3TH6A

Crystal structure of triosephosphate isomerase from rhipicephalus (boophilus) microplus.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
247
structure length
244
Chain Sequence
ARRFCVGGNWKMHGSKNSIRDICNTLKGASLDPNVEVIVACPAPYLDYCRSLLPPSVALAAQNCYKVEQGAFTGEISPGMIKDCGGQWVILGHSERRHVFKEDDVLIGEKIKHALESGLNVIACIGELLEDREAGRTEEVCFRQIKHIASNVKDWSKVVIAYEPVWAIGTATPDQAQEVHSKVRNWLSTNVSADVASKVRIQYGGSVNAGNCKELGRKPDIDGFLVGGASLKPEFVQIINAMQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
publication title Structural and biochemical characterization of a recombinant triosephosphate isomerase from Rhipicephalus (Boophilus) microplus.
pubmed doi rcsb
source organism Rhipicephalus microplus
molecule tags Isomerase
total genus 90
structure length 244
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2011-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3th6A00
3ZS4A 1XFBA 4NNAA 4TO8A 3B03A 1TQJA 3TNOA 5D09A 3O1NA 1G4SA 4JNMA 3A23A 3R12A 4HSNA 1ONRA 4RZ6A 4TMCA 1DORA 3DU0A 4KFOA 3GDMA 3W1RA 3N34A 4KFPA 4ML9A 4AWUA 3UWWA 1OVDA 3O07A 1C8VA 1RVGA 3NR0A 2G95A 2J6XA 3T40A 2QUTA 4HPXA 3TW7A 3IV3A 3GDLA 3LOTA 2ZRWA 2V8ZA 2OT0A 2C1HA 1KV8A 3A5FA 3OIXA 4YCPA 1GYNA 4OT7A 4YLWA 1BTMA 3W1MA 2GVLA 2BZNA 3LCIA 1OFBA 4MUZA 3LCHA 1Q6QA 5DY3A 4AWSA 1PVNA 3C2FA 1LDCA 1IF2A 3F4NA 1TSIA 4Z0JA 1VJIA 5BNKA 1SPQA 3A24A 4D2JA 1OX4A 5E93A 4JTSA 3O06A 5AYZA 1YDVA 2ZFAA 4FF7A 3W73A 2TPSA 3R8RA 4UTMA 5I3GA 3GAYA 4LT9A 3KOFA 2YFOA 5CPLA 1I45A 2VFIA 4N4QA 5EKYA 5C6MA 4O54A 1JCJA 5AFDA 3C52A 2G96A 5HWNA 1IIGA 5D02A 3VI2A 3CM4A 3E96A 4BFAA 2JKAA 3M6YA 4EF8A 3UZ5A 5D30A 4JTKA 2J9YA 1F7BA 1T96A 2X1RA 3G1DA 3W1TA 2VFGA 5FEPA 1O5KA 3LRMA 2PRHA 1KM1A 3NAVA 3TV8A 2TSYA 5K4XA 1YADA 3UZJA 4UTJA 1X6UA 4GNJA 4MJZA 4FHAA 3CU2A 4UC5A 3H54A 1XL9A 5HUPA 3STFA 2NV1A 2QCDB 3PBWA 4M6VA 5DN1A 3MHUA 3G3DA 1PCKA 1WOBA 2ZZ5A 2PE4A 1C9DA 3NPWA 2QJGA 1XUUA 1GYLA 1K3UA 1A53A 2Q3RA 5U4NA 3W74A 4DF0A 3LV6A 1W3NA 2YGYA 3P84A 5D05A 4LRTA 2EAWA 4PH6A 5G4EA 2J9ZA 1TPFA 3MP3A 5LSMA 3BW3A 4GUIA 3O16A 3DFNA 1H7XA 4Q4KA 1K7EA 3FYPA 4FIQA 3B0PA 3TQKA 3V1PA 4K37A 3W1QA 5KTLA 1AG1O 1L6WA 4FNQA 3ABSA 1K8YA 8TIMA 1UB3A 3ANYA 3PUOA 4DF1A 1D9EA 3UY8A 4H4IA 3FFSA 3QM3A 3G1HA 1KW1A 2OJPA 5J5RA 3O05A 1YDNA 2A1YA 2DZPA 4LNYA 4I9AA 3NQ6A 5AB3A 1SSGA 2E5CA 2R14A 3MWAA 4LVBA 4DXVA 1W1ZA 3STEA 4UXDA 1KM6A 3PB0A 3AJXA 4IPJA 2ZZ7A 5D2XA 1YLVA 1FXQA 3PS7A 5D32A 1VS1A 4ALDA 1ZFJA 1TV7A 4NXKA 3STCA 5F4WA 4CQ8A 3TU9A 4RV8A 2Y7FA 2B0MA 4HHPA 4NJIA 3QMTA 4E2BA 1W5OA 1J2WA 3EWYA 5D38A 1IXQA 1QPRA 3INPA 3NO5A 3S5NA 3W7PA 3T7VA 4IX0A 1UASA 1LBMA 1A5AA 4TR9A 1JCNA 2FQIA 1H1YA 4RLIA 4E38A 2A2IA 3BLIA 3GYEA 3RLVA 1YTKA 3M5YA 2TMDA 1U83A 2TYSA 2F7FA 1JCLA 2OT1A 3O63A 1OYBA 1KFJA 5HWMA 1XKYA 