3TH2T

Mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
198
Chain Sequence
TVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII light chain
publication title Mg2+ Is Required for Optimal Folding of the Gamma-Carboxyglutamic Acid (Gla) Domains of Vitamin K-Dependent Clotting Factors At Physiological Ca2+
rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 198
sequence length 205
ec nomenclature
pdb deposition date 2011-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3th2T01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3th2T02
5E6YA 5JW5A 3MRRA 2P45B 5F88B 3ZL4L 1B0WA 4HK3N 1KIRB 4MD0A 4X4ZA 1RHFA 1ZLUK 5DRNB 1PQZA 1IQWL 4Y4FB 2YSSA 5IFHL 5AAMA 5KSBF 1I8MB 1HNGA 4XPTH 5EU3B 4DWHA 1S8DB 2YZ8A 1Z9LA 3INUH 1LO3H 1ZV5A 5EWIL 3BIBX 2VAAA 1KYOK 1J8HA 4FNLH 4LQFH 5ISZD 3ILPA 1J0IA 3WIIL 5CJOH 4OQTH 2HN7A 1AJ7H 1PG7H 3SE3C 3NBNA 2EDXA 2P24A 3GHBL 3QUXD 5F7DB 5TQ2H 3KGRA 5E7FA 3ARUA 4UZGA 3VGAB 1UFUA 4V1DB 4F33B 1RMFL 1KG0A 5SV4A 1AY1H 2R4SH 3C09C 5BO1L 5T1DL 1YUHA 2XT1B 4YR6A 3O2DA 2Z4QB 2CIIA 1D5XB 3VFMA 3CXHJ 3RPIA 2ED9A 4JFFD 1WZ1L 1AHWB 4HUVA 1MLBB 4FG6C 5DJAB 5LGHL 1RIVL 3ARQA 1MIML 2D7MA 3SGEH 3VXRB 5K33A 4OZ4A 1GAFH 2MTPA 5J1AA 3SCMB 3X3FL 1F3JB 1HCVA 4ORGB 4M7LH 5T1MA 4EN3C 3CGTA 4PRPA 4Y5VA 3OKOA 2DWDA 4KRLB 1FNEA 1CICB 1R3JB 3PDGA 1FZMB 4QRUA 1DLFH 1SJXA 3MOAH 3FO1B 1U8LA 3RVVC 5E1AA 4APQB 5EIIA 2VQ1A 5KSVA 3MXWL 4J3SA 4QRPE 1U2HA 5DJDB 3ALXA 3REVA 2VDOL 1A3RH 3BD3A 3WHXA 5IFAH 2F58L 1RJZA 2NR6D 2OXHA 3TFKC 3RBGA 2G2RA 4H0HB 2BY0A 3U7WH 4ZUUA 1A7QH 1A1NA 1AIFA 2PO6C 5A1AA 4N5UA 3P0VL 4NO5A 3J7HA 2KL6A 4DKFH 1DE4B 5DGQA 2EXWD 5J6GA 4XAWL 1N2RB 3QDJB 2I9TA 2RR3A 4QHUB 4RFEA 3L5WB 5EIQA 3OX8B 1PG7X 3LKSB 1X6LA 1BAFL 3L3HB 3PABB 4RZCA 5B38B 4PJAE 1S9VA 3G5XA 3KXFE 3QIBA 1FP5A 1K2DA 4OFIA 3HNSH 5E9DD 4FZEL 4KKLC 3QISA 3NACL 1D5MA 2WWKO 3UO1L 3P2TA 1YEJL 2WV3A 4JRXE 4GAYB 3RDTB 1HINL 1M6OA 1K6QH 2KZWA 5DK3A 2IQAB 1IKNC 2VXUH 4Y4FC 1BJ1H 5GGUB 2IAMA 2VL4A 5FOJA 3S8WA 3O3BB 4JFDD 4JLRB 3BHBB 2H8PB 5GGRA 2XZCH 3BZ4A 4OZIF 4FQ2L 4NKOB 3G6JE 1F90H 4PG9A 4Z7NF 2Q3ZA 1WTGT 2WINB 4QHNB 1AXSB 2LQRA 5E8PB 1OAZL 5DRZA 5IVXE 5IVZA 3K8MA 3WXVH 2XWTB 3NZHH 5ADPL 3IFLL 3WS3B 4HV8B 4LNRA 5DZOA 4YAQB 3D3VA 3AUVA 2ZUXA 3VGAC 4MZ3A 1UWXH 2YD1A 1OP3H 1E4WL 4M00A 5EC2B 5K9OA 5HD8D 5DLMH 4U6YA 1KT2B 3D85A 1CDGA 2B4CH 4LAQL 3SE3A 4U1IA 4KTEH 4K3JH 4NYLA 4B53A 5HHPB 3GK8H 4P59L 1SY6L 1J05B 5HDLA 5GRWA 1IBGL 2VLJE 5JOFA 2CLZA 1NFKA 3O4LA 2F53D 4OCYH 1H3WM 4PRHA 3SCMC 4X5WB 3PE9A 3ORJA 1P4LA 1BGXH 4EI5D 4JHAL 3G6AA 1CICC 2V2XB 4KV5E 4M5ZH 5IV2A 1HZHH 5DGRA 1MI5E 3MOQA 4MNGA 2IJ0C 1SJEB 5DXWA 5L8KB 1K8DA 5I76A 1QKZH 1YN6A 4ZD3H 3E1F1 5KTEL 4PGEB 4APQC 5T1LD 3MODH 4EN3A 4JN1L 2DI8A 3LQZB 3WNNA 4XVSL 3KPOB 4KY1H 5IBTL 1JWUB 5FUCC 3OHXA 1A6TB 4I77H 3IXAB 4NKQB 1JTOA 2ZUUA 3MA9H 1BD2D 5LVEA 4QHLB 4LBEA 2B8OT 5I66A 5CJQL 5D7SH 3TBTA 2ZKHH 1NSNL 3JTSB 1GPOH 3MRKB 3GSUB 3IDXH 1OPGH 4G8IA 3S35H 2M1KA 1CXLA 4LCWB 4P46A 1MHPH 2HTKC 5F3HA 2Q1EA 4WUKL 3STZA 4JR9H 3UTTD 3WKMH 1CD1A 2EKSB 3RDTC 1NFIB 5EOQH 1A14L 1HHKA 4RMUA 4KJWC 3IVKA 2BRQA 1EEZA 5BVPL 2JKXA 3BWUC 3WHE0 3BAEH 3UP1A 4BSVA 3CZJA 2C4XA 2X05A 3SQBA 4YBLB 4RISL 2I26N 4R7DB 2MCG1 3KYNA 5F88A 2X10A 3SDXB 2W1NA 1KIRA 3OG6B 4FP8H 3TF7C 5DRNA 4JG0H 5AYUL 2E3VA 2WK2A 3GSOB 2JIXB 1I8MA 3WNKA 4H25A 5EU3A 3OKMB 2ITCB 2HFEB 3TVMD 5D7JB 2PTUA 4OV5A 5JW3L 5DUBB 2PKDA 4LKXB 3AXLA 4ZUTB 2ORBH 4S0TD 2AQ1A 3M1BB 1ITCA 2FGWL 2D9CA 1NCNA 2EDHA 1HQRB 4WCYH 4YFLF 5F7FA 5ITBH 1DVFD 4OF7A 4OZFH 3OF6D 1AO7A 3WXWH 5F7DA 3U1SH 4JDVB 4OF0A 3QEGH 1V7NH 5C0AE 4L29A 1NBYB 4V1DA 1XMWA 2FSEB 5CSBA 1YPZB 4R96B 2ED7A 3PWUB 1F11B 4G5ZH 4RSVA 1PBYA 1T03L 3DUHA 1KJ2H 4JFPB 1ZA3B 5K9QI 5BS0B 5DEZA 5LKNA 1U8OB 1R0AL 4PJHB 4HS8H 2VWEE 4XCEB 1MLBA 5DJAA 3W82A 3TBYB 5DWUL 4HWEH 3VXRA 2R1WA 4P9HC 3CCHB 4QWWD 3RHWF 5EOCH 1YEKH 3SCMA 1F3JA 4ORGA 4OF5A 4EBQL 1PVHA 4PYGA 1J8KA 4UQ2B 4MHHI 2DI9A 3W0WD 1CICA 1R3JA 4OF8A 1Z6JT 5EC1B 1LP9E 1MOEA 3NN8B 4C56E 4YDIL 2ENSA 4JFHE 3RWDA 5HPMA 1F4WL 4KVCL 4APQA 3EO0B 3KDMB 4XCNB 5GJTH 2GTZA 1JK8B 3ULUH 5EBGA 3RWGB 5AYQA 5ECJE 2PTTA 5F3BA 4OLUH 4FQXD 2VLRD 2CUHA 4I3SH 4RDQG 3FT3B 4GG6E 1U93B 2W07A 1KFAH 1ZEAL 4LEXL 5IVOA 2F19H 3CSPA 4PBWD 1NMAL 2APTA 4AH2B 1DE4A 3C2AH 5C2BH 4TUJA 1EFXB 1N2RA 3QDJA 4PJFE 1NGXB 1YZZA 4PG2C 3CU1A 1J0KA 5TF1L 2RBLA 1CF8H 1N59B 3MGTA 3OX8A 1N6UA 4RGNB 1E4XH 3CC5B 3TEUA 2RGSA 1JGVL 4M02A 3RU8H 4EUPH 3L3HA 5IMOA 4YBLC 4L3EA 1CFNB 3S96A 1YC7A 5GSVB 4UDTB 4HF5L 4Y5XA 3RDTA 2DN7A 2VDRH 3KYOA 1OM3L 4NDMB 2QV2A 1K4CA 5SWSE 2IQAA 4I0PC 5EO1B 1UH2A 4Z7QF 1JPGA 2D03H 3V7MA 3O3BA 4JLRA 4K2UH 1MVUB 2F54A 3FB7B 3OZ9H 5BV7L 2BVOB 5D7JC 3PL6B 4HIJA 1ND0A 1P7QD 4NM8H 4P4KB 1A0QH 2VC2L 4X8JA 1M7DB 1AXSA 4HFWB 5C0GA 5E8PA 4HCRA 3CVHH 3H9SB 3DX6B 3JXAA 1HWGB 1CXFA 5FGRA 2XWTA 2A0LC 3WS3A 3WLBB 5F7WC 2AJVH 3RI5K 1KPVB 3HMXL 2WM0A 5EC2A 3ZT7A 1I7TB 3MLXL 5EU7E 1KT2A 3EJZD 4EQ2A 5MEND 4Q9QL 4XMKL 1JGLL 1ZAGA 5TE6L 3RZCC 1N0LA 3KPTA 4GKZB 5KVMC 5C0BB 3S88L 4L4VD 1PLGL 4XC1L 3HRZB 15C8H 