3TH6A

Crystal structure of triosephosphate isomerase from rhipicephalus (boophilus) microplus.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
247
structure length
244
Chain Sequence
ARRFCVGGNWKMHGSKNSIRDICNTLKGASLDPNVEVIVACPAPYLDYCRSLLPPSVALAAQNCYKVEQGAFTGEISPGMIKDCGGQWVILGHSERRHVFKEDDVLIGEKIKHALESGLNVIACIGELLEDREAGRTEEVCFRQIKHIASNVKDWSKVVIAYEPVWAIGTATPDQAQEVHSKVRNWLSTNVSADVASKVRIQYGGSVNAGNCKELGRKPDIDGFLVGGASLKPEFVQIINAMQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical characterization of a recombinant triosephosphate isomerase from Rhipicephalus (Boophilus) microplus.
pubmed doi rcsb
source organism Rhipicephalus microplus
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
total genus 90
structure length 244
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2011-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3th6A00
4Y96A 1GOXA 3N19B 3DHDA 4UNLA 3HG4A 4GC4A 1TPDA 4FHAA 3WJZA 3GIYA 3LCXA 3DI0A 3D0CA 1ZALA 5D2WA 2ZA2A 5FI8A 5U4NA 3O15A 2ATMA 4ALDA 2H6RA 3DXIA 3NQDA 4PC8A 3UZ5A 1LLWA 1XBXA 2H3BA 1TPC1 2QCFA 2CW6A 2R14A 2QUTA 1A5BA 1TTPA 5G2IA 5FF4A 1CI1A 3GX9A 2Y7EA 1QOPA 3HPSA 1XC4A 4HT3A 1TO3A 3WK1A 5AHIA 3THAA 2E1DA 2NZLA 1I4NA 1LM1A 1WQ5A 3THQA 3PG9A 4YCPA 3NL2A 4NJKA 3WK0A 4UTTC 1VZWA 2Y7FA 1KW1A 5LHFA 4AMAA 2VEKA 3P62A 5CPNA 5AN7A 4UMAA 3HJZA 5K2ZA 4AF0A 2OZ0A 1IXNA 2JGYA 4WY0F 2NXIA 1KV5A 4MLJA 4N02A 1DKWA 5C54A 1KFEA 1WXJA 1ME9A 3BGGA 4H4IA 3RLUA 3TMLA 1S5TA 3DFNA 4QISA 1JUEA 3TFXA 3WK3A 2E09A 1Q6LA 1V5XA 2QJIA 2V81A 3NQ8A 2ZRZA 3R5EA 5LHEA 2YFOA 4K37A 3C0JA 2WNZA 3DBPA 4LTSA 2HS6A 1F2JA 1P0NA 3A5VA 4MZ1A 5FESA 2VFFA 3TXZA 3M5YA 3NZRA 1EX5A 2YX0A 3W9ZA 1I2QA 1H7OA 1OX5A 2X1UA 2WOQA 4NJIA 4O11A 3RF9A 1OK6A 1S5VA 2X30A 1OFOA 3UY7A 1B3OA 1V7YA 1TREA 4RR4A 2HS8A 3W3OA 1TIMA 3V75A 2A6LA 2ZBTA 3DKJA 3LCIA 3N2XA 4LRTA 2RFGA 3L9CA 4I7WA 2ZZ6A 2V8ZA 1W5PA 2YFNA 1OHLA 1UCWA 1JCNA 1TQXA 4IGHA 4NVTA 2LLEA 2V82A 4UXDA 3W22A 2VFEA 5IM51 4LT9A 1GVQA 3CB8A 1KLYA 4PEKA 1SZGA 3W83A 4A22A 4LU0A 4LY8A 1KTCA 3W1NA 1SUXA 4L4LA 3LB0A 1K7EA 3QC3A 2QAFA 2A1YA 2PRMA 5E0KA 1RPXA 4WY0B 1L6WA 3B4UA 3C2VA 5K4ZA 2ZQ0A 3BLEA 3TC6A 3UWUA 3I6RA 3I65A 3N2MA 4K39A 3SW6A 3M16A 5C5YA 2C13A 2YSWA 3M0ZA 5HWNA 4IMDA 4AHOA 1ME7A 6ALDA 2PRLA 4IMCA 2OCZA 3O07A 3VE9A 2BTMA 4GE8A 3VKJA 3KOFA 1DHPA 4ZQRA 3QSRA 3W7NA 3PUDA 1W8SA 1FWNA 2ZTKA 1SQ7A 1IXQA 4E2DA 4WUIA 3STGA 1C29A 3G0SA 4FEZA 3NZ1A 3LX9A 5CZSA 2FPYA 1EP2A 2ZTJA 3NEVA 2NXGA 3M5XA 3C2OA 2QJHA 4TX9A 3H53A 4NXSA 1SW7A 4IWWA 2YR1A 4N4PA 2QEZA 2Y7DA 4KFOA 1VHCA 2QCGA 4EIVA 3M44A 1W5OA 4DQWA 5LZLA 3NGJA 1R46A 3L67A 4O0KA 4NNBA 1XL9A 3Q37A 4MFEA 1YLVA 2TPSA 1L9WA 4QM1A 2FIQA 4UTMA 1MXSA 1SPQA 2VENA 3PBVA 3EKZA 4IPIA 1X8FA 2RDTA 2PURA 3QF0A 5AC6A 3OG3A 1LOQA 3N9RA 4LUIA 4Z08A 2Z6JA 1QFEA 4ZQOA 3GR7A 2QDHA 3UWQA 3C2RA 2Q3RA 1ICPA 4B5NA 3CEUA 4RZ6A 4MUZA 1W3TA 3OVQA 4CQ9A 4O4VA 3TDFA 4KKXA 3DU0A 1T96A 3TUUA 5HR7A 4DELA 1G7UA 4MOZA 3DHFA 4XBKA 1P5BA 1DBTA 3STEA 4O1AA 1QO2A 2GQ8A 3R12A 3M7WA 3LHZA 5CG7A 3KFTA 2FPTA 2QAPA 2VC6A 1OF6A 4YWIA 1U5JA 2C19A 2ZA1A 4UTHA 3AJXA 4PL1A 3IVUA 3PBWA 1F74A 2WQPA 4BFAA 4MKNA 3PM6A 1GVFA 2G97A 3DFQA 3QSTA 2I14A 4UTWA 2ZZ3A 4O52A 4UTKA 2ZZ2A 1Y0EA 3MP4A 3P5ZA 4GUJA 1KM5A 4AHQA 1O60A 2A7PA 2ZYFA 5AYZA 2H3DA 3HMJG 2ZDRA 3F1QA 4LS1A 2ABAA 4P61A 1FQ0A 2BLEA 4LUJA 4O4WA 3W2NA 2C3ZA 3FLUA 1WOBA 3L68A 4DO4A 2V2HA 2CLHA 4FXRA 3W2LA 1IIGA 5EYWA 3HGRA 4JR5A 4LC8A 1LYXA 2FJKA 3LRLA 1EEPA 3LXAA 1ZENA 2FB2A 4MY9A 4LVBA 3FYPA 2WSRA 1F76A 2DJLA 3M1ZA 3W1QA 5EPDA 5BOOA 1A50A 3CIXA 5AC7A 3RLVA 5D09A 3CT7A 3LTPA 5J5RA 4IOTA 1TPUA 1W31A 1T8XA 3WFAA 2WJZA 3TC7A 1EP3A 2C0AA 3UQNA 3Q2DA 4Q32A 2CZFA 2V9DA 5FF3A 2NWSA 1TB3A 3QMTA 3EX2A 5D2TA 3TJLA 3B0VC 3FJLA 4JN6A 3W07A 5C6MA 1I2RA 3W1MA 3GZ3A 2FQIA 1UASA 4MY1A 5LNUA 2HMCA 2VEMA 4RXFA 4MYXA 3SGZA 5AHFA 4DF0A 1M7OA 1TQJA 3TSDA 4TIMA 4QAIA 4NJGA 3PF3A 3RMJA 3G3DA 5EBUA 5ABTA 4XKYB 5AFDA 2WSYA 6TIMA 4QNEA 5LGXA 1ONRA 3G1FA 2ISSA 1TTJA 1VQTA 2FB3A 4BR1A 2NUYA 3W7EA 2JKAA 2V30A 4CLMA 2YXGA 3PWAA 1PE1A 2G95A 1QDSA 3CWNA 1W37A 4X2RA 1TTQA 3B05A 4NT0A 2VKZG 2UV8G 3MJYA 3TX9A 4M19A 3PSVA 4PODA 3W7IA 1FBAA 3NM1A 3P82A 1OG0A 1VHNA 4C1LA 2BXVA 3MHGA 3EWXA 1TPVA 1L6SA 1CW2A 2PCQA 1OJXA 2DORA 5A8GA 1H5YA 1KTBA 4RZ5A 4O13A 4ZVJA 1UB3A 4ZQNA 2NXHA 2E6FA 1FDZA 2DZPA 4M7SA 4P2VA 1L2UA 2QCMA 1FX6A 4JEQA 3S5OA 1RD5A 2YGYA 5AOUA 3PBUA 1ML1A 1R47A 2HTMA 4HHPA 4RCXA 1F73A 3W7OA 5DCEA 2ZRXA 5FEWA 4FB7A 3HOJA 3W86A 4I9AA 4JTJA 5AHLA 3C52A 1D9EA 4FNTA 4DPQA 2CU0A 3CTLA 3T4CA 5DXXA 5F2LA 4K36A 3IEBA 1NFBA 3G1HA 3W73A 5HMSA 1VGAA 3C56A 4CQ8A 5IBXA 1W3NA 1OFRA 1EP1A 2CLLA 3CC1A 3A24A 1EA0A 3CWOX 4A29A 1QWGA 2JKPA 4PA8A 4NQ1A 1HL2A 1KLZA 2CLEA 3PB0A 3TE9A 1YDOA 2Y89A 4JX4A 2JBMA 1PCWA 5D04C 1HG3A 4ADUA 2QCDA 2H8ZA 1RQEA 3GDRA 3L65A 1AL7A 2QCEA 3LXBA 3MHFA 5LNSA 3DFSA 5AHNA 3LBMA 3SFKA 1G4EA 3TK7A 1JULA 4A2RA 3LHUA 3KVJA 2E68A 3MI2A 4O15A 3SI9A 5H91A 2ISVA 1XBYA 5TBOA 2AGKA 3M43A 1QPQA 4BWLC 5CZJA 1DV7A 2X16A 2GJLA 3S5NA 1FY6A 4NX0A 4J9JA 3P67A 4UTUA 4XWUA 3NO5A 1J5TA 5F2IA 1OFEA 3NR0A 3EX4A 4N6EA 