VA 4XI5C 4MJ4A 1IEBB 1J86A 4CW1B 3ARFB 4LPCA 5L88L 3JV4A 2I60L 1CK0L 1KIPA 3LKPB 1S9YB 2R1WA 5MI0C 4NQSA 4QRTB 3QJHB 5T1KD 3MRMB 5C0AB 5K9OA 2XQYK 1KPRB 1KLUB 4GRMB 4YHOH 1P7KA 1H8SA 2JELH 1KGCD 3JUZA 1RK0B 4PJHA 4ONHB 3MOAH 1AD9A 1RFDL 2HTKD 3VRIB 2XV6B 3NGBB 2ITDB 2DQIH 2HP4A 1OVZA 1YUHA 1FVCB 3UYOD 1K8DB 3QA3A 1MI5B 2DLEA 4YNYB 4Z76A 3FFDB 1IKNC 4Q9RH 5FA3A 4FXGA 4Z5RB 3I3EA 2AGJH 1A1NA 3CXDH 4JGUA 3QRGL 1DLHA 3P9MB 4XVSL 2HKFL 3ARGD 1QLFB 4QHKJ 4QNPF 4U1IB 43C9A 3WD5H 4HJ0D 1EVUA 3VJ6A 3LRSB 1FO0L 4LLDB 1D5XB 2ADGB 2VITA 3N9GH 4GXVH 3P9WB 3RU8H 1O7SA 5CD5D 3K8MA 4JPIB 5C08B 3O9WD 4LVNB 2RJMA 5F1KC 4P2YA 5C0GA 5JOPD 5FGBA 4XPGL 3SBWC 2BFVH 4MQTB 6FABH 5DJDB 1Q0YH 2BSRA 4OFVA 1UXSA 3KYKH 3CUPB 5JW3H 5T1DH 1QFUL 4ZNCD 4P4RB 3BPNB 4YJZL 3LKQB 5FO9A 4HWUA 4KI5D 2FLBT 2OL3L 3IT8D 3WL9B 4L4JA 2WIMA 1PGRB 1EFXB 5CWSB 1V5JA 5J3HC 3C6SA 4F15C 5D7JC 3WV0A 3D0VA 4HX1A 4PB0H 4K23L 3INUL 4Z7WB 3GHEL 3DBXB 3MNVA 4MS8C 3ZKQD 4ODTL 3JWDH 2KBGA 3FB5B 3QWOA 3UX9B 2F54B 3ZKXB 2D4FA 1PX3A 2CDEB 1MJ7H 1I9JL 2MWCA 1HHJA 3HN3A 1RUMH 2YD2A 4UU9A 4TVPE 1RVFH 4YBHA 3UYPA 1IGTB 4JDZA 4LSRH 2B1AL 2X41A 2CLVA 4WWKB 3NABL 1RV6X 4RAHA 3H3BC 4XT1C 3GKWH 4AG4H 4IJ3B 2DYPB 4Q6IB 3T2QA 1RZFH 5IJVB 2GW5A 3FL7A 2AK1H 3L1OH 1YEFL 3UCRA 4WUKL 5F9AC 5EULV 3ZTJG 2UWEF 4TNVK 1OHQA 2VAJA 2XWTA 4LCIH 1KUMA 3RWCB 3WL9A 3IFLH 2AEPH 3VDAA 3PWPA 4UIMB 5DMGC 5IP4A 3A6BL 4OZFH 1HWGB 3BMWA 5CKAA 3B5TA 3MOAL 1XF4A 3VGHA 5DVKA 4ALAH 2J5LB 5C0GB 3P0VH 5CHNA 1KJ3H 5F1NA 4E42B 3KLAB 4HPOL 4UBDD 1R6VA 3MA9H 5IOPB 1KCLA 4YPJA 1JPGB 3D1MC 1T21A 1A6AA 4PJ8B 4I5BA 1JPST 1OAQL 2F19L 1EEQA 3ULVD 4U1IA 4J1UA 1A1MB 1YEKL 3RA7L 5IFJA 2Q76A 1RUQL 5E8EB 2V2WB 5JORA 1FO0H 3HI1A 1IZJA 2NXYC 1OARH 2R2HA 2V5YA 1J0YA 1Z0MA 4LF3A 3LVEA 1K8DA 4KV5E 5HYFA 5I16A 1D5ZA 4JO2L 1PKOA 1T4KB 4L8SC 3S3SA 5I71B 2VLRB 1K3IA 3UJIL 2BOBA 1RK0A 2H8PB 5D1XD 3O41A 3VG9C 4I0PB 4L29A 4YXKL 1MHHB 3UTSD 1RZKH 4R0LA 1BQLH 5BO1L 4PJDA 1GC1H 2YA2A 2AI0H 4P23C 1KV3A 4KRPB 4FTVD 3WO3B 3DO3A 1I1CA 3CU7A 4MHHI 1QYGH 4DAGH 1H3XA 4PS4H 4XPAH 1IGIH 3RJQB 1T04A 2HG5A 4TVSa 3W39B 4X83A 1CZ8L 4P5TA 3MOQA 5HHMD 4HWBH 4FZEL 1ORQB 2X6MA 4NPYA 4N8CH 5GGQH 4Z7OE 5I1LA 4H88L 3NACL 1X6NA 1WWBX 3CXHJ 4TNVF 5EBWA 3T77B 2A74B 2XKSA 1YEFH 3WFBH 5J6HA 2DLFL 2J7LA 1G9NL 1VA9A 4PRHA 3VFGL 4DWHA 2NY6D 5ELIA 5DYOA 3LKOB 4NUJA 3VD7A 5I19H 3UJJL 2DICA 4UV4L 2Y7QA 3SDAB 3BZFB 3DVNA 4LHJB 1I1FB 1WSST 3B6SA 3PWNA 3NCYS 4QKXB 4QCIB 5JPMA 3U36A 3BH9B 1AO7D 1NCBL 1JHTA 2QR0B 3G5XA 4R26H 5DHYB 3WIHH 1XGUB 1RJZA 3GMLA 3MYZA 2XA8H 4NGHL 2AXHA 3MUGA 5HDBF 3IFPA 3QQNA 4KKBD 3UEZA 4AM0B 4N0CD 2MOVA 3BKCH 1LO3H 5L2KD 2GK2A 2ZSVB 1MPAH 3DECA 1CQYA 1AD0B 3S3PA 2X10A 5HGGS 4N1EA 3HI5H 2YWYA 4QT5A 5EUOA 1A4KA 5MEQB 5IMMB 2AJXH 4ZPTA 3SE8L 3WKNA 4KRLB 5H8DA 3VFOA 5ETUB 4G8GB 4I1NB 2Z8SA 2K7PA 1EMTH 3KR3L 5B39B 3TT1H 4JLRB 3Q2CA 4CN1A 3QEUB 4YDIH 3WFZA 4KHTH 1XGRA 1NCAL 5JQHC 3EFFA 5DMKB 5FV1L 4UBDC 5B8CB 1X5IA 3ZTJH 4GS7B 5C0ND 1P84J 4MDIA 1R3LA 5KZCD 4EN3D 2R4RH 4LGPB 1MFEL 3UTTA 3GSOB 2BC4A 5DHVA 1YJDL 4BUHA 5SWZE 1JGUH 4I18A 5FB8B 2YMXL 1WGOA 4I9WE 2JIXB 1JCKA 2IPKB 4DZBB 4LLYA 5HHQA 5IMLB 5EBGA 5JIIA 5GGQL 3HNVL 4DJMA 4X8JB 1HINH 3BRDA 4ODHL 3MYJB 4L3AA 5CBAA 5HPMB 3OHXA 1X9QA 1A7PL 2EDQA 5DJYA 3UC0H 4PJXB 5F9DC 1T03H 3H7BA 2DLFH 1Y18B 4Q2ZA 2QKIA 1YN7A 5FCUH 1MHEB 1KB9J 2CRIA 3IKKA 3QQ9D 1BHGA 4I0PC 4S1QH 4X6DF 2AJ3B 1J7VR 1JRHL 3S5LA 4UT6H 4RGNE 2AJYL 5M94B 1SYSA 3RUGE 3OGOE 5HYSB 1EHLH 2R0KL 2VL5A 3S97C 5ALBL 3HB3C 4PJEF 1LDPL 3VMOA 4Z6AT 1M1SA 1AQKL 3GRWA 3V95A 3BQUB 5E5MB 1WZ1L 4C56A 1OSZA 1KPUA 1Y6NR 3KPRB 5JDSA 1A7NH 2X1OA 4RWHA 5EO9A 1KJVA 4M9PA 1R5WA 1IM9A 3WIHL 2WANA 1AKJB 3AB0B 3HPJA 4K7PL 5E5RB 1HHGB 3D25A 5FECB 1XIWB 3H8NA 2FBOJ 3DUUA 4Q9RL 5IT2L 1BLNA 2Q87A 3BW9A 3QCTH 3OKEA 25C8H 3IDYB 1XF2B 1PAMA 1EA9C 2YZ8A 2ITCB 1NFDE 3C5ZB 3B8SA 3EJJX 4J23A 5IFAL 4RDQG 5EUKA 3HAEA 4P2RD 5SWZA 1HN1A 1MFAH 5J11B 3OB8A 4PPTA 2D0GA 4MVBC 3T3PE 4HBCH 2AJUL 4IRJD 4WUUD 5GJTH 5JZ7D 1FNGA 3FMGL 5JW3L 1CLOL 3DRTB 1U91B 3C6LC 1CGXA 3WDHA 1CFQB 2DTML 4L3CA 1HHKA 4LDEB 2DLTA 3ARZA 1I3RA 3KG5A 4NZRL 4KAQH 5ICXB 1ETZB 1G9EA 1UT9A 4OD3H 4MA8H 2GT9B 3OXRA 2W0LA 5EOCH 3Q6FA 2Y06H 1P4IH 1FG9C 3T04D 3T3PF 5FUCC 1X6LA 1YYLL 2NW3B 3LN9A 2PUQT 3TZVB 4ZTPH 5E8NB 2DQJH 4QF1A 5EOQL 1PY9A 2VTFA 4WEUD 4JN1L 4P46D 3SBWA 4OI7A 1WVZA 3VWKC 4YZFE 3VGFA 1BJ1H 3NABH 1G7JB 3VRJB 4BZYA 3D48R 4YDJA 1DUYA 5J1AA 1HILA 1QKZL 5IHBA 1A7RL 2YPLB 4PRPD 5J8OA 1AJ7L 4G3YL 3S4SA 1S9KC 3UC0L 1D5MA 2R56L 4WUKH 4LSPH 3T3ME 1CN4A 