2X1WL 7FABH 5CD3A 4YO0B 2FWOB 1LE5B 1U8HB 5HYJE 2V2XA 3ZKSD 3MJ9L 1ZVSB 4KC3B 5CZXD 1SJEA 5JHDE 3LRGA 4JDTH 2P5WB 4JPVL 4OTXH 4JY6B 4PGEA 4TUKL 3WUZA 3Q6FA 4FA8A 3QCUH 4WHYG 2ZOLB 3RA7L 3LQZA 3HZMB 1T1YB 5E5RB 5DJXB 3KPOA 4BFBD 4KMQA 1E27B 1T5WB 4QYOB 2UV3A 3UYOD 1OQXA 5JORA 2HAZA 1A6TA 1CU4L 4XPBH 3LKRA 5D72L 1KXVC 2XN9D 2OZ4L 5GIRB 4QHLA 4QHKJ 1NCBL 5HVGB 4KMLB 2Y07L 4OKDA 4NC2B 2PUQT 2HT2D 4U1MA 3ZDYF 8FABA 4U7SA 3MRKA 1AP2B 3GSUA 1CR9H 3AY4C 3H42L 4Y19B 4A2LA 3RGVD 4RGNC 3DYMA 4LCWA 4JQVC 3SJVE 1BREA 4A6YH 1IFHL 3MSPA 4R9HA 3MMEB 5GSRB 4PG2A 5CEZL 4LLUB 5TDOB 2CJUL 4J4PD 43CAA 4PD4J 3EGSB 4N1EA 4UDUB 4LDOB 4K94C 2YZ1A 4WFEE 2ADFL 3M8OH 2EE6A 4JO3H 4TSCL 3RWJB 1FVEA 2ITDB 1UVQA 2VDML 4RBPK 3PL6C 4LQ1A 2CLRB 4N0CD 3KPQB 1TJIH 4I0PA 2UY7A 4O2CB 3ZL4H 1U58B 4QXTB 3ILQD 1G9MC 3GSOA 1J11A 5FF6A 2YMXL 1IQWH 2ITCA 2HFEA 1JHKL 5IFHH 3GJFB 2YR3A 2F8OA 4JZOB 1CFTB 3V0VB 3M1BA 5I74B 3B2UD 4POYA 2ADIB 5EWIH 1EERB 2PXYB 1HQRA 1IM3A 3HI5L 1GCFA 5CFHA 1J8HD 4JDVA 1ADQA 3EIFA 3TPKA 3RUGE 4MA3B 1NBYA 5HDQL 3MXVL 2FSEA 3U9UB 4R96A 1ZHNB 1MF2L 3MRFB 2O93L 3GHBH 3AS2A 4PJEF 5TE7H 1YYLL 2R9HD 1RMFH 3NPSB 3UJIL 1ZA3A 5BS0A 3QNZB 5BO1H 2BZDA 4RFNB 2PETA 3RZCA 1QOKA 4GRWF 4WU5A 4XCEA 1F3DH 3TBYA 4WV1B 3HAEH 4XXCC 3CCHA 1WZ1H 5E2WH 1AGEB 4QOKD 1W72A 4MQ7B 5LGHH 1RIVH 1MIMH 4UQ2A 1QP1A 4I3RL 1S7TB 3OMZA 3T65A 4PBXA 5EC1A 4B7IA 1MCHA 3PGDB 4JRXA 1LK2A 4PRPD 4MDJB 4JFOB 3NTCL 2NLJA 1JK8A 1L0XA 3QUML 1NCUA 3AU1B 4BSWB 2V7NB 2DM3A 5HYQB 2AXFB 3UBXI 3ET9F 5E2VL 5C0EB 3MXWH 3FT3A 4HJ0D 1IE5A 2F58H 2ICWJ 1BP3B 2W0PA 1KCSL 5HHMD 3HPLA 1TZHB 1JVKA 1NGXA 3P0VH 1CLZL 1CFSB 3L5XL 3PIQA 1AH1A 5ELIA 3V8CA 2EDDA 1PEZA 1YY9C 3QFJE 4XAWH 2I9LB 1N59A 4I9WD 2R1YB 1S7VB 2H3NA 3AY4A 4AENB 3CC5A 1WBZB 4JQVA 1WTLA 4BQBA 1L6ZA 1CE1H 5AUMB 4R2GB 4UINL 5GSVA 4Y0GA 2MPAL 3IDJB 5GRUL 1BAFH 5FM5O 2W60B 4KI5C 2NY4B 4P2RD 4DFHA 4FZEH 4HS3A 2YXFA 3KYMB 3NACH 3UO1H 4KKCC 1QFWM 3QIBD 5D1ZB 5EO1A 3WDJA 1HINH 1ZGLM 2UWEE 2NQCA 2O26U 1I3GL 1MVUA 3I6GA 1H5BB 1YNTA 2BVOA 2ZWLT 5HHOE 3PL6A 1QLEL 1C08A 2FD6H 1OTSD 2WWMC 4R3SA 1MI5A 3ZE1F 5EA0H 4RGMB 2IAMD 2OCFD 4YK4B 1ZLWH 1LDPL 1M7DA 2Z8WC 4FQ2H 1MCQA 2E5EA 4HKXA 5I74C 4KHTL 3BKYL 2PXYC 5C0IB 2OTWA 4WU7B 2BNUA 2FHBA 4YC2B 1OAZH 4PJDE 3RVWC 4O2EB 4P99A 3C5SA 1KPVA 3MRBB 5FHBL 3IFLH 3SKJL 1B90A 4JZNA 1I7TA 1T21B 3NPSC 1CK0L 3D3VD 3D25A 3X3GL 4RNRB 5DHVB 2DL9A 2Z93A 4CU6A 4RFNC 2FEDD 4QTIL 3HG1E 5ALBL 4YXHH 4F80A 4LPWA 2Y5TA 1QQDB 4LAQH 3QWOA 1OWRM 3ROOB 4WV1C 1CG9A 3FO0L 4UB0L 3O3DA 3RWFA 3KG5A 3LOWA 1KTKE 2FWOA 1LE5A 1U8HA 1IBGH 1G9NC 1ZVSA 3O4LD 1YMHB 1A9EB 3QQNA 1NCCH 4PRHD 3NCEB 1EV2E 4JHAH 2P5WA 4N0RA 4JGJA 4WNQB 4JY6A 4XXCA 5C71A 3MOBH 5DA4A 5JMOC 4FTVA 4MA7L 1F58H 1PFCA 25C8L 4FG6D 1CVSC 5DJXA 5DEFB 5I16A 1DTUA 2R69L 1E27A 1ORSB 4JN1H 4QYOA 1G7JB 2R2BB 1FZOA 4XBPA 4EN3D 4BH7B 1ZSDB 5IBTH 5MEOB 1JMXA 5GIRA 4CVXB 3F6IA 1A7OL 2P8LB 2ZSVA 4J12A 2VXSL 3UCRA 3RVVD 2KUTA 5GZNC 4OFPA 1ULVA 4TUOB 2LU3A 1PY4A 4ODWB 5CJQH 4NHUB 4DUWA 1JZ6A 2VSDA 4BFEA 2LVEA 2BK8A 1QYGL 4XNZB 4R2GC 3ZTJH 4JVWA 4N9OB 4NQDE 2NY4C 4GMTL 5TDOA 3UBXA 2FO4B 3MR9B 3EYOA 3IT8D 1LEKB 1Q1JL 3EGSA 4P46D 4WUKH 4OLEA 4UDUA 5DS8B 1NCDH 3PQYE 3VI4E 5D1ZC 1A6WL 5FYLL 1EZVX 3F62A 3BJLA 3RWJA 1A14H 4NGHL 2ITDA 4G6JL 1H5BC 1L9MA 3TYFB 4G8GE 2X4PB 4X7TB 3OKLB 1S7XB 2MKLC 1RK0A 1DUYB 2CLRA 4YWGH 4RISH 4RGMC 4YK4C 3BD5A 3FAWA 3GB7A 3UXFA 4HUUA 4O2CA 1U58A 4WFFE 4QXTA 5JUEL 3QT2A 1XF4B 4RCAA 1K4DA 5AYUH 4U7KA 3I85A 4YC2C 5HGDA 1INQB 4N9GA 5EBLB 4L4JA 1OTUD 3I84A 1NAKL 4Z9KB 3QXUA 4LSSL 3AREA 5JW3H 2D0GA 3N1MC 2ADIA 3MV9B 4Z7UB 3IDNA 5HYSB 2FGWH 4PTTB 3IETA 4MA3A 1T5XB 3U9UA 3PDOA 3BYTA 3MRFA 2FJHB 4OJFL 3V7AG 3M45A 1AO7D 5EZIL 4IOSD 4V1DD 5FB8B 2X70A 3U4BL 1BFVL 1QSVA 1T03H 1CGUA 5IW3A 3MLSL 3Q1SL 4N5EC 4Z7VF 4G6AC 4JRYA 3QO0B 1R0AH 4WV1A 5DYOA 3BI9X 1EEYB 1WBYA 2H9GB 4X6BA 3JV4B 3QDGB 4OZGF 3RFZC 4YHNB 5DJ2A 3TYGH 5IT2L 2YD3A 1S7TA 3CH8A 3K8LA 1TXKA 1MFEL 4Y1AB 3UTSE 3VXRD 4EBQH 3B9KB 3RY4A 3SCMD 1DBKL 4O5LL 5EUKB 4MDJA 4JFOA 4MA1B 4DVRL 2FDBP 1UG9A 3AU1A 4YDIH 1VKXB 2V7NA 3C5ZA 1GOFA 4KVCH 2NPLX 1WCQA 4AEHL 4JAMB 3QBTB 3HUJA 3GMRB 4APQD 1C5DB 4Z77B 1MEXH 5D2LF 4H88L 4F8TA 3ZZ1A 4BQCA 2V2TA 2ZNWA 5BRZB 3EYSL 3BT2L 3HB3C 1RY7B 3WDIA 4IHOB 4XNZC 3OKYA 1JGUH 4NBZB 1ZEAH 5JW4N 1JPST 1Q9LB 5K59F 3T09A 1TZHA 4PJIF 4ZMAT 5IHZB 1NMAH 4X6EA 1DANU 2I9LA 1XR9A 1XF1A 1WBZA 1ZVYA 3QDJD 5TF1H 4EXKA 5T3ZD 4F9LA 4NO3A 1LO0L 1NEUA 5DDHA 3SGEI 3ZDZF 1U36A 4P2YA 3IDJA 1TENA 1JGVH 4URTB 2W60A 4X99A 5D5MF 2QJDA 2DMCA 3EZ8A 4D9RE 4CGTA 3WCYA 3PHQB 2HTKD 3KYMA 4L3ED 4QRTB 2RAMA 5I8OL 1OM3H 2VXVL 2VTFA 2W0FB 3KPRA 4LRIC 4C58B 1F2XK 4HJGB 1O7VA 3RDTD 2D7NA 4K07A 1H5BA 5E8NA 4OLWL 4KJWD 4OT1L 2PN5A 3DBXA 3GUTB 1FRGL 2HWZL 4G6ML 5BV7H 2F54D 5CEXB 4UT9L 2DS4A 1IM9B 2VC2H 4RRPA 3WN5B 4F7EA 4WU7A 4G43A 1CS6A 2X4OA 1C5CL 4O2EA 4RIRB 1PD6A 3MROB 3MRBA 5JOPE 3KPLB 2AK4A 1P7HL 2X4SB 2XKUA 1GH7A 4D94A 5BOZG 4AT6A 3L3DB 1MHHA 2EKJA 3DVNA 4WW1B 2RIKA 5EG6C 3HMXH 4JFXA 4RNRA 5DHVA 3HC3L 1HEZA 3MLXH 4J6RH 4H1LH 2IG2L 5DFTA 5J9PB 