2CZEA 3W87A 4AXKA 2QDGA 4Q4KA 3HG5A 1OFDA 4H6KA 4FX6M 2VFDA 3SECA 1XUZA 2Z6IA 2EAWA 3NYZA 3I7RA 2OT1A 4YMZA 3P81A 2A21A 3W1LA 4UFIA 3QJAA 3S1WA 4OQVA 5I3HA 1WA3A 5G2WA 2OMAA 4GRSA 1I45A 2Y85A 2J88A 4O54A 2X1SA 4AHPA 4AF0B 4BK9A 3BO9A 1GYNA 4Z0JA 4UFLA 4ZL1A 5BNKA 1N7KA 3WJSA 1MZHA 1G7VA 4TO8A 5FF0A 2NV1A 5BRBA 1PCKA 3MI3A 3F4WA 1UJPA 4K8HA 2ZZ7A 2YW3A 4LV4A 1LP6A 3IIXA 4BI6A 2WKJA 2B7NA 3GXPA 1S5WA 3NPVA 2CWNA 1FDJA 1WV2A 4QNWA 1GVOA 1DQXA 4JS3A 5D02A 1VYSX 1JRBA 4KWVA 4DF2A 3T40A 5HNRA 1M7PA 1VCVA 1LROA 1VH7A 4S2BA 5LNWA 1YPIA 4N2YA 3EB2A 4EF9A 3S0CA 5BW6A 1VS1A 3A9IA 1JUKA 3INPA 1YTDA 3W74A 4MZYA 3OVRA 3M9YA 2E6DA 5HUOA 1TPB1 4O53A 4WOQA 4CCEA 1A5AA 3G0UA 5A5WA 1SFJA 1Q45A 4O18A 4JYEA 4NUWA 4AH7A 1GG1A 3MP5A 2QJGA 1Q3NA 1LLZA 3NNTA 1XI3A 3BLFA 3G8RA 3LERA 3I7SA 1TV7A 4G1KA 1EUAA 4YL2A 5F4SA 1B4KA 1ZAHA 1W56A 2E6YA 2QCCA 4HNUA 2NUXA 5D33A 1HFBA 3DZ1A 4CCDA 1TPH1 3O6CA 5D05A 1HUVA 4U28A 4O19A 3U2OA 1FCUA 3NXFA 1UUOA 1MEIA 3NA8A 1TTIA 1H63A 4A21A 1XXXA 4WQ6A 1D3HA 3OVPA 4XBSA 2V2DA 1EPXA 5KZDA 2IQTA 1Q6OA 1YXCA 3TSMA 1VRDA 3A21A 3E49A 1WX0A 4O1DA 4PCFA 3V1PA 3BG3A 4BF9A 3M5VA 3TMQA 2GOUA 3FEMA 1XKYA 2YPIA 4JGDA 3UYCA 2J6XA 3P8JA 4I7UA 3S5YA 2FDSA 3P84A 1RQHA 1LCOA 1YYAA 4NNCA 3PVFA 1K7XA 5CZ0A 4UTIA 4AB4A 3GDKA 1VYRA 1FCQA 3ABRA 4JTEA 1DJQA 1B57A 2ZZ4A 3L0NA 3ABQA 1JCXA 2ISWA 3KRUA 1U83A 5DY3A 1SZNA 3WJYA 4Y9AA 1SO5A 3TQKA 4CNNA 4Q33A 2YZRA 5C55A 3UXAA 1N8FA 3EXTA 5HUPA 4HNVA 3TAOA 3UXDA 4H3DA 4NXKA 1ME8A 2ZZ5A 1SFLA 4AWUA 1TRDA 1KBIA 3LTYA 4NJJA 4O28A 4LVGA 2ABBA 4R7JA 5EKYA 4MFDA 5K9DA 5K9CA 1FXPA 3B04A 1QPOA 3TAKA 1R2RA 4GNJA 2YDAA 3NPUA 3MWAA 3HPXA 3MYOA 3E02A 4ADTA 3MO7A 1H1ZA 1PS9A 1F6KA 4N4QA 2C16A 4NZFA 3S1UA 4AVFA 3QFEA 1K03A 5CGQA 2DZXA 4K7YA 1KM1A 1HO4A 3W1RA 5F1UA 4DO6A 3FIGA 5LKYA 3TW6A 3GAYA 1JQVA 4IMFA 2VFHA 3TROA 3FYOA 3CLMA 2I1OA 3AO0A 5H2ZA 1NF0A 1F7BA 4XZ9A 2CLMA 1PHQA 3SY5A 1QCWA 5AYYA 1NSJA 4KFNA 4RJEA 4LVDA 1EIXA 1PL9A 3DFOA 1I2PA 1XDMA 3W76A 1JCLA 2E5BA 1JVNA 1Z48A 3KRSA 3TQ0A 2V5BA 3TW7A 1XDLA 4RXGA 1G4PA 1DORA 4LW7A 4WXYA 3LBCA 4HIBA 3QEZA 4UFMA 3PY2A 2KZHA 1H7PA 2CZ5A 1RZMA 1KM4A 3ELFA 3W7PA 4ORMA 2FPVA 1Z41A 4JY8A 3DGRA 3TJXA 1JCYA 5KZEA 1ZHAA 3ZR4A 1VLIA 4LOCA 3NQ2A 1K8XA 2Y63A 1IIHA 3LM7A 4FNQA 2B4GA 4X9SA 5K7JA 4K6AA 2EGZA 2YCEA 3QQ0A 5KZMA 1OFBA 2ZCGA 3S6DA 4RKAA 1JQXA 4JD4A 3PUEA 2BSLA 3W1PA 5AC8A 3BPWA 4GUIA 1KFBA 1H7XA 1GEQA 1Q6QA 1W54A 3TR2A 5D38A 4XKYA 4CNOA 3LRMA 3EX1A 1KBJA 3N9SA 2Y6ZA 3IIZA 5E93A 5HINA 4UR7A 4EVZA 4QJ1A 1MSSA 3A5FA 3LLDA 4FX7A 3L5MA 3W2MA 1YTKA 4UTWC 3SZ8A 3E96A 1I8JA 2EPHA 2Z2UA 3HG2A 3HQ1A 3FFSA 2OX1A 4ZQPA 5D03A 1W0MA 2J9YA 1D3GA 1YTEA 1XFBA 5G4WA 2F7FA 4QIUA 4JTTA 3P8IA 3NL3A 2E5CA 3QMSA 3GXNA 3F03K 3NAVA 4A3UA 3LCLA 4GUGA 5BMWA 4Z1DA 2QCDB 1KFJA 2P1FA 5L9FA 5U7SA 4DF1A 3S42A 2CZDA 3GNDA 3BW4A 4WXZA 5L6UA 2NWRA 3SSJA 2C18A 4TR9A 3A23A 4JIQA 5CKSA 4IMEA 3LI1A 5K3VA 1EB3A 1ZAJA 2Y61A 1M5WA 2VEIA 3P61A 1WYIA 4UC5A 5HJLA 2BWGA 3GDMA 1FDYA 1GTEA 1LBMA 3HGOA 5DCBA 4K7VA 1H62A 1EWDA 1TV8A 2FLIA 3W84A 3WJXA 1J2WA 3EWBX 4R33A 4YXGA 4IX2A 1AW1A 3UWVA 3T7VA 1N55A 1P0KA 3QM3A 5LGZA 3HF3A 3NQCA 1TCDA 1A5CA 3CQ0A 3LOTA 4S1FA 1HO1A 1X1OA 1K8YA 3BW2A 3QH2A 4U4MA 3QRHA 1GYLA 4MYAA 1W5MA 2QR6A 3PAJA 3SJ3A 4PFMA 2P10A 1BTMA 3DFPA 4HSNA 3SGUA 4D2JA 3CM4A 3P5YA 2R8WA 4W9TA 5DXYA 4EF8A 1SR9A 4EOUA 3MW7A 2C6QA 3GNNA 2DP3A 5TIMA 2RDWA 2X1RA 3LCHA 1KFKA 3B8DA 3W1TA 3JS3A 3CEPA 3B0PA 3LGEA 4LVAA 1R2SA 1IGSA 1Q6RA 5F4XA 3W7HA 3UWWA 3HG3A 1CX9A 4FO4A 2NLIA 5EL1A 1O95A 4DO5A 1LZOA 3G22A 1PIIA 2B0MA 3NQEA 1QO5A 3BGJA 1C9DA 3M47A 3E0IA 3LXCA 1Z44A 3UY8A 1NEYA 2CFFA 4NJHA 5T26A 3DAQA 3UZJA 2TMDA 1H60A 2FFCA 4O50A 2J24A 1TPFA 1VCGA 3HGSA 2A6NA 1LOSA 4UNKA 3L21A 4ZQCA 5G1TA 3YPIA 3R13A 5HWMA 4ONVA 2GPTA 3NPXA 1B4EA 2VXNA 2B7PA 4TMBA 1SSDA 1G4SA 5F1VA 2OJPA 4O14A 1ALDA 3QPZA 1VR6A 3IIVA 2X2GA 3T55A 2I9EA 1OK4A 4UTLA 5CZTA 4WD0A 3IVSA 3W2KA 1AW5A 1J4EA 5I3KA 1QPNA 3KVKA 4N6FA 5HULA 2TRSA 1LOLA 3LV5A 2WV8A 3S8HA 2C1HA 2R91A 1O94A 3W1UA 4UFJA 1KM0A 3G1VA 1UBSA 4ADSA 4OV9A 4JY9A 1LRTA 3FJ6A 1JCJA 1SW0A 1SO3A 5CPMA 2B7OA 3OA3A 2QUVA 3PS7A 2EKCA 3HO8A 4N9DA 1OVDA 4IPJA 4O8RA 1OX4A 5F2MA 1FWWA 4LRSA 1VJIA 1FUYA 4Y6GA 5CPOA 1X1ZA 4WX2A 1GJPA 1X7FA 1O4UA 4MVAA 2Q3OA 4NX5A 1SSGA 1AK5A 3O1NA 4LS0A 5IBXC 4DPPA 1ADOA 3G1SA 4JYDA 1E51A 5KTLA 3B06A 3W70A 4OWGA 1H7RA 1P1XA 3PUOA 4GUHA 3GB6A 2NX9A 1KM2A 5E1QA 4QSHA 1QMLA 1ZY9A 3ABOA 1KFLA 1ZFJA 3NQGA 5DY2A 3DKLA 1G4TA 3E12A 2ZA3A 1H7NA 2QCHA 2V2CA 1QPRA 3EXSA 2JK2A 3LHTA 3QW4B 5DN1A 2H8XA 3IRDA 4C1KA 3KVMA 3I68A 3W7RA 4IUOA 3HIJA 2ZZ1A 3W7GA 3W7QA 3IVTA 2WSQA 4M6PA 3R2GA 3RK8A 3Q94A 4N9CA 2TYSA 1FWRA 3PB2A 1AW2A 4HKPA 2NX3A 4MZ8A 2NX1A 4HPXA 3STFA 3DENA 1QR7A 3EWUA 1T0OA 1G67A 1KM6A 4ZZ9A 1TJPA 3W7MA 4O57A 4RX0A 3BG9A 1L6YA 3GDLA 2ATSA 1P4CA 5CSSA 1BEUA 3S1XA 5AYXA 3KX6A 3M5ZA 4ML9A 2DZTA 5KSWA 4FNPA 3BLIA 3QPYA 3C8FA 1LRNA 2C14A 5FEZA 4LS2A 1QNVA 4JXCA 3FKKA 1F6PA 1OYAA 2DZSA 1LORA 3DI1A 3BW3A 3TCEA 1MEHA 1KFCA 2Y70A 4OV4A 2AQWA 4KWWA 1PVNA 3W7JA 2NUWA 4RV8A 1AMKA 4JTSA 4Z1CA 1RQBA 2J27A 3L2IA 3STCA 3VI2A 3W85A 