2CU0A 2JKEA 2RFGA 4OU1A 1OX5A 3KX6A 4FX7A 2QJIA 2FJKA 4O8RA 4JN6A 1FX6A 1S5VA 3VE9A 4FIRA 4O17A 1R30A 1IXOA 4O18A 1H51A 1AL7A 2BSLA 2VEIA 1KLYA 4UFJA 4R34A 3EX6A 3GXTA 3MP4A 1KFLA 3BLEA 2Y63A 1W3IA 4RCXA 3HQ1A 2QDHA 3LTPA 1BEUA 1YYAA 2DJLA 5D37A 4JYDA 4LS2A 4UTLA 3LXCA 4WJEA 2YSWA 3WK0A 5LGZA 3A21A 5BMWA 4MVAA 1ZAHA 4YL2A 1M7PA 2DJXA 1MEWA 4QNEA 3U6WA 4WZHA 2ZZ3A 3TIMA 3UY7A 4AMAA 1TYGA 4UTWC 5G1YA 3HMJG 2VELA 4CNPA 3W2JA 4RJEA 4LVDA 2NXIA 3GDRA 4J9JA 5HINA 1OK4A 3R2GA 2WNZA 3FOKA 1HO1A 3CB8A 3U8GA 4WD0A 3UNDA 3SFKA 4LRSA 4FX8A 1FWSA 5KITA 1JCXA 1OYAA 4K7VA 3W7RA 3HG5A 2VC6A 4UMBA 3GVGA 1XI3A 1KM5A 3SR7A 2V2HA 1FUYA 3T44A 4E2DA 3NM3A 3WK3A 3HBLA 3QW3A 4NXSA 5J5DA 1KFKA 1UUMA 4Y9AA 4FXRA 3W71A 4GE8A 1AL8A 2HTMA 3KRUA 3W70A 3BW2A 3UWVA 2BTMA 1GJPA 3PF3A 4NJHA 3C0JA 1OJXA 3BK0A 5G5IA 2Y7GA 5U7SA 1SW0A 4UR7A 1G4PA 1OF6A 1J5TA 3MHFA 3W23A 3HG3A 2QDGA 3W7KA 5DBTA 5LNUA 3C56A 5IBXC 2YW4A 1G4EA 4S2BA 2H6RA 3M0ZA 3I7QA 1G69A 5CZJA 2ZTJA 3W86A 3MMTA 4Z1CA 1I2OA 2NXGA 1W5QA 4N6FA 1O94A 5AHLA 4W9TA 1MEIA 1QPNA 3MHGA 4JX5A 3P80A 1TTJA 1WBHA 1HFBA 1AW2A 3G1XA 3QQ1A 1DV7A 4JTEA 3ABOA 3GKFA 3TXVA 4DEFA 2RDUA 3U2OA 2CLFA 2VXNA 3RK8A 2ZQ0A 1SSDA 4C1LA 2H90A 2WV8A 3EWXA 3MYPA 4IX2A 1M7OA 3S1WA 1ADOA 1W8SA 1L9WA 3UXAA 3Q58A 1VH7A 1W0MA 3G24A 4H6KA 4ZVJA 5G4WA 1XC4A 3NQAA 4AVFA 3LB0A 3NZRA 1S5TA 4NJKA 3SY5A 5DCDA 3VCRA 3AO0A 1DQWA 3P8JA 4WY0A 1NEYA 4MY1A 1OHLA 3DKJA 3HPZA 1FXPA 3TCEA 3KVJA 2Z2UA 5AC6A 1PE1A 1Q6LA 1EA0A 1H7OA 4I7WA 2NX3A 1H60A 1JRCA 1H7NA 3TC7A 3CHVA 3S9YA 5HR7A 4YWIA 3W72A 2I9EA 1TPVA 1W54A 1G4TA 3W2MA 4CCDA 4ADTA 1R2SA 1R47A 4ORMA 1VLIA 4N6EA 2V9DA 3BG9A 4FNRA 4Q32A 2DZXA 3Q94A 4EWND 4ZQNA 2CZFA 1W5MA 3PG8A 4Z1AA 1OFDA 1I8JA 3DXIA 4OQVA 2QCFA 1H61A 3MBFA 1QR7A 1K02A 4UNLA 1DVJA 2QUVA 3QH2A 5CG7A 4K39A 3RU6A 1LP6A 1FDZA 3CWNA 1B9BA 2CLIA 2J9XA 1DOSA 2FLIA 3EXRA 4UTIA 4AWTA 4UFHA 1KM3A 1W5NA 3B0VC 2HS6A 1N7KA 4GUFA 1EUNA 1VHCA 1KFBA 3ZR4A 3PBYA 2Z0IA 4FNTA 5EY5A 2RH9A 3LBCA 1TO3A 4BI7A 4NUWA 3UWYA 4UTUA 1V7YA 2JKPA 4EOUA 1ICQA 3V75A 2A4AA 3C4UA 1EP1A 3M43A 3ELFA 1ZCOA 5DCEA 2GQ9A 5EA9A 3P5YA 3MJYA 5CSSA 4KWWA 2CZ5A 2E77A 2QAFA 2WNNA 5AHIA 3FS2A 3S5ZA 5ABTA 3C2OA 4GC4A 3EX4A 2CLOA 3THQA 5KSWA 4FNSA 2A7PA 1SZNA 4FXSA 5KZDA 5HMSA 3E02A 1KM0A 3UD6A 4O0KA 2AGKA 1JQXA 2DZTA 3DFPA 2QCHA 1RZMA 3R5EA 3W7IA 4MLJA 2UV8G 3N9SA 4WQ6A 5DXYA 4AEOA 3M5ZA 3TW6A 2E5DA 1RV8A 2I1OA 2WOQA 4XUGA 3M47A 1TPC1 1FWWA 2E09A 2DORA 4OHQA 3TFCA 4ZQRA 3CPRA 3DFQA 1QO5A 3TE9A 1UCWA 4XWUA 5A5WA 2ISSA 1B3OA 1TPWA 3CIXA 1JVNA 2X30A 3P5ZA 4AHPA 2G5WA 1XBYA 3S5OA 4JY8A 1O4UA 5HULA 3OVPA 1ICPA 2V0TA 4NNCA 5D04C 3NPXA 1H5YA 3DFOA 4LV4A 3SZ8A 1VZWA 3LHTA 4XTDA 3T55A 5D2WA 4FEZA 4UR8A 3BG5A 1R2TA 4HT3A 3TC6A 1DHPA 1ME8A 3F1QA 3P62A 1GT8A 