4GBXA 4PRIB 1XF5B 4CMHC 1DJSA 1LEGB 3HMXH 2R0KH 3MUJA 4RRPG 3MV9E 2IFGA 1IARB 2ZSWA 3PNWA 3RAJH 4I4WB 5B3JF 1H9VA 1NFIA 4XVTL 2O26U 3FT4A 1G6RA 5ABDE 1SJVA 2XRAH 5J6GA 4LPVA 1QOKA 3JWDC 5D2NC 5IJKA 5BS0E 3WIIL 2GIYA 2LVCA 1OT1A 4GRWH 3MTRA 3DMMB 3U0PB 4Q97A 2Z4QB 4OD1L 1A7OH 4PY8J 3QXDA 3W82A 2DOCA 5IW1B 2O93L 5D1QC 4OIAA 4NQVB 3T65A 3GJEA 1GOFA 5IEHA 2P5WE 1WUNT 5BQ7B 1TIUA 3T09A 1HQ4A 3ARDD 2F5AH 4P5KA 4GAGH 5EBMA 2J3SA 4KPHH 5SX4H 5KG9A 1S5IH 1JIBA 2C3HA 3WBDA 3ARGA 4PTTA 1K4DB 3G6JF 4OLVH 2CKBB 4XP6H 1NCCH 3QPQD 4LSSL 2Z9TA 2NY5H 3DRQB 1QRKA 4NNYA 1D6EA 5D2LE 4PJ8D 2VJXA 4FP8L 4NNXA 1Q9KA 3VXRE 2IH3B 4UT7L 4KAQL 1EX0A 2RBLA 4V1DD 3IDIB 3BPLB 5TH2A 3R4DA 3CVHB 1JZ2A 1LEKA 5JQ6H 3TLRA 4ENEC 4BKLB 5GISL 5F88B 3ME0A 4HUUB 1S7WA 5HYJD 5ADPH 3WHE1 4XPAL 3FO9A 2DQJL 3MFGB 5EOQH 3FRUB 4KKAD 1G0DA 1FC1A 4HSQA 1BFSA 5CGYC 2I25N 3WXWL 4FQJH 1FFPB 2QHLA 4WWID 4J4PD 1N4XH 2W91A 1RIVL 3RDTA 1P4BH 4M7KH 1FQ9C 1ZSDA 3K2UH 3CFEA 3IDUA 5ESAB 3QULB 2P8LB 4LSPL 4RDQF 3P3YA 4LGRB 3KYMB 2HT2D 3IF1A 5C09B 4MCZA 2V9TA 4LSVL 4LIQE 3JSSA 4X7SH 2JTDA 2P44B 2CRYA 2YD9A 4Y5YB 5DR5H 4Y2DA 3WXVH 1T1XA 2FH6A 2EXWD 4EUPB 4M6NL 3OJVC 3WDIA 3D85D 2YC1B 1S7QA 3CLEL 5F9OL 5GGSY 1G1CA 2V7HA 3SPVA 2VO5A 3O2VH 4LCWE 3T2OA 5HTSA 2FJFA 5CZVH 4CU8A 5K93A 2WUCL 4NQDB 1HSAA 1DBKH 3HHRB 3WIIH 4BSJA 4HWNA 5FGCB 2EE9A 1MCWW 1U8KA 3VU2A 1A02N 1VADB 4Z7QF 5E6IC 5I15L 1HI6B 5I1IL 1MPAL 2C7UA 1OP3K 1L0QA 4DUWA 1AI1L 3EO1B 3HZMA 4YHKL 1LMKA 3K4ZA 1AIFB 2NX5B 2P4AB 4OCYH 2LFGA 5GRYA 1MHCB 2DM4A 1CBVL 4XC3H 4H25A 3M17B 4HKJB 1WF5A 5TQ0H 4U0RB 3TYGL 2ZUYA 3ULUC 2YA1A 2E6JA 1YQVL 5I17B 5K9QI 4U7MA 1BWWA 4KPHL 2RGSA 1J05B 3D39E 3AB0C 5FKPA 3ZHKA 2DQTH 1LE5A 1HH6B 4MGXA 3IB4A 3B3IA 5IB5B 2ICCA 4Q9QH 3IDYC 3RX5A 2QADB 5H2BA 3T65B 2ICWB 4Z8FH 1ZA3B 5T3ZL 1UWEL 2ZJSH 3OJ2C 2EYRA 1J5OL 1I1AC 2W0FB 3BPOB 1YDPA 4UT7H 4KKCD 4IRSD 5IV2B 3LHPL 3ALPA 3QO0A 3RWJA 3E6FA 2CIKA 2VSDA 5DD0L 3DROB 4O02H 3F7YA 1MJ8L 3QG6B 4JAMA 4QGYA 1TZHA 4PGBA 3KPMB 4P59H 1PG7H 4YHZH 5AD0A 1F4YH 1A7QL 1MCCA 5DD1L 2E7LC 2FEEI 5C0CD 2GJ6B 2RFXA 3FT4B 3OR7B 2APWA 4MNQB 4XBEH 1XH3B 2FJHA 1DQMH 2AAVA 4I4WA 1P4BL 3BISA 3JVGA 5LBSL 4QHMB 1OAYL 1GZQB 3S6CA 5IVNA 4M1CD 3FN9A 1RZJH 5JW5B 3AUVA 2R2BB 4HIXL 3GSNL 5D5MF 5J0BA 4EI5B 2GJ6A 3C60D 3KJ6H 3QXUA 5EZLB 1NFKA 1TZGL 2PETA 4UTBL 3MLTA 3UTPD 1A3LH 3MBEB 4XCYB 3BJ91 4UQ3A 5AAWA 5J1AB 4OCRH 3RKPA 3BUTA 5KVEH 2VH5L 3QEQE 4MWFB 1HSBA 1F3DH 4U1JB 4N90D 5IV2A 4LCCC 1D9KA 1UCBL 1GJIA 2W0FA 4MAYB 5DVOA 4HGKC 1SBSH 2YD1A 2YPVH 4M7LT 4BFBD 3TT3H 1PZ5B 4J3VA 5DUPL 2PTTA 1Z9LA 4ZS6D 5IVZA 5FXCH 3FKUS 3IFOA 1ETZA 1QP1A 5IBLC 3FO0H 4JKMA 5HJ3B 1MCJA 3E6HB 3IDXH 1EEYA 4LCCB 4H1LB 1UZ6E 4JZJA 5TQ0L 2CJUH 3C8KA 3DHJA 4YIQA 2N56A 4NKOB 2W0KA 4X4YB 1MHCA 2C26A 1CTOA 2F54E 4MB3A 2VAAA 3CX5K 1BVKB 2O5YL 3HZMB 3ARDB 4KROB 1I3GL 3VXOA 3VXUA 3C5JA 2AJVL 4XVUC 4GLRH 2H41A 1Z0NA 3HB3D 3PGDA 4RSVA 5HGAA 1VADA 4L8DA 1FP5A 4RISL 3K74B 5CIPA 5J12B 4XP5L 1FZJA 1HSAB 1QPPA 4OD3L 3DX7B 4PJCF 2B7DT 4NQDA 1BZ7B 3O0RL 5AZEL 5D70L 2X4NA 4WHTA 1P7QA 2D9CA 4U1KB 1XAUA 2EEDA 4DCQB 5BV7B 5I8CB 2YSSA 3HE7D 4LHUG 3ARSA 4POZC 3KJ4B 5EIQA 5DMIL 3D2UD 3VW3H 4IHOB 4ONGH 2I27N 3HR5B 3NFSH 1EZVX 1YY8B 2EDHA 4DZ8B 3ZDZE 4D9RE 4F9PC 3G9AB 2DL9A 3MRLB 4R3SA 2B2XL 3FQTB 2BRQA 4L9DA 4DKEL 1OAZH 1NKOA 2QQKL 1WFOA 5ICZA 3C6LA 3EOBA 1FFPA 1QTYT 2QADC 4WEMB 1TZIB 4JFDB 3FTGB 3DSFH 4IMLA 1YN7B 3I02A 2R23B 2BVYA 3LQAL 3SE4C 3DVGB 1M7IB 1KXTB 4JRYA 5JMOC 1J8HA 5E9DB 2WBKA 1JGEA 1GSMA 2NXZB 4YHPB 4IRSA 4TOYH 4P46B 3S8WA 2R4SL 2W60A 3W0WD 5TH2B 1SEBB 1UCBH 2HVKB 2IAMB 5JLZA 2NY0C 2J5LC 1BAFH 4LSDA 1AGFA 3WJJC 3TT3L 5C0DB 2Y4SA 3GSRB 1PLGH 4X80H 5KSAD 5GZOC 3BN3B 3RIAF 2YD5A 3IDIA 3I75B 4G43B 4O2EB 4QOKE 3SDCC 1B4RA 4MDIB 4CAGA 3FQNB 1CTNA 5E8DL 2QQQA 5CKGA 3Q6GL 1DBMH 3MNWB 4HFUH 4GRLA 1R5IB 5K9KA 4WCYL 3DYMA 4DGIH 3MLVL 3TH4T 4HUKB 2IG2H 4M6ML 1VKXA 3MNZA 3TCXA 5EBMB 4P2RA 5SWZD 2HA1A 2Q6WB 1A5FH 4JFPB 5TPWH 1YY9D 4WI5A 3GZKA 4FP8H 5LXGL 5TE6H 3EGSB 1JNJA 5HDOA 5IW1A 4JFDE 2ERJC 3LKSB 3RVXD 2Y36H 1N26A 3FB6A 2C4FU 1C08B 1R3IL 1CFTB 3OKKA 3PP4L 3VI3F 2B8OT 1OB1B 5CEZE 1ZWIA 4UINL 1NFIB 1FFQA 2AK4D 2CUHA 2QADD 2OZ4H 1G7QB 1CGVA 2XZCH 4XPBL 2H32B 4R97B 5IVXA 3L3DA 4HCRA 2ZSWB 1M6OB 1RJZB 2VXVL 1XGQA 4ODVH 1O5DT 2IQAB 3KPRD 4KV5F 2FEDD 4R96B 1GGUA 1TTGA 4KZEL 1U3JA 2X4QB 4KWUA 4DKEH 5F7EH 4NUJB 3Q5YA 1NEUA 4Z7WF 9CGTA 4NQCB 1JV5A 1DUYB 2R29L 4KY1H 5D2NA 2FH8A 1FYHB 2P24B 2AXFA 3DSFL 3X17A 5B38G 5I30L 4JVWA 2FEEL 4UDUB 1AHWC 4QF1B 2VLME 5E2JA 1PSKL 3S4SB 3KHOA 