1ZNNA 3N34A 3W75A 2ZRWA 1GVSA 2A7RA 3S1VA 1TSIA 4HSOA 5HWJA 5F2GA 5GVJA 5CPLA 2OT0A 2VFGA 3G1YA 3LI0A 3TIMA 4K38A 1H61A 4DBEA 4A2SA 4O16A 2CLKA 1SW3A 2C15A 5FF2A 2ZFAA 2W6RA 3BARA 2VEPA 5D2XA 3MYPA 1WBJA 4FNSA 2P0OA 1VPXA 3ZS4A 4R53A 3T78A 1EUNA 3W2UA 3NOEA 4JNMA 1S3HA 4ZQMA 4R34A 4PTNA 1OYBA 3TFCA 2F84A 3W2JA 3K30A 5G2HA 4O12A 2E77A 3OHIA 7TIMA 3M41A 1R30A 1JJKA 3P60A 3CPRA 3Q58A 2DJXA 1FWTA 2CLOA 3OBKA 1I2NA 3O6DA 3BK0A 5CSRA 3GLCA 3NQFA 2Q8LA 2WNQA 4LWWA 4FXSA 3P80A 4MY8A 4JDBA 2Q8ZA 4UFHA 3G18A 1RVGA 2A5HA 2GVJA 2WPBA 3NQAA 1GQNA 1BKSA 4GJ1A 4LNYA 4WY0A 4E2BA 3N3MA 5F4WA 2V5LA 4JTIA 2XN0A 3NPWA 3NQMA 1I2OA 3TKFA 3IIPA 4M6QA 1KTNA 2ZRYA 2Y7GA 4O0ZA 1RR2A 3O05A 3KVLA 4UMBA 2Z0IA 4QITA 4I7VA 5DBTA 3QZEA 3BVJA 3VE7A 4UMCA 1WAUA 3EX6A 4JTFA 3ZWTA 1OABA 4S2CA 5K9XA 4YLWA 1YPFA 3W6YA 1TMHA 1TV5A 1RV8A 2DU2A 4BI5A 2QKFA 4E38A 2B7QA 1B9BA 3WJWA 3TSBA 4GWEA 4UTTA 1ICQA 2YYTA 3ZWSA 3LHYA 1T99A 1OYCA 2A7NA 3N73A 1GVRA 3NQ7A 1F05A 4EWND 3SR7A 3QW3A 3C6CA 3NG3A 2DZVA 4MPQA 2J9ZA 1GG0A 3MHUA 4TU1A 5EY5A 3W7LA 4AWSA 3SIZA 5G5IA 5D37A 3EWYA 1ZCOA 3KXQA 1GTHA 3OIXA 5J5DA 3ANYA 4OT7A 4M5PA 2EHHA 2NV2A 1HTIA 1IF2A 4JTKA 4PH6A 3LHVA 1IXPA 4PL2A 1VYPX 4L4MA 3KAOA 1XM3A 1F5ZA 1A5SA 2PE4A 3BV4A 4Z0SA 4JICA 4N9EA 1YADA 3TU9A 8TIMA 2VFIA 2A4AA 3L66A 1H51A 4OHQA 1TJRA 3W7DA 3IIOA 1JUBA 1FCVA 1H7WA 3IV3A 1LDCA 3GR8A 5AHEA 4HNNA 1EWEA 3FKRA 5TQLA 1NAL1 2ALDA 3LCWA 4JDYA 3B0UX 1X6UA 3L5LA 3UWZA 4CNPA 5D2VA 2GVLA 4WZHA 3MMTA 3TNOA 3PSWA 2E5DA 3C3NA 1W5NA 1QOQA 1SZEA 5KINA 4Y8FA 3G0XA 2HSAA 4O1CA 2J9XA 3QYQA 2XN2A 4QQ3A 1XBVA 5D32A 1XUUA 2O7SA 3O16A 1K02A 1PHWA 1G6CA 3ATZA 4ICNA 3ATYA 3NL6A 3NQVA 1VLWA 2CLFA 4GBUA 3HPZA 1WDWA 3PR2A 1W1ZA 3PC0A 2XFWA 4NNAA 1KM3A 3C61A 4MLRA 3NM3A 4WOZA 3EXRA 3NQ6A 4M6VA 4OU1A 1MO0A 3OEXA 4XTIA 1DQWA 1WBHA 4DEFA 3EEGA 4TMCA 1GWJA 5I3IA 4GUFA 4N9BA 3UNDA 2TSYA 1A53A 3KRZA 2DZWA 3PG8A 2RH9A 5HR6A 2DZUA 2E6AA 3DFTA 1DJNA 1LBFA 5AHMA 2WO5A 5C2XA 4LC6A 2XN1A 3M6YA 3USBA 3VNDA 2VOMA 1BWKA 3GKAA 4NU7A 4O17A 4YCOA 3FA5A 2GQAA 4DXVA 3NDOA 1JRCA 1K7FA 1ZAIA 4JIPA 4UUIA 4FIRA 3JR2A 3LDVA 1SO6A 4Z1BA 5I3JA 4RZ4A 3GAKA 2WNNA 3QQ1A 4HPJA 3C2EA 3LLFA 1FWSA 1OFQA 2RDUA 2ZRUA 4M7TA 3NL5A 4ZMGA 1DL3A 5LNRA 3LTSA 1VC4A 4ORIA 2ZRVA 4JTUA 3O63A 3TA6A 3VFLA 5I3GA 3MP3A 4CQAA 2W0UA 2YYUA 2QCLA 2GQ9A 1OX4B 5BMXA 1OF8A 1GT8A 2FTPA 4FNRA 4JYFA 4FF7A 1LTDA 4NZJA 4JTLA 3GVGA 3PBYA 3PULA 1TPWA 3L0KA 1SZFA 1ICSA 3JRKA 3GYEA 1H50A 3W23A 3NVTA 1W5QA 3EWZA 3N14A 5SWUA 3L5AA 3EX3A 4O1BA 4E0CA 4UCGA 4AEOA 1NF7A 3TXVA 2G5WA 2YW4A 5KITA 1YXDA 3CU2A 1THFD 5I3FA 2QF7A 3LV6A 5AB3A 3RU6A 1DOSA 4XQ6A 4CCCA 5FEPA 4WJEA 4GFSA 1Z42A 4IXXA 2GVGA 4MJZA 3L0GA 1R2TA 3RFAA 5D2YA 3W71A 3HB9A 1ZJIA 2A85A 4JX6A 3O8AA 3G24A 4RK8A 1IXOA 1O5XA 3DH7A 2Y62A 4POCA 4UFKA 3TV8A 3GK0A 3C2FA 3RNDA 3F4NA 1AG1O 1AL8A 4LV9A 1BWLA 1C8VA 1NVMA 2VELA 4JTHA 1H1YA 3A22A 4UR8A 2GUUA 2EF9A 1JCMP 1W3IA 1YDNA 3MUXA 2Y88A 3U6WA 3UPWA 3E9AA 1FXQA 2W79A 3HBLA 4Z1AA 1VCFA 3R89A 3G1XA 4RLIA 3P74A 2PC4A 4UIOA 3R8RA 3W88A 1O5KA 2GJNA 1TYGA 1K8ZA 4HNTA 1PV8A 5FEXA 3FOKA 1OX6A 2Z1BA 5DBUA 2V0TA 5G4EA 1YXYA 4IJBA 3MBFA 3IGSA 4IX0A 2JGQA 3MBDA 1JR1A 3WK2A 4IMGA 3G1DA 5MHBA 4MJMA 3W7CA 2R94A 1WOAA 3UD6A 3QMRA 3LCFA 5K4XA 3ABSA 3GDTA 3UWYA 4BI7A 3EWWA 4O10A 3GXTA 2BX7A 3S5ZA 4JTGA 1MEWA 3LCGA 2G96A 3O6YX 1G69A 4GXMA 4OGZA 5LSMA 4X22A 3H55A 1DVJA 3W7KA 4OBTA 1XBZA 2QUUA 2RKXA 4UTJA 5G1YA 4AAJA 4Y90A 3MI6A 1FCBA 3IGXA 4BWLA 4JX5A 3W1XA 2CLIA 3VCRA 3TH6A 4IXHA 4KFPA 1LRQA 4XTDA 3I7QA 2PRHA 1SU5A 4DBDA 5FF7A 2D73A 3EKLA 3W72A 3FS2A 1UUMA 4OE7A 4HN4A 1OFAA 1XCFA 3O06A 4AWTA 5DELA 1TRIA 3HGJA 1YDVA 4FX8A 2X1TA 1M6JA 5HQEA 4LVFA 4FNUA 5DCDA 5LNVA 3IGUA 3B03A 3ZFHA 3G3MA 4XUGA 1OFPA 1KA9F 4X3ZA 2BZNA 4MIMA 3TQVA 2QCNA 4K8EA 2H90A 1GZGA 3LRKA 1GPWA 2A0NA 3CHVA 3G1AA 3H54A 3U8GA 5EA9A 2JKEA 3UPBA 3S9YA 2A2IA 3G8EA 3T44A 5D30A 4FIQA 2RHGA 5EMUA 3BG5A 1QAPA 3CIWA 2O7QA 1TPEA 1K3UA 3P7YA 5DLCA 2AAMA 1LBLA 3KHJA 1SO4A 3W1AA 3GKFA 3C4UA 5KMYA 1KV8A 3LHWA 4IQLA
chains in the Genus database with same CATH superfamily
1TPDA 4LF2A 2X40A 3V16A 4H04A 3RLHA 2DSZA 1FHLA 4CUCA 4KETA 2ATMA 1Z89A 2H6RA 4YWSA 3SSZA 3WNOA 1TPC1 2QCFA 1BG4A 1Z8AA 2GWNA 3SRKA 1N8IA 4MHBA 2QUTA 4MDPA 1CGXA 3BOLA 4DJEA 3MMDA 1XC4A 3WK1A 3CUIA 1GOIA 2E1DA 4NP7A 1TKKA 1I4NA 3BMWA 4ZA0A 3PG9A 7ODCA 4YCPA 3WK0A 5M5DA 2VEKA 4NILA 4UMAA 3BURA 5K2ZA 1WKEA 2OZ0A 1IXNA 2YCLB 4WY0F 3ABZA 1Q4NX 4N02A 1EDTA 5C54A 1M04A 1ME9A 3RLUA 3IK4A 1S5TA 3DFNA 3WK3A 1PKMA 3H70A 1BYAA 3SIMA 1EX1A 2ZRZA 1A4MA 1VF8A 3IGHX 4ZGYA 2OFJA 1U5HA 3BTNA 4IICA 4D8ZA 1F2JA 3H8AA 3M5YA 3F4VA 1HKKA 2YL5A 3VD9A 3TYBA 2BHYA 2YX0A 4DXXA 1Q6EA 3W9ZA 1OX5A 2NQ5A 1LUCB 1T7LA 4NJIA 3RF9A 3THUA 4WJXA 2BMBA 1TIMA 5D9PA 3U2EA 3I3BA 2ZBTA 3DKJA 3RX3A 3Q45A 3KOZA 4LYKA 2BVTA 4L5ZA 2YFNA 2J4GA 1IGWA 2V82A 2VR5A 5EMLA 4LT9A 3SFWA 4TTGA 4UNIA 3W83A 3CUXA 4A22A 4QJ4B 4ZBCA 4CNSA 1VBUA 4LY8A 3W1NA 3FAWA 3LB0A 4C65A 1K7EA 3DDMA 3O0KA 3G5EA 2QAFA 1RHCA 2D2JA 1Q63A 2PTZA 3VINA 3M46A 2WANA 2VRKA 2ZQ0A 4TXEA 3N2MA 2YSWA 3M0ZA 1W17A 3V18A 5CXPA 2BBFA 2C91A 