1R2RA 3NQGA 3E49A 3BARA 1QPQA 3NPUA 3OVRA 5GVJA 3TROA 4NQ1A 1LYXA 4I7UA 4X2RA 1EWEA 3W7DA 4A29A 2NX1A 4MZ8A 3NPVA 5D2TA 4IMFA 2GUUA 3IIOA 3EWZA 1EX5A 4HNUA 3LHVA 5I3HA 3W84A 1OX4B 1RR2A 1YTDA 2FIQA 3KAOA 3HJZA 3DZ1A 1VC4A 5FF3A 3BO9A 4IMGA 3P7YA 1O60A 4Y96A 1LRQA 1LRNA 3NQ8A 3L5AA 1R46A 4O1BA 5LHFA 1TREA 3W7GA 1UJPA 1QNVA 2NUWA 3SIZA 4A21A 1DKWA 4PCFA 4QAIA 5K7JA 3NL2A 3GNNA 1V5XA 2R91A 1X1OA 3W88A 1GQNA 3G1FA 3LLDA 3WJXA 1TJPA 2DU2A 2QEZA 2X1TA 4XZ9A 4IGHA 4EVZA 2FTPA 5IM51 1HL2A 1TPB1 1VHNA 1RQEA 2RDWA 3FKRA 1QCWA 2C15A 3NG3A 1G6CA 4P2VA 1LOQA 5F2GA 3HGRA 3TH6A 1SZGA 1TCDA 2F84A 3NQ7A 5AN7A 2A85A 1B4EA 4GJ1A 1NVMA 2CLLA 3HB9A 1SO3A 3LCFA 3S42A 3CT7A 1T0OA 1WX0A 4OBTA 3C2RA 3LLFA 1A5CA 3LHZA 3C8FA 1QDSA 2ZA3A 4IMDA 2LLEA 2OMAA 3N73A 4CCCA 4QM1A 4K6AA 1JQVA 1FBAA 3G1SA 5AHFA 3LGEA 1QMLA 1E51A 6ALDA 3DHDA 1YPFA 3W07A 4LS0A 4TIMA 2B7NA 2JK2A 2ZDRA 4IOTA 4OGZA 4JYFA 3G22A 3NQCA 3USBA 4PC8A 3TAKA 4Z0SA 4UTTA 2QCGA 3EX3A 4M6PA 2OX1A 4C1KA 5F2IA 2C3ZA 3HGOA 4CQAA 2ALDA 2QKFA 2R94A 3FJLA 3D0CA 5C54A 1EWDA 3B8DA 1H7PA 1KFCA 1QO2A 3M5VA 2H8ZA 3LDVA 3P81A 4N2YA 1L6SA 4DBDA 1W31A 3B4UA 4NJJA 4PFMA 2FB3A 3CEPA 4QJ1A 3P60A 1EIXA 3P74A 1FY6A 1H63A 4O1DA 5EBUA 2NXHA 3L5LA 4DO4A 4Y6GA 1XDMA 4NU7A 2D73A 2WNQA 4ADSA 4GWEA 2X1SA 3CC1A 3TSMA 3W1NA 3M9YA 4WOQA 4GUHA 3UQNA 1AW5A 2BXVA 4WXZA 4U28A 4UMCA 4N02A 2ZYFA 5DCBA 3L66A 4B5NA 1BKSA 1VYSX 2KZHA 2ZBTA 3VNDA 4ADUA 5I3KA 3IVTA 3HG4A 1G7UA 3W1PA 1SQ7A 1SZFA 3CLMA 1JCMP 1C29A 2GQAA 5TIMA 1P0KA 1VYRA 3W1UA 5BOOA 3C6CA 3OEXA 3DGRA 1LLZA 3IGSA 4O12A 3H55A 1PIIA 4O4WA 4O1AA 2A0NA 2NUXA 4MYAA 4X22A 3W2UA 3LCLA 4LWWA 5FI8A 3S6DA 4ICNA 4N9CA 4LTSA 2TRSA 5CZ0A 3C61A 3WK2A 3KVKA 2H8XA 1THFD 4O52A 5E1QA 4O53A 4UNKA 1SR9A 3IEBA 2QUUA 2QR6A 5EPDA 1TTPA 4QQ3A 1ML1A 1OFAA 1WA3A 4AH7A 3P82A 4JD4A 3W1AA 4AAJA 2QAPA 4MZ1A 4RXFA 4LU0A 4BF9A 3N3MA 2FB2A 1VYPX 3NQMA 4O1CA 3HPSA 1H50A 4CCEA 4GRSA 1K03A 3DI1A 2YPIA 2G97A 4MJMA 2FPTA 4MPQA 4L4LA 5DELA 3LTYA 3W22A 1FWTA 1OFQA 1LBLA 4E0CA 1JUEA 3LHWA 3GK0A 3QFEA 3N9RA 3S5YA 3NQDA 3IVSA 1GVSA 1JJKA 3I65A 3GX9A 2ZTKA 3LXBA 4IMCA 1OFEA 2QCNA 4MOZA 1GG0A 2ATSA 4GUJA 3IIVA 3I7SA 3RNDA 3FA5A 3L5MA 2E5BA 1K7FA 1B57A 4POCA 1LZOA 3UWZA 1YTEA 1J4EA 3PC0A 2Y70A 5FEWA 4M7SA 3OA3A 3G1VA 3I6RA 1A50A 2ISWA 3W7LA 3EWUA 2W6RA 3HPXA 4NJGA 1FDYA 2Z1BA 4HKPA 2XN1A 3W3OA 3NA8A 2NV2A 5CPOA 4WOZA 4X9SA 3LHUA 4JGDA 4MYXA 3W2KA 4ZQMA 3G3MA 4QISA 3WJZA 4Z1BA 3GKAA 2AAMA 4LVAA 4R33A 3SGUA 5BMXA 3L68A 4WY0F 2IQTA 1ICSA 2C13A 3TJLA 2YCEA 3FLUA 2W79A 5EL1A 1ZAIA 3L0NA 3GXNA 4O28A 1ALDA 2ZRZA 4TMBA 3T4CA 1RQHA 3HO8A 5LNVA 1QOQA 4K7YA 4MFEA 4IJBA 2GOUA 1GPWA 2OCZA 1OFRA 5FEZA 2ZCGA 1VCFA 2C16A 1I2QA 3W9ZA 3PVFA 4PL1A 1EP2A 3DFTA 5D2YA 4O13A 1I2PA 4DO5A 1JR1A 3QPYA 3MUXA 