1NDMA 1JHKL 3JXAA 3PL6C 3BPNC 4PREB 2I07A 3C5SB 4JY4A 4XCNA 1CWVA 4KDTA 2PTVA 3W39A 5L8LB 1WAAE 2JIXD 3ZLQC 3FAWA 4WFFD 4G8FB 1KIQB 3D85B 3NPSC 2IPUK 4JG0H 5JIKA 4QRPE 3KNBA 3KPOB 3GKZA 3HAEG 3U0WH 3PGCA 1U91A 1VHPA 4K3EL 4P2OD 1YN6A 1MJJB 1DVFC 2X1WL 3CDGB 2FJGA 4Y4KC 4OCYL 3FFCD 5C1MB 4NDMA 2JB5L 1OGAB 5T3XD 2PYFB 2HJFB 2CDFA 2NXYB 4P4KC 4WI2A 5EUOF 3ZT5A 1U36A 3ZMRA 4OZ4A 2IG2L 3GMNB 2CIIB 5IEKB 1FIGH 2D4DA 4M5ZL 4WFFE 3E1F1 4KKCC 3JZ7A 5E2WL 5TF1H 5INDB 4FFZH 4MAUH 2J8UE 3BW9B 4J3SA 4OGAC 5T3ZH 1PDKA 1BLNB 5DEZA 1PZUB 3QR2A 1I7RB 5LXGH 2VWEC 4LU5H 1XR8A 4HBQA 5C2BH 3V4PL 2G9HA 5KBNC 1CD8A 4PJXE 5EBLB 4A6YB 3BGAA 4FXKB 3BEWB 1OP3H 4M1CC 2W38A 3B9KA 2WP3O 3BWAA 4KQ3L 3RUGB 1NC2D 3MV8A 3CFCH 4L4TA 1XIWA 3BO8A 4FQXC 3NFNA 5I1DA 4F58H 3WIFA 5BZDA 1AXTH 4KRMB 2R1XB 4PJ5D 3TZVC 5J06A 1MRDH 4LEXH 4YC2B 1QO3B 2ZUSA 1OSZB 3TN0D 1S7XB 4V1DA 3G6AA 4QRPB 4HAFA 2XTJE 5L0QB 2AXJA 4JRXB 1UWXK 2A83B 2B5IC 2YD3A 3EYFA 3MUHL 5L9DL 2AEQL 3QIBA 1LE9A 1XGPA 4OM0H 1TQBC 2B4CH 4LLVB 5KVGL 1I9IH 3RNKA 3L3OB 3ARUA 1J1PL 5HHQB 4NO5B 3W2DL 3WLBB 4YHIA 3DMMD 3GM0A 3OHXB 3KJ4C 4U7KA 1G6RL 1QG3A 4OCRL 5DRNA 5KVEL 2DM7A 5C0BA 2J8UA 2X2YA 1WEJH 4RNRB 1T83A 2IPKA 4DZBA 1KT2A 2IADA 4GSDL 3VXQA 5FKAB 4IBLT 5LAXA 3LN5A 4M6OL 1TTUA 2DIAA 5F7KC 1WBZB 5DUPH 1JGVH 2ARWA 3WN5B 4RMQA 5EH1A 4HX1B 4U6HB 3T4AB 3LV3B 1CQKA 3ZYJA 1EFXA 3ARXA 3GBNH 4OZFA 3RDTC 1KJMB 2VLKA 2OYPA 1QFWL 5DGQA 4YHOL 1FLRL 4D0BA 5L6YH 2BNRD 4MSWB 4N0YH 1WBXA 3CVHH 4YLQT 1I7ZA 1IC1A 4BZ2L 5KOMC 4M5ZH 1MVUA 2OQJA 1T0PB 1OSPL 5SV3A 3GMMA 4B7LA 1QLRB 4XAKE 4JDVA 5DEFA 5C71A 1OTSD 5GHWH 1FJ1B 2XOTA 5D7IE 1G7HA 2KKQA 3H3PH 1D3CA 4JFEE 4XP4H 1PEZA 3QDMB 3TCLB 4XP5H 1PY4A 2XNAB 3GMLB 1JNLH 4EDWH 2LABA 2EIBA 4K9EC 4P5MB 3MJ6A 3SKMB 1FGNL 3G5XB 4NC0B 1SMOA 5H37G 4M43H 2UUDK 3PWNB 5DJ6A 3CFCL 4XMKL 4M1DH 3KPSA 4KVNL 3WUZA 4NN6C 5DMIH 3PXHA 2BNUA 3GB7A 5EU5B 1T20B 3HTLX 3MZGB 2M2DA 4M1GH 1KN2L 5GRJL 5A1AA 4TUJA 4ONHA 1AE6L 3JTTB 2AEWA 1E4XI 3QNZB 4LEOB 3QSKB 3J8F7 3G5YA 3ZDYE 3VWKB 3U9UB 2JJSA 1EFQA 1BPVA 3C09B 1C5BL 4W81A 1Z9OA 3T77A 2IPTH 5D7IF 3VDCA 1F6AB 4MA1B 1NUNB 3ROLB 1ORQA 3DIFA 4HKZA 2FHBA 3V6BR 4G5ZL 1CXLA 2YD8A 2BHZA 4X4XA 1IM9D 2FB4H 2J12B 4XTRC 4JB9H 4J3XA 1N59A 2HG5B 4Q0XL 4ODSH 2FBJL 1YZZA 4Y16B 1IILE 4C83B 1ZE3C 2ZUQB 5BVJA 5FO8A 4IRZH 4JVPA 5KSAC 1ES0B 2IBZY 1FVDB 4ZUTA 3O3UN 4Z0BH 2BP3A 3QXTA 4P3CL 3QUXB 4MJ5B 5HGDB 5DS8A 1PKQE 1NC2A 5DQ9B 5KS9A 2HYMA 4UAOC 2GJ6D 2O61A 3IXAB 3QEGH 3AMLA 3SGDH 3U9UA 1U8LB 1QD0A 1IKNA 1EFXD 3VXRB 2MPAL 2J4WL 4D2NA 5IHUH 3LIZL 3HE7A 3SGDI 1FLRH 1YNKH 1EPFA 5CZXC 4R4NC 2H2PD 2R2HB 4NCDA 4AIXA 1F4XL 5HVWA 5T5NF 3IU4L 4TUJB 5SWQB 2ID5A 5HI3C 5IFJB 4P5MA 3H9SE 5E56A 3B4NA 5F1IA 2D31A 3P2TA 4U31A 1Q9OA 4XP4L 5IQ7L 4ACPA 2ZPKH 3QUZB 4ZTOL 4JY5L 5E8EA 1E6JL 3VXNB 3P40A 4WHDA 1K5NB 1Y0LB 3JV6B 1YEKH 3RA7H 3MROA 3Q1SL 1Z9SA 1XF4B 2DBJA 1QQDA 2OQJB 3VFUA 3PWVA 4PTUB 1R0AH 4DQOL 3HCVA 4OI9A 4YDVB 1UH4A 2CK0H 4U1GC 2EH7H 1TVBA 1VACA 3ARTA 4YHYB 2X5PA 1T83C 3MRIB 4JO2H 1B88A 1MVUB 4OZHF 4LDOB 2YBRB 3UJIH 3BJLA 1I7ZB 4LVHC 3QXAB 1HYRC 4K8RC 4NQDD 3QUYB 2QSCL 3W0WE 3RX8A 4OZGE 1KLFA 1BQLL 2DQEL 4R4FH 3OAYH 2P8PA 3U79A 4YR6B 4B53A 1ZMYA 2DDQL 2HKHH 2XWTB 1KT2B 1NDGB 3QUXD 1MRCL 2ZKHL 2OK0H 2FB4L 2E27H 3O6MH 5CEYB 1RMFH 2QSTA 2UYLB 4HIEA 2LU7A 2NX5E 3KPQA 1WFTA 5DJCA 3LN5B 3C6LD 4HV8B 4PS4L 4ZXBD 4OZIA 4S0SD 5JW4N 1W72A 2RCSH 2VDKL 4PJGF 4Z0BL 5FA4B 5JO5A 1ZHKA 3V6OE 4W70A 3A6CL 4NM4L 3MJ8B 2P8PB 3S34H 1BFTA 3DBXA 4WENB 2UVFA 3WFBL 4NJ9L 5CD3A 4JRXA 5D1QB 3WLBA 2VDQH 4NCC1 5KS9F 3WNPA 2APXA 4U1HB 4K7PY 3IJYA 4X7EC 4HUVB 1U9KA 4MMZC 5CWSA 2J4WH 4JFQB 4HK3N 5D7SH 4LASH 5KJRH 4JM4H 2VERN 5I75B 1X5LA 4KTEL 5DJ2A 4YDVA 4JPIA 5C08A 4M02A 4CADB 5CP7B 5K59F 4V1DB 5E03A 1E4XH 4FZ8H 1UXSB 1RFDH 4WWKC 1JZ8A 5BV7H 1RJLB 5A3ID 3O9WA 1KTLA 1VB9A 1RU9L 3WIFB 5BZDB 1G1YA 4PJHF 5DTFB 1GXEA 2VLLA 2IGFH 4X7FC 5DRXB 4CRPA 5E6ZA 3KWWA 3HZYA 3CMOH 1OW0A 2BSED 3B9KB 2ARJQ 2IWGA 1U95A 4KC3B 5E7BA 3JWOL 5L88H 2EDRA 2CSPA 5MEOB 4PJBF 2P5ED 1G7MB 2I60H 4OUOA 1CK0H 3H3KA 3V0AC 2PYEE 3MXVH 4JFFD 5FA3B 5HXMA 5LCVH 1KC5L 1LK2B 4FQIH 5D1ZD 1CR9H 5KN5A 3TJHC 1MI5A 3FONB 3N1MC 1K8IA 2VLJE 2HJFA 4HF5L 5I1JH 4I0PD 4Q9BA 3RTQA 2X4UB 3MRJB 4JM2D 2MNUA 3KYKL 1NBZA 4YDIL 3LZFL 3PWJB 5I8KH 3ULUH 2OCFD 5M7QA 4CMHB 1IT9L 4WW2A 3BN9D 3PDDA 2VDPL 2FJGB 4FQXB 4WW2F 2HT3C 4JVUA 1NC4A 2Z91A 3QUXA 4XVSH 3UZVB 4OM1H 2ZKHH 4WHCA 1YECL 1YJDH 4P2RE 4ZFOL 2LU4A 1OLLA 5C0NC 4K9EH 4KRPC 3G6DH 4V1DE 1DBJH 3FFCE 4OQTL 4P3DA 1G6RH 1A3QA 2BX5A 1P2CB 