1C93A 1UR4A 4INFA 3WF0A 2WXDM 3VKJA 2NQHA 3KOFA 4ZQRA 5H8MA 1Z3NA 1FWNA 3OVGA 2I5IA 2ZTKA 5BRQA 1SQ7A 4HMEA 1IXQA 1JEZA 4WUIA 4IFRA 4ZFMA 1MW3A 4UOJA 4AIOA 3LX9A 3D3FA 4HTBA 4C6JA 3H53A 1SJBA 3IARA 5E09A 2QEZA 2Y7DA 1CWYA 3CV2A 1XISA 2QCGA 4LB3A 5AZ0A 3M44A 4DQWA 1XSJA 1R86A 1ZCCA 4NNBA 4MFEA 4WVXA 4QM1A 4HVXA 2CHNA 2PS2A 1MXSA 1SPQA 4C7DA 1X8FA 4I9JA 1LOQA 1CIUA 3N9RA 1GOOA 2WVSA 2WVUA 4ZQOA 3GR7A 2QDHA 3E74A 2G37A 4XSMA 2VDIA 2BASA 3QN3A 5CGMA 3WMBA 3CEUA 1V0NA 3UR5A 4DM1A 1T5AA 2EQDA 3OVQA 2ZX5A 4KKXA 4D6HA 1FWGC 4IQEA 3VCNA 1BSLA 4DELA 1KR0A 1J9YA 4MOZA 1SJDA 4K2SA 4H2HA 1DBTA 3STEA 4AZ5A 3MSYA 1C8YA 2GQ8A 3OLDA 2HPIA 4B3ZA 3U2CA 4YIWA 3KFTA 1OF6A 4YWIA 2V68A 4HCHA 5CGTA 4UTHA 1Z9AA 4J2MA 3RO8A 3FGCB 4PEEA 1TG7A 4XKMA 3PBWA 2WQPA 4H00A 2ACSA 3UFYA 1UKTA 1Y0EA 1H0GA 4M24A 3GC2A 2G41A 4YHGA 5AYZA 4B3LA 3HMJG 3F1QA 3SCWA 1NP0A 2XFYA 2WSKA 2DSVA 1IZJA 4DJDA 4P61A 1QW9A 3FY1A 4AX6A 4O4WA 5AECA 4OFCA 5HJYA 1ZZMA 1UOKA 2IKIA 1TELA 1WOBA 2V2HA 3W2LA 3KBJA 1IIGA 3BE7A 3DBNA 3HGRA 2Q02A 2QNEA 1LYXA 3CUJA 1DJYA 3RLGA 4FOJA 3TOPA 1U1JA 2FB2A 4MY9A 1XR2A 3M1ZA 2DJLA 2BP1A 3JZUA 1JI1A 3B9EA 5D09A 5J5RA 4IOTA 4MWAC 3GXDA 1W31A 4D72A 3WFAA 4M0XA 2WB5A 2V9DA 4Q8MA 1TB3A 3QMTA 3EX2A 1TVLA 3WF3A 1K6WA 3FJLA 4GLEA 3W07A 2BVDA 2G3MA 4ATDA 1UASA 2HMCA 4MYXA 1ZS2A 4TQTA 4DF0A 2XIQA 1M7OA 4HU4A 5CEWA 3TSDA 4QAIA 2G3FA 2WZTA 4NJGA 4DUWA 5EBUA 1AUSL 5AFDA 2JF7A 4EPBC 3HJEA 4ZB2A 3OTRA 2ISSA 1H3GA 1MXGA 1TFVA 2W27A 4Q7IA 3UGRA 2FB3A 3RRXA 1UR3M 4TVCA 2JKAA 3AMCA 4IGNA 3T6CA 5JIPA 3PWAA 2G95A 3UJRA 2WCSA 3CWNA 2XDFA 4AU0A 4H7VA 4LPCA 4YHEA 3MJYA 3AZSA 4LCRA 3CUZA 2GUBA 1CNVA 2CHRA 5CPSA 3PSVA 3VDAA 1FBAA 1MW2A 3UP8A 5C9WA 3ZJ8A 1EF2A 3CZEA 1MUWA 1L6SA 3GXMA 1QBBA 2XYLA 5A8GA 1CLXA 1H5YA 1S38A 1QW7A 2JALA 2QLYA 2NXHA 2E6FA 2DZPA 1XYCA 1MNZA 2DFAA 1FX6A 1Z32X 1C8XA 3UZXA 4A3RA 5AOUA 5I7GA 3PBUA 4RDYA 4R9XA 3RCYA 2Y2WA 2OPJA 2AAAA 1UH4A 3QHOA 1F73A 2ZRXA 2E8YA 5FEWA 3C52A 4AFYA 4FNTA 1SMAA 3SO7A 5CZKA 5F2LA 4K36A 3IEBA 4C90A 4FLSA 1W3NA 1OFRA 2W92A 2FHFA 2CLLA 3MY9A 3A24A 3T0AA 2ZC1A 1UQYA 4US5A 3CWOX 4A29A 2FVMA 1VBGA 1R9YA 3EA2A 1RCQA 3D5HA 1QK0A 1KLZA 1ONXA 2DVTA 3TEVA 4LH8A 4JX4A 4EPEC 1R38A 2JBMA 1HG3A 2HVOA 3GFZA 4DJFD 3WUBA 4E8DA 4U33A 4P8WA 3MHFA 2WZMA 3ORWA 3QGVA 3LBMA 4RNHA 3MSRA 3LHUA 3C0SA 3WNMA 3SI9A 1VPYA 3MMWA 5EMKA 5CC6A 1XBYA 4ZOCA 3M43A 3EMZA 3VTRA 3LY0A 4DN1A 4PE8A 4J9JA 3P67A 4UTUA 4PTVA 1CEOA 4BEQA 2PZ0A 1EPVA 1J5TA 1OEPA 1OFEA 3NR0A 4N6EA 2QDGA 2OU4A 3WBAA 4DBUA 2FZBA 3GXFA 1E0WA 4H6KA 1R3YA 4U31A 2R1LA 2VFDA 1XUZA 2Z6IA 4KBXA 2I57A 4C6NA 1DQUA 3NYZA 4HPHA 1OT1A 3P81A 3WF1A 3W1LA 3VO0A 3S1WA 2OQYA 3VOGA 4DHGA 2OMAA 1I45A 2J88A 4PCPA 1FKWA 4BK9A 2INFA 3EPOA 3SADA 1JDCA 1UD2A 2E67A 2FH8A 3EWDA 1XG3A 4TO8A 1TJ0A 3VIHA 1ENUA 2Q09A 3TYCA 1ZP3A 4WSKA 3GIQA 4K8HA 3OBAA 3PZNA 4LV4A 1LP6A 4BI6A 3GG7A 2B7NA 3KTSA 4GZJA 3NPVA 4PMQA 5C0QA 4WR3A 3KCJA 4IQDA 4RPQA 1GVOA 3OYZA 1DQXA 3DX5A 2XM1A 1JRBA 4KWVA 3QZAA 4DVOA 3T40A 1LROA 1AZ1A 3AU6A 1J5SA 3V5OA 2VUYA 1AMYA 4JBRA 4EF9A 4JIEA 3S0CA 1D7KA 4B5TA 1TCMA 3WQ6A 3A9IA 3DYPA 1JNEA 4JQ3A 2UY3A 2W3ZA 4KQNA 1TPB1 1EJTC 1HKMA 1QT1A 2E9LA 3HN3A 1W2VA 1A5AA 3GY1A 3VMOA 3G0UA 4HGXA 1VB9A 5E9AA 1GOWA 2OX4A 3UERA 4JQ4A 4D6EA 1Q45A 2H9AB 2PODA 2XIOA 4AH7A 1X39A 2QYGA 1K4GA 4NHVA 3ARUA 3MP5A 1Q3NA 3CYJA 3APTA 3RR1A 2FZMA 5D8WA 5F4SA 3MS8A 2E6YA 2QCCA 4OIFA 5D33A 1LF1A 1HFBA 1WKYA 3DZ1A 4MSSA 1HUVA 1WB0A 2XH2A 4U28A 5D4YA 3U2OA 2J7EA 1UUOA 3QY8A 4XO6A 3E6EA 3T0BA 1KKOA 1XXXA 2NQ9A 3SN1A 4XBSA 2PDNA 5KZDA 2BB0A 1Q6OA 4NY2A 1YXCA 3TSMA 3A21A 5BWFA 3V1PA 3M5VA 3IK2A 3LNPA 3C2YA 3FEMA 5JMUA 4JGDA 1S5NA 1M9HA 2J6XA 5T8GA 3FJ4A 3S5YA 3P84A 4QG6A 4FAMA 4YVXA 1YYAA 4NNCA 3WDHA 1DIOA 5CZ0A 2YXOA 4AB4A 3GIPA 4JTEA 1DJQA 2V5DA 1B57A 2ZZ4A 3B3DA 3L0NA 2ISWA 4X0NA 1SZNA 1NELA 1SO5A 4CNNA 4Q33A 1UA7A 3GC5A 3URAA 1CB7B 3EXTA 4AZBA 1ZRQA 3UXDA 1DXIA 4NXKA 1PO9A 3WLIA 1TRDA 1KBIA 1ZTVA 3LTYA 2ABBA 4MFDA 2HBVA 1R2RA 3UZZA 3M7SA 2J8TA 3E02A 3H2AA 1TUFA 4E4FA 3LK6A 3Q4DA 2D20A 3M0IA 5A8NA 1EBHA 2C16A 1E0TA 3QFEA 1K03A 1NP2A 5CGQA 3R4IA 3MT1A 1KM1A 3W1RA 2PEVA 5LKYA 3GAYA 4IMFA 2VOTA 8RUCA 2AQVA 4UCFA 4G56A 3AO0A 2VUNA 3U7VA 2BGSA 1XIDA 3AROA 4EPKA 1TV2A 1QCWA 2VQUA 2YCLA 4Y8EA 5AYYA 2WHMA 2OGYA 1PL9A 1UOZA 2XIBA 4MM1A 3N6JA 3TTOA 3UU0A 3TW7A 5FSDC 5T9CE 1JFHA 2IW0A 1QI3A 3VGBA 1Q7MA 2WNWA 4UFMA 3N1AA 1KGWA 3PZOA 1RY8A 4H2CA 3FW6A 5GNXA 3W7PA 4QXIA 2FPVA 2CITA 3AU2A 3DGRA 3TJXA 1ZHAA 3T2PA 2ASHA 3MPGA 2B4GA 3GSMA 3RN6A 1EL3A 1PX4A 4DUOA 2YCEA 4HJWA 3SRFA 3V0TA 2FH6A 1H7XA 1W54A 4XKYA 4CNOA 5M1TA 3LRMA 3QV7A 2CBVA 3O6AA 1CT5A 1XD1A 1VBJA 3IIZA 3WNLA 4UR7A 1A49A 3S2LA 2YB4A 4QJ1A 3W6LA 2V38A 4FX7A 3SZ8A 3E96A 3HQ1A 1SVDA 3FFSA 3LGGA 1XRTA 1V6TA 1I60A 3DN5A 4MF4A 1U30A 4AZGA 3BQ6A 3ZVHB 4P7OA 3GXNA 3NAVA 4S3GA 1BHGA 4Z1DA 2V67A 1KFJA 2P1FA 5L9FA 1N82A 3NTYA 1W3LA 1O68A 2TODA 3WBXA 2J25A 4WXZA 2Z1SA 4D6DA 1H0IA 4TR9A 4JIQA 3PJUA 5FJRA 1EO5A 3PBGA 4ATLA 1QVBA 1BRLA 2VEIA 3P61A 3NGFA 4UC5A 2NT1A 3T05A 3GDMA 1FDYA 1XQLA 5XIAA 1LBMA 3HGOA 4GZEA 4C7FA 3AHVA 3W84A 3WJXA 2FJUB 