1WBJA 2ABAA 3C2EA 5KZMA 2C6QA 1SW3A 2Y7DA 4FX6M 1TQXA 3L21A 1TRIA 2GPTA 3MYOA 3GIYA 1OYCA 4N9DA 1NAL1 4JIQA 3HF3A 1OFOA 1GTHA 2Y89A 3EXSA 2RHGA 3M41A 1LOSA 3ZWTA 2I14A 1D3HA 1SUXA 3EKZA 4O57A 4RK8A 3PM6A 1LORA 1YXDA 3QMRA 3KVMA 5HR6A 3GNDA 2VKZG 3OHIA 1GEQA 4AHOA 4KFNA 5CPNA 2E6DA 3WJSA 1TB3A 2NWRA 3MBDA 5AC8A 2GJNA 3DFSA 4XQ6A 1TPH1 4WY0B 4M5PA 3UYCA 4K36A 4BWLA 1JULA 2VEPA 4NX0A 1FWNA 1QAPA 3LV5A 2C19A 1FCQA 2DZVA 4A3UA 4TU1A 2FDSA 3KFTA 3O6DA 2Z6IA 5SWUA 4NNBA 1TIMA 1WV2A 1TV5A 3C2VA 5AYYA 4ZMGA 1BWKA 2Z6JA 3WJWA 3CTLA 3KXQA 3QW4B 3NGJA 4XKYA 3QPZA 1Q3NA 1H62A 3C3NA 4HN4A 3G1YA 2CLMA 1GOXA 4N9EA 5T26A 1JCYA 3F03K 1HUVA 1ME9A 5F1VA 5I3IA 5LNWA 1GVFA 2DZWA 2DZUA 3S1UA 4O4VA 1FCVA 3UWUA 2PURA 4IWWA 3STGA 1ZHAA 3FEMA 3BPWA 5K9XA 1ZNNA 3NQFA 1OFPA 1XBVA 2V2DA 3MI2A 2V81A 5FESA 3B05A 3MW7A 1SO5A 5HWJA 3CQ0A 1FDJA 1XXXA 3GXPA 4DF2A 1FQ0A 3O15A 3PBVA 4MFDA 1MEHA 1DQXA 5K9DA 1G67A 1LLWA 3LERA 3KRZA 3LX9A 2RKXA 3W1XA 5AC7A 1GVOA 3TFXA 3TMLA 3M16A 3DKLA 3NQ2A 4MZYA 3A22A 4K38A 2DZSA 1LRTA 4OV9A 3CEUA 3LI1A 4UTWA 3LCXA 3YPIA 1N55A 5AOUA 2NLIA 2NWSA 5CZSA 2CWNA 4FO4A 5C5YA 4YXGA 1UBSA 3MI3A 4LY8A 2CZEA 1MXSA 2PCQA 3HG2A 3W1LA 3M1ZA 2AQWA 4RXGA 4BI5A 3JRKA 1GVRA 3N2MA 2JBMA 3HIJA 4JTGA 4NZFA 1Q6RA 4UTTC 2CFFA 4IUOA 3P61A 5F2LA 2EGZA 4LS1A 4FNUA 3DH7A 4M19A 2WSQA 4BR1A 5KZEA 3GZ3A 3NOEA 4PEKA 3TJXA 2P1FA 1GG1A 1JUBA 3UPWA 5HNRA 1TPDA 4QSHA 3KRSA 1ME7A 3HGSA 3LM7A 4ZQCA 2ZRUA 2WO5A 1QWGA 2Y88A 2YW3A 1W5PA 3PG9A 4UMAA 2NUYA 3Q2DA 4N4PA 1GZGA 3TSBA 4IQLA 3GLCA 1ZY9A 4Y90A 1ZJIA 2C14A 3GAKA 4LC8A 2ZRVA 3G8EA 1FCBA 2C18A 4K8HA 1SO6A 2PRLA 2YR1A 5G2IA 2A7RA 2GQ8A 1CI1A 1H1ZA 5DXXA 3BVJA 3KHJA 4AXKA 4MY8A 2VOMA 2ZRYA 3OG3A 3PBUA 3K30A 2B7OA 3PUEA 3W7HA 4A22A 3G1AA 1L6YA 4QNWA 1P5BA 2V5LA 3LRLA 2V2CA 1IGSA 2FPYA 1SFLA 5F4XA 1MO0A 1D3GA 1OK6A 3O6YX 1VRDA 3NEVA 1P0NA 1PHQA 3TUUA 3HGJA 3O6CA 2BX7A 3NZ1A 3LI0A 1A5SA 1F74A 1P4CA 4EF9A 3QC3A 1M5WA 1F6PA 4UFKA 3W7NA 5MHBA 1TTQA 5K2ZA 1QPOA 3LRKA 2JGYA 2EHHA 3GR7A 3PULA 3RF9A 4K8EA 3W2NA 3RMJA 2V5BA 2P0OA 3LBMA 4JY9A 3BV4A 4MKNA 3WJYA 1YXYA 2A5HA 1I4NA 3SW6A 2CZDA 3PB2A 3PUDA 5L9FA 1QOPA 1F05A 2BLEA 3TR2A 1TTIA 3NQVA 4WXYA 2YYUA 3SECA 3EX1A 3TXZA 4LUIA 5D2VA 3NVTA 5DBUA 1KV5A 3E0IA 4O50A 3BGJA 2X1UA 3IGUA 3PSWA 3S1VA 1UUOA 5LKYA 7TIMA 3W2LA 2HMCA 1DJQA 1OF8A 1KA9F 2EF9A 1WAUA 1OABA 4DO6A 1X7FA 1Q45A 4WUIA 1DJNA 1TV8A 5EMUA 1W3TA 1A5BA 2E1DA 3L0KA 4OWGA 3PY2A 3S0CA 1XCFA 3QQ0A 1N8FA 3W7CA 1FWRA 2QCCA 2GJLA 4MIMA 3NYZA 4A2SA 3W6YA 1U5JA 3B06A 3RFAA 3TA6A 2EPHA 1O5XA 3NL3A 2GVGA 2FPVA 4MY9A 3PR2A 4S1FA 3QZEA 1ZAJA 4GUGA 2Y7EA 4UFIA 2QCDA 1KFEA 1ZALA 1WDWA 4TX9A 5AHNA 3MP5A 4HPJA 5LHEA 3UPBA 1HG3A 4QIUA 3FIGA 1DL3A 4JTHA 3RLUA 2ABBA 4OV4A 5HJLA 3EX2A 2QCLA 3QF0A 2J27A 3GR8A 