3G08B 3LY6A 5HI4D 1MAML 1EJOL 1S9VB 5FUZL 4X4XB 1T1WA 2XTJC 2LAAA 3IETA 3TNNA 4JHZA 3X13A 3HNVH 5DURB 1HNGA 3JUYA 2VZUA 3KPPB 3UP1A 4PJGA 4KVCH 4YEEA 5I9QB 4OQ1A 2ZUUA 4MXWH 5HHNA 3MRPA 4NJ9H 1IEAB 1HK6A 2VOTA 1YMME 4OBSA 3Q0HA 5D2NB 3JTTA 4LCIL 3X12B 1FSKC 2PYEB 3UPRA 3IFLL 4LASL 3P77A 1XGQB 2RB8A 5I0ZA 2GHWB 35C8H 3SKNA 1UACH 3LEXB 5ID1B 1NAMA 4ZS7H 2CO7B 3N1PC 5FK9B 4GRWF 4GXUN 1GH7A 4BQCA 3FQUB 2GSIB 3QBTB 1J9CT 3GMOA 3WCYA 4IIQA 4WTZG 5D7JA 2JK5A 4PV9B 3U7AA 1RVFL 3TF7C 1AY1H 4GH7B 3LKSA 1JWUA 2H32A 1NCWH 4D0CB 4RWYH 3VGAB 1K4CB 3UTZA 4QTHA 1X5JA 2LTQC 4HMEA 2BVQA 3QUML 5F89B 3T4YB 3VFTA 1R5VB 2P5EE 2CD0A 2R9HC 3X3GH 3ZDZF 1RZFL 1G7HB 1YEEL 1OB1A 2ZCKL 3LEVL 2BHYA 5T5FH 4PLKD 5DUMH 5DFWH 4P2RB 3FB6B 1OAKL 5KW9L 4Y5XB 3GMMB 3C2AH 4J2XA 4L4VD 2APTA 1HKFA 2DMBA 2DRUA 1WFNA 4GLRI 4GRLB 2NXYD 1CICD 1QRND 3PHOB 4NOBA 4QY8A 5F44A 1KJMA 2VLKB 4HBCL 3OSKA 5A2KH 3DV6B 3K4DA 4GG6A 1OGAD 4EI5D 5I18H 1N6QH 5EPMB 3T4AA 3WLWD 5ERWB 5EC1B 3LZFH 3A6OA 4Y2DC 3ULVC 3QPXL 4ALAL 2HFFB 2F8XC 1OP5H 3E0GA 4DVBA 4PJ5A 4ELKA 2VUYA 4MX7B 1OGTB 2EE2A 5D2NE 1G7PB 4PGCB 5LAXB 1OTSC 5FV2A 5JUEL 3SO5A 1OAQH 3O3DA 4Z7UF 3BQUD 5EIIA 4G5ZH 1B4JL 1YECH 2P5WD 1U93B 5LGJA 3CZFB 5EU6A 2NY1D 5TDPA 4NRXA 3RIAK 5L8JB 2JCCB 1WICA 2D03L 1A14H 2UUDH 2W60B 5FUZH 4NO5A 4Z7VB 3CFJA 4P3CH 1XF1A 1LNUB 4IRSB 3ZE1F 2X4SB 1J10A 3DVGA 4EBQH 3MGAA 2FRGP 3MRBB 1NMBL 2A83A 1UM5L 5D71H 2ZWLT 5I2IB 2G2RA 4XP1L 3EFDL 3QH3B 1RURL 2NTFA 4QRUA 4U1SB 5IHUL 3V7MA 2CPCA 1V7NH 2R1XA 3ETBF 1TVHA 4IS6A 4RFNB 5I19L 3PWPE 4PJ7E 3K8KA 1Q72H 7FABH 4FNLH 1N3NB 4ZAKA 5IQ9B 1FG2A 3G5VB 3HR5A 1E4KC 2A9ML 4WHTB 2N1KA 3MV11 1DP0A 5F7LB 3BAEL 3QEHB 3WFEH 1P7QD 2XN9E 2ZCHL 3C08H 3PIQA 1GAFL 1FCCA 4F7PB 3U2SB 3MFFB 5HGAB 3NN8B 1JK8B 3QXWA 5A16A 4ZUSB 1RUKL 1KB5L 4PRDA 1A7BA 2W92A 1URLA 1AGDA 1U58B 3BP7A 3CPLA 3U0TA 2XTJD 1DLFH 2VDOH 3O11A 4OFIA 5EZIH 3O8XB 1XMWA 2VAAB 2CIIA 5IEKA 1Z5LA 2NY2D 2OP4H 2FATL 1U0QA 1QBMH 2OTPA 4XC1L 4Z7VE 2PYFA 4R2GC 3VG9B 1QA9B 4NDMB 1MQ8A 4PJGE 5CBEB 1WK0A 2E8YA 1QHOA 4ZFGL 3MLUL 1JYVA 3QPXH 1KOAA 1HYSD 1RJYA 3K4AA 2NY4C 4KXZH 4MXVF 4QO1A 4LSSH 1RQ5A 2BJMH 2I9TB 2L4OA 1RD6A 1XGYH 2DDQH 2HKHL 1LO3L 4WU5B 4M00A 4D9LL 3MV7A 1KGCE 4LSUL 3REVB 2FNBA 2IAMD 1FZMB 4NJAH 3R1GL 4QHLA 4KQ4L 1H3VA 3QFDA 5E2UH 1JGUL 4X5WA 2EDBA 5IROC 3R0NA 3OKDA 2I07B 3C5SA 4JY4B 5IK3B 4OZGF 2DD8H 3FZUC 2P47B 1A64A 3MBEA 4MAYA 4XCYA 4LSQH 5C07B 3TFKD 3IAPA 4IOSD 1LO5B 2YRLA 4HS6B 4MWFA 3SKUD 3GJFK 4OTXL 3O3BA 4QRRD 4ZOBA 4S10A 1FN4A 2XQYG 4ODHH 1CL7I 5DK3A 1J88A 3IGAB 1RZGB 2CXGA 1NSNH 3VXMA 2VDQL 3QEQD 5D72L 5D71L 2WINA 4EI5A 4FQXD 2P42B 3EFDH 2QQNL 5HVFB 1SJHA 2VXUH 3V8OA 4FABH 1B0GA 1HKLH 4PY8I 1BOYA 5I8EB 4QHMA 3TN0C 4IMKC 5IHZA 4M6NH 2BCKA 2E6QA 2UZXB 3EDFA 4XXDB 4OCSL 3SJVA 5IB4B 5F7UA 2ZOKA 3LRHA 3MRCB 3O2VL 1ZWIB 4DVRH 1JI2A 4F2MB 3RWJB 1A21A 2GQHA 4GQ9H 5ID0B 4K3GA 1KN4L 4AT6B 5IB3B 5L0QC 1J1OL 1YNLH 2VDMH 3DROA 1ZLUH 3F58L 4XBGA 4KROD 1W0VA 4RAUB 3PQYA 5I1GL 4IOIB 4RIRA 4PBWD 4S1QL 4XNQB 5EZIL 4AL8L 3MXVL 5AYQA 2OP4L 2OL3A 4WUUE 5FHAH 1KC5H 5H2BB 1MQKL 1R5IA 1QBML 3R8QA 3TEUA 3LS4H 2A1WL 3TYGH 3P4NB 4MAYC 4OI8A 5BW7A 2DM2A 4XXCA 3D3VD 1U8QA 4NQEE 4RCAA 3QAZC 4MD5B 3AXLA 4NKQB 3SDYL 2VZTA 3EYVA 3CCHA 4XB7A 5BRZD 3WNLA 1WZMA 2FGZA 4YBQD 5FOBB 1KYOJ 4H25B 1IQDB 1S7VA 4QXTA 1ZA6B 1ZANL 4Y88A 1MF2H 5H37H 3T0DA 2K9UA 1W72H 4HUXA 1SEQH 3MJ7B 4OM1L 2ADFH 3PL6D 5CEZL 3L6FB 2WWKT 4OF0A 3F12A 8FABA 5B4MD 4YHPA 1YEDB 4OD2A 5CIPH 2V7HB 5IUSA 4ETYA 1BBJB 3MBED 4F37F 4X6CA 2BSSB 3QUMB 4M8QB 5IFAH 5GPRA 1UEYA 4DTGL 1CD1B 2WM0A 3RNQA 4B41A 5AYUH 1MAMH 4NKIL 4OT1L 2VQTA 2NY0B 5DD5L 3HZVA 4KTDL 1TZIA 4JFDA 2AJUH 2YD7A 1INEL 4GKOA 2Z31D 4XBEL 3DO7B 4I0CC 4DW2L 4MXQC 1W2KT 2XWJA 1HEZA 2JF1A 1ZEAL 3O3EB 4ZXBA 5IMKB 5JA9A 3WSQL 1XZ0B 1OAYH 1NSNL 5GRVK 3MACH 3P30L 1A6TA 2XWJB 3FN0L 5D6CA 4XAWL 3KHQA 4ELMA 4A6YL 3P0YH 5DC4B 3VE0B 3JTSA 3HZVB 3WFHA 5D1ZA 1E4KA 5DZLA 5AG9A 1CXKA 3NIGF 3W5MA 1P4IL 4X98A 3CC5B 1FFNA 3I2CH 1A3LL 4NN5C 4KUZH 4X6CB 5FYJE 3UZQA 4C4KO 5I8OL 4YUEH 1C12B 1U3HC 3V4VH 4NQTA 5KSBA 1Q1JH 2VRAA 3EO0B 1U8NB 1BZ7A 3CK0L 3QIWD 2E5EA 1P5VA 2B20A 1ZXQA 4CVXA 3STLA 5CIPB 1DEEA 2W1NA 1KN4H 3OXSB 4J8RA 1UB6B 3GRWH 4OF3A 3QUMH 4PP1C 1YNTA 1A7RH 4L4VE 1S7WB 1YNLL 3A67L 1FNLA 5KVMC 2OR8A 3VXUB 1MIMH 1LP9F 3LOWA 4P2OB 2XI9A 4W4NA 2IH1B 1OP9A 1EJ6A 2E7MA 1BVKA 1IE5A 1UYWL 5HBBA 2ICES 1FBIH 2DKUA 2DJ4A 4X4YA 3OKNA 4K8RH 2W9EH 1JBJA 3TWCL 5DK2B 4JO4L 4PTTB 5L2JA 3ARGB 2OL3B 2VR5A 3E6HA 1CDIA 1FRGH 2FR4A 4POZD 1FFOA 4XVTH 1S5IL 1CXIA 2NX5D 