1NDWA 3UVIA 3QM3A 2F38A 5LGZA 2D3NA 3OG2A 4LYQA 4IMAA 3R11A 1UP0A 3SJ3A 2PZNA 3DFPA 3P5YA 1JCTA 3MW7A 4GGHA 2DP3A 2RDWA 3LCHA 1N2VA 1Q7QA 1UD6A 3VC5A 3B0PA 4MNKA 5A2BA 2W91A 5FJIA 2VZOA 2PWDA 1Q6RA 1WUEA 5F4XA 3AC0A 4RE4A 1E56A 1E6QM 2NLIA 3POHA 1O95A 4HCDA 4L1WA 1PIIA 1QI5A 1WZKA 3PTQA 3QHMA 4UWMA 4MB1A 3E0IA 1OY0A 3LXCA 1AQHA 3UY8A 1PZ1A 4O1EA 4NJHA 3TYUA 2I9UA 5T26A 3DAQA 2TMDA 4TV6A 5HPCA 4NYYA 4RZBA 5HWMA 2F9RA 2O4QA 4KCWA 3WELA 3QBUA 4DRSA 1SSDA 3ANUA 5F1VA 2OJPA 1ZSXA 1E1EA 1VR6A 3IIVA 3VGEA 2I9EA 4CQCA 2GK1B 3MMUA 1B3VA 4XIAA 4HNLA 1F6YA 5A8MA 2TRSA 3KE0A 1LOLA 2WV8A 4A3HA 3VDCA 4ASTA 1XC6A 3PWIA 3WD4A 2WAGA 1KM0A 3G1VA 1YNPA 3WYZA 4J3ZA 2NSXA 1LRTA 3FJ6A 5DFAA 2Z7KA 5CPMA 2YDQA 4DZ5A 3HO8A 1E55A 1OX4A 5FJTA 4RE3A 1VJIA 4Y6GA 3WD2A 4C5YA 4P7RA 3CUFA 3O1NA 4LS0A 1VKFA 4WGXA 3W70A 2YCKX 4HHHA 4OWGA 1KFWA 4KW2A 2QIWA 5I5RA 1PZ0A 5E1QA 1JXJA 3GU1A 1ZY9A 1TWZA 4A3QA 1HJWA 5JUVA 1MDLA 3RG6A 2VCCA 3E12A 5BXRA 4NKCA 2QCHA 2NQZA 3R25A 4HPNA 3LLXA 4IQJA 4C1KA 2WHKA 1PSCA 3KVMA 2Z4GA 2CKSA 3W7RA 3HIJA 1RLCL 1X96A 3WZ0E 1PB0A 3IVTA 4M6PA 3DEQA 4DO7A 4N9CA 4A8RA 1C3FA 2PP3A 3KBSA 4HKPA 1S46A 4MZ8A 1XLAA 2NX1A 2GZXA 3MDWA 3VIJA 4GYPC 4CEXC 3CMJA 1QR7A 5IDZA 4MAVA 2AMGA 3AS1A 4LUSB 3WDRA 4ZZ9A 4O57A 3WF2A 4ERIA 2XIJA 2WZHA 3GDLA 5CSSA 1BEUA 3S1XA 3FVDA 4RV3A 3WLJA 1V3LA 5KSWA 3BLIA 3ITTA 3QPYA 3ICJA 1VFOA 2C14A 4R5EA 1UP3A 4DI8A 4JXCA 6XIMA 3FKKA 2DZSA 4PB5A 1LORA 2JIWA 1VIZA 1XYLA 1OCQA 1B5TA 5EMJA 2ZE0A 3W7JA 1RA0A 3GUGA 1O7AA 2XG9A 4RV8A 1AMKA 4P8XA 4LX4A 2Y5SA 1E6NA 3STCA 3W85A 3CASA 1NU5A 3S1VA 1E70M 1OC7A 3G1YA 2FZDA 1KRAC 3DHPA 3VMPA 3LMZA 2C15A 3MA8A 4GQGA 2PBOA 3UR8A 5C8BB 2W6RA 4C5ZA 3FNDA 4LAOA 1VPXA 1IR2A 1V6VA 2ZKMX 2YA1A 1XD0A 1OYBA 4AG0A 1WPCA 1UMYA 5M3WA 3VNJA 1KBLA 1LQ0A 2FHBA 1GOMA 4BQ2A 1R7AA 3P60A 2P3ZA 3VZZA 1AH4A 1UJQA 4J7RA 5AYBA 3WQDA 4FXSA 4MY8A 4JDBA 1K9TA 3S1GA 4UFHA 5DMLA 1G0CA 4QP0A 4KGLA 2A5HA 4ZE5A 1GQNA 2A79A 1EJRC 4QDPA 3TTYA 4JTIA 3NPWA 1S2AA 3K8MA 3EDJA 4B90A 4GH3A 3I10A 4ZSTA 2BFGA 4M6QA 2ZRYA 2A3CA 2Y7GA 3SCOA 4IJRA 3AYSA 1PKLA 1Q7ZA 3DECA 3VE7A 1WKFA 4W8LA 4KRZA 3EX6A 4HA0A 3UA3A 3KOXA 4S2CA 2AL1A 1YPFA 3W6YA 2YLLA 1RV8A 2DU2A 4BI5A 2QKFA 4E38A 2F6XA 3WJWA 1T99A 3N73A 1AQMA 1PWMA 5FJUA 4WSJA 1OINA 3U4AA 2PD5A 3NVDA 3W7LA 5G5IA 4HK5A 9XIAA 2ODOA 2EHHA 2HISA 3PZMA 3LHVA 1RSCA 2ZVRA 2PDQA 4L4MA 2DH2A 3EMCA 4H01A 2SFPA 1A5SA 3QLDA 4ES4A 2EG8A 4MNJA 4H1ZA 4JICA 1YADA 3MDUA 3TR9A 3WMSA 3HM7A 3PZUA 3O0FA 3VX1A 1K70A 4LB4A 3UR2A 3MKKA 1TJRA 2PAJA 3ID7A 4S3JA 2CETA 2BXZA 3IV3A 1M7JA 3MZ2A 4W88A 1NAL1 4DNHA 3GH5A 5D2VA 4WZHA 3TNOA 1XLEA 2VX4A 1J01A 2E5DA 2OYKA 1ITCA 2XIIA 3H2NA 1XLBA 3LSBA 4UBPC 1B90A 1SZEA 4AY1A 4W93A 1SGJA 2J9XA 2Y1HA 1XYAA 3PPHA 1DIDA 3O16A 3GR4A 4V28A 1E1CB 2OYLA 3ATZA 3ATYA 4US6A 4BS0A 4ZEPA 3GTNA 1L6FA 4HYVA 2XFWA 4P7LA 2XTKA 4DAFA 4WOZA 3EXRA 4M6VA 3EDEA 4OU1A 3OEXA 4O8AA 3CMFA 4TMCA 4DWSC 5I3IA 4GUFA 1O1ZA 2TSYA 3KRZA 2E6AA 3DFTA 5HMDA 5AHMA 5A3HA 4XZNX 5C2XA 2GL5A 2QIIA 1LL4A 2VOMA 1BWKA 3GKAA 4NU7A 4CN1A 4FK9A 3FA5A 2EKGA 2GQAA 3I6TA 3NDOA 4Q4SA 1JIBA 4QS6A 3JR2A 3LDVA 1SO6A 4XZMX 4Z1BA 3GE7A 1HGWA 1NJJA 3L4ZA 2XSBA 1IEQA 3GXIA 2ZRUA 3WNPA 5MKGB 3S2JA 3OPSA 4F66A 1GONA 3CL6A 3SRHA 1OC6A 3DCPA 3LTSA 2ADAA 2WM0A 1IEVA 2OWWA 2FGBA 3VOHA 1XYBA 3COTA 3TA6A 4AWEA 3VDBA 5I3GA 2G4JA 4KEZA 4CQAA 2GQ9A 2ZIDA 3EOLA 4CKQA 4NZJA 3GZAA 4JTLA 3V5FA 3GVGA 5DQPA 3DHUA 3PBYA 1NDZA 4JZ5A 1CGYA 1H50A 3NVTA 1NWSA 1W5QA 3EWZA 3L5AA 4AEOA 3H6OA 4V15A 1THFD 3WLPA 5AB3A 1OZMA 3N2TA 4AEFA 3P3BA 3ZT7A 4IXXA 4ML4A 2GVGA 4MJZA 3L0GA 4D1JA 2OO0A 4Z2IA 1XCXA 3G24A 4RK8A 3KRBA 3AYVA 5FL0A 3RAOA 4POCA 2IPGA 3AMKA 4ZXLA 4LV9A 5F7UA 3QKZA 2PGRA 2RJGA 3E0WA 1VFTA 4PFHA 4GKLA 1YDNA 3LPPA 1G9HA 1YEYA 3RJXA 7REQB 1FXQA 2W79A 4D8LA 3HBLA 1OG6A 3UYIA 1VCFA 4PUEA 1UBPC 2Z29A 2GJNA 1HT6A 4U10A 1PV8A 4XZBA 1W8GA 1OX6A 4W87A 2BODX 1QW8A 3ARSA 3ARTA 2PLCA 2V0TA 1YXYA 2PP0A 3MBFA 3NO1A 4IX0A 2W67A 1JR1A 1US2A 4HTYA 3WK2A 5MHBA 1XWYA 3PBMA 1W9PA 3U0HA 6REQB 3GG0A 3UA4A 5FA5A 6PTDA 2OZ3A 3KBVA 2J78A 2OSYA 2ZX8A 3CV7A 1D7FA 2BX7A 3H21A 5G1MA 3VUPA 5C9RA 3EDFA 1JGIA 3LCGA 3O6YX 5LSMA 5JH2A 3W7KA 1XBZA 2QUUA 2RKXA 1KKRA 3IANA 3N2BA 2XVNA 1HL9A 3E5PA 3VCRA 3TH6A 3MZNA 2VDHA 1SU5A 3S2NA 4DBDA 1CPUA 3EKLA 2QV5A 1UUMA 4OE7A 1OFAA 3O06A 3VK5A 1JDDA 1YDVA 1GW1A 5GJNA 1M6JA 3B9NA 3EMQA 3VIOA 1BXNA 5LNVA 1ZL1A 3JW7A 3ZFHA 2PDLA 4JL2A 3G3MA 1KA9F 4X3ZA 3TA9A 1OBAA 5M17A 1WE5A 4B5VA 4K8EA 1V3MA 4JTRA 3LRKA 3MANA 3H24A 4F8XA 3G1AA 3H54A 3B8UA 3OGSA 3G8EA 2WQDA 3VD5A 2Y8VA 3VU2A 5EMUA 4GNKB 5I06A 4JFUA 2CYGA 4MKVA 2VZUA 5DLCA 3W1AA 3GKFA 4HPGA 2PDCA 3PTKA 2PDKA 1W3HA 3UZWA 3PTDA 5CSYA 4Y96A 1GOXA 3N19B 3CLWA 4UNLA 1HKJA 3VIMA 2PDHA 3E5BA 4FHAA 3WJZA 3GIYA 4GOAA 2JQXA 3D0CA 3R94A 1ZALA 5H1WA 3Q65A 3LPGA 3N2OA 4JCMA 3O15A 3NQDA 1QHZA 3PPGA 1EYEA 1PZ2A 2WJFA 2HV5A 1PTDA 1J10A 1AD1A 1TTPA 5G2IA 4R7OA 1NWTA 3FAXA 4PBEA 1CI1A 3GX9A 4GPNA 4XVDA 2ZUWA 4HT3A 3THAA 3KM8A 3THQA 3T9PA 1BVZA 5BROA 4UTTC 1VZWA 1H4PA 1FP9A 2Y7FA 4K3ZA 1KW1A 1YW1A 5CPNA 2CIPA 5AN7A 3REQA 1R9XA 3HJZA 2C79A 2NXIA 