1GVIA 2OM5A 4XXDA 3ROOA 4Q9QH 1JGDA 4XMKH 1JGLH 5H94B 5TE6H 5EO0B 1DBBL 2AI0L 4YFDB 2IMNA 5F89B 3S88H 1FL5B 3MTRA 1D3CA 3MNWB 4XC1H 3VFSB 4EDXA 4LAJH 5GPRA 1TVBA 3EYVB 4G9FE 1IAMA 5C1MB 3NGBB 3O9WB 1WIPA 5C8JB 1A9EA 1JNLH 3HNVL 1MH5B 2ILLA 3B9KC 1XZ0A 1UCTA 3LN5A 1FCGA 1I4FA 3QWQB 4WNQA 3FQTB 4MA1C 1X5KA 5KANG 3QUKB 4EEEA 2HLFC 2KH2B 4K8RL 4YBHA 4JPVH 2E8YA 4M7LT 1LK3L 4EXPX 3DNKA 3IAPA 1YJDL 2AV7B 5SWQB 1G7JA 3RA7H 2R2BA 4HWBH 4M1CC 4BH7A 1IQDB 2NX5E 3O81A 2HKFH 1ZANL 4BFGA 1CU4H 5D72H 3K4AA 2OZ4H 4PJBA 4TUOA 3N50A 3WHE1 3OR6B 1NCBH 4Y89A 4ODWA 3UJJL 2XFXB 2Y07H 5FDYA 4NHUA 3WKNA 5B8CC 2D9QB 2DQTL 2ZUSA 5TGBA 1KIPA 5IW1B 2D31B 1SBSL 3QQ4A 3WNPA 3MLPA 1CE6A 5JMRA 1KNOB 2BJML 1J9CT 5C0NC 1HHIA 2NZIA 5F7EL 4LCWD 2P47B 2FX7L 4MZ2A 3ULVF 1X5JA 1T0PB 2E9WA 5CEZH 2C1OB 2B4CC 4OQTA 1ZGLP 2CJUH 2DKSA 1T6WA 2VQUA 5IIEA 3VWJB 4RRPG 5GGTH 4YHML 2ADFH 2X4PA 4X7TA 3OKLA 2AJXL 4OQ1A 1DUYA 1G0XA 3O6ML 3HE7D 2VLKB 2WP3T 1HQ4A 3JV6B 4DCQB 2P8PB 2VDMH 1KCVL 1DN0B 3V5HA 1AXTL 5FKPB 3WN5C 1I1AC 1A7NL 1XF4A 2PW1B 3ZO0A 1FCCA 3H7BB 1ORQB 3MLTB 5TF0A 4ONFL 3VFPB 2BVEA 4I0PD 4YX2L 4Z0BL 2NCMA 1J1PL 4KMTL 5ID0A 4G6FB 1NDGB 1LILA 2NY2B 3O6FB 1NGQL 4K3HA 1S7RB 3SDXE 1JN6B 3S7GA 3MV9A 4UIKL 1JFQL 5HYSA 1U95B 4PTTA 3OPZL 2QSQA 4OCWL 4ZS6C 3V8OA 3HI5H 2X9YA 3O45B 3BESR 1BQHA 4MMXC 2A0LD 4JHWL 5HDQH 3MXVH 2J88L 4DKDC 3KPPB 1MF2H 2VN4A 5FB8A 3HR5A 3CUPB 3BO8B 2NY0B 1YYLH 3OXRA 1BHGA 3NGBC 3O9WC 1J0ZA 3UJIH 2QQNL 2XTJD 3O6KL 3QO0A 3FONA 3EO9L 4JM2C 3LPWA 4ZXBA 5BS0D 2H9GA 3JV4A 3ROLB 2YN3A 4YHNA 1YPZE 3RZCD 4ZG1A 3BEWB 5DD5L 3LD8B 4B7LA 4Y1AA 3PP3H 5LCVL 4N0YL 2GSIA 4BM7A 4WDIB 1NUDA 4PJHE 5T5NG 1FH5L 2I25N 4I3RH 4LVEA 3M17B 3VXQB 3BZEB 5ESVA 4X6FB 2AJZA 1VKXA 4MNQB 4YDLB 1NLBL 4PGBA 2IH3A 3BEVA 4JRXD 1T7XA 4PV8B 3NTCH 1QSFB 3QWRA 3QUMH 3BKJL 1C5DA 3GEWB 4Z77A 3IRZA 2FR4B 3JWDL 4I8DA 1WLHA 3MJ7B 5E2VH 4AYFA 5GGRY 1LNUB 5HGHA 4IHOA 2A1WL 1WK0A 1OTTD 5IHZA 4HUKB 3FN0L 5F8QC 5HVWA 1KCSH 4XNQB 3WIFB 5C0CB 4CL7A 5B8CA 1CLZH 2MWCA 3L5XH 3ULVL 1MAJA 4ZUSB 4YDVB 4ZAKA 5HBBA 4KQ3L 2VRAA 4NQCE 1FZJB 3OB0K 4HEPG 4XP9L 4RDQF 1X4YA 4RGND 5DUPH 3B2VL 4UINH 4QRTA 1GGYA 2HVKB 5CD5C 2MPAH 2R0ZH 4V2BA 5GRUH 3GSNB 2W0FA 3RIFF 2GSGB 3E3QE 1QFHA 2JJVA 4NT6B 2HG5B 1OP9A 32C2A 5HYSG 4XMLL 4QRSB 2FNBA 4U6HB 4XTRC 3GUTA 2ERJB 1I3GH 3L7FA 2NY2C 3O6FC 1F4XL 1CD8A 1QLEH 1BQHG 3MREA 1IZJA 1IM9A 2BVQB 3WN5A 1I1AA 1TQCB 3PL6D 1LDPH 1W0VB 1MI5D 1NGPL 4DKAA 4WHTB 1Y0LA 1DCLA 4KHTH 4RIRA 3BKYH 4M1GL 3KPLA 2OTUA 2X4SA 1T04B 3ULUC 4QLRA 4AY0A 4WW1A 1PKQE 2D3VA 5FHBH 5BW7C 2X09A 4HWNA 3SKJH 1H8OA 1M7XA 5HHNB 3TO4B 2NY0C 1GXEA 1H0DB 4MQXC 5J9PA 3K3QA 5JDJA 3X3GH 3H2WA 5EULV 4QTIH 5H94A 1CWVA 1MHCB 3I75B 3W2DH 5ALBH 5EO0A 4ZYKB 5FOBA 5F89A 4IIQB 4LEOB 3J8F7 2VL5A 1FL5A 1O5DT 3FO0H 1A22B 3EYVA 3LD8C 5C8JA 2D7QA 2WIIB 3WFCL 5DQDL 5L2JA 4NQDA 4JM2A 2VDLH 1KB9J 5C0BE 3QUKA 2C4FU 1GZPB 1KXQE 4YDLC 1T89C 2P5WD 1G7QB 2AV7A 4MA7H 4EZMA 4XCYA 25C8H 3C60B 1XEDA 4FTVD 3ARFC 1SJVA 1IQDA 5FYJD 5B3NA 3OGOE 1PZ5B 5GGSY 3MRNB 3B4NA 3ELAT 1GGTA 4LSVH 2Q8AL 5FYKD 3LQMA 1OARL 1LDSA 5F7KC 5HI5D 1A7OH 1ONQA 3OR6A 4WHCA 2XFXA 3UJTL 2VXSH 5IW1A 2D31A 1IVLA 3LB6D 2HA1A 3T4YA 1RURL 4NC0B 1KNOA 2DQCL 2YPKB 4PY8I 5FFLA 1QFUL 2R39A 2JLLA 1QYGH 1OF2B 4HIHB 4Y8AA 2X40A 5EZJB 3A6BL 4H26B 2C1OA 4GMTH 3IJSA 4OZFA 1B0RA 5F7UA 5FYLH 3QCTL 4U1NA 2ERJC 1TJHL 3TPUB 2VLKA 4DCQA 2H2PD 2P8PA 1A5FL 3BJ91 3L3KB 4JFQB 4MJ6B 4PJ8B 1KJ2A 4PS4L 1DN0A 3TP4A 2D7TL 3CH1B 1TQCC 4NJAL 4KI5D 1R3LB 1ORQA 2CRMA 5CLTA 3VFPA 3IJYA 5L9DL 4KKCD 5JUEH 3HAEB 3DTXB 4U1GC 3UTSA 4H0GA 3UYRL 2B7DT 1NDGA 3O6FA 4XI5C 1N0XH 1RZ7L 4PJXB 4U1SA 3BGFB 2UY6A 3RTQC 1JP5A 1MPAL 1NAKH 5KS9F 2WWMD 3NZ8B 1YN7B 4N90E 4NOBA 4OCLC 5E24E 3MV8E 3TO4C 3AGVA 1CQKA 1UACL 1U95A 3BWAB 3ARED 4X6DA 4JFHD 3G9AB 3RBSA 1A6AB 1WZKA 2CDEA 4IIQC 1RZGB 3RVWD 4TQEH 5D1QB 4RAHA 4X5XB 4LSDA 1QBLL 4XGZA 3VGHA 5HXMA 3IFNL 5F1IB 3SGKC 4X98A 1OAQL 3NFNB 5E8DL 5EZIH 4XP6L 4PJGF 3IU3A 1ROWA 3U4BH 4K3EL 1BFVH 2NY7L 3PWLB 5CGYD 3ROLA 3MLSH 2BNQB 2JCCF 3Q1SH 4DUXA 5J57B 3BEWA 1G7IB 1KTLB 4JRYD 1QRNE 3LH2L 3QNXB 1JHLL 3WLWC 4P5KB 2NW3A 1KUMA 3PXJA 4UILL 4WDIA 3C60C 5IT2H 4GW4B 4JKPL 5J89A 4JB9L 4EUPA 2D2OA 1FDLL 3M17A 3BZEA 3Q5YA 3VFUB 4X6FA 1DBKH 1F13A 1T89A 4DVRH 2EDLA 5DMKA 1QSFA 1IC1A 1QO3B 4DVBB 1P4IL 2GAZA 2EYRB 3ARFA 2FR4A 4AEHH 3KPSB 4X4YA 3C5ZD 4W68A 2DMKA 1LNUA 2B39A 4D2NA 4F7MB 1URLA 2X41A 4H88H 4JE4B 5DTFB 4OZFG 3EYSH 3GBLA 3BT2H 4JO4L 3KAAA 5KSBB 4O58L 1U2CA 4ZUVB 5KSUB 2EDQA 5C0CA 1MCCA 3CVHA 3CD4A 1UJTA 4ZUSA 4YDVA 2VLME 1TVDA 5GZND 1BIHA 1P4BH 1Q9KA 1R5WB 1FZJA 2EYSB 3PGFL 4HGWB 3GMOA 1FLRH 2XZZA 1DQDL 1CDJA 1SVZA 1ETZB 2QSCL 3PUCA 3VXNB 1WT5A 3BDBA 2EIZB 2HVKA 4LKCA 4O51B 4PJ8C 1VB9A 1XGTB 4NCC1 3B8SA 1IJ9A 1RZJL 2A9ML 1OP5H 1IEAA 3O6LL 1CN4A 2GSGA 4NT6A 1NGZB 3BOVA 3CAFA 2VXVH 2H41A 3HZYA 4QRSA 3TBVA 1BZ9B 2ICES 3KPRD 4R4NC 4OLWH 1G6RH 2VXQL 3BGFC 3X14B 1L0YA 4OT1H 2IF7A 1FRGH 2HWZH 1T4KB 1W0VA 5GS2H 5JQ6L 1OT2A 4WHTA 4UT9H 2AEIT 3O8XA 4PUBL 4QRRB 3QA3A 2VDQL 4J23A 4YBQC 1C5CH 3D5OF 5JLZB 