2LAGB 5E94A 4IOIA 5DA0B 1MI5D 4LKCA 4TVPD 4XP6L 1EGJH 1PG7W 4GRWE 4NN7C 5B4MC 5IEHB 1S7RB 3DUHA 1PKQB 3OAUL 3G6JA 4F3FB 1QSFB 4PGJA 3QG7H 3B8YA 2WLYA 2NY1B 4AIOA 4ZO6A 5CEZH 2PKDA 3ZKNC 5IIEA 3OTTA 5D70H 1A4JA 5EZJA 3FB7A 1A2YB 2QLVB 4YQXH 2ORBH 4UQ3B 2ZOKB 3QQ4A 3TO2B 4HC1A 4TTDD 2BOCA 4ODBD 4LNRA 4YEFA 2IFFL 5BJTA 3WHXA 4JPVH 3TVMA 1I1RA 1WWCA 4OZIF 2A6JB 4HC1H 3V0VA 3ULSA 4E41E 4HWEL 4JY6A 1ZLSH 2NMSA 4O9HH 3M45A 1KPVA 3VXUE 5LG1A 4AEFA 5EORL 1VFAB 2D7PA 1VDGA 1F8TL 1NCCL 2X4PA 2QQKH 1TJHL 1XH3A 2FJHB 4N0FB 4NRYA 5CINH 3TBSB 4PLNC 3MUY1 5GS2H 4F8QA 3LKNB 1DL7L 3OPZL 4IIQC 4OLYH 3ARVA 1ZS8A 2YA0A 2YUWA 1B2WH 4JFZH 4LQFL 5ACZB 4M93B 5F7DB 3VXSA 1U2HA 5LJYH 1A8JH 4HJJL 1HCVA 1LO0L 2COQA 4X5WB 1I4FB 4APQD 2G5BB 3EJZD 4ORGA 3WXWH 1FZMA 2HH0L 2AV1B 4PBVC 3GSWA 5E8NA 1IAMA 3AROA 3BHBB 1F45A 1QSFE 2OMNA 1FO0B 5I1IH 1U8MA 4OLZL 1CFQA 1KB5H 1PBYA 2X9WA 2PO6B 4M7KL 5DDHA 3B3IB 2NTSP 5CZKA 1P6FA 3TA3D 1A6WL 1HH6A 3SEPA 5GGSA 3VDBA 1FDLL 3DX8A 1J05A 3BKJL 3OX8A 2WSKA 1AXSA 4XB8A 3Q6GH 2FECL 5IB1A 1EBAA 3QNYB 2ENYA 5C8JB 1SY6L 4TUKH 2PNDA 4NFBA 1WAAF 1QSVA 3CLEH 4Y4HD 5CS7A 3S96A 1Q0XL 3U9PH 3NIDE 1P53A 2F53D 3NCBB 3V0VB 1MH5B 2NX5A 3O11B 2R0WH 2DQTL 3HS0B 3MLUH 3O81A 4OGZA 5BJTB 1CFNB 2YK1H 3DV4B 3HI6H 4I48B 4N1HB 5ENWB 4ZUSA 5ALCH 4NHUA 2ZJSL 1DEDA 1TXKA 3JV0A 3EOAB 1D5BB 4D9LH 2V6HA 3B5GA 5HDQL 3C5ZA 1V05A 2AJSL 4YE4H 2Y9RT 3R1GH 1S78C 3PF2A 5DD0H 4O02L 3CSPA 2WQRA 3OKEB 3SPVB 3QIUB 1ND0A 1MUJB 3F7VB 3SDDB 3PHQA 2W9DL 1ZTXL 3GSXA 3GGWB 3D25B 3IJSA 2B4CC 1GGYA 4N8VG 3QDJD 1MSPA 3ZKND 5DA4A 3I6GA 1DQML 4OAWB 4HWEH 1GCFA 2FR4B 3BQUA 5E5MA 5C09A 3DYOA 2OXGA 5F21B 1OAXH 3TBVB 2BHUA 4FQLL 4PGDB 5D72H 4D8PB 2DB8A 4Z8FL 4PJFF 1ZHNA 1AGCA 2ED7A 3UTOA 5F9JA 4F57H 4ODXA 4UV7H 1HKLL 2D7NA 1NUGA 4EKXA 4OLYL 2QL1A 3H7BB 4YHML 1B2WL 4JFZL 4LQFH 3K2MC 5E7FA 1OF2B 4KH2A 2Q86B 5J89A 4KK9C 4J8RB 3RWHB 1AFVL 2BNQA 4GG8B 4BKLA 2ICWJ 3T0EA 2XKNB 2HVJA 3N85H 4HXAL 5C0JB 2CLZA 4P57B 4TN9A 4OZHE 1MI5E 4I3SL 1NGZA 2PXYA 2EEBA 3O3DB 4GG8A 1HZHL 1FAIL 1NKRA 5GGVL 3ZZ1A 2ADJB 2Q3AA 1D6EB 2BXZA 5EB9A 1OF2A 2IQ9L 2DBLL 2ZG2A 2W0PA 4HIIB 1MLBA 3KXFA 2X1PA 1EBPA 4L5FL 4HS3A 1R3LB 4P2QA 4XPFH 4RQQA 1HQ4B 4XNZC 2Z93A 3WUWA 3JWNC 3Q48A 5IMKA 2X4TA 4NQVA 3QEUA 1HOCB 3EUUA 4I9WD 4BA8A 3OKOA 2CKBH 3BEVA 1CE1H 2Z8RA 4M3JA 3IJSB 1I3GH 1R5VA 1Y6MR 1KELH 5GRUH 1CXEA 1REIA 2XACC 4RISH 1W72L 4MXQD 3F7QA 3GSUB 4Z78B 8FABB 1W8NA 4PP2A 3MQIA 1MELA 2JK5B 2WUBH 4V2CB 5TE4L 1YMMB 2AABL 2VN7A 3GMOB 4HUXB 4HG4J 4QHUB 1D5BA 4QCIA 1JWMA 3JBG7 4L4TD 5IBTH 5HD8C 4ZUUB 5I1CH 4I48A 1NAMB 5HPOA 1PEWA 3BPOC 4O2CA 4MD0B 5C0CB 3V0WL 1CFNA 1XGUA 4TTGA 1AXTL 1MCWM 2PXYC 4OZHB 5B22A 4JRYD 3NCJH 1MRDL 4QYOA 1MH5A 5JPMB 3ALWA 5D2LA 1UGNA 4Z18A 3AREB 4PRIA 1I1YA 1HXYB 2CR3A 1IEAA 3DVNB 4YAQB 5E2VL 3WLWC 5EO1A 1PYWB 4U6VL 4Y4HA 2OR9L 1BF2A 3LKOA 5SX5K 4BH8B 2F53E 4D9QD 4F57L 1IMHC 1CICC 4YDJB 1HWHB 5F7HA 3PABA 1B6UA 2A0LD 1FORH 1I7UA 4MNHB 5AZEH 1A6PA 4HKBA 2EO9A 3LQAH 5E2TH 2PTUA 4QRRA 4ENED 4RGOL 3BX7C 2BDNL 3GNML 2BRRH 2BNQD 3V4VL 4LCYB 3VXPB 3ZDYF 2FO1A 1YMMD 2XXCB 4P3WA 1NJ9B 2D7QA 3LH2H 3Q6FB 4N0RA 2BVTA 4JEGB 1I9RL 1YA5A 3TVMC 2FX9L 3VXUD 3QHZL 4L1HA 5IROA 3VRLF 5SWSE 5ITFA 4KI5F 1UZ6F 5JOFB 1F97A 3SJVB 4LSTH 5BS0A 2DLIA 5FM8A 4GAYA 4MB5A 5I8EA 1ZS8B 4HUMB 2B2XH 4PB9H 4I0PA 4L29B 3O41B 3SKJH 1SJHB 3RWEA 1H3TA 2IANB 3AGVA 2NNAB 4PJDB 1T0MB 5E8DH 2JJUA 3SDDC 3VXMB 1BOGB 4G7VL 3FONA 4ZFZA 4E0RB 4HW6A 1OAUH 1RZGA 1MCPH 1DQQA 3P73A 1XEDA 4BFIB 3D39D 4GKZB 2R15A 4NRZB 5I1HL 3KYNB 4ZUWB 4FG6D 5GIRB 5HHVH 4FTVE 1MLCA 2DL2A 1BD2D 2F74A 4X0KB 3D69A 1T21B 3QQ4B 3HI1B 2DF3A 5F6HJ 3GI9H 3K0WA 3CNKA 3MMEA 2C9AA 3TV3H 4LRNH 1R3IH 3ARRA 1IM9B 4LHUA 5IHLB 1CFSA 3QQ3B 3RWIA 1I8MA 4H8WL 4ELME 2XA3A 4I5BB 4G6KL 4C56B 2DQDL 5I1CL 3PWPB 5CHNB 2VXVH 3QIWA 4WO4A 3V2AR 4JHWH 3PUCA 3BN9C 4DGIL 3B9KC 3NCJL 5JDJA 3RWCA 3TJHD 3QWRD 5SWSB 1ACYH 5T33H 3MOBL 4P2QD 2APBA 1CT8A 1N2RB 3SQOH 4O9HL 2QKIB 4OGYH 4HWZA 1S9XB 2Y25A 5IJVA 2XN9B 1JYXA 3DMMC 3NOIA 4GMSL 1FZOB 4X8JA 5TE6L 4KY1L 4OCMC 3QZWA 5CUSH 3W81A 2Y36L 3BP7B 2Q7YB 4P2OA 1JZ3A 4H5SB 5IW6A 3LEYH 4U0QB 4P46C 2C1OA 1MCHA 4I18B 4JDZB 4BQ9A 4CVXB 1C1EL 5FGBC 4FTVB 1HHJB 4KKNA 3RZCB 1M7DB 3FRPA 1FFNB 2YHGA 3RVTD 3I9GH 4X4ZA 5D1ZB 1S8DA 5ADOL 1FYTB 4KJPC 3SKJL 1T2QL 4ELMB 1FDLH 2GAZA 43CAA 2BSRB 4X4MA 4QRQA 5B39A 1QLEH 3AY4C 3MRIA 4MZ2A 1TVBB 1VACB 4POUB 5K9JH 1DQJA 1U3HA 4K2UH 3O3AB 2CLRB 4TULH 3TVMD 5DD6A 1PSKH 2WIIA 1HEZB 3B9KD 4LAJH 1FL6A 1Q0XH 1GIGL 3DGGB 2ZUWA 3KYOA 5CJXA 3O4LE 3M8OL 5TF1L 5HHPA 