4H9UA 1WXJA 4QISA 1JUEA 1XPGA 3TFXA 4D8AA 1Q6LA 3F5KA 4GMEA 4EACA 2QJIA 3CZLA 2BHZA 2Z1WA 3R5EA 4DJEC 4K37A 2WNZA 2REQB 1ITUA 3WLHA 4MZ1A 2PU1A 3K13A 3EYPA 4LY4A 3TXZA 3AUJA 3VKCA 2FDMA 3VDHA 1H41A 4C6OA 1JXKA 4R85A 3R10A 3HURA 1MW1A 4ZE4A 3S83A 2X30A 1QJWA 1B3OA 2HS8A 3ITVA 3GHSA 3OJGA 3WSUA 4KEVA 3O2LA 2QDDA 1EHNA 3V75A 3T0TA 3LCIA 3N2XA 4RL3A 3L9CA 4I7WA 4NRSA 2F2KA 1TQXA 1IWPA 3WLSA 3BJFA 1RD6A 3W22A 2VFEA 4JFWA 2G3NA 4LJ3A 4Y9MA 1KXQA 1HJSA 4LU0A 2VGBA 1KTCA 1SUXA 4YNGA 2Z00A 4GD0A 4KMQA 3FV9A 1L6WA 3L4XA 4IGSA 1GYMA 3B4UA 1H09A 3TC6A 3E2QA 4K39A 3A12A 4G9PA 3SAZA 1VIWA 4IMDA 2W5FA 3IJIA 1L8PA 1H49A 4IMCA 3O07A 2BTMA 1NOUA 5JH1A 3QSRA 5EU9A 3WQWA 1BSIA 3AICA 3S3GA 3OGVA 2DQWA 4IPLA 2OYMA 4FEZA 2FPYA 3T1GA 1OGSA 3C2OA 2P0IA 4JL1A 4J5NA 4IWWA 4PUMA 1YDYA 3M0VA 5LZLA 3VYLA 2OEJA 3L67A 3T09A 4O0KA 3Q37A 2FFIA 3PNZA 4UTMA 1VENA 4IPIA 5AC6A 3ZR6A 3ALFA 1DTUA 2OZ8A 4Z08A 1VFUA 3ALGA 3TN3A 1Q8AA 4B5NA 2WVTA 3BQ5A 1T96A 3TUUA 1RH9A 4QCEA 1G7UA 3TN5A 2BY1A 3WQEA 4XB3A 1P5BA 4O1AA 1QNOA 1EJVC 4YJ5A 3WL0A 3R12A 4EXBA 2O4MA 4JTCA 4S23A 2BXYA 2WC7A 3N15A 4HN8A 1TJ1A 1UKOA 2C19A 1PXGA 4D6CA 4W7VA 4HB7A 1SYTA 4NZCA 2GWGA 4UTWA 2ZZ3A 4Z2KA 3P5ZA 4U2ZA 4AHQA 2H3DA 5ABGA 4GO8A 2ZDRA 2OB3A 2ABAA 1G1YA 4EP8C 1P1MA 2BLEA 4QDMA 3RYSA 1EJ7L 4AMCA 3EOEA 1XW8A 1CLVA 4OUEA 3S4TA 2C3ZA 3FLUA 1PTGA 4AVOA 4LC8A 3LRLA 3UETA 3BGAA 3EDKA 4TOQA 3LXAA 4IP4A 1GK8A 3MCMA 2V63A 4AZHA 3CT7A 3LTPA 1XICA 2P88A 2O9OA 2WJZA 4GVHA 3R79A 3Q2DA 1BD0A 4Q32A 2CZFA 4JKLA 3T8LA 1ODZA 1UR9A 1VEOA 4JN6A 4DAIA 5C6MA 4Q8PA 3QTPA 2J7GA 2VEMA 4FPSA 5LNUA 3SGZA 3OP2A 2J7CA 5ECVA 4AZ6A 3BLKA 3WLTA 4OTKA 3G3DA 3M0KA 4EPDC 3ABXA 4QJ3B 1JZ5A 3BMXA 1AJ2A 4LAMA 2NUYA 3F5LA 4HNCA 1REQB 2PDUA 3L2MA 2V30A 1ISXA 2YL6A 2C0HA 1E6RA 4AYGA 3HPFA 1QDSA 2DQXA 1W37A 1S2VA 4AZCA 5BOEA 3VKKA 4Q8VA 3PNUA 1UZHA 4M19A 2Z1KA 3P82A 4QG9A 5LYRA 1OG0A 1VHNA 4C1LA 4MB4A 1IEXA 3VCCA 1REQA 1CW2A 2PCQA 1OJXA 2DORA 4QAWA 1OADA 1V0LA 2DIKA 1IYXA 4KEMA 1MFUA 5HJXA 4M7SA 1L2UA 4IJCA 4JEQA 5LA1A 3GTIA 4BHYA 5FIPA 1ML1A 1J11A 5LA2A 4HHPA 2HZGA 4CNTA 2PDBA 1NFPA 1E15A 4GCAA 5DCEA 1M65A 3RITA 4FB7A 3D46A 1CYGA 4HQVA 3W86A 3CPGA 4I9AA 3TP4A 4CN4A 4DPQA 3CTLA 3UPMA 5DXXA 5I03A 1I1WA 1KRMA 3DC0A 5HMSA 3B0XA 1UC5A 4V1XA 1EP1A 4F0KA 4QFUA 3CNYA 3CC1A 3WFZA 1WZLA 1TE1A 4HBKA 5I77A 4ZOEA 4PA8A 1NDVA 4ACZB 5A6SA 3TE9A 2VURA 2WM1A 4R88A 3EA3A 2ESCA 1JI2A 4J1OA 3AI0A 2H8ZA 4F79A 3FA4A 3JUGA 5E5CA 3LNMA 1ADSA 1AL7A 2QCEA 2CKRA 2V5KA 3TK7A 1G4EA 4IUGA 1H5VA 3MI2A 5EB8A 3DFHA 1Q5MA 4O15A 3RX4A 4QLKA 5CZJA 2GJLA 4YTTA 5C71A 3S5NA 1V6YA 1FY6A 3FSUA 4NX0A 3ITGA 4U3CA 4XWUA 3MB9A 1DWHM 2PDIA 2CZEA 3W87A 3QVQA 1OFDA 3D47A 5ECUA 4EXAA 1HQTA 1EQCA 2PUZA 1XLMA 2OT1A 1V3KA 4H7CA 2A21A 1GKRA 4PMVA 1GEHA 2EJAA 3OIHA 3QJAA 2CBUA 2R24A 5I3HA 4GACA 4HK6A 1KRBC 3QOKA 5HANA 2JFEX 5GNZA 5CPQA 2DVXA 3NO3A 4Z0JA 1UWIA 2QW5A 3WJSA 5BRBA 4JN8A 4M1BA 3WN6A 3G1RA 4AD2A 3II1A 2ZZ7A 3BICA 4AISA 2YW3A 4J2PA 2FZ8A 3AMGA 1AVAA 1PIFA 3W26A 1LWHA 1S5WA 2CWNA 2WKGA 4ZO6A 1W32A 3QV6A 4HOZA 4DF2A 2YKKA 1M7PA 6TAAA 4REQA 3W00A 4S2BA 4ACYA 1B3YA 4CN6A 2QVHA 1Y8BA 2J79A 3C0QA 3OVRA 5HUOA 3TONA 3CZGA 4H8UA 1C92A 4EX4A 3RGTA 3ZM8A 1DJIA 1Q2SA 3P0XA 3ONCA 5A5WA 4PMNA 3DESA 2DVUA 3ARVA 3ZVIA 3ZOAA 4O18A 4G8TA 1GG1A 4BY3A 2QJGA 4XZLX 3VOJA 3BOFA 2QUMA 2XVLA 2QZRA 1XINA 3QV8A 3LERA 2X0YA 4IH3A 1TV7A 4G1KA 4YL2A 1ZAHA 1QTWA 1W56A 4HNUA 2NUXA 1TZZA 1J79A 1JYNA 3EGJA 2VX7A 4JTAA 3NXFA 5B7ZA 1MEIA 3NA8A 1UMLA 5A6MA 4AZIA 3BJTA 3GVVA 3LMYA 5HNTA 1D3HA 3OVPA 4JOMA 4GNVA 4PUJA 2XH7A 4BF9A 1DE5A 3W6MA 3URBA 1R6WA 2YPIA 3W53A 4J28A 3P8JA 1V6WA 3U2ZA 4GIAA 5C7HA 4J3TA 3B4YA 4U3AA 4ZR8A 4J27A 1VYRA 3GG1A 1EZ2A 2WCAA 1UHVA 2IPFA 2VEGA 5PTDA 1WDPA 2JE8A 1JCXA 3KRUA 1U83A 5DY3A 4GZ7A 2Z24A 2PGFA 1ISWA 5C55A 2PLKA 3WLMA 5RUBA 2YB1A 5HUPA 4UTFA 3H4WA 1TWSA 3ZZ1A 4H3DA 2ZZ5A 4J3VA 4I8YA 4LVGA 3AAMA 5K9CA 1FXPA 3VIKA 4JCLA 4GNJA 3H2EA 3NPUA 3MYOA 3F7JA 1NFGA 1UD5A 1X6LA 4ADTA 3NDZA 2OOGA 1H1ZA 4MWAB 4BF7A 4D6JA 1F6KA 5D8ZA 4NZFA 3WDQA 4AVFA 1CBGA 1XSIA 4M6UA 1F8MA 3QR0A 1BYBA 1HO4A 4DO6A 3IWPA 1KXTA 2OWXA 3GNXA 1Q6CA 2VFHA 4HU0A 3WNKA 3CPUA 1ECEA 3CLMA 1UW9A 1NF0A 3MC5A 1U22A 8A3HA 3VFCA 3EOSA 3I3EA 1OB0A 2XH0A 2E5BA 1JVNA 1Z48A 5I2UA 1MFVA 4JIHA 4RXGA 4WXYA 1UIOA 4QSFA 2ZXDA 4PYSA 1Y65A 3PY2A 1OCNA 3ELFA 5A6LA 3OZMA 1Z41A 3WQPA 3CT2A 5BOFA 5A95A 5KZEA 3M6DA 1JPIA 3DIPA 2FVLA 1VLIA 4LOCA 3ZR4A 1K8XA 4ROPA 5I78A 5K7JA 3T2QA 2G0WA 3FJNA 3QQ0A 1Y5VA 2ZCGA 4BQ3A 4RKAA 1S2UA 4JD4A 5DMMA 3W1PA 4WSHA 4KPLA 4GUIA 3GHTA 1KFBA 5D38A 1ODUA 5CJ5A 4IP5A 5E93A 4C6MA 2OGJA 5HINA 2Z2BA 3LPFA 1MSSA 3A5FA 1A0DA 3LLDA 1C8QA 4NIRA 1I8JA 2EPHA 2Z2UA 2OX1A 2G8ZA 3GHUA 2WCGA 1D3GA 2ZUTA 3TZNA 1YTEA 3OB8A 3THDA 2GOKA 2EPKX 4X9YA 2D1ZA 3NL3A 2XZ7A 3QMSA 4H9TA 3LCLA 1QUMA 4GUGA 5BMWA 3U9IA 4H41A 2IKJA 4GQQA 3PFRA 4C60A 2ZDSA 5U7SA 4LSBA 2VZSA 5CBBA 1DTNA 1UR1A 2D2HA 3OQ8A 3CJPA 5JU6A 1EH9A 4M3PA 2OKTA 2G4FA 1V4YA 1NOFA 2PP1A 3IAPA 3M0YA 1EKOA 2R1MA 2FGLA 4L7ZA 5K3VA 1ZAJA 4LEQA 1M5WA 4AXNA 3E3HA 4CD5A 1PWLA 3GYCA 3IJQA 1ONWA 5LIWX 2PWGA 1EWDA 1TV8A 