2GK0B 1T20A 2G9HB 1ODAA 3OAZH 3RTQA 5D1QC 1MCJA 2OYPA 1J1OL 1MCBA 4UOW0 2AK4D 3VFRB 3ARZA 5HHNA 1F4YL 1JI1A 4MXQC 3TO4A 1KLFA 1H0DA 1VENA 3HI6L 4N8PA 1FE8L 3HC3H 3ARTA 5I71B 5DD0H 2DJ4A 2NY1B 2IG2H 3HLAB 2ICEB 4IIQA 1SYVB 3SGKA 1DBBH 3RIFK 3LRSB 3HC0A 3TN0C 4A6YA 3C8HA 1TJGL 5MERA 3HNVH 4J3XA 4N5ED 1D6VH 4G6AD 3FFCB 1XF3A 3WNOA 4LCYB 2HH0L 4PJAF 1FBIL 4K8RH 4BYHA 3C60A 1C1EL 5EU6E 4WFGE 1LK3H 4M9OA 4OD2B 4XVUC 3H3KA 4ZTPL 3UPRB 1YJDH 4PREB 1TIUA 3MRNA 1YY8B 5T3XL 1XGQB 4MD4B 3FQUA 5HJ3B 4ZO7A 1L6XA 1H3PL 1H9VA 1OSPL 1Z3GL 4OZIB 5I19H 4CJ1A 1T2JA 3G6JF 4FXGA 3C6LA 3KNBB 5EPMA 4LGRB 3UJJH 3TZVB 3NFPB 2DQTH 1MCPH 1SEQL 1SBSH 1QFWL 1OF2A 5AD0A 1HKLH 5EZJA 3DO3A 3RWIB 3H9HA 3RIAF 2BJMH 4CMMB 4F7CB 5F7EH 4DKEL 3MRPB 1YQ2A 4HZLB 1OL0A 2DIJA 4NO0A 2ESVB 1IEHA 3SKOA 1S9YA 5FM4A 5CEZE 4LCCB 4ETQA 3TPUA 2W9LA 1U8KA 4YHMH 3L3KA 3H8NA 4MJ6A 3U0TA 3CH1A 3O6MH 3SQOL 1IGTB 1JF5A 4OF3A 1U3HA 1R3LA 1AKJB 5ICYA 5TQ0L 1KCVH 1I8KA 1AXTH 1RHHB 3HAEA 3DTXA 4HS6B 1A7NH 4KV5F 3N06B 1RJCA 4PJXA 4ONFH 4MD5B 4MJ4A 4U31A 4YX2H 4Z0BH 1J1PH 1KLUB 4KMTH 1MCKA 3NZ8A 1YN7A 3O4OB 1NGQH 5L6YH 4PRDB 2GYSA 3BWAA 1TCRB 4UIKH 1DUZB 1JFQH 2GY7B 1A6AA 3MV9D 4LRNL 4QTHA 1XR8B 5I71C 2DQUL 3BIKA 1D5ZA 3OPZH 4OCWH 4ZNEE 1II4E 1UB6B 4KVNL 5D1QA 3DYPA 4GQ9L 1DQJB 1FNFA 3BE1L 4Z7UE 3HZKA 4JHWH 2DQJL 4WVRA 1MCNA 1FFPB 4PJCA 1ZTXL 5FA3B 1AQDA 4GLRH 1VSCA 3CFIC 3PWLA 1FVCA 2BNQA 2QQNH 3P9MA 4QF1B 3EO9H 1G7IA 2R0WL 3QNXA 4P5KA 4ZXBD 1IKFH 2A83B 2DB8A 2VXTL 4EQ3A 4Z18A 4GW4A 1T3FA 4ONHB 3TN0A 5DD5H 3MV7E 1VPOL 5LCVH 3SKNB 3VFUA 4N0YH 3VCLB 4Y1AD 1FH5H 3QDGE 4P5TB 1MCSA 1OB1B 3EOAB 3MRGB 5BZWB 2VQTA 1U8MB 1KIQB 1QO3A 4DVBA 3BUTA 2EYRA 3SDYL 1RI8A 2HLFD 3RQ3A 2V5MA 1MWAL 3RRQA 2Y7QA 4NNPH 1JI2A 2ZSWB 3QWRD 3JWDH 3AC0A 3TZVC 4M1CD 1G7HB 3GRWH 2A1WH 2YUVA 4ZUVA 3FB6B 1IT9H 3U4AA 4D0BB 3FN0H 3P4NA 1MNUL 4OCNC 2Q6WA 1FV1B 3DX9A 1DBJL 3GMNA 1OGTB 1U92B 2APFA 2EYSA 3ULVH 4OIIL 3VA6A 3QJHB 4KQ3H 4LCCC 3RKPA 4NN5B 3MFFB 4ZAKD 3FT4B 3HAEG 4L8DB 1H3XA 2EIZA 4XP9H 1XGTA 1ED3A 4K9EL 4X4ME 1Q94B 1X6NA 1T0MB 3B2VH 4UNVA 3HG1D 1JL8A 3MYJA 5IJKC 1NGZA 3MLWL 5IHUL 1BZ9A 5I15H 5JW4M 3W9EB 3JWOH 3LY6A 1CDCA 2J6EL 4OGZA 3RX5A 2IFFL 3NOIA 2CKBL 2FB4L 3QG7L 4XMLH 2OMBA 4GKNA 4WO4B 4P4RB 4YPJA 3O4OC 1F4XH 3ALPA 2BNRB 1NBZA 3L7EB 5A43C 2DQFB 2N1KA 4H8WC 4QRRA 1NGYB 1NGPH 1IM9D 1I1AD 4YZFE 4JQIL 5JA9A 2YK1L 5JLZA 1LP9F 1WWCA 2GK0A 2VISB 2G9HA 3C5JB 4M1GH 4WFHE 5L2KB 2OLDA 2IWGA 1A4JB 5C07A 3VFRA 5J12B 1CGWA 2FRGP 4FQQA 4H20L 4M7ZB 1J10A 3UTPD 2PTVA 3DXAB 4LVOB 1UWGH 1UXSB 4KUCF 5E94A 4GG6F 1P5VA 1LEIB 4QHMB 1EXUA 5JDSB 1BFOA 4Z7OE 3LS4L 1GIGH 4OM1H 5DVMA 3N9GL 3GSXB 4AM0B 5HHXH 1OGAB 3SGDI 1TVHA 3EDFA 2D0HA 4UI2A 3TNNB 1MREL 5HYIA 4P5TC 3RNQB 3T1FB 5MEQB 3H0TB 4LCYA 4NQDD 4JM2D 4E0RB 3QXWA 2EDRA 2R1XB 4PR5B 2ZZUT 4OD2A 5I1AB 4GG8B 1FNLA 1DFBL 4WI5A 5DHYA 1AGBB 2WZPD 4XHJC 4MD4A 3MNZB 1IEBB 4OKVB 3HUJF 3SHSA 2WLYA 1SYSB 1I85C 2B20A 1PSKL 2Q8AH 3KNBA 1W0WA 1OARH 4WUUA 3VD5A 3STBA 2XWJB 4AIZA 4NRZB 1YECH 1MIEH 2E7CA 4NN5C 1RURH 4DZ8B 5I1DA 2DQCH 2CMRL 1YEIL 3I3EA 4XAKD 4CMMA 1QFUH 4OFKA 4DOHE 1NFDE 2PF6A 4K7PH 4F7CA 3ZYJA 1MFCL 3MA7B 4QY8B 3MRPA 1EGJA 3A6BH 3DURB 5BJTB 3QUXB 4XPHL 1MCIA 3FHAA 3ZKQD 4HQQL 3MCKB 4PV9B 4Z78B 4NZDA 3DVIA 4JCMA 3B8YA 4P9ML 4NIKB 2DAVA 3U2SA 5IB1B 1YEDB 5MHSD 3QCTH 3RVUC 4WO4C 4GH7B 1TJHH 5CKGA 1RK1B 4I2XE 4LARL 1AKJA 4GKOA 1Q0YL 4L4TE 5I8CB 1EMTL 3KVQA 3LKPB 4JFFB 2VLKD 4PS4H 1JYNA 5IJKA 5CD5D 3P0GB 2D7TH 5SX4I 4ZO9A 1RHHA 4NJAH 1EDQA 1NBQA 1DN2A 1RUPL 1BOGB 3G6DH 4MD5A 5L9DH 5IB5B 2V17L 4W4NA 1KLUA 4PLNC 3UYRH 4XTRD 4JM4L 4BZ2L 2NY5C 3QEHB 4MCYA 1RZ7H 3UTSD 2VR9A 5J12C 4PJ5B 3O6FD 1TCRA 1MPAH 5IKCA 1DUZA 4M7ZC 4LVOC 1IILE 1BF8A 3B3IB 5INDB 1T1ZB 2A73B 1FL6B 5DC0A 2Z92B 2HT4C 5I2IA 4HDIB 3RIAK 3CFEB 1WUNT 3ZTJG 1TTUA 3LKQA 4OGXL 1P7KB 3EOBB 5CIPH 4OCMC 4X8XA 3ULUD 1FFPA 2QSTA 3SDDB 1QBLH 2CH8A 1V3JA 1CXHA 3IFNH 5E8DH 4TTDC 5GS0C 2NY0D 4XP6H 4WI4A 4MQXD 2XWBB 4K3EH 5EN2A 2NY7H 1CXKA 3BP6B 1FL3A 1F00I 3SDAD 3D2UB 2OX5A 4M61B 2A83A 4P3WA 4G9DB 4NN7B 1EHXA 5F7LB 1ZA6A 3LH2H 3K74B 1NJ9B 3F58L 1MLCA 1MUJB 3DSNA 1CL7I 2EIBA 2X7LA 3SKNA 4NFDA 2W65A 1WZMA 2J12B 4JKPH 3H3PL 4JB9H 4P5TA 3OGCB 1BWMA 1FDLH 3NIGE 4D9QD 5IQ9B 3C87A 5BZWA 1U8MA 1KIQA 4JFEB 4UV7L 4LLYB 2AJSL 2G5BB 4JFDB 1EAPB 1P4IH 2NXZB 1QSFD 2ZSWA 5E6ZA 1BVZA 4PTUB 3V2AR 4G8EA 1G7HA 4OSUL 3DVFA 1FFNB 2OQJB 1VESA 2R0KL 3ARFD 3PWPE 4XHQA 4MNQE 5IBUB 1HILB 2GUOB 4HLZH 5MI0B 3Q5OA 2ZUYA 5GRYA 2OR8A 1CDHA 2MSPA 5T5NF 3FB6A 4PJBF 1I85A 1WC7B 3WFEH 2AXGB 4JO4H 1H15B 4KPHL 4D0BA 3WV0A 4E41E 3E8UL 1FV1A 1F2QA 3QUXC 1OGTA 2WW8A 1BX2B 4GQPH 4HLJA 5EBWB 1WBXA 1WWBX 5DD6A 2BY1A 5C0CD 3QJHA 5FO7B 3MFFA 4G42B 5I1GL 2RFXB 3PGFH 4L8DA 1ZLSH 3RUGF 5F9JB 3HMXA 1DQDH 1JF1A 4Z6AT 2E9BA 1Q94A 2J4WL 1JRHL 2QSCH 4K7FB 2YPLE 1T0MA 5H35A 4PJEB 3MJGX 4G8FB 1X4ZA 1YNLH 4H1LA 3FN3A 2YA2A 3CLEL 1RZJH 2A9MH 3QHTC 2CQVA 3O6LH 5GGVY 3W9EA 4R0LA 4GRWB 4LLWB 3T3PE 4P4RA 1XGUB 1OLLA 2BNRA 1U8QB 2VXQH 3L7EA 2DQFA 1CGVA 3GBNL 5C2UB 1LEGB 4BKLB 5JQ6H 4CU7A 5SWZB 4X7SL 