1VFOA 4EQ3A 4X6DE 2H26A 1CD1A 3RNQB 2VB5A 1DLHB 3QIBC 1VGKB 1W8OA 4NRXB 1A1NB 2PW1A 4Z77B 2GEEA 5IQ7H 4WV1B 3SKOB 5JPNA 3MUGB 2AJSH 2A9NH 2IC2A 4Y5VA 3HC4L 3VRLE 1J11A 1JTTA 1IVLA 1ODAA 4K07A 4R4ND 3B2VH 3VRIA 1JHTB 1HH9A 3ELAT 5EU4B 4KROC 5D8JL 5GS3A 4O5LL 3U36B 3LPGA 1FNFA 1L7TL 2DQDH 5BS0D 4X6BA 3MLXH 4FQQA 3DARA 1KPRA 5EC1A 3D6GA 5EPMA 4YPGA 5JNYB 1OP5K 3Q5OA 1TPXB 4GG6B 3EDDA 1OAXL 2DWDB 4QY8B 1CGSH 4P99A 1FV1A 2EIDA 3CMGA 4R4FL 1KLUA 5DQDL 4KJPD 4X9FA 3L7FA 4LNVA 4OKVB 4OM0L 2FHFA 4TSCH 4YWGL 1EZVY 3V4PH 3ARQA 1W0VB 3ARFA 4RAUA 3NVQA 5AWNH 4PRBB 3U48A 3NTCH 2FIKA 4HXBL 4KDVA 5FO8B 2GTZB 2MJWA 1M05B 3KPRE 2F54D 4WUUB 1GRWA 3SE3C 2GTWB 2H45A 3DX6A 3IS1X 5DJ0A 3BVNA 4ZQKA 4LP4A 5H94B 6FABL 4N5EC 4L4TE 3MRCA 1KB9K 4TVPH 2X05A 4CVZA 3KPLB 4O2FA 4NQEB 2O5XL 4IM8A 4RAVA 4JZNB 4RZCB 3LRGA 3QUXC 3HNSL 1WT5C 1JPTL 1WBYB 4HEME 1T0NA 2Y5EA 5ACMA 1UXWA 2EDFA 3MX0A 5HDBE 4P2CG 5HYQA 2YUZA 1NFDB 2AKRA 3HRPA 3L3GB 2FX7H 4GW5A 1H15B 3DXAE 2YN5A 2G75A 1H15A 2LV4A 1T20A 1QLEL 3EJYD 4XNYL 3RVXC 2ZG3A 5HYQB 4KJQC 1PQZA 1XIWD 3CFDB 5C08D 4TULL 4RAVB 4RZCA 1E4XL 5B38A 4S2SB 2ZOLB 3MRHB 1FN4B 1EEUA 4ODUA 4J6RH 4WI4A 3IJHB 3TPUA 5B3JE 5J1TC 4AH2A 1NCUA 2JB6B 1YEGL 3VFPB 1MIEH 4HJGA 4K3JH 5HHOD 3WNNA 3KLAA 1OW0C 4KMQA 3QFDB 4WU7B 5TE4H 2DN7A 2AABH 2W07A 1NC4B 1MCOH 4X9HA 5GGUA 1LK3H 2HLAB 1S7SA 2YKLL 1UCTA 2QSQA 5IBTL 1KG0A 2XZQL 1TJGH 4M1DL 3V0WH 5L6YL 2A6DB 3MBEC 1SMAA 1UJ3A 3S36L 4XCCL 2EDWA 5DO2D 3MR9A 5C0AD 3QDGE 2R8SH 4M1GL 3OZ9L 4X6CE 3VFRB 3LB6D 3V6FB 1YMHB 4K71C 1RPQA 3MA7B 3QHTC 1QA9A 3ULUL 2EDDA 1DUZA 2EYTB 3BPCA 1WBZA 4PJFE 2IPTL 4MQ7B 4OF6A 4U6VH 3H3PL 4HUWA 3CDYA 4OLWL 5FKAA 1HH9B 2VLKD 3BP4B 5AUMB 3FT2A 3STZB 2CDEA 3MLWL 5JPNB 2H1PH 5HVGB 2B0SL 2IALB 1QPXA 1MWAH 5F93C 3IDJA 3D0VB 1KTLB 3QDHA 3C6SB 3RNKB 2VZ1A 2DWEB 3BD4A 1WC7A 4F80A 4WI8A 5JR1H 5MP6L 3MLYH 1HDMB 1BBDH 5DD6B 1HHIA 5BRZB 1C5BH 2DLHA 5D5MA 1II4E 4PB9L 4NFDA 4ELMF 4Z7UA 3S88H 2PXYD 4DN4L 5L2KB 4PJCE 2FIRT 3SCMB 1FYTA 2LQRA 1DFBH 2A73B 3FB8A 3MRBA 3EBAA 5KSAB 3RTQC 1Z6JT 1UJTA 4PJ7F 4X6FA 1MCNA 4YX2L 1TNNA 3BWAB 3SE4A 1IGIL 5F3BA 3STZA 1CDCA 5D7JD 3EKCA 3IU3B 1F5WA 3IKCA 3BSZL 3SO3B 4Y4FB 3BP4A 4FZEH 1J0KA 1PG7X 3HZKB 4U6XB 1C5CH 4CN4A 1JPSH 3N1QC 4E41B 1PD6A 3BIKA 2K3TA 4ZTOH 4JY5H 3LEVH 4YNYA 1DBBH 5AUMA 1ZHBB 4BFEA 3RPIA 1DUZB 5KW9H 4LPUA 2ZNWA 3V6FA 1FZOA 4OF7A 3RHWK 3AMKA 3D5OF 1ZVSA 4MX7A 3RWDA 1OD9A 4OLXH 4DVBB 5D7KE 3RHWF 3BDYH 1S9XA 1FSKB 3BPCB 2EH7L 4LBEB 4JPKH 2CUMA 1KXQE 4OCNC 5I18L 1MY5A 1F4XH 1BEYH 1LO4L 1O0VA 1TCMA 1AC6A 5E00A 4Z7UE 4WU7A 4KGLA 3IXTA 4I3GA 1UJ3B 4WO4B 5BRZE 4FQCH 1ZT4A 4HJGB 3ISWA 1B9ZA 1S7SB 3NPSB 4G8FA 3EZJB 2Y6SD 2FO4A 4QXUH 3DXAD 4LKXB 2R1YB 4PJCB 1I8MB 3RWIB 4UDTA 1EUTA 2IEPA 2EIZA 2X42A 1K5NA 3S4SG 5FOJA 1QR4A 2Y5TB 3CSYA 4X5LA 3RY4A 1GC1C 4XCEA 1XF3A 4YO0B 5B38B 3D39A 4G9FE 2D9QB 4D0CA 3LN4A 5C3LD 1C1EH 3V5KB 1DQDL 3IYLW 3B43A 3KYNA 4ZUWA 1PQZB 1D5IL 2KH2B 3RL1A 1WZKA 4UAOB 4Q58C 3KDMB 1Q0YL 4FQ1H 5E6YA 1FNEA 3VMNA 3P9LB 4JFYB 4JFXB 1CD9B 2AKRB 5MP6H 5JR1L 5GS1B 3NCEB 4ZFZB 1UG9A 3GBMH 3U4AA 2DQEH 4JREC 5C0RH 3ES6B 5ADOH 1FE8H 4IJ3C 4PLOB 4Q6IC 5ICYA 2OL3H 1QHPA 4CVZB 4I2XE 5CSGA 4R8WH 5IESH 1NFDA 2VDNL 3U7YH 2DKSA 2EDLA 4DGVH 1RIHL 4JKPL 5IVXB 3VWJA 1J0IA 5KS9B 2WK2A 3D39B 1QSED 3ZE0E 1DSFH 2Y07L 3KPLA 2FIKB 3SDDD 4FFVD 2NZ9C 4NFCA 5CD5C 2AV7A 4K71B 4PJ7A 1Q8MA 1C08A 4OGAD 3SGKC 4BSWA 4PR5B 4L9LA 4LSRL 3EAKA 4WUUA 1GAFH 3A6CH 1M05A 1TENA 4OKVA 4PJIB 5CEZD 4Y16A 4JFPA 1NAML 4QRRB 2OR7A 3CVIL 3IXTB 4XZUA 2R0ZL 3PABB 2FZ3A 4M03A 4YPGB 5D8JH 2ATPB 3FO1B 4G9FB 2FATH 4Y4HB 5KJRL 4WJ5A 3BP6A 5K9KB 2GSGB 4MMXC 4M93C 4Q9CA 5KSVB 1HXYA 4RFOH 1ZVSB 3EYQC 3A6BH 4Z7OF 5JNYA 2ZUXA 1WZ1H 5H35B 1IKFH 4FZ8L 4MNQD 1IFHL 1T3FA 4WFGE 2MQ3A 5E8OB 1R3KA 4LL9A 1ZHBA 3ZT7A 4LHUD 4MD0A 4WNQB 4O2CB 4AIZB 2IGFL 1S3KL 4F7EB 3SKOA 2BJML 2R39A 5DJ6B 1KFAH 4POYA 1VGKA 1SEBA 2IAMA 4PJ5E 4QTIH 25C8L 4ZFOA 5BMFH 1ACZA 3GIZH 3GSUA 4APQB 1U8IA 4XRCB 3T0VA 5E9DA 5DVLA 2WQ8A 2EZ0D 4NP4L 4OUUB 5KSAA 1EJOH 1DQDH 2F15A 5HGBA 4EDXA 4J3WA 5GJTL 2WBJB 3CX5J 3U7WH 1X5HA 4PJIE 5JXED 5D1XA 5I8KL 4YXKH 1XCTA 4QRRE 3MRLA 4R3SB 3SDCA 2NR6C 2P5EA 1DQLL 5J7CC 3DTXB 4JFQA 1BZ9A 4WI3A 5GZOD 2QQNH 1EEZA 2Z8VC 5IJKC 2P1YA 3UBXA 4JO3L 4YFEA 1KCRH 4OGXL 3VH8B 4ZS7L 3W9EB 1QFOA 4AENA 4RBPH 3ILPB 1YEJL 2C1OB 4J4PA 5ISZE 4U1KA 1F6LL 2V17H 4ZTPL 3QFJE 1HHHB 4NO0A 2FYYB 4JFHE 1IAKA 4F37K 3DLQR 4AMKH 3D0LB 1A6UL 5DO2C 5DRNB 1QKZH 5IFHL 1AJ7H 1NC4D 2VZOA 3BP5A 3MV01 4JREB 2WLZA 5DUML 4XNXH 3ARFD 1FGVH 1X5ZA 3QZWB 