3R89A 4CQ9A 4O10A 4P61A 1L2UA 3ABRA 4CLMA 1MSSA 2VFFA 5D03A 3TSDA 3QRHA 1Z41A 1PHWA 1ZENA 2VEKA 3F4WA 1X8FA 2NZLA 1PV8A 3JS3A 5C2XA 4JICA 2YDAA 3B04A 3MO7A 4LW7A 5TBOA 4UTKA 5E0KA 2QCEA 4YMZA 3PWAA 1OX6A 4KKXA 5F1UA 4U4MA 1RPXA 1SZEA 4JS3A 4ORIA 5LNSA 3EEGA 2A21A 1AW1A 3LTSA 4WX2A 4DPPA 4PL2A 2ZZ1A 4NX5A 1EEPA 1NF7A 5LZLA 1LBFA 2FFCA 4L4MA 4HNVA 2YX0A 3N14A 3CWOX 4NZJA 1RQBA 2ZA1A 3DAQA 1HTIA 1O95A 4JTJA 4BWLC 4HIBA 4GBUA 3HOJA 3G0UA 1I2RA 4M7TA 3DI0A 1QFEA 1VCVA 5G2WA 5BW6A 3IVUA 1VR6A 4KWVA 4DPQA 1H7WA 2Y62A 3G0SA 2A7NA 3LCWA 1X1ZA 5H91A 1GWJA 5HQEA 4EIVA 4UCGA 3LHYA 3IIZA 4Q33A 2B7PA 5K9CA 2EKCA 2E6YA 1IIHA 5EYWA 2VFEA 4JDYA 1AMKA 3BGGA 5AHMA 2YZRA 1FCUA 1YPIA 2YXGA 3SGZA 1TPUA 4LVGA 4JTLA 4YCOA 1SW7A 1XDLA 2ZZ4A 5KMYA 3TX9A 4QITA 3W75A 3UWQA 4ZQOA 2Q8ZA 5I3FA 3L0GA 4O16A 5I3JA 5FF2A 3TDFA 4HNNA 1HO4A 3I7RA 1KTCA 2XFWA 3O8AA 1TPEA 3W7OA 1YDOA 3DBPA 3R13A 4JX4A 3W85A 3WFAA 4IXHA 2CW6A 4PA8A 3IIPA 3WK1A 1S5WA 4UFMA 3W83A 4GFSA 3QSRA 3E12A 2ZA2A 5AYXA 2A6LA 3L67A 3PAJA 5K4ZA 3VE7A 3TMQA 4CNOA 1P1XA 3ATYA 1Y0EA 4BK9A 3E9AA 3NXFA 3ABQA 2B7QA 3LXAA 2PRMA 3IGXA 3B0UX 1T8XA 1CW2A 2DP3A 4OE7A 4ONVA 3M5XA 2C0AA 1TMHA 4XBKA 4AB4A 1Z48A 3CIWA 1F2JA 1F76A 3H53A 5CGQA 5FEXA 3TQ0A 2O7SA 4JDBA 5AHEA 5F4SA 2R8WA 4GXMA 1RD5A 3M7WA 1LTDA 5G2HA 4LOCA 2BWGA 4H3DA 4RR4A 3P67A 3T78A 1LROA 3L9CA 3NL6A 1NF0A 1XBXA 4LV9A 1H7RA 4M6QA 3S1XA 2A6NA 2OZ0A 4MLRA 2B4GA 1SU5A 1F5ZA 1K7XA 3A9IA 4A2RA 4RKAA 5FF0A 1KLZA 3QJAA 5DY2A 4DBEA 1PCWA 1KBIA 2WQPA 3FJ6A 4ZL1A 2ISVA 3OVQA 4PODA 3QYQA 5DLCA 3BW4A 1WYIA 2CLKA 3W87A 5KINA 2W0UA 3PSVA 4RX0A 3IIXA 4FNPA 3OBKA 3QSTA 4JXCA 4O19A 4DELA 4HSOA 2QJHA 3W7EA 1SO4A 1WOAA 4RZ4A 1Z42A 3THAA 3QMSA 4Z1DA 3UXDA 2VENA 4N9BA 4JTTA 1I2NA 1KM2A 4S2CA 3L65A 1TJRA 3ZWSA 1CX9A 4PTNA 2V82A 3EXTA 3G18A 3P8IA 1VLWA 3BLFA 4I7VA 4Y8FA 2P10A 3NQEA 1LM1A 1XBZA 3NDOA 2XN2A 2WPBA 1TRDA 2RDTA 2CLEA 4NVTA 3A5VA 1GTEA 3GB6A 2GVJA 1SFJA 5FF7A 2H3DA 1PL9A 3ZFHA 5BRBA 3SJ3A 1NSJA 1W56A 3GDTA 4JTIA 3FYOA 2X16A 2WJZA 4XKYB 1EB3A 2ZRXA 1T99A 3EB2A 4XBSA 5L6UA 4JTFA 4UUIA 5D33A 4XTIA 1KM4A 2ZZ6A 3L2IA 1DBTA 4IPIA 1KBJA 2J88A 3MI6A 1KTBA 2VFHA 4BI6A 3W7MA 1VCGA 3SI9A 1K8ZA 1F73A 4RZ5A 3DHFA 1BWLA 3BG3A 2J24A 1XM3A 3KVLA 3I68A 5C55A 4LVFA 4CNNA 2HS8A 4UFLA 3SSJA 1Z44A 4R7JA 1K8XA 3TKFA 4JX6A 2Y61A 2Y85A 1WQ5A 4LC6A 5CZTA 2Q8LA 4JEQA 2Q3OA 3W76A 1PS9A 2E6FA 3W7QA 5K3VA 2YFNA 1EP3A 1W37A 3NNTA 1JRBA 1IXPA 5F2MA 1G7VA 4JIPA 3LCGA 5LGXA 1Q6OA 2JGQA 3G8RA 1KTNA 1YXCA 2CLHA 2WKJA 4X3ZA 5H2ZA 4G1KA 3W7JA 1MZHA 1XUZA 3EKLA 3G0XA 3N2XA 4Z08A 4JYEA 5HUOA 4ZZ9A 3QEZA 2X2GA 3Q37A 4O0ZA 2XN0A 4FB7A 3TAOA 1GVQA 1AK5A 3VKJA 1VPXA 4DQWA 4JR5A 3EWWA 2HSAA 2NX9A 2V30A 5G1TA 4IMEA 2QCMA 4IXXA 3TQVA 5CKSA 1VQTA 4R53A 4UIOA 3TK7A 2E68A 3FKKA 1WXJA 5CSRA 3NM1A 3S8HA 1LOLA 2E6AA 1EPXA 5A8GA 3VFLA 3N19B 1M6JA 3GDKA 3DENA 3IRDA 2VEMA 1VGAA 4LUJA 5CPMA 2QF7A 3NL5A 2ZZ2A 2PC4A 5LNRA 4HNTA 3M44A 1JUKA 1F6KA 2O7QA 4O14A 5FF4A 3EWBX 4ZQPA 4AHQA 4AF0A 2ATMA 2VFDA 2YYTA 3JR2A 1OG0A 1NFBA 2WSYA 4O11A 1EUAA 1B4KA 4AF0B 1S3HA 2WSRA 5IBXA 2Y6ZA 1IXNA 1LCOA 2H3BA 4JTUA 4O15A 5TQLA 4UTHA 3ATZA 4NT0A 6TIMA