3C5JA 1XIWB 4PUBH 5EU6A 2VDQH 1A4JA 2R0LH 4NNXA 2L4OA 4M5YL 3O8XD 3RWCB 2NR6C 2C7UB 4CADA 4HWBA 2QLVB 2EO1A 5F71A 4XWGL 3QDHA 2M2DA 3SDDC 1FGNL 2E27H 3RTQD 2K7PA 6CGTA 1F4YH 1U8PB 1UXSA 5TH2B 1U3JA 1FQ9C 3FQXA 3TO4D 3HI6H 1FE8H 4CVZB 4OCXL 1CIUA 2BC4B 3QIWC 5E8OB 1TTFA 2OZ4A 2Z91B 4NN7C 2BERA 4HEME 1R5VB 4PY8J 4EIGB 4PRAA 4AM0A 1IRAY 5JIHA 1OGAA 3QXVA 4LF3B 4YGAB 1I1CA 3UTTB 1OSZB 2OBGA 4W70A 3H0TA 3RNQA 5MEQA 3GMLA 2QBWA 4EKXA 3AS0A 3V5KA 2VSCA 3P4OB 5KJRL 3QEQA 4JGUA 1A7BA 2HH0H 2FYYB 4GG8A 1FBIH 1KN2L 4WJ5B 5IR1A 2NXZC 5GGTA 1R24B 1C1EH 4KKBC 3C60D 3R0NA 4ZTPH 1QHPA 2UWEF 3W5MA 1IEBA 5MI0C 4XX1G 4U0QB 5T3XH 1SYSA 2ATKA 3MZTA 4CRPA 1H3PH 1TZIB 3OAYH 1OSPH 1Z3GH 5IB3B 3PNWA 2XWJA 4M7JL 4ISVB 3TVMB 4NRZA 4H1LG 1WF5A 3C6LD 2W38A 2BVTA 8CGTA 4F9PC 2C4FT 4PJDF 5HD8C 1SEQH 3GO1L 4FMKA 1QFWH 1MJJA 1DVFB 2BSED 4QY8A 1YMME 3DURA 5C9JB 1FHGA 4WGVB 3MCKA 4DKEH 1JNHB 5FGCE 5LAXB 4R4FL 5IB1A 1WV7T 3LEXA 3CNKA 2V5TA 1YEDA 4ZSOE 1KGCE 3F7VB 2BCKB 4NO0D 5JXAL 4FZ8H 3TH4T 3NIDF 3LKPA 1FO0H 2XRAL 1NANI 2PW2B 5A40E 1IGJA 5I30L 3SQOH 4P2CG 3NVQA 5TQ0H 1BOGA 3QZWB 1U3HD 3O2DL 1HHGB 1XIWC 3MV7A 4JO1L 4FQHA 3QEHA 1J1XL 2ARJA 2YC1A 4PJ5A 4R4ND 4Z7WE 4LLVA 3L5HA 3GZKA 4ETYA 4JREC 5C08E 4ODXA 3B3IA 5INDA 1T1ZA 4MXWL 3LCYA 2X6MA 4HDIA 4LRNH 3CFEA 3F5WB 2VLRB 3L95A 4BSJA 3QUMA 3EOBA 4WI2A 4KVNH 1A47A 1U91A 5IESL 3SDDA 1A7RL 2AAVA 5D1QD 3W81A 1CXEA 3MUJA 4MXQD 5J7CC 3DHJA 1ZTXH 3QIWA 1IGFL 3BP6A 1HHHB 3M07A 3D2UA 1XH3B 3QPXL 4BQ9A 4G9DA 4HXAL 2BNQD 5F1NA 4NRXB 3T0AA 2R0WH 1KB5H 3VXME 4JM2F 4MJ2A 5JO5B 2VXTH 3L6FB 4X4MA 3VI4F 3OGCA 2AEQL 4TULL 3C2SA 5DC4B 3I9GL 5IQ9A 3TN0D 1C16B 1U41A 4HBCH 4NM4L 4JFEA 5A2KH 2CXKA 4LLYA 1QBML 3VFVB 2G5BA 3CZFB 3K81A 1EAPA 1U8NB 1FFRA 3SDYH 4NQEE 3T77B 4PTUA 1JJUA 3S4SB 3LKOB 3VXOA 4NQVA 1P7QB 1MWAH 3MACL 2GUOA 1A3QA 4XVUD 3QDMA 1G6RB 4N8VB 2AXGA 1RZKL 5T1KB 1DVFC 3KPSE 4OFYA 2QHLA 5EBWA 1UXWA 5SX5H 1DBJH 4QT5B 4G42A 2PYEE 2R8SL 1KC5L 4OIIH 4C59B 4FQCL 1INDL 4M6NL 1DQQB 3C6SB 4CN6A 5MENB 2XA8L 4PJEA 5GZOC 3GJEB 4G8FA 4K9EH 4MGXA 3BRFA 4L4VB 3AVEA 4I18C 3T0VA 1YEEL 5M94B 4QWWC 3MLWH 1G1CA 2DWEB 2IPTH 4UOW1 4Z7VB 2N7BA 4XBEL 4LLMA 3MUHL 4LLWA 2PNDA 4XPGH 5IHUH 2NTFB 2YWZA 5ICZA 3D18B 1XGUA 2J6EH 4OZGB 3TT1L 3AMKA 1I7RB 5AZ2H 3KWWA 3QG7H 4LHJB 4MSWA 1A6VL 2Z8SA 4LIQL 3O3EB 2IBZX 5SWZA 5IK3B 5FCSH 3STLB 3WEXB 2HMIC 2A77L 1XIWA 5J11B 1BFSA 3DGGA 3BP5A 4QRRD 5M7QA 2YK1H 5ACMA 4L3CA 3GIVB 1GL4B 5IMLB 1PDKA 4GAJL 2J1KA 2AEPH 2E9JA 1DDHB 4X6DF 1N4XL 1U8PA 5C07D 3OKKA 5TH2A 4H20H 5D2LB 3T0EB 3VG0H 2P5EE 5DSCA 4CVZA 1BZ7B 3CFJB 1AQKL 1DEEB 5TE4L 2VJXA 1W8NA 1GGUA 4PJIB 1R5VA 4D0DB 3EHBC 1OCWL 4R26L 3LS4H 3S36L 4LP5A 1KTDB 3AMLA 5ACZB 3VA2C 1OSZA 4XNMA 1SM3L 3D39E 1ZT4A 2OJZL 2YKLL 1SMOA 1MREH 3P4OA 1IGML 1X44A 1WIOA 1FNAA 1IGIL 2DYPB 2FYYA 1VA9A 2OL3B 5D5MB 4ZFOB 3TNMB 4WJ5A 3V0AC 5L88L 1R24A 3WSQL 1JZ8A 3OKNA 3B43A 4L4TA 2DBLH 3FFCE 1DFBH 3TCXA 1DZBA 4DGVL 1MHEB 3CMOL 4GAGL 5CS7A 1NUFA 4OD1L 1P84J 4MJIE 5IB3A 3A67L 4QHKI 5FM5M 1PSKH 1MFBL 3FO2A 4ISVA 4ODSL 3T0BA 1OD7A 3WO3B 2YSSB 4NUJA 4WUUD 3DWTA 4DTGL 1CGXA 5EOTA 4OZIE 4PB0L 2M8XA 5E03A 1OT1A 3EJZC 5AAWA 2VAAB 5C9JA 2CMRH 1YEIH 3SPVB 4J7RA 1MFCH 1JNHA 5LAXA 4QXUL 4YHZL 4KGJA 4XPHH 4C4KT 1NC4A 4V2CB 2VLLA 2X4UA 4UTAL 4F15B 4HQQH 2A9NL 3SN6N 3F7VA 4P9MH 3O3AA 2XNAA 5J56B 1X5ZA 3LMJL 5CZXC 2PW2A 2V5SA 3IGAA 5K9KA 1U8JA 4I18A 4LARH 2ESVE 1Q0YH 2H1PL 4LNVA 5MEPB 1EMTH 2IPUG 2R4RL 3QZWA 3RPIB 3VFMB 1HHGA 4QOKB 1AKJD 3EJYD 5J11C 1BBDL 1KLGB 4G80A 3LDBB 5HI4D 1RUPH 2EECA 3ALWA 1FYTA 3VFNA 4K8RC 4EJ1C 2V17H 2N4IA 3EFFA 5T1MB 2YRLA 4JM4H 4PRPB 3WBDA 1FNEB 4ERSL 1YDPA 1EO5A 4QRUB 5D2NE 3T0EC 1KCKA 2X1OA 3F5WA 2HT2C 5GGQL 5EIIB 2VQ1B 4UT7L 1FJ1A 3CSBA 5FYJU 3REVB 5HGGS 3BXNB 4NSKA 3GMMB 2O5ZH 3U79A 4OGXH 3WHXB 3L3JB 2ADJA 1RJZB 3QAZB 1UWXK 1OP3K 5FYKU 3ARGB 2G2RB 5GS1B 2PCPA 1T83C 1HHHA 4Z8FL 1WCBB 1XH3A 2A6KB 1I7UA 4NO5B 2X4NA 2EDTA 3L3GA 3K46A 1EPFA 2O5YL 4MQTB 2VDKL 4GMSL 2EEBA 1NL0L 4B50A 1T22B 2GJ6B 1BVKB 5H2BB 3F58H 3UDWC 1EJOL 4N0CC 4P2RB 1X9QA 1C16A 3VXUB 3H3PH 4JN2A 1K2DB 4XCCL 3DVGB 4P5TD 3WFDL 1D5MB 1T7ZA 3CZFA 4I0CC 4RFOL 4UV7H 3T77A 1A2YA 2EZ0D 3FB5B 3LKOA 3EFDL 2AJSH 3S5LB 4EIZC 4JHZA 3C9NA 1FAKT 1TFHA 2ATPA 4LPTA 1KPUB 1FIGL 2Y9RT 3O11A 4L5FL 1G6RA 4OSUH 5J3HD 3BZ4B 2R0KH 1NDMB 5CINL 4RA0C 5CMAA 5T1KA 1JZ4A 4XHJD 4U6TA 4PG9B 2ICWI 4AK1A 4KPHH 3SDXF 4ZS7H 3T04D 3E8UH 3V4PH 4NWUH 4YLQT 5CAYB 4TVPD 1JUFA 3S98A 3JTTB 4F15C 2A74A 3QZWG 2B0SL 3GSQA 3D3VB 3U36B 5C09E 3C6SA 2MQCA 5I1GH 3GJEA 5D7LE 4HMEA 2E9IA 3CDGA 3VGBA 2VITA 2J4WH 1JRHH 3WFBL 4U6YB 3SE9L 3S9DB 4NOFA 3MRJA 4YPGB 1RSFA 3CLEH 4NYLB 4Z7VA 4QXWA 5LXGL 2Z35A 3LDBC 5HY9A 5DJ0A 4CBPA 5JOFB 4X80L 3RL2B 3O4LB 1I7RA 5DEGB 3Q3GA 1IAKB 2AGJL 3HZVA 1QSEE 3D69B 3VMOA 1S5HA 1CI5A 3WEXA 4YHKL 5IV2B 3GBNH 4MNGB 1K8DB 2H32B 3FMGL 4NQUA 1YN6B 4X7SH 3GIVA 5IMLA 3GDBA 4Q9CA 4TSAH 3WJLA 5EU6D 4QRQB 2KZ1B 3N85L 3BMWA 3MCLH 4PGCB 4HJJL 4XWGH 3QAZC 3T0EA 4ZFGL 3ARGC 5GS1C 4QGTA 1HKFA 3CFJA 2Q3AA 4HC1H 1DEEA 4OCXH 2H45A 4D0DA 4LBEB 3U7YL 2HT4D 2Y36L 