5EFIB 4F9PA 4JQXA 1LD9A 2XT1B 4NNPH 4TPRL 1CCZA 3IDGB 1TJGL 4G8EA 4TUOA 1JF5A 1TDQA 5JOPE 4N9OB 1ZVYA 3SGEH 2IBGA 1IAIL 4X9BA 1T7WA 1FNSL 2R8SL 3L5IA 1IKFL 3AU1B 2XRAL 1CLZL 2PTTB 4N0UB 2C3WA 1E28B 3GSXB 5CZXD 1NCWL 1ZANH 1CL7L 5DK0B 2H2SC 4YGVA 1NGPL 4TQEL 3VFSA 1GYAA 1QQDB 5D9SB 3T0BA 2ZCKH 3SJVE 3QQ3A 1TQBB 5MHSD 2CO6B 5BMFL 2FDBP 4Z7NF 4HIHB 3WD5L 1UEMA 1RUPL 1I8KB 5DC9B 3T3MF 4BFIA 2H1PL 4KU1A 1EAPB 1XR9B 4U3XA 3D69B 4PJDE 4U3CA 5E9DE 4ODWB 1R3HB 1EUUA 5TGBB 1BOGA 3V4UH 3P0GB 2BY1A 4GAGL 5GGTH 2BNQE 3QDMD 4DOHE 2EE3A 3KXFD 1JNHA 1DDHA 3TBTA 3BDXA 4DW2H 4GW5B 3ROOA 3MRFB 1QFUH 1G7IA 4KHTL 1I1AB 4L3ED 1PVHA 1KB5B 1QFWI 1T7YA 3EYQD 4QOKB 5FM5M 2NNAA 1F13A 3IDMB 4OV5A 3GFUA 3CDGA 5SX4I 2R4RL 4A2MA 4P0DA 5C2UB 1JL8A 3UTTD 1JF6A 5AD0B 3BGMA 1H3PH 2PO6A 2EECA 1BIIB 4FFWD 4C56E 2VXTH 1TLKA 4DEPB 3K81A 5EZOL 4ONFH 2H3NB 5KOVC 5I66B 1ES0A 4ZUTB 3P11H 3N1GC 5IF0A 4X5XB 1NJ9A 4I77L 4P9ML 3SCMC 5KSBF 4PREA 2YD6A 4BH8A 4I13B 5GSVB 3A67H 5DRZB 1ULVA 2IAMC 1FV1B 1MWAB 1FVEA 3K2UL 5D96B 2DQGL 3RY6A 1I7UB 1UQSA 1KNOB 1NFDF 4LHQB 2UVEA 1BVLA 4LSVH 4NRYB 1ZGLB 3V6OA 1F6AA 2X4QA 5ALBH 3WS6A 2XG5A 3UBXG 1BQSA 4X6BB 4RA3A 4YH6A 3WE6B 5J11C 1LO4H 5BZWB 3H9HB 1A7NL 5BXFA 4QYOB 4R6UA 1NQBA 2BNUB 5DLMH 3TVMB 1S7UB 1CLZH 5CZVL 3P0VL 2WUCH 5C0CA 1N0XL 3PXJA 3MA9L 2BOCB 4ZUUA 1G7QA 5HVHB 4YXLL 4WV1A 4PJEE 3MRGB 3M1BB 1U8PB 5EOTA 4I3RH 1YMMA 5DJXA 1CD0A 1T6VN 3RUGF 1EH9A 2FJFB 4JE4B 2XNAA 3VG0H 1FYTE 3IDNB 4MQXD 4J3UA 5CGMA 5KVFH 1QUNA 2DD8L 3G6JB 4WO4C 3LCYA 5D6DC 2X4TB 4IRSC 4OFKA 1DQJB 1U3HB 1VCAA 4JQIL 4JDVB 1IBGL 1I1AD 5J57B 4Y5YA 1N64L 3BEVB 4U4BA 4FQ1L 5FYJD 3WNOA 3KXFB 1Q94B 1JYWA 3KYMA 1QR1A 2C3XA 1GGTA 4UTAL 1IL1B 4Q9QL 4H26A 1SHMA 1KIUA 4JCLA 5E1AA 2ADJA 2YS4A 3C87A 3IS0X 1CDJA 2AI0L 1IGCH 3I75A 4FTVA 4G43A 5IGXH 1FCGA 4NJAL 5E2UL 3T0EB 1ADQH 3GHBH 3RWHA 4LOUD 1YNTB 4NT6A 5I73C 2Y07H 3OXSA 4KK8C 3VFNA 4FMKA 5EZOH 1WLHA 5JLZB 3SGJC 2HVKA 4M48L 4LK4A 3CVHA 4UNUA 2VLJA 2C4FT 2XKNA 5ECJE 5C0JA 2J8UB 3O6KH 3O4OC 1JUFA 1ZVHA 1U8JB 4H26B 4JDTL 4GG6E 3CC5A 2DIJA 3F58H 3HKFA 3I02B 2MQCA 5JTWA 1QFWM 3L3OA 5GRVL 3VFGH 4LLVA 4OAWA 4KUCD 2VR4A 4OCLC 3TC9A 4ETQB 4JJ5A 2VXUL 3BKJH 4IEFB 3VCLB 3VGAC 3K1DA 4FABL 4GKNB 4EVNB 1BGXL 4HD9A 3RL2A 3OF6A 3L3JB 5LGKA 2K7QA 3RAJL 4OCSH 4KKBC 3PHQB 3QNXB 1U92A 5JIHA 3C09C 1QO3A 4G8IA 5GXBB 1IFHH 5DLML 2XTJB 4NIKB 2YK1L 3NFNB 3DURA 2XA8L 3THMH 3GGWA 2Z4QA 4L4TB 3QCVL 3WS6C 4P4KD 3RUGA 2OS7A 3WFCL 5T3ZD 5JXEC 5ILTL 4I3RL 2W59A 1P7QB 3EZ8A 5EU7C 2AP2A 3LMJL 3L6FA 3T0EE 4PRIE 3ECBB 4M7ZC 3WEXA 4L8DB 3RBSA 5IWLA 1H5BB 1Z2KA 3DXAA 1BJ8A 4QXTB 2AJXL 3T1WA 1SQ2N 2CR6A 4C59B 2NY0D 4NKIH 2G5RA 2CJUL 2VKXA 3BPLC 4GFTB 4Z7NE 4ESKA 4GMTH 3I6LE 1XF5A 3RWEB 4FOMA 1X5YA 1NCNA 5C0IB 1UQSB 3O45B 3FRPG 1D5MB 3OAYK 4OCXL 1NCAH 2EDTA 5BS0B 2ATKB 5F97E 3TBYB 3FN0H 4WV1C 1DQLH 1HILB 3BHBA 3UPAA 3DX8B 4YDLC 1AP2A 1U8OA 1WWWX 4MQSB 1MFDH 3P0YL 4NM8H 4PJ9A 4RIRB 3IFOB 1YN6B 4YXHH 4JO3H 1MCKA 5F1SA 2G5BA 4TSBL 4GW4A 1FNAA 4LCYA 4NBYB 4UILH 3VXPA 1VGEL 4ZOAA 4MXVE 1KIQA 3S37X 5ADPL 4AT6A 4YUEL 4XX1E 2XY1A 1EV2E 1AFVH 2AJZB 4NO3A 4DTGH 4KJWD 4MNHA 1AP2B 1U8OB 1DR9A 5I1KH 3IDMA 5E5UB 1NDMB 3BIAX 4J7RA 1UWXH 3HE7C 2IQ9H 3LKRB 4XXDA 1JPFA 4YAQA 1I1AA 3MACL 3P30H 4WFEE 5EZLA 1KPVB 4G6MH 4GBXC 3ROOB 3LKNA 4XAWH 3BYYA 5D2LB 4D9QE 1RIUH 4UT6L 2AJYH 1A1OA 1U3YA 4XCFH 2A6JA 2X4PB 4Y16D 4TPRH 2HTLC 1BGXH 1GZQA 3L5HA 4Y0GA 1IAOA 3N06B 1MFCL 1FH5L 1AH1A 4HQQL 4YBQC 1IAIH 4LOUC 5HHOE 2VIRA 5F9OH 4KUZL 4JY6B 1EAPA 3MRDB 3WEXB 4U1MB 1A9BB 4AZ8A 4BFGA 1MFBL 3QHFH 3ZKXC 3EDEA 5HY9A 3S37H 2DLGA 1H3UA 1DBKL 3THML 4DKDC 5FYKD 4OIBA 3TNMB 3QUKA 3ZHLA 3D87B 3BZDA 3O6LL 5T1KA 3OKDB 5ILTH 2XICA 4N0UA 1MIML 1AKJA 2CIKB 1CFTA 1Q9WA 3C9NB 3PGFH 5C09E 4G8IB 5JDSB 3EGSA 1FBIL 4LLUA 1FFOB 4F3FA 5FYLH 2E9WA 2XN9D 3GIVB 4GUPA 4K8RL 4OIIH 2VXQL 1A6ZA 1I7TA 2A6IB 3MCKB 5ESQB 2BZDA 2DQHH 3S35X 3UJTH 5C70A 2X4RB 3MRRA 1NUFA 3NGBC 5E4EB 4HIJB 4XMLH 2VKWA 1JHLL 1K6QL 2XZAL 3MRQA 1JYNA 2RQ8A 1Y18A 4DKAA 5DK2A 2WMPA 4PUBH 4PGEB 3DSNA 3M17A 4HKJA 5FGCE 4MA3A 4P48A 1KCVH 3OKNB 2DM3A 1J5OH 2ICEB 5JXEA 5DURD 2IH1A 5IMLA 4QHKI 3FT3A 3U4BH 2CLZB 2YZ1A 3BE1L 1HHHA 1H3PL 1JGLH 3GSRA 4PRDB 4YHLL 1MJ8H 3T0AA 4YQXL 1HI6A 1YYLH 3I50H 2XG4A 4P59L 3PIQB 2JCCF 4JANA 1DEEB 4HJJH 5FB8A 3W9EA 4YHZL 1VEOA 4D9RD 3EO0A 1J18A 3VE0A 5C7XH 1S7TB 3NFPB 4EXKA 5E1AB 1A6TB 3K8LA 4D8PA 4M7LL 5I6XB 2R23A 3SDCB 2R56H 5B39G 4XPTL 3R8BB 3P4OA 3O3EA 3TBWB 3VI3E 3VFMA 1IC5H 3PJSB 3DO7A 3MJ9A 4G6FD 3IVKB 2B39A 5I30H 4G7VH 1R24A 1I8IA 4XVJH 8CGTA 