1V3HA 2FLIA 3H7VA 3EWBX 4R33A 4IX2A 1AW1A 3LSCA 3T7VA 1N55A 1R7OA 1P0KA 3HF3A 1TCDA 3CQ0A 1HO1A 2PLJA 4ZOAA 1RBLA 1K8YA 4PMRA 1ITXA 3QH2A 3QRHA 1UROA 3AZRA 4NF7A 2QR6A 1KCLA 2P10A 3CAKA 1DHKA 4D2JA 4W85A 4GC3A 4QBXA 3BSGA 4AIBA 4W9TA 3QKEA 4EOUA 1M7XA 2C6QA 1DJWA 4F0RA 4GHRA 1V02A 3JS3A 1R3RA 4E4PA 3H26A 4S3CA 3VXGA 3KP0A 4LYPA 2ACQA 4GX9A 1R2SA 2DSKA 2ANUA 1IGSA 3TN6A 3W7HA 1O5QA 3G77A 5EL1A 1WCGA 2W66A 1J0KA 1QO5A 2J75A 3R1ZA 3BGJA 4PRRA 1HJQA 1TWDA 1Z44A 1NEYA 1H60A 4O50A 1VCGA 3CL7A 3HGSA 2A6NA 1FWDC 5MKGA 1DWIM 3L21A 4KESA 3YPIA 4DLMA 3S47A 4S3KA 5I02A 2OSWA 2VXNA 2B7PA 4TMBA 2RAGA 1M41A 3ZYZA 1QI2A 4R27A 4LBUA 2Z1VA 3T55A 4A35A 4UTLA 1OK4A 3QC0A 5CZTA 4WD0A 3VILA 1AW5A 1RVKA 2WWCA 3W28A 2BG5A 1QPNA 3CQIA 4R3UA 3CHCA 4E2OA 2C1HA 1O94A 2X7WA 4NAFA 3MQTA 1TZ9A 1SO3A 2B7OA 3OA3A 3LQLA 2EKCA 3AIBA 3REQB 2DH3A 1OVDA 4N9DA 4PUKA 4N0RA 4LYRA 4LRSA 2Y24A 3CYVA 1GQKA 4WX2A 1GJPA 1X7FA 1O4UA 4MVAA 4JPGA 1SSGA 1HJVA 3PFMA 1BVNP 2EPOA 1UYQA 1E51A 1NARA 2V6AA 3B06A 2FZ9A 1BKHA 1P1XA 4GUHA 1UH3A 4Y9OA 4LUSA 5DRIA 2NX9A 2X09A 5I0DA 4QSHA 1QMLA 3KDNA 4AIUA 3AIEA 3ZVHA 1EJSC 1ZFJA 5E6YA 3NQGA 1G4TA 5LXEA 4NL1A 3WD3A 2ZA3A 1H7NA 2V2CA 3R0DA 2FTYA 2AMXA 1V08A 2JK2A 3PZGA 3SN4A 3VD7A 4WJ8A 2ZZ1A 3W7GA 2Z2AA 3C3UA 3R2GA 2WJEA 2TYSA 4P7NA 1FWRA 2V3FA 4Q4OA 1P7TA 3STFA 2HROA 4B9ZA 2HWGA 1F9CA 3EWUA 2ZX9A 3UW6A 1KM6A 3WBWA 4RX0A 4S3FA 5CCZA 3WLKX 2D2OA 2ATSA 5AYXA 2EXOA 4XUYA 2PFHA 3KX6A 4ML9A 1HN1A 1UUQA 1WDDA 4FNPA 3K1DA 2UZ9A 2Y8UA 2Z27A 4H6QA 5FEZA 1GVIA 4PCTA 4LS2A 3S46A 1QNVA 2GVEA 7ENLA 1OYAA 1BYDA 1POJA 3DI1A 4E3VA 3TCEA 1E6SM 1MEHA 2Y70A 4OV4A 4K68A 3ITYA 4DZHA 1W91A 3HTWA 2NUWA 1E9ZB 4HNOA 4Z1CA 3VI2A 1TV3A 3V4BA 4RNIA 6ENLA 4OOUA 1DYSA 1HP5A 3LI0A 4S3EA 4A2SA 2CLKA 1SW3A 2VC7A 3C5QA 1OCBA 5I24A 1W9UA 2JEQA 2ZFAA 4L56A 5D2XA 1FH9A 2CNCA 4HYRA 5EMYA 3T78A 1EUNA 3CXOA 5JXQA 1KXHA 4QE4A 1S39A 2WMKA 2F84A 4GFIA 1GOKA 5G2HA 4O12A 1M3UA 1E0UA 7TIMA 3M41A 1R30A 5E0FA 5MF5A 1B3WA 3CPRA 4F0HA 2DJXA 1JF6A 1I2NA 3BK0A 2PTXA 4GY7A 4QTGA 1U33A 4GQ0A 3WQFA 4LNYA 4WY0A 2YIHA 5F4WA 1Z7AA 2RJHA 1XP3A 2XN0A 3SURA 4BQ4A 1E9LA 4HOXA 2FMNA 1ZBCA 4MB5A 3IIPA 3UXKA 4O0ZA 1GZJA 3O05A 2Z0IA 1PX3A 1OZQA 3P14A 4GG9A 4I7VA 3EB3A 3QZEA 1I0DA 2HBXA 2WSPA 4UMCA 3SCVA 1WAUA 3KOYA 4KGJA 3A4JA 5K9XA 3AZTA 1TV5A 2PF8A 4AY7A 3VAVA 3GNOA 2B7QA 3S5SA 1QHOA 3WY1A 4CQDA 1B9BA 2W63A 2WC3A 2EO7A 4GWEA 1W1TA 1ICQA 2YYTA 1OYCA 4DM2A 3BAWA 2HNEA 3NQ7A 1F05A 4EWND 3C6CA 3CB3A 3ITLA 2PWEA 4AWSA 3GNRA 3IAQA 5G4HC 1GTHA 3B9AA 3OIXA 3ANYA 4OT7A 2Z1XA 1HTIA 3MUY1 1R85A 3T81A 1BYCA 4DWSD 3U5UA 4XZIA 1E73M 3BV4A 2F2HA 4JHZA 3OW1A 2VFIA 2A4AA 1RJQA 1J0IA 2UWFA 3LZ3A 3HU7A 4OHQA 3W7DA 1Q4WA 1JUBA 1KGUA 4L9XA 1V6UA 4C6LA 1Z69A 1KO0A 4B15A 1ZQ5A 4DY1A 4BA0A 3B0UX 1X6UA 1GW9A 3L5LA 1S2WA 1O66A 3AIWA 1XKJA 4B4FA 4Y8FA 1I6NA 4O1CA 4M82A 3ZXWA 1AQ0A 3NDYA 1K02A 3OZYA 1G6CA 1NWUA 3CO4A 1XCWA 3QOMA 4IIDA 4HZMA 3RUBL 1CCWB 1W1YA 1QWKA 3PR2A 1W1ZA 3PC0A 3GG8A 1QNQA 1KM3A 4IZGA 1XG4A 4YU1A 3C61A 4MLRA 3NM3A 2HJPA 4W8AA 4HMCA 3E0VA 4DEFA 4AY8A 3AJ7A 1US3A 1A53A 4XSLA 5EGRA 3PG8A 2VZTA 5HR6A 2DZUA 2IQ0A 1XQKA 2G3JA 3ECQA 3W01A 1M1BA 3M6YA 2INZA 3VNDA 2IPJA 4GINA 4DXVA 5DO8A 1JRCA 1ZAIA 4L4OA 4UUIA 3NZGA 3E2VA 4PMDA 1VEMA 5I3JA 4RZ4A 3GAKA 1CGUA 2WNNA 1OFQA 4M7TA 1DWGM 3E38A 2XFFA 5A8QA 2P3EA 4GQRA 3O63A 3VFLA 3MP3A 4U2YA 3PJTA 2W0UA 2YYUA 4XAFA 3RPMA 1OX4B 3DUGA 1UC4A 4UQ9A 1OF8A 2FTPA 4FNRA 4JQ1A 3D3AA 4JYFA 1RBOB 1E4MM 2WMGA 1ONEA 5C7VA 1KCZA 1MUMA 1HX0A 3MTWA 4PTDA 4H7ZA 3JRKA 1K9DA 3W23A 2IKGA 4DX3A 5SWUA 3THCA 4E0CA 2BY3A 1GNXA 3SN0A 1NF7A 3CWHA 3TN4A 2YW4A 1JDAA 3PK7A 2QF7A 4L9YA 4JFTA 3IV8A 3AFBA 3RU6A 4LCSA 4XQ6A 5FEPA 3KL0A 4A8IA 3AWNA 4V2XA 2YJQA 1ZP4A 5I6SA 4PCSA 5D2YA 3RFAA 3VKDA 1ZJIA 3ZMRA 3WQ4A 4PSRA 1IXOA 1O5XA 2GGIA 2ISFA 2O9TA 3DH7A 3B8IA 3WL1A 2ACUA 2Y62A 3ARYA 3TV8A 2XINA 3RNDA 3K2GA 1T41A 3F4NA 1AG1O 1RK6A 1UR0A 1YQ2A 2VELA 1NVMA 3A22A 4I5XA 3LEPA 2QPXA 5FD0A 1I0BA 1KGXA 3BC9A 2Y88A 3MUXA 4NG3A 4ZB5A 2PCEA 4CVWA 2VCBA 3E9AA 1R87A 1CXIA 1Y5WA 2GLKA 3G1XA 5I79A 1A5MC 4RLIA 3W88A 4UIOA 1TYGA 4EK7A 1OCJA 4GYFA 4OKDA 1XGEA 4CVUA 2GSJA 2GGGA 2PWFA 4CD6A 3TTSA 4GI4A 3F4DA 4IMGA 2P50A 2R94A 3GDTA 1X1NA 3UWYA 4BI7A 3EWWA 3GXTA 4TTUA 3S5ZA 4LXFA 4Q7BA 3BAXA 8XIAA 1GJUA 1G69A 4GXMA 1KB3A 3H55A 4OBTA 3ITOA 1P43A 4UTJA 4Y90A 4JKMA 1FCBA 3IGXA 1I9CB 3W1XA 3WH8A 3A3XA 4F3HA 4W5ZA 1LRQA 1J18A 3FS2A 3JVAA 1S1PA 4F0LA 1JYVA 3UZYA 3HGJA 1YE6A 4QDWA 5HQEA 4LVFA 2HE8A 4XUGA 2BZNA 3JZEA 5DANA 3IUHA 2CPUA 5ABFA 4MIMA 2H90A 3UCCA 5EBAA 2A2IA 3A4AA 2GFTA 1UH2A 1HVXA 2EBNA 3BG5A 1QAPA 3CIWA 1TX2A 2AAMA 3KHJA 1MMFA 1O6IA 4PRTA 1S1RA 1BLIA 4B5WA 2GUYA 3KWXA 3HG4A 4US5D 1XIJA 4QX4A 4FA3A 2J8GA 1U5VA 2WVVA 3R7MA 5FI8A 2VYOA 3BSMA 1JDFA 3HV8A 2VD8A 4PC8A 1LLWA 1XBXA 2H3BA 4MWAD 2A3AA 2R14A 1HL8A 3VDGA 5FF4A 4UQCA 2YLAA 1BVWA 3PZTA 3HPSA 4UOQA 4L6DA 1TO3A 4XAYA 2IS7A 2NZLA 1AD4A 2PTDA 3B8WA 3WCZA 3EZ4A 1M01A 1DEDA 4L6OA 3NL2A 1AFSA 2OLSA 2YL8A 5LHFA 3P62A 3EBVA 4C6QA 4AF0A 1FOBA 2JGYA 3N17A 1KV5A 3QHNA 4MLJA 1DKWA 3TMLA 3I4KA 1VFHA 1HKIA 2OLHA 2E09A 3OLIA 