4PJCF 5FGSA 3DXAE 5D9SA 1H3TA 2AK1H 4YHPB 3ULVC 3VH8B 3V4VL 4OD3L 1T83A 3LV3A 1VFUA 3P77B 4QNPE 2A6IB 4P46B 3BRGC 2EDJA 5GS0D 4OUUA 1OGAD 4RGOH 5F3HB 3QI9B 2DYPA 3N0PB 1CFVL 5D5MA 3TNMA 4ZFOA 4KK8D 3KJ4B 5KJRH 1I1YB 1HHKB 3UDWA 4OZHE 4ALAL 3QEQD 1KN2H 2GTWB 3X13B 4I3GA 3JWOC 3KLAA 4P2QE 1H8SA 1MHEA 3BZFB 5I6XB 35C8L 3KYNB 3NFSL 5GGSB 2VZUA 5CKAA 5HHVH 2IANE 2ZUWA 3Q2CA 5FCUH 2WIMA 5IMKB 5T3XE 2XICA 4JPWL 5I1EL 3BUYB 2DF3A 1HDMB 4PGZA 4ODUB 2GFBA 4H25B 4RAUB 4MYWB 1ZE3C 5IG7B 1X5XA 3ESVF 3KR3H 4OV5B 3IYLW 4NHCL 2FEDC 3AXLB 2G60L 3GO1H 3SPVA 3HTLX 1ZOXA 5I75B 1AO7B 3GI8L 5CEYA 5KZCD 2VZ3A 4R4FH 4L29B 2R29L 5ISZE 3EKCA 1FVDA 1BOYA 1N5AA 3ZYIA 5IBLD 2X1XR 2ICWA 3VE0A 5JXAH 2OXGA 3I6LD 4Q2ZB 2K3TA 4ZPVA 5KVFL 1OAKH 5MEPA 2XRAH 1XAUA 4QOKA 3SE8L 5I30H 1N5YL 1KLGA 5ANMA 1A1OA 3QJFA 1U3YA 1JF6A 3O2DH 2R1WB 4G7YH 3IDGB 2EC8A 4JO1H 2I60L 1SMAA 3MV7D 1J1XH 3MGOA 4LSQH 4PJ5D 4K23L 3QRFM 2ARJQ 5E0QA 3RWDB 4MXWH 5HPMB 2GTZB 2YD9A 3BXNA 1BF2A 2PTTB 5F3BB 4XCFL 3GMMA 3L3JA 1P9MC 1RPQA 1T1WB 5IESH 4YHOL 1A7RH 3R8BB 3ARGA 4LPXA 5GS1A 3MQIA 3VFTA 3SDDD 2I07A 3GRWA 3R1GL 1WCBA 1P6AB 2A6KA 4P46C 4GRLB 4TUJB 1IGFH 2DLHA 3NCJL 3QI9C 3QIWD 3QCVH 2JTDA 1T22A 3QPXH 3ZE0E 3V6OC 4KH2A 4YXKL 3D2UD 3KJ4C 2GJ6A 1BVKA 2I27N 2P7TA 5H2BA 1RULL 1CFQA 2ZUVA 3MGTB 1UT9A 2ARWA 4AQ1B 2XY1A 4P2RA 3VXUA 2UUDH 5IMOB 3MZGB 4L3EB 2AEQH 4TULH 4R8WL 5I6XC 3I9GH 1EA9C 3FN9A 3S96B 3DVGA 4U3HA 3PF2A 4Y5XB 2HRPL 1VGKB 4LCUB 4NM4H 4NQSB 3GHEL 3KYOB 1FG2A 1K4CB 1QBMH 3FB5A 4JFED 3S5LA 1AXIB 1OTUC 5E9DE 1QACA 1JPGB 2J8UE 1IAIL 4K94L 5D96B 1KPUA 2HLAA 2P1YA 3VXSB 2F5BH 2NXZD 1JTTA 3QQ9D 1NDMA 2F54B 2WSKA 4KKBD 2FIKB 2HFGL 3MACH 2DLFH 5ADOH 2LE9A 1VDGA 4HIJB 5EUOA 1ND0B 4N0UA 1MCFA 3DYOA 4JFDE 4X8JB 1RZKH 3QDMD 5KS9B 2I24N 3MRDB 3JTTA 5ERWB 5JZ7D 1UWEL 4OFYD 5I75C 1G9ML 2BSSB 3U36A 2GKIA 2R8SH 1KC5H 4HMCA 4OBSA 4FQCH 1INDH 4M6NH 5I17B 3W11C 5IEKB 2XA8H 3V6ZA 3DJ9A 4GOSA 4S10A 3PV6B 4YPGA 4YDJA 4PJGB 3ARWA 1YEEH 4S1SL 2PR4L 3QQ3A 5TFSL 4J8RA 1A21A 1LO4L 3RL2A 2JCCB 1NAMH 4XBEH 5FGBC 2EE2A 5DEGA 1BBJB 5CD3B 1EJ6A 1IAKA 2VKWA 2C3WA 1ZMYA 5DVLA 2W92A 3TT1H 3D69A 4G3YL 3GMPA 4U2ZA 4LIQH 2F53E 3B9EA 2H32A 3NMEA 3RAJL 3ZKMC 4HIIB 5SWZD 3Q6FB 3U82B 4IBLT 3DUUB 1XIWD 1R5IA 4QRQA 1PYWA 3QYCA 5I1JH 4PGCA 5FYJL 4GAJH 3T0WA 5I1IL 4ELMA 3EDEA 5JORB 1N4XH 4MJIA 3B83A 3LKRB 1JHTB 5FYKL 4P2OB 1QSZA 1KXTB 1AFVL 4GRLC 1GGBL 1UH3A 2VNCA 5DD3L 4WW2A 4LP4A 6FABL 1JIBA 1AQKH 1P9MA 2QADB 4U1MB 2Q7NA 8FABB 5TE4H 4YHPA 3VH8A 1BD2E 4R26H 3L9RB 1J18A 1NUGA 3S36H 4KK5C 1I9IL 3P77A 1ZHBB 2A6IA 4PRIA 3S5LG 2XA3A 2ZJSL 5EZLA 5F96L 1DSFL 1HI6A 1SM3H 2OJZH 1WAAE 3UEZA 3QI9A 1ZGLB 2ADGB 4Y5XC 4ZFZB 3V6OA 2B1AH 2Y25A 2YKLH 43CAB 3MJ6A 1IGMH 5D7KD 1RUKL 1I1YA 2ZUQB 5HDBF 1IGIH 2OK0L 2RQ8A 2GTWA 3UTTE 1I8LA 3X13A 3HE7B 5D96C 5BXFB 3WSQH 3BZFA 1FVEB 5GGSA 1UVQB 5FYLD 3MLUL 1FFOB 4L4TD 4PJ7E 1FO0B 3DECA 4F7PA 2OR9L 3CMOH 4GAGH 5D71L 5IMKA 3BX7C 4S1RL 4I0PB 1MAML 3BUYA 2D7PA 1HDMA 4OD1H 1WFOA 3DI2B 3A67H 2FZ3B 4ODUA 4Y4KB 4GKSB 1S5IL 5FF6B 1QVOA 2JJUA 4RAUA 5IG7A 5DO2D 1VADB 3FHQA 4MAYA 1BPVA 4WEMB 1OY3B 3ZE1E 4DTGH 4PB0H 3TJEL 3EDKA 1ZHKA 4XP1L 5ESAB 1IM3B 3A0OA 4KDTC 3IXTB 4QRPB 4F57L 5IFJA 4KZDL 3U4EA 4QXUH 4YHZH 3UYPA 5CIPA 4UTAH 3QPQC 2A9NH 4FHBD 1NC4D 2XTJB 5IHLB 4Q2ZA 2NYYC 4PPTA 4KDVA 5IWLC 3WNMA 2IBGA 3GSVA 5GZOD 1NMCB 2OTPA 3RZCB 1Q72L 3S36X 2BOCA 4WU5B 4ZTOL 2CRYA 5F7HA 2CDGA 1B0GB 2H1PH 1MJ7H 2R4RH 4FXKB 3KJ6L 4BFIB 3ZLQC 5FGBA 4HG4J 3IDGA 5LQBL 1BBDH 2JJTC 3CVIL 1W72B 3T8XB 1KB5B 2QL1A 4JO2L 1HOCA 3TC9A 4KZEL 5ALCL 1FYTD 4PRNA 1RUAL 3T65B 5BQ7A 2E7LC 1G9NL 3IAGC 5A3IC 4JRXB 1ZLWK 4ERSH 1LK2B 3VH8G 4CDGC 5EOCJ 3PXHA 5F8RC 1QFWI 3W0WE 1NQBA 4P2OC 2HMID 2NLJB 5EBMA 4ZDHB 3QDAA 4LPVA 5GGQH 2XIDA 2B1HH 2BDNL 3EYUL 4Z95L 4AIXA 1HXMB 2QADC 4UT7H 1T1WA 2XQBL 3KPMA 3G6JB 2ZNXA 1FFQA 3TESA 4U1KB 4X6CA 2VLRE 3CLFH 3RWHB 4GRLA 4Z8FH 3HPLB 1X5AA 4GBXB 3O0RL 5E5UB 3PIQB 3P30L 2O5YH 3FFDA 2VDKH 4GMSH 1KYOJ 3AAZA 2ZUQC 4GW1A 2H3NB 5D7IE 1NL0H 3D0VB 3EHBD 2FEEL 3HE7C 1MY7A 4PY7A 4R7NB 4IM8A 4YH6A 1EJOH 1EFQA 3HE6B 1VGKA 4LCUA 4NQSA 4CU8A 1RJLB 3TO2A 4HS3B 3AM8C 3QHZL 2VLJB 4LSUL 3S3SA 4RFOH 4WWKA 4HAGA 4Y4KC 3VXSA 3ZT5A 1J0HA 5J6HA 3EFDH 3I6GB 2FIKA 1YNTB 4S1DC 1F6AA 1V5JA 4MWFB 1C08B 3DRQB 4R3SB 1FIGH 1MI5B 4L5FH 2OMNA 2F8XC 4M6OH 5CINH 2YRPA 4XRCA 4HKXB 5T1KD 5KS9A 1UQSA 1PGRB 1Q9WB 2DLEA 3G5VB 2KDGA 3BMVA 5GS2D 1G9EA 3MRDA 2OTWB 4NP4L 5ERWA 2BNUB 2HYMA 2BSSA 3WNLA 3C5SB 1FNSL 1QNZL 5ICXA 2B0SH 5I17A 4JZNB 2XTJC 3L3IB 2YD4A 5IEKA 1P2CB 2K7QA 3F7YB 4KDTA 3D25B 1Y18A 1OHQA 2Z93B 5T33L 3PV6A 4OBRA 1NMCC 4DQOH 3WFBH 4HX1B 1HIMH 4PJGA 3SE9H 5TDNA 4EOWL 2Y5TB 2EIEA 4JDZA 2BY2A 3QWOB 4ODHL 4DJMA 4YFEA 1CG9B 2JCCA 3HHRB 3FO9B 4RMVA 3O3DB 1BBJA 3RWFB 5MENE 1JPSL 5LXGH 1KACB 3KYKH 3PV7A 5FKAB 5IWLA 4X80H 4OCSL 4L4VE 3U0WL 3ZSTA 2AGJH 4M6MH 3DV4B 3UTOA 4LLAA 1J0JA 4YHKH 3BP7A 3OAUH 4HIIA 4HLZG 5BVJA 2JJTA 3RY6C 2P49B 3SO5A 4OZGE 4FTVB 3DUUA 3FMGH 5TPWL 4P57B 4RAVB 1BEYL 1EO7A 5I16B 4HT1L 5ENWB 4K8RD 5IF0A 2E7LA 5LBSL 1OTTC 4P23B 2JELL 