4LMQE 2H6PA 1CIUA 4Z0XA 1YY8A 2M1KA 1BBJA 3F62A 3NCYP 2KUTA 3U83A 3SGJA 1NBQA 1U8IB 1LO0H 4XRCA 4CNIB 1MFBH 1IGFH 4Y4FD 3HI6L 2BSSA 3QUMA 3HMXA 4LCWD 1WCBA 3DI3B 4M8QA 5ALCL 5TDPB 4UUJA 4OD2B 5IB2A 5A2LH 5F7YC 1A6WH 4Y4KD 2CH8A 4MJ2A 4Z95L 4W4OC 4W6YB 2PF6A 3T1FB 1U8QB 1A6VH 4I2XB 4NNYB 15C8L 4Z9KB 2NY6C 3VXOB 1NAKL 2GSGA 2HWZL 4K94L 4AY0A 3CCHB 4ZFFA 5F8QC 1KEGH 4R7DA 2NYYC 2OJEA 1TJIL 5IVXE 1UC6A 3AXLB 3H0TA 3V5HA 1PFCA 4XMLL 1KCSH 4UT9H 3ZE2E 3RVUC 5HVHC 3DV6A 4WDIA 3VFWA 3BRGC 2HTLD 4P5KB 4ZAKC 4CDGC 3P4NA 3KLHD 4XBGB 2M26A 4HLJA 1EEYB 4YDKH 2NY5L 1EERB 5I74C 5IB3A 3MLZH 1T7ZA 4LLUB 4OV6F 3B9AA 2ZG1A 5ID0A 5HDQH 4XWGL 3NCCB 1Q9WB 3C9NA 3KPSD 3W5NA 4XNUH 1ADQL 2BSTB 2XY2A 4YHLH 2DJSA 4UIKH 1UENA 1INQA 5F89A 2NQCA 2F53A 3E8UH 3FQWB 3L3IA 5F7DA 5IB4A 5ACZA 3TP4A 4JZJC 4H1LH 2ZUQC 5J6GB 2J8OA 3RIFF 5EDXA 1TTFA 1B6DA 3AS2A 3TBSA 1DN0A 1NGYA 3ARFC 1BX2A 4XGZA 3RDTD 3CXHK 1F3JB 4JDTH 3BKYL 4G80A 3ES6A 5FK9A 3QB7C 1KB5A 4LP5A 1RZ7L 3LEXA 3FQXB 4U6YB 3MRFA 5F6HI 1JVKA 1OAZL 2JJTC 2UWEB 1IC5L 5LVEA 1X4YA 3ULSB 1INDL 1I9IL 2EKSB 5DR5L 3WXVL 4GBXB 4HS6A 1ZT7B 3V5KA 1U3HD 4LNRB 3GDBA 1JPFB 4YHMH 3BXNB 4ZNEE 1VPOH 4BYHA 3RGHA 2UY7A 1XF3B 4YO0A 3PWLA 2Y5TA 2CKBL 2Q76B 4PRHE 2RFXB 3VD5A 3FB7B 3M8OH 3N85L 2EIZB 1BF8A 1N7MH 4ZPVB 3VFSB 2GJZA 4LCWA 4LQ1A 5INCB 1KIRA 3QUZD 3MC0A 3I6LD 4M6OH 5IOPA 2OTUB 2FGWL 5IK3A 3F7YB 2XZZA 4JFHD 5DF0A 4LMQI 1V8HA 1MCQA 4UB0H 4PY7B 4EN3B 1NANI 4NHCH 1IQWL 4O58H 4XPFL 2A0LC 3MLXL 3QZWG 1HCFX 2VLJD 2JJWA 2NLJB 3SN6N 3DRTA 2XQBH 5JHLH 1KENH 4XPHL 32C2B 3O8XA 1BFVH 2AERT 1CE1L 4N8VB 2VABA 3BD5A 4LDLB 2NZ9D 12E8L 5LGHH 5CILL 4L1DA 1FHGA 5TPWL 2OX5A 4DK6A 1JK8A 5F3HB 1UWEH 2LE9A 1M7XA 1Z5LB 1YYMH 4JFOA 1ZLVK 4Y19B 3ECBA 2B1HH 2CUIA 4NM8L 5HD8D 1IAKB 1U58A 3CPLB 4JM2C 4UU9B 1FFRA 2KQNA 3OF6D 1UM4L 2WUBL 5F7WC 1QEWB 5IVXF 2K1MA 3AREC 1GHFL 3V5DA 4UINH 2BRRL 1CDBA 2F54A 4M43L 4XP9H 2OZ4L 1U8KB 3NBNA 3O2WL 1KCUH 1BJ1J 2N7BA 3E2HB 2UZIL 2WAHA 2SEBA 4ODVL 3OWEA 4PJAA 5E99H 4PLKC 1NEZB 3KPRA 1AE6H 1OPGH 4U1LB 1MOEA 2F9BT 2P5EB 1MRFL 1S7QB 2EDYA 5LBSH 4JQXC 3L3JA 1XZ0A 4N0UE 3HG1B 4Z7QE 1M71B 4Y2DB 5GSRB 3S35H 3SO3C 1G0XA 4XCFL 4XNYH 3C60A 2OJZH 3IDJB 5HGBB 3AFLA 5ESAA 4UTBH 1RZKC 2JCCA 2VLKE 2XPGB 4HQQH 4RGOH 4NYLB 1OAUL 1VPOL 2HRLA 4DK3A 5DUBB 4IMKA 2FD6L 2VH5H 3TO4A 1DZBA 4FFWC 4CJ1A 1I9RH 2CXKA 2D7TL 1JF1A 3CGTA 4OZIB 1G7PA 4MAYD 4PGCA 3GI9L 3KPQB 2FGWH 2P48B 5C0EA 5FOBA 4K3JL 5LGJB 1V3MA 5D1QD 5DI8B 5A43C 4HMDA 3NCFB 2HFFA 3ULVL 5ANMB 4JHAH 3HUJF 3MA7A 3H9YA 4C56D 3BESR 4X99A 4B0MM 4HLZH 3L5WB 4NHCL 2FEDC 2JCCE 2ZP0T 5E6IA 4GRMA 1K4DA 2DQHL 3UJTL 3QUYA 5C0FA 1QR1B 2DI7A 3FO1A 4G9FA 3NPZB 3O9WC 5KG9B 4Y1AE 3HFML 4XNQA 1IC7L 5KSUB 1EK3A 4N9GB 3OAZK 3HRZA 4XZUB 2FL5B 5I1HH 1MHPH 5BVPL 3RGVC 3RP1A 4PIRF 4FFZL 5IVOA 4MAUL 3W9DB 1P9MA 3CAFA 1KCVL 1SVZA 4K8RD 4QT5B 3QRGH 4OLWH 3VFUB 5MEPB 4AEHH 3ZSTA 1XCQB 2XWBB 4F33A 4Y5XA 1CGWA 1X5GA 4LRNL 5F8RC 3IJHA 2UY6A 1UM4H 4PJ7B 3Q1SH 1FNHA 3VGEA 3FQUA 3T4YA 3VFTB 3CLFH 3N0PB 1ITCA 2HTKC 4WFHD 1C8PA 2D31B 4PJ9D 3L95A 1XFPA 5J56B 1P6AB 2NY2C 1GGIH 4LLAA 5CMAB 3G5ZA 3NAAH 4NC2B 1NGQL 5C07D 2WV3A 3NFSL 3O6FC 1T89C 2PW2A 5B21A 1ACYL 5IMOA 4JR9H 1I1FA 4PJFA 1WBYA 1K2DA 3QDJE 3TIEB 2Y7QB 3SDAA 4MCYB 3I9GL 3HE6B 4DN4H 2B4CL 5KVGH 2DQFB 5HI5D 1S9VA 2E27L 4OZGA 3INUH 5HHNB 3WS3A 2GJJA 4L9LC 2O61B 5JHDA 4ODTH 4LAQL 3RZCC 2YPLA 1NC2B 4PJGB 1DN2A 5DQ9A 3G6JE 4F7CA 2X89D 2Q8AH 3NIDF 4PP1D 5I9QC 3REVA 3RWFB 4LKXA 2EE6A 5A2IH 4JO1L 4EOWH 3KXFE 1BAFL 3I85A 3SHSA 4L8CA 5C6TL 4X80L 2AK1L 3L1OL 1DBBL 1N59B 4JGMA 2H2SD 4M62L 3DHMA 2HN7A 3VD4A 4KJYB 3ROLA 2Z31A 1I3RB 4F9LA 5D7SL 4G42B 4M4RA 2P46B 1HIMH 2VDLL 1UADC 1LILA 1UB5B 3MXWH 5E8PB 2IPUG 2Q20A 1TJIH 5GGRA 2E7BA 1BEYL 1CDHA 3HC3L 1JNHB 3MJGX 4ONOA 3TBTB 2CGRL 5EU4A 1T66D 4BK4A 1T4KA 5FYLE 3U0TB 5EU3A 3HNTL 4K94C 1OT2A 1K8IB 3KPSB 3HAEB 2V2XA 4YFLF 4H0GA 2ENSA 4Z77A 4E41A 3HZYB 3U2SA 4F7PA 3HZKA 4TSCL 4U6XA 4YWGH 2F19H 4NWUH 3D9AH 4KJQD 2A9NL 4BZ1H 3PL6B 2V5RA 4XNUL 3BZEA 4RFNC 1RUQH 3GMQB 2Y1VA 2Q7NA 4HXBH 4PJ8A 1G7LA 1E27B 1NCTA 3QIWC 3KWWB 1UH2A 2CLRA 1E28A 3CJJA 4YFDB 5F1NB 5DEFB 2UZYB 1G84A 1KBGL 4HF5H 5I1JL 1QLRA 4KHXH 4HFWA 1RJLA 5DHVH 4M61B 5HYJA 2FLRT 1S8DB 5FDWA 5CP7A 4JR9L 4U1HA 5HI4C 2OXHA 5GQBA 3UTSA 1OWWA 5EWIH 3KS0H 4TUOB 4KZEH 3VGGA 5DQDH 1M7DA 5I76B 3OB0H 4EZMA 4R0LC 2EIEA 2R29H 5HGHB 4HUVA 1JZ4A 5IESL 3DI2B 1T5WA 2MKLC 1DE4A 1W72B 5DMGD 2J8UF 2GITB 4HPYL 4HV8A 2I5YL 4LAQH 1JHKH 1NCDH 2Y23A 3MYJA 4K7PX 3R0MA 3CZFA 4YHNB 2BVPB 3D0LA 1IGTA 4J6RL 5FA4A 2DQC<