chains in the Genus database with same CATH superfamily
2YDSA 4BA0A 2A3HA 3TNOA 2NLYA 2HE5A 1G4SA 3CB3A 3U5UA 4J5NA 4ZEPA 3AIBA 2DT1A 3N34A 4WVXA 4KFPA 5FCZA 3ZJKA 8XIMA 3I6TA 3NR0A 3VNYA 4HOZA 2J6XA 2O4MA 4LJ3A 2XM2A 3GDLA 3URNA 2V8ZA 4M0XA 2C1HA 1JPMA 4PB5A 4YLWA 1E1EA 2V5JA 4Y9OA 4IIDA 4H01A 1U5VA 1OFBA 1VPQA 1OGGA 3NSNA 5DY3A 2V63A 1LDCA 4US6A 4OOUA 4L65A 1S2TA 2Z4GA 3PN8A 1HIZA 1OX4A 5E93A 3O06A 5AYZA 4DWSB 3W73A 2TPSA 4H9ZA 4I8YA 3H2EA 5CSYA 3R8RA 1I1XA 4FS9A 4LALA 3CLWA 3PPGA 1P0EA 3E2QA 4KEZA 4PMQA 2JF7A 1I45A 1YEYA 5C6MA 3LY0A 4O54A 3HA1A 3AROA 5HMFA 1HL8A 2ZUMA 3VI2A 3CM4A 3S2CA 4DJFA 3UZ5A 4C6IA 4ZFMA 4M3PA 3PHAA 4HA0A 3UZYA 2X1RA 3R58A 3BH4A 5A6JA 2OVLA 4FXFA 1W91A 1POKA 3SUTA 4UTJA 3LYEA 1OD8A 1FFRA 4Q6JA 4M6VA 3MHUA 1PCKA 1XUUA 3GG7A 4P7OA 1AD4A 4DF0A 3FK4A 3SSZA 2XIIA 1PUDA 3ABZA 2FFIA 4U3AA 3U7VA 5GJNA 2BY2A 3S6OA 5M5DA 2D69A 4GYJA 3BW3A 4JQ1A 4GGBA 3V1PA 3TQKA 3W1QA 3L2LA 5KTLA 2DEPA 3ABSA 3SCVA 1EH9A 8TIMA 2REQA 3ANYA 1L8PA 3ORWA 1XIFA 4DF1A 3QM3A 2QPUA 5J5RA 3O05A 1PYMA 5KZ6A 1V3HA 3R7MA 4D6FA 3CH9A 2R14A 4XKMA 4H6RA 3STEA 4UXDA 1KM6A 4NZCA 5D2XA 1YLVA 1FXQA 3PS7A 1U33A 1OCBA 2BY3A 3JZEA 4ALDA 3GHUA 3VK5A 4RV8A 4YTRA 4NJIA 4E6MA 1IXQA 2FVKA 3NO5A 2GQ3A 3S5NA 3ZR5A 3T7VA 1UASA 1FKWA 1XYFA 1A5AA 4JFUA 4YIWA 2A2IA 2E28A 4GYPA 2DW7A 3LNMA 1JCLA 2OT1A 2RFGA 4DUXA 2MNRA 4FZIA 4ICCX 3SM0A 1J5SA 1EDQA 4JN6A 4GHRA 1NM9A 3BOFA 3EDFA 3R10A 1DWIM 2C71A 3WD1A 1AL7A 4XSLA 3ZM8A 2DT0A 4I90A 2VEIA 3I3DA 1K6WA 1KLYA 2HVOA 4UFJA 3MP4A 2HV5A 2CKSA 3W4RA 2HISA 2Y63A 1TVNA 4GBDA 1W3IA 3PFRA 3W0KA 5D37A 1B3ZA 1US2A 2HEJA 3N29A 4GQGA 4UTLA 3BAIA 2YSWA 5BMWA 4QJ5B 1SZRA 1M7PA 3ALFA 1MEWA 1QI3A 3V0SA 1TZZA 4PMDA 2WZTA 2QGHA 3P6LA 5EMLA 2VELA 4CNPA 4ERIA 3W2JA 3E1F1 3AHZA 3R2GA 4FLSA 3FOKA 1HO1A 4WD0A 4LRSA 4FX8A 3W7RA 3B8WA 2XIQA 3GU2A 4CN6A 3VZZA 2OZTA 5FSEC 4WKFA 1H49A 3TYCA 3SR7A 1E9YB 2V2HA 1S2AA 4FP1A 4E2DA 3T81A 4AC1X 4A4AA 3QW3A 4NXSA 3CHFA 3WELA 1KFKA 4MNLA 2XH2A 4IUGA 2NT1A 4GE8A 1J18A 5ABGA 1AL8A 5HA7A 3W70A 1XIMA 4NJHA 3XINA 3F5KA 3G6MA 1EGMA 2Y7GA 5CLWA 3A13A 4HZ7A 2QDGA 5DBTA 1UC5A 3BLLA 4BF7A 4JTQA 2H6RA 4HHHA 2YXOA 4LCSA 2CHOA 1TUXA 1W5QA 4WKHA 4N6FA 4W9TA 3VM7A 1XGEA 2HK0A 3CMJA 3PJUA 1TTJA 1WKEA 3BCFA 4J35A 3ARWA 3MDWA 3KE0A 2J66A 4QEEA 1HFBA 2R1PA 5HK4A 3V5OA 3U2OA 3MUAA 3RK8A 4ERAA 1DHKA 2H90A 1QHOA 4IX2A 3S1WA 3H12A 1L9WA 3CIVA 