1FZOB 4XBPB 3U83A 3N85H 3QR2A 3TIDA 1JHTA 3C8DA 4HJJH 5DRXB 4U6VH 4UT6L 5JHLL 4P2OA 4ZFGH 5B22A 1F8TL 3T0ED 3WS6C 5JIIA 2ZSVB 1EUTA 3W39B 4GBXC 3VFGL 5ACLA 5E00A 3U7YH 1BJMA 2XN9E 2Y36H 3L9RA 3NH7L 1ZHBA 1NBVL 3SKMB 1NH6A 4FABH 3K1DA 3WL9B 1U8IA 1UB5A 1ZGLA 2ADGA 4D8PA 3HE6C 4U3CA 4I5BB 4ZFZA 3UBXB 4IDLA 3EYOB 3ZHDA 5C0AB 4E9LA 4FNLL 3RP1A 1J7VR 2P8MB 5DR5L 1CFVH 4N1HB 1DEDA 2A6JB 2DYPD 3HE7A 5BXFA 4OQTL 4KI1A 3V0WL 1YA5A 4ALAH 2HTLD 1FFOA 1RJYB 1RK0B 1FO0A 4MVBC 35C8H 3AM8A 3NFSH 3GB7B 1QLRA 1FYHB 1CL7L 4HUUB 1S7SB 3R8QA 2FZ3A 4Y4KA 4GKSA 3Q6GL 4KRPB 1K4DB 3LPGA 5I1EH 4FQLL 3IFPA 2VB5A 1WGOA 5HGDB 4N9GB 1VADA 1HH6B 1AGCB 1YEGL 4YZFF 3TBSA 1LP9B 4C56B 3AREB 3RGHA 3P73A 3C08L 3I3BA 5ESAA 4NHCH 3BH8B 2AABL 4M7LL 5F1KC 3IDNB 2G60H 3QUZA 4QXGL 3IXTA 4QRPA 3S37L 2DQDL 3WIIH 1BIIA 2FCBA 3IETB 5EORL 3MOAL 3PDOB 4OLXL 4GG6B 3GI8H 3IFOB 2R29H 4UQ3A 1J8HE 4Q74A 3DMMA 2X70B 1AD9B 4KTYA 3JUYA 5T1DH 3CIQA 2WQ8A 4JRYB 5K9QG 1B0GA 2CO7B 3DIFA 3WO4B 1ACZA 3U7WL 4FXKA 5DYOB 4BFIA 3VG9B 1WBYB 3SE8H 4X6BB 1N5YH 1TNNA 3T8XA 1XGYL 1KB5A 2VOTA 5DJ2B 3V6FB 4MS8C 3AB0B 5D6DC 4O02L 4PJAA 2ZG1A 4HUMB 2I60H 3KXFA 5E8EA 3X3FH 4MX7B 2BSTA 3VFOA 5BZDB 4P23C 2V9RA 1XCQB 2YBRA 4MHHG 4BELD 4E5XA 2FLBT 3ISWA 5SWSB 3EUUA 5HI5C 1AR2A 1OD9A 4K23H 3RY6A 4ZDHA 4F7TA 4U4BA 3C5ZB 2XKSA 2C1PB 3I02A 1HXMA 3LB6C 2ZP0T 4PRPE 3HUJB 2IPKA 3G6JA 2VDOH 4C55A 2WP3O 4XCFH 1MWAA 2V2TB 5D6CB 4U1KA 1LWRA 1P1ZA 3IS0X 4LHUA 3QFDA 4Q97A 4OGAC 4YHOH 1N6QL 2HJFB 3RWHA 3WS6A 1FNGB 5IVXA 4IRZL 4AL8L 3ARGD 1HYRC 3R1GH 4GBXA 4PLKC 3LN4A 4I0KA 4X6EB 1NFDF 1XR9B 2WNGA 3EW3B 3NCJH 4KJPC 5DRWA 3D0VA 3FRPA 1A9BB 5LGJB 5HHME 4YXKH 4X0KB 3QIUB 1INEL 1CD9B 1GC1C 4NO3B 1RULH 2H2PC 2GJ6D 5DDHB 4R7NA 3ULVD 4I9WE 2JK5A 2LAAA 3RHWK 4MLIA 3HE6A 1RJLA 2WUBL 4X99B 2WBJA 3GKZA 4WENB 2VWEC 4AJ0A 4R8WH 3VXUD 3CDCA 4Y88A 2VLJA 4HUWA 1YEJH 2HRPH 4DEPB 5EIVA 4F58L 3GHEH 1NUNB 3EBAA 3KPRB 4G7VL 4KRPC 4YGVA 4KTEL 5E8NB 5HYJB 1GGIL 5IUSA 1IAIH 3DHMA 4K94H 4MWFA 3DRQA 1A7PL 3DBXB 2RHEA 3BH9A 5JHDB 2EH8L 2NY6D 2HFGH 3AREC 3CU7A 3QEUB 3G5VA 1Q9WA 2HVJA 3QNYB 4F7EB 4DGYL 4DZBA 2P46B 1CBVL 5HGBB 4G43B 2X4OB 4LGSB 4CMHB 2AK4B 1XCTB 5ADPH 1UWEH 4AT6B 1MHHB 3DVNB 3L3IA 3ZT6A 3ZE2F 1H8NA 1P2CA 3F7YA 4MXVE 1E4WH 3ESUF 4LSPL 4JFXB 2ICCA 3EZJB 5CGYC 1CQYA 1HEZB 4HX1A 1YYML 4KY1L 3NCYS 1E28A 2AW2A 1VFAB 3WO4C 5TJWK 4XXDB 3D3VE 5CP3A 3VG9C 1JGDB 3FO9A 2L7JA 4P59H 3MA9L 4PB9L 1SY6H 4S1SH 2PR4H 5FKAA 3AB0C 1LO4H 4EDXB 1TVBB 4HZAA 5DJCA 2EO9A 3REWB 1D9KB 1WAAA 3DV4A 1XZ0B 3LN5B 2GEEA 1I4FB 3D39D 3IDXL 1OPGL 4G3YH 3BRDA 4U2YA 1B2WL 2XV6B 2W0LA 1I3UA 4LHUG 5JIKA 2CR3A 4LIQE 4P57A 3RAJH 3C5ZC 4PRHE 1T2QL 4RAVA 5D6DA 5KTEH 4JR9L 1JCKA 4WWID 4KRNA 4OB5L 3GSWB 5ENWA 3HI1A 3VRIA 4P23A 2BP3A 4O9HL 3HS0A 4XVSH 1X4XA 5DRXA 3FRPG 4LPCA 3BAEL 1XF5A 2YUXA 1A02N 5FIEA 3MRCA 3W39A 2WAHA 2C5DC 4MJID 1JRHI 4XNUL 5DK2B 1J5OL 3GBML 1KF9B 4PJBB 4L8SB 1AFVH 5DD3H 1GGBH 2FJGB 4HIEA 6FABH 1V05A 2APBA 5HGAB 4KWUA 1NSNH 5TGBB 4TVSa 1KIPB 3QIUC 2KBGA 3QQ4B 4F9LC 3SKMA 5EU7C 1CE6B 4LVNB 3WL9A 1I9IH 4DAGL 4PLJD 1HHIB 4I5BA 2AJUL 2ZJSH 4PRID 5F96H 1VGEL 1DSFH 5C0AA 3RUGB 2ORBL 2Y5EA 2P8MA 4DEPC 2BOBB 1MELA 5DF0A 3QI9D 2A6JA 4WCYL 5ITBL 1RUKH 5IIEB 3WXWL 2OK0H 5BVPH 1B6DA 3PP3K 3U1SL 3QEGL 3LS5L 1RJYA 3GIZL 2VIRB 2OJEB 1E6JL 5GRXG 1HQ4B 3T3PF 1A4KB 4GJTB 3MLUH 3L1OL 4CNIA 3EDDA 4G5ZL 1S7SA 2FGZA 3V5HB 3F7RA 3RKDD 4KKNA 1I1FB 5D71H 1MAMH 3A6OA 4XB8A 4CMHC 1HH6A 3P4LA 1AGCA 1FC1A 2Z8VC 2F15A 3LZFL 5ID0B 1S5IH 1LP9A 4C56A 4UU9B 2ZG2A 4M8QA 3SDCA 1MY5A 1LHZA 5B3JE 3BPLB 5EOCL 3BH8A 3G9VA 3GJFH 3ZKND 4MAYD 3T4AB 3TJEH 2AP2A 4XP1H 3UC0L 2DDQL 5DJYA 4GG6A 1BQHB 4F57H 4KZDH 1UEMA 3IFOA 3UTQB 5GJTL 3THML 3ULUL 1XGPA 2W9DL 3HR5B 1AD9A 3OXRB 4I3SL 4PLOB 1D9KC 4PJFA 1AO7E 3W11D 1A8JH 3FONB 4CDHA 2EE9A 2E7MA 3QFJB 4ZXBB 1CGYA 4V1DE 4TOYL 5F7NC 3CJJA 4ZTOH 1OQOA 3V6FA 5DWUH 3KJ6H 2YD5A 5LQBH 2Q86B 3CVIH 4MX7A 4JO2H 1I9EA 2GSIB 5BZDA 1XCQA 4KZEH 1K9TA 5ALCH 3MV11 4M3KB 4ZO6A 1VACB 1MCDA 2W0KA 5SWSA 1E4XL 3FQRA 5ESVB 1G9NH 3VXRE 2AJZB 4PGBB 1F4WH 2IH3B 3BEVB 3CK0L 2C1PA 2UWEB 3ZKMD 2XPGB 3EYFB 2R15A 4L8SC 3E2HB 2CKNA 3UBXG 5D6CA 5GHWL 5KSAB 2BDNH 3EYUH 4Z95H 5DT1L 3IU4L 4XB7A 2DD8L 2XQBH 2LTQB 5HGHB 3OJDB 2HJFA 1FNGA 4K2UL 4LEXH 4LVNC 1GZQA 3B9AA 1T66D 4PJDB 4A2MA 1JGEB 1Z0MA 4KJYB 3C8KB 1IGCL 4MCZA 4NM8L 2MCPL 2HFFB 4KQ4L 3O0RH 3IJHB 4GRLD 1UEYA 5B8CB 1A9BA 5LGJA 4Q6IB 3P30H 5FUCE 3CFKB 4S11A 2D4DA 4X0KA 3QIUA 4ZAKB 3FZUD 1C12B 3UAJD 4NQXA 5GQBA 5FM8A 4KK5D 1K8IB 4E42A 3QDJE 3HG1B 4PJ9C 4HF5H 3JV5A 4U33A 3FOMA 1F5WA 1CIDA 5DI8A 1HXYB 3GSNL 1UJ3A 3QHZH 4LSUH 5HYJA 32C2B 1WFTA 4L3EE 1ZLVH 3WIHL 4P3DB 3SGDH 1NAMB 4BUHA 3L7FB 5JHDA 4WWKD 2IPUK 3VXSD 15C8L 2G75B 3BPLC 4POUB 3QEUA 3MREB 5C0JA 3QNYA 1I1AB 3QO1A 4Z7WF 3N1FC 3EO1B 5HGBA 3ARSA 1Y0LB 5GISL 4NCC2 1QHOA 4X4XA 2OTUB 1XCTA 1C7TA 1NPUA 4NP4H 4JDTL 3EYQD 3H3BC 2CRZA 3L3OA 5I8KL 1NGWB 2XXCB 3Q48A 2EDBA 1FNSH 1ZT7B 1QNZH 2JB6A 3HMWL 4HKBB 2X89A 1B4RA 2Y23A 4D3CL 1SHMA 2DKMA 5H8DA 1VFAA 4LGPB 3UX9B 4ZXBC 1M71B 3MLZL 4HC1A 4NKMB 4XPBL 4S2SB 5DHVH 5DMIL 4EOWH 1QR1A 3U30B 5FOBB 1PLGH 2VL5B 3DETD 1X5GA 4ODHH 3SJVA 3O2WL 4GW5B 2Q8BL 1JPSH 4AEFA 5FK9B 3QG6B 3QPQD 1D9KA 3REWA 4F3FA 3DRTA 1EUUA 5F1OB 5L2JB 4NQDB 4JM2B 2NYYD 3MJ9H 3G5ZB 5IW6A 3LIZL 1ERNA 2D7OA 3PQYB 4OGYL 1HHJB 4TUKH 3GSWA 3K4ZA 4G8GB 5KOVC 4XCYB 3E2HC 3X12A 1BEYH 1R3HB 1EVUA 4ZOBA 5KSAC 3MRLB 2Z9TA 5I9QC 1VFBB 3QB7C 4HT1H 2LTQC 3MRHB 5SX4H 1KEML 1RQ5A 5LBSH 3M8OL 2JELH 2YWYA 1MQKL 5A3ID 2BMKA 1FAIL 5JHLH 4UT6H 1BQLL 5DK2A 4L8SA 1RZKC 1F8TH 2FJGA 1ONQB 4P2OD 5T3XD 3ARBA 5HGAA 1TJIL 1N64L 3VFGH 4Q6IC 4NKDB 4ZAKC 2J3SA 2QADD 4O2FA 3DROB 2FH8A 3T4YB 1G7LA 3NH7H 3H42H 2GI7A 5ESQA 4OUOA 1NBVH 1IFHH 5DJ6A 4BA8A 4XWOC 3RUGA 1JYVA 1GOHA 4K3DL 4P5MB 3TIEB 3G04A 3BVNB 3QUYB 2BOBA 4CW1A 5KN5B 3B5TA 3IJSB 4OZFB 3GGWB 1N7ML 1CVRA 5F7MC 5F9OL 1B0RB 4LCWE 5DR5H 2DJUA 1HYSC 4RX4A 4U1NB 4TSCH 2VIRA 3OQ3B 2ZCKL 3V0WH 2OJEA 4PJ9A 4IMKA 1A4KA 2PYFA 1KJ2B 3LHPL 2VKXA 5TE7L 5FO8B 4X9HA 1BFTA 1I1FA 1HNFA 1ZHLA 2C26A 1CL7H 3IJYB 2FL5B 2EDOA 2A6DA 3MLVL 3Q6GH 3UTSB 5EUOF 2YMXH 3LQAL 4UU9A 4FQLH 4Y4KD 2GW5A 4U1SB 1S9WB 2QSVA 1JHKH 4FFZL 1OAXL 5E2WL 3GNML 1YEGH 1CDUA 4S1DD 1D5IL 1CXIA 3I6KB 5L7XL 3T4AA 4JFYA 2YOCA 4ONOA 3C08H 4IMLA 2AABH 4X6DB 4IRSB 4QXGH 4HHAB 3S37H 1PY9A 2H6PA 2CDEB 2DQDH 3QUZD 5EORH 4QRPD 1BLNB 4Y4HB 3U30C 3UTQA 2QQQA 3GKWL 4AZ8A 4WTWA 1N8ZB 4OLXH 4XGZB 3MBEB 5E08L 4X98B 1D5BA 1JZ3A 3OG4B 4RQQA 3IU3B 5C6TL 4NBYB 3QFJA 3SDAB 3DMMD 2F9BT 1OP5K 3DX8B 3OXSB 3G5YB 2XTJE 2Q86A 3FB8A 5ID1A 5BS0E 3RI5F 1XGYH 1PZUB 2NW3B 4M43L 2GHWB 4O02H 4JPIB 3TJHC 1JYXA 1MCLA 1TDQA 1VACA 3BPCB 4GUPA 4EUPB 5DURD 3KXFD 1CE1L 2NXYD 1D6EB 2UWEA 1MFDL 3DSFL 3TCLB 5DMKB 2GT9B 2XPGA 3EYFA 3T3ME 4KHXL 2FBJL 5HHOA 4ESKA 2GAZB 3ARFB 4OM0L 4ELMF 5KSAA 4X4YB 2VABB 3OAZK 3ZYZA 3OJDA 2FLRT 4FFVC 1MJ8L 4NZUL 4R4BA 1X5HA 2E8ZA 3TH3T 2CIKA 4WW2F 1N6QH 4PJDA 4LHUD 2FD6L 3RWEB 1JGEA 4WTZA 5EA0L 4KJYA 2E6PA 3C8KA 2QEJA 4IRZH 1ZKAA 2HFFA 4AL8H 3CVHB 3IJHA 3QUYC 4Q6IA 3CFKA 4GBXD 4YHYB 1CCZA 4JGMA 1C12A 1LO5B 3K7UA 4WRLA 1Q9KB 4EVNB 1CGTA 5ILTL 4MJ5B 4XVJL 3GMOB 3S37X 2JE8A 1K8IA 5M95B 1INEH 4L9DA 3HG1A 4OIAA 4LKCB 1RZ8B 1E6OL 5I1CL 2WUBH 2LU7A 3DO7B 3HE6D 3ARRA 1HXYA 1IEAB 1CLYL 4PD4K 2R56L 4RGNE 2WBJD 4NCDA 4LLQB 3HC4L 1JMZA 3A6CL 4PGDA 4C54A 4F58H 3HZYB 4M6AA 1TMCB 2VLJD 4G9FB 4YXHL 4P3DA 1JWSA 3TBVB 1NAMA 4G7VH 2ZCLL 4ZFFB 4JVUA 2KQNA 1MFAL 1GGIH 2G75A 1DL7L 1AHWC 1A7PH 4AEEA 2EH8H 5CJXC 3VI3F 4JFZL 3EO1A 4MVBD 4NNYB 4P0DA 5J1SC 3O8XB 1NCCL 2GJZA 4IRSC 1JYWA 3QA3B 4U1GB 4D9LL 4DGYH 1CBVH 1NGWA 4WI9A 3MOBL 1T20B 3MUZ1 4Y4HC 3RTQB 2NX5B 1ZT7A 1F58L 4HKBA 3D1MC 3H9SE 2W59A 1LE9A 2BHYA 1KN4L 4LLDA 3MBEC 5E99L 4L8CB 3WFZA 1CK0H 4LSPH 3SDAC 5F44A 1M71A 4DW2L 4NKMA 3WJJC 4S2SA 1YYMH 3V5DB 1WEJL 4UB0H 4GW5A 3V6BR 9CGTA 2UZXB 5FK9A 3QG6A 4PB9H 1Y6MR 3UMTA 4JKKA 1DLHB 3HC0B 4A6YB 3G5ZA 43C9B 5MERB 4K7PY 1P69B 3FRUA 4N68A 3PQYA 1DQML 1HHJA 2Z0BA 2PO6A 1XF3B 3TM6A 5D4QA 1B2WH 3UROR 2O61A 3DV6B 4J3WA 4G8GA 4ZOCA 3CDFA 1T2QH 1R3HA 4MS8D 3MRLA 4WTZG 3VW3L 1NCDL 1VFBA 2R69H 4OB5H 3MRHA 1NANH 2P5WE 3V7AE 3BD4A 4O9HH 4Z76B 4P23D 5AZEL 4FTVE 3FQUB 1T0NA 4TYUA 4M9PA 2Z31B 5FYJE 3OR7B 1RV6X 4YWGL 3R4DA 1DQLL 4HGMA 4FXGB 4XNUH 3C6LB 4NKDA 5E6ID 3GBMH 1IC7L 5EPMB 2X5PA 1J5OH 4X6CF 5FYKE 5ABDE 4YHYC 5CP7B 3DROA 1RD6A 1IKNA 4TNWF 4Y4FA 2YUZA 4OIBA 3DPBA 2E7BA 5AD0B 4NPYB 4OGAD 1VERA 1WT5C 3H9HB 4DAGH 4Q9RL 1S8DA 4X83A 4P5MA 3TIEA 3QUYA 3BVNA 5IM7B 5KN5A 2AJUH 4PLKD 1Q1JH 1VGEH 3GGWA 4Y19E 4U05A 5C0AD 1EGJL 4NO0B 4KJPD 2FX8L 1A6WH 3SKOB 1S9YB 4ETQB 2Z8RA 4NGHH 4X9IA 4G6JH 1U8KB 3FOLB 3E6FB 2Q76B 4CVUA 3LS5H 4ENED 5FO8A 3GIZH 3U0TB 4F33A 3N1QC 3X17A 4PRBB 1E6JH 1I75A 1U3HB 4JKLA 3ZDXE 5ICYB 1E4JA 3L1OH 1I8KB 2FL5A 1MSPA 3O8XC 2Z4QA 1PG7W 1D5XA 3B9DA 5T5FL 1QPXA 1W8OA 3JV0A 4KRPD 4KI5E 1S9WA 3S35X 1AHWA 1W2KT 2YD6A 3LZFH 3I6KA 4RA3A 3TYGL 1GSMA 1I9JL 4LSSH 5CJXA 3O2VL 2V9TA 4FFWD 4C56D 1JWMB 3SDCD 4KK9C 3F7PC 5F6HI 1TZGL 4IRSA 4L9LB 4HHAA 4H8WL 4QTHB 1FZMA 3BIKB 3UC0H 1BLNA 1D5ZB 4MQSB 4Y4HA 5C0DB 1N8ZA 2DDQH 3FO1A 5DMGC 2IFGA 4OJFH 1ZLUH 3MBEA 1ZXQA 3P3YA 3HZKB 4KUCD 3THMH 2W9DH 5DJDA 4PJCB 2CXGA 4ODVL 1AQDB 1MEXL 2BHUA 3SDAA 3WJJA 1FVCB 4LDLB 3P9MB 3DX8A 3UZEA 3L5IA 2LFGA 1JGUL 5I1HL 1OVZA 3OXSA 3G5YA 4FQIL 4QNPF 5F9WB 3R0MA 4TOYH 4NQCB 1VEOA 3OKEB 4NN6B 2HJKB 1T3FB 3BN9D 4JPIA 3TBWB 3TN0B 3VRLE 3BPCA 5GRJL 1MFEH 4JRYE 4QHUA 3AS1A 2XTLA 4OZHF 4O5LH 1OAYL 2EXYC 3L5WA 1D6EA 3P11L 4LPYA 3HR6A 3TCLA 3CMGA 2GT9A 3LKSA 4HULB 2Z31C 4YE4L 5SWSD 1SBBA 3PABA 4WHDA 2BVUA 4YIQB 5B38A 1FORL 3CK0H 4KJQC 4PGJA 2VABA 3C6LC 5JNYB 4GAYA 1BZQK 2Y7QB 2CUMA 2JB5L 5GHWH 1B4JL 5DT1H 3IU4H 2DD8H 1RZFL 5GGUA 2ZUTA 1KEGL 3RWEA 3VWKD 3BHBA 2H8PA 3IB4A 3HUJE 3DOSA 4KXZH 5C0FB 4NKOA 2GIYA 3P4NB 2Q6WB 5I1KL 3ZTNL 3DX9B 1LO5A 1IGCH 2MCPH 2WINA 3GMNB 4KQ4H 4U6XB 4TVPL 1PKQB 4QHNA 4EVNA 4MJ5A 1IZKA 2KQMA 3NA9L 1LO0H 4J1UB 3QIUD 4HV8A 1RZ8A 4Y2DB 4YAQA 1ED3B 1NCAL 1UENA 4XPFL 3WYRA 4RMSA 3DO7A 1U3HC 3MYJB 1V3KA 4LLQA 1UA6L 4J6RL 5I8OH 5F70A 4G9FA 4JY5L 3GSNH 4ZFFA 4I13B 2C9AA 3BGAA 5HHPA 3WIHH 1KV3A 3ARVA