1V5XA 3EPNA 1EHAA 1IR1A 5AC5A 3NQ8A 1HW6A 5LHEA 1QHPA 2YFOA 1DWFM 2PDFA 3BLOA 4DLFA 5C9UA 3DBPA 3ES7A 1O5RA 2QVNA 1PX8A 1P0NA 3A5VA 2VFFA 3WEMA 4YTRA 3WLOA 2X2YA 4H8VA 1EX5A 1UKSA 4NRRA 3N3TA 3EWCA 1I2QA 3UXIA 3XINA 3EAUA 4O11A 3F2CA 1OK6A 1S5VA 3UY7A 1V7YA 3OBEA 4RR4A 3KEHA 3C0LA 4IG2B 2ZXQA 1WZAA 2NQLA 4B9YA 2NSOA 2VHLA 4IP7A 4ZODA 1EDGA 1E9IA 4DJDD 4H6EA 2RFGA 3V1HA 2V8ZA 2Y8KA 1OHLA 1UCWA 1JFXA 1V03A 4IGHA 4NVTA 5IM51 3CUHA 3CB8A 5A6BA 4PEKA 2A3HA 3W0KA 2QDEA 4CU6A 2A1YA 2PRMA 5E0KA 5A6KA 4J3UA 4CD8A 1S3TC 3BLEA 4RDVA 3I65A 2BVWA 2VGGA 5C5YA 2X7VA 1XYMA 1XLGA 3NXLA 4AHOA 1ME7A 6ALDA 2OCZA 1YNYA 4NAFB 2CBIA 3VE9A 3RCMA 4GE8A 1RBAA 3H7RA 1EDQA 1W9BM 3GS6A 4DJFA 3PUDA 2GDUA 3KCLA 5A6AA 1TE6A 3VKBA 1GKQA 2O56A 4E2DA 4DWSA 3GVRA 3PPFA 3G0SA 5DMYA 5CZSA 4DI9A 4LANA 1JZ6A 2ZTJA 3T8QA 3S6TA 2NXGA 3QGKC 1GCYA 2F8QA 4ECLA 4Q8TA 1SW7A 3KLLA 2F61A 3W38A 1ZB5A 3ARPA 3H7UA 1V93A 3TTQA 2PWHA 3PAOA 4JKKA 1XX1A 2TPSA 2FIQA 1Q6DA 2VVNA 2VENA 1P0EA 2PDPA 3N25A 2PURA 3PANA 2A3EA 3OG3A 2HEJA 4DZAA 1D8CA 1OIFA 1QFEA 4C6EA 3UWQA 2Q3RA 1ICPA 2MANA 2IMRA 1WO2A 1V51A 1W3TA 4MUZA 4CQ9A 4O4VA 1K77A 1WKDA 3DU0A 1EC9A 2KX9A 2ON3A 1XIFA 1JNDA 3DHFA 4XBKA 2R1NA 4PUNA 1QO2A 1TV4A 5CG7A 3ZO9A 1DWJM 2QAPA 4HZ8A 1U5JA 1OT2A 2ZA1A 3B8VA 1J2BA 2L5HA 1A5NC 1R3QA 3IVUA 1F74A 1GVFA 3RM8A 1Q6FA 2G97A 2J6VA 3DFQA 3QSTA 2I14A 5GJMA 3WMCA 4I9MA 3SCSA 2ZZ2A 1LG2A 4GUJA 1BAGA 1KM5A 3TLQA 1O60A 2ZYFA 3N12A 4I3GA 1KQYA 5DX7A 1WDQA 3GU9A 3FVMA 3AIVA 4LUJA 3W2NA 1UP2A 4TV5A 1DJGA 2YDSA 2R1KA 4FXRA 1Q65A 2ACRA 1XRSA 1UZ4A 4I90A 4JR5A 2H9AA 2FJKA 4GXWA 4CEUC 2Q01A 1B2YA 1EEPA 4DUVA 2E40A 1ZENA 4LVBA 3FYPA 2WSRA 1F76A 3WBEA 1E5JA 5EPDA 5BOOA 1A50A 4GI9A 5AC7A 3RLVA 3AMDA 4K8GA 4FLOA 1EP3A 2C0AA 3UQNA 4C6IA 2D3LA 5FF3A 2NWSA 5IRPA 5D2TA 2PDGA 4DZIA 2PC8A 3B0VC 2QMJA 4F0MA 3W1MA 4A3YA 2FQIA 3AIQA 1M68A 4RXFA 3M0XA 5AHFA 2D0GA 4TIMA 1E6XM 4J3WA 3RMJA 2HPMA 4KS0A 2J47A 4QNEA 3OZOA 5LGXA 3G1FA 4X61A 3W82A 1TTJA 1VQTA 4P5UA 4BR1A 3W7EA 4YS1A 1NQ6A 1P6WA 2YXGA 5HQMA 3CL8A 4AD4A 2E7FA 3VOFA 4A4AA 4Y9PA 4X2RA 1KRCC 1VJZA 1TTQA 3B05A 4Z1YA 2YOCA 4HHMA 4NT0A 2GGEA 2UV8G 3UCQA 2VM8A 3N4FA 4AZ7A 4QCFA 1DJZA 1GHSA 2CC0A 5CBJA 3BANA 1TPVA 4TX6A 1UG6A 3TQPA 1XH2A 1IT0A 4PTXA 2VX6A 4NAEB 4O13A 1CZ1A 3CK5A 1B1YA 2O0TA 4ZQNA 1FDZA 3DYMA 4JNZA 2WHLA 4IL2A 5C2GA 4KF1A 3DOPA 4P2VA 1UZDA 2QCMA 3S5OA 5DF0A 3WH5A 1CGTA 1RD5A 2YGYA 5CAKA 2HCVA 3W4RA 1ZLPA 3EA1A 3WENA 3GO2A 3ISIX 1OGGA 4NI8A 4RCXA 5BZAA 4L6HA 2ZUUA 3W7OA 1UR8A 3ONBA 2BOEX 4G2DA 3HOJA 2HE5A 1DJHA 3VMNA 1EGZA 3HQNA 1PBGA 4W7WA 3T4CA 4FZIA 4OVXA 2DT1A 3DG7A 3K4AA 3D6NA 3G1HA 2ISDA 2XVGA 1VGAA 1LWJA 1RLDA 1KXVA 5JBFA 3FDKA 1PIGA 4ATWA 1QWGA 3GHRA 1E4NA 1E0XA 3SCNA 2VTFA 2JKPA 3DGBA 2HVNA 1HL2A 1UWUA 2CLEA 3W27A 3H23A 3WD1A 2DIJA 1MYRA 4K1WA 1PCWA 4ADUA 5ABFB 3W81A 1XV8A 1K8CA 1RQEA 2GJRA 3GDRA 3M0HA 4B3KA 3PZQA 3MUZ1 3P0WA 3DFSA 4HOWA 5AHNA 3SFKA 1JULA 2WMFA 2BY2A 2CWXA 3KVJA 2E68A 3IJ8A 9XIMA 2P8CA 1UWRA 3B0YA 5H91A 4E8GA 1XLDA 5IXEA 5TBOA 1HVQA 3V0SA 1I1XA 1DV7A 2X16A 2NVCA 3QZ6A 2P8BA 3PN8A 3NO5A 3FDGA 5F2IA 3M0MA 4NAEA 4HCLA 4FX6M 3PWGA 1DXEA 2I16A 2X05A 4PB3A 2P76A 1ZJAA 3DC8A 1FVPA 4JTQA 4LAZA 4UFIA 4KRTA 4OQVA 4FLRA 1A3HA 3L7RA 1FHUA 1XDJA 2BDQA 4TX8A 4GRSA 1EJUC 4AX7A 3AS3A 4GVIA 3M0LA 4WCJA 2X1SA 3DERA 3L12A 4AF0B 3BO9A 2DGAA 4J4KA 3HFTA 4UFLA 4ZL1A 4HA4A 1EA9C 4RDZA 3SJNA 1N7KA 5JQ9A 5FF0A 2NV1A 4GVGA 3B40A 1PTAA 2VMFA 3AYTA 3MI3A 4QE1A 1PJ9A 3GTHA 3FGCA 2RUSA 1IQ8A 4GGBA 1C91A 3IPWA 3WBYA 4DWSB 3IIXA 2WKJA 4JQAA 1UWTA 4XK2A 4QNWA 1FTXA 5AZ1A 1OQFA 4QQUA 1MNSA 1V6XA 3E2SA 4GI6A 1VYSX 3L23A 1W1IE 3FXGA 3G6LA 2HDJA 1L2QA 1YPIA 4N2YA 1IZKA 1VS1A 4IT1A 1JUKA 3INPA 1GJWA 3W74A 1Q66A 4MZYA 3M9YA 1NQKA 1XIMA 4ICCX 4XAZA 4WOQA 3U48A 1U2YA 4EWJA 4Z42C 3QQWA 4JYEA 4OOZA 5C9ZA 4MB3A 2XWDA 4UQBA 4D9PA 3BLFA 3G8RA 3LQGA 1ITQA 3HA1A 1B4KA 2OZTA 1LUCA 3WQOA 4CCDA 1TPH1 3BCFA 3FHAA 2QULA 3O6CA 1UWAA 5D05A 1VFLA 1SR0A 3V7PA 5CC7A 2PPGA 4O19A 1FCUA 5XIMA 2NVDA 3SQLA 4JIRA 1TTIA 1H63A 2V3DA 4WQ6A 3LGDA 4CU7A 2WBKA 2IQTA 4ZTXA 2OWCA 1A5KC 1P48A 1VRDA 1OD0A 3E49A 1NDYA 1WX0A 4L4PA 1E3XA 4O1DA 4PCFA 3BG3A 1E0VA 3LM3A 4IF2A 3CS2A 2I7GA 3UYCA 2FDSA 4ZCWA 3VOIA 5FSEC 4B16A 1K7XA 1FCQA 2CLPA 2XVKA 2Z28A 3ABRA 4IISA 3AS2A 3WLLA 4LUTA 1F3TA 3ABQA 4AYSA 3IUIA 4Y9AA 1XH1A 3TQKA 2YZRA 4BQ5A 4E8CA 3UXAA 1KQZA 5ABEA 4S3DA 4HNVA 4F9DA 4Q8QA 4DIAA 1IEIA 1ME8A 1DWAM 1YRRA 4O28A 1OIMA 1XLIA 2E4TA 1QPOA 2HRWA 4FR6A 3MWAA 3HPXA 2YXXA 4LUTB 2IUZA 1Q13A 1CXEA 3MO7A 4WF7A 4CGTA 3SY8A 1PS9A 2IPWA 4REQB 3S1UA 4CD7A 3CQJA 2WK2A 4K7YA 5XINA 2VL4A 1WXYA 3FIGA 1AJZA 1JQVA 3TROA 3H2FA 3FYOA 1GHRA 4DJFC 1F7BA 1IEWA 4KERA 2CLMA 4Q6XA 4FF5A 4H9VA 3SY5A 3SQSA 5FAGA 4KFNA 3CHDA 4QROA 4RJEA 4LVDA 1EIXA 4GIRA 1ISYA 3ES8A 3DFOA 2VC5A 3RM9A 2VWTA 1JCLA 4BZYA 3KRSA 3UVAA 4CD4A 4M56A 1DORA 3UG5A 4LW7A 3ITXA 3OO2A 2PBGA 1ADDA 1IWBA 4P7QA 1JGMA 3ZJ6A 2D69A 2CZ5A 1KM4A 4ORMA 1M03A 4AD5A 3KCOA 4ZSUA 1JCYA 3OYXA 1B3XA 4LAUA 3NQ2A 2Y63A 1CDGA 1IIHA 3VGFA 1MI3A 4FNQA 1V8EA 1UR2A 4X9SA 2QT3A 4JIIX 4K6AA 5IDIA 1JPMA 5KZMA 1OFBA 3LYEA