1FP8A 4ZVJA 5G4WA 1L6FA 4AVFA 2ACSA 1S5TA 5IDZA 5DCDA 2CBIA 3AO0A 3A3WA 1PX8A 4EPBC 4UCFA 1FXPA 3KVJA 2GGHA 1BFNA 1Z69A 1OADA 5J8LA 1Q6LA 3SRFA 1H60A 1EQPA 2I9EA 1TPVA 1G4TA 3VCCA 4CCDA 4KGLA 4ADTA 1TV2A 1R87A 4N6EA 4C7FA 3BG9A 1JDEA 1LWHA 4AVOA 4EWND 4QTGA 1ZS2A 1I8JA 2PGWA 2XVLA 4I3GA 4HZ8A 1GHRA 3U4FA 4BJHA 3U57A 1UPPA 1LP6A 1FDZA 4UTIA 3WEMA 2OSWA 1W5NA 3EYPA 2VQTA 4EXBA 1F4AA 1EUNA 2O0TA 3ZR4A 3UBPC 1GQKA 1DJIA 1D8CA 3ALGA 4FNTA 4RZBA 1AD1A 2RH9A 3EEZA 1TO3A 2CETA 4YU1A 3C5QA 4H7VA 3EPNA 4QS5A 2JKPA 3V75A 1FA2A 1DQUA 4W7WA 1X38A 2PUZA 1ZCOA 5IXEA 4F0SA 3A4AA 3WKZA 1Y5VA 2X05A 1A80A 4IISA 4KWWA 2CLPA 2CZ5A 2QAFA 3NQBA 1OM0A 3IJ6A 4RE0A 3VIPA 5KZDA 3V0UA 5HMSA 3UD6A 3PZVA 4O0KA 3E2SA 5GJMA 1JQXA 3AS3A 4HSHA 3TW6A 3L23A 4ATLA 4OVXA 1RV8A 1R86A 3TYDA 2I1OA 2GJRA 3M47A 2ICSA 2DORA 3ABXA 4HPHA 1GOMA 2VT0A 3WLKX 2WSPA 2EPLX 1UCWA 3CIXA 3P5ZA 3KBVA 3FGCA 2ACRA 4C5YA 1XLLA 3M0XA 4LV4A 3UA4A 2QUNA 1UQZA 3UNTA 5D2WA 1J0IA 4FEZA 1FH7A 4B3KA 1R2TA 3ARUA 4HT3A 3TC6A 4F0LA 4L9YA 4TQTA 3F1QA 2B81A 4JKMA 1R2RA 3A64A 1CB7B 2GVYA 4IQDA 2P50A 1TWIA 3GR4A 2NVDA 2SFPA 1UR9A 1EWEA 1RCOB 4IIHA 3ARYA 4PMOA 4MZ8A 1ZJAA 2GUUA 4J7RA 3IIOA 1A5NC 4PUWA 2Y5SA 4H19A 1EX5A 2I57A 3CUGA 2VWSA 2PTZA 4JTDA 4LAZA 1L8NA 4Y96A 2XUCA 4O1BA 1TREA 3SIZA 1XP3A 4A21A 4PCFA 4LUTA 4QAIA 3TN3A 2ISDA 3GNNA 2V5KA 2R91A 1TJ1A 4Q8VA 3FXGA 3TOPA 4Q3MA 1A5UA 2X1TA 2YA1A 3CHCA 4EVZA 3G5EA 1TPB1 3I4KA 2VOTA 1U22A 3VGDA 5E6ZA 4PUUA 3CPUA 2OQHA 2ZX6A 3TH6A 1JZ8A 3TTSA 4C6BA 1CGWA 4MAZA 3UJFA 2PP0A 4QE5A 1P1MA 3HB9A 1SO3A 1FWCC 3MMDA 1ESWA 3N4FA 2WNWA 3C2RA 4W89A 4ZE4A 3N73A 4CCCA 2QW5A 1PO9A 3HV9A 6ALDA 1XISA 1QNOA 3W07A 1V93A 1BYBA 3MKVA 4IM4A 2ZXAA 3VDBA 3NQCA 5DQPA 2VCBA 3TAKA 3RX4A 4B5XA 4M6PA 2OX1A 4B16A 4C1KA 3MA8A 3HGOA 3ZMRA 2V3FA 3AXMA 1H7PA 1KFCA 4PSPA 2H8ZA 3LDVA 2WMIB 4XD3A 3GHSA 1L6SA 1WO2A 1W31A 4QEHA 2OLSA 1V79A 3GVWA 4PFMA 4QJ1A 2BBFA 4XIAA 1EJVC 3PP7A 3T09A 5A6AA 2NXHA 1F8IA 2J8GA 3A47A 1MVYA 1TWDA 2D73A 4HTBA 3UJRA 1X98A 2HVNA 3KHDA 2F9RA 2Z1VA 2ZE0A 3CNYA 4L6OA 4F0KA 2ZYFA 3KLKA 1EFZA 4B5NA 3ONBA 1VYSX 1SJBA 2CC0A 3VNDA 1V08A 4QHRA 4S3GA 1OB0A 5IHRA 1JYNA 1QHZA 3W1UA 5BOOA 4NZ1A 3C6CA 5I23A 3VIFA 4JNYA 2O4QA 1PZ1A 3H55A 1PIIA 3V18A 4O4WA 4KBXA 3WBAA 1TUFA 2PC8A 2BGSA 2NUXA 4MYAA 1CEOA 2VM8A 3BGAA 3W2UA 1HGWA 2QGYA 5CZ0A 2FZDA 5H8PA 3EGJA 3KVKA 2UY4A 3OZYA 4O53A 3IEBA 2XSBA 2QR6A 1ODUA 1TTPA 4QQ3A 1XDJA 2WB5A 2J78A 1WA3A 1OFAA 1W9UA 3P82A 4HK6A 4JD4A 2QAPA 4BF9A 3N3MA 2D0HA 3NQMA 4O1CA 2PDPA 4Y2WA 2OEJA 1LF1A 4GRSA 2QVHA 1XKJA 3QY8A 3QY6A 2J8TA 3PPFA 3GG0A 4L4LA 1KGWA 5DELA 3W22A 2OQYA 3DERA 5CAHA 5A8OA 3DG3A 5C2GA 1V6YA 4AXNA 1Z89A 3S9ZA 3S5YA 3RG6A 3NQDA 1NIUA 4RW3A 1B3VA 2BHYA 3GX9A 4MKSA 4IMCA 7A3HA 3CWHA 4FLRA 4MOZA 2G3JA 1LL4A 4HMDA 3RMEA 4JHMA 3FA5A 4W84A 2DQXA 3RN6A 4MDPA 3CL8A 5HMDA 3UXLA 4POCA 1LZOA 3PC0A 2P3ZA 2D2JA 4LUYA 2C7FA 2PDCA 2C0HA 1VF8A 3G1VA 3FXYA 2ISWA 3EWUA 3HPXA 1FDYA 4J3UA 1OZQA 2G3FA 2XN1A 1IR2A 1JL8A 2NV2A 5CPOA 2POTA 3EWCA 4ML4A 4MTVA 3M46A 4MYXA 2GYIA 4L4OA 3SGUA 2IQTA 2C13A 3TJLA 5EL1A 3L0NA 3GXNA 1GGOA 3AHVA 4O28A 4MNKA 4O0QA 1ALDA 3DHUA 3HO8A 1BYAA 1QOQA 3S2LA 5A8PA 4MFEA 4IJBA 3TR9A 5FEZA 3VGEA 4X63A 1I2QA 3M0LA 4G7EA 3PVFA 3WLOA 4AD0A 3DFTA 5D2YA 1NOUA 3MUXA 1E4NA 4F79A 2NQLA 4DN1A 3L4ZA 1UOKA 3WFLA 3AICA 1CGUA 4IG2A 1T40A 1TRIA 1AJ0A 1UC4A 2XZ7A 4JIQA 3PNUA 1OFOA 3BLKA 3CAQA 5A95A 2Y89A 3K1DA 4U5IA 3UW6A 2W5FA 1QNPA 4PFHA 3HV8A 4RK8A 1AZ1A 4IPPA 2GJXB 4Q8NA 3SCNA 1FHDA 2VKZG 2NQHA 3OHIA 4EAMA 1D7FA 4AMCA 4KFNA 3CMFA 1QHPA 3RILA 3ID7A 3KOYA 3ZVHA 3WJSA 3VIHA 5AC8A 1VJSA 2E40A 4WY0B 4UWMA 5GNXA 4M5PA 4GJIA 4HHMA 2QS8A 4NX0A 3ZT6A 3WBXA 3LV5A 5AYIA 2PCEA 1FRBA 5I7GA 4A3UA 4TU1A 2FDSA 4PMRA 2PD5A 3KFTA 3WLRA 4ZMGA 1TV5A 3WX7A 2WZHA 4XKYA 3P0WA 3AIRA 4DBSA 3GNPA 1GOXA 4N9EA 1JCYA 5DMLA 4V1YA 5F1VA 1UD8A 2DZWA 3UWUA 1DJGA 4IJRA 4MB4A 2WCGA 4I6VA 5EMYA 5CH9A 3STGA 1UIPA 4XAPA 3BPWA 2ANUA 2Y5EA 3VUPA 3SUSA 4UOZA 3QKZA 1GQJA 2NW0A 3MW7A 4ZODA 1XXXA 1ZGDA 4DF2A 4MFDA 1DQXA 5K9DA 3SEPA 3KRZA 5AC7A 4ZXLA 3TFXA 4XD6A 3TMLA 3NQ2A 3AYRA 1TJ2A 1TWZA 2Y2WA 3A22A 4K38A 2DZSA 2G0WA 3T0TA 5C0QA 3CEUA 1JNEA 5RUBA 1N55A 2FZBA 2NWSA 3WDQA 3OG2A 4YXGA 4B9YA 3MI3A 4BQ3A 2QHAA 1MRAA 2RJHA 2PCQA 2Z00A 5HATA 1WDDA 4MDOA 3N2MA 3H26A 2JBMA 3UERA 3HIJA 4PB3A 4HYVA 4UTTC 3APYA 2CFFA 3P61A 2WSQA 3GZ3A 4JCMA 5ECVA 1GG1A 3GBDA 4QSHA 3KRSA 1VBUA 4XZWA 1A3WA 3S6TA 2XISA 4ZQCA 4B5UA 1XIDA 1KGUA 2PDFA 2Y88A 3DHPA 5BXPA 3J7HA 4UMAA 2NUYA 3MQTA 1EJSC 1KCZA 3SN4A 1KCXA 3RAOA 4BKNA 5BRPA 4IQLA 3FYYA 5D8ZA 3GAKA 1W2VA 2DH3A 1E0XA 1CXKA 3CUJA 1ZCCA 1R3YA 3SUUA 4F4RA 4DJED 2C18A 4LUSB 2YR1A 5G2IA 2A7RA 4PTMA 4E3VA 4EKJA 1CI1A 5EU9A 2WAGA 4AXKA 4QE4A 5MKGB 3RCNA 1ZQ5A 3U7BA 2J79A 5CPSA 3GFXA 1DXIA 4NYYA 1L6YA 3PWIA 3PFMA 9RUBA 1P5BA 3LPGA 4K68A 3SRKA 2WVVA 3SBFA 2V2CA 3T0AA 3GTIA 2JE8A 3WLSA 3O6YX 3TUUA 3T9PA 1W3HA 3O6CA 3A3HA 3BAWA 1ZU8A 2Y8KA 4GA8A 4UFKA 3WUFA 2EHHA 3GR7A 3W2NA 3RMJA 3AJ7A 3LBMA 3OHMB 2FHBA 3WJYA 2A5HA 3OODA 3WH9A 3CUZA 2FZ8A 3SW6A 2XGIA 5EMKA 1QOPA 3WSUA 2BLEA 3NQVA 3MC5A 4QAWA 5D2VA 5DBUA 3LK6A 4F48A 1QPKA 3T2OA 4TVDA 4MWAD 2GGJA 3EBVA 4HZMA 4O50A 3LUTA 2DV0A 2VEGA 4AZGA 3GW0A 5A6BD 3QTPA 4GIEA 4RNJA 1Z3NA 2J62A 4YTTA 1QJWA 3N9KA 5LKYA 3NEHA 4CD8A 2A3LA 4V1XA 1U1JA 5CC3A 4FF5A 1OF8A 4I5UA 4BHYA 1WAUA 3VOIA 3TJ4A 4WDXA 5EMUA 1TV8A 4OWGA 4UTFA 1N8FA 2HPMA 3B06A 1ONEA 1QNQA 4H9MA 4W8AA 3JUGA 1KFEA 3RRXA 5LHEA 1E0TA 1MYRA 2F2KA 1DL3A 2ABBA 2PP3A 3IJIA 5E9XA 2P53A 2J27A 3GR8A 1CPUA 5FIPA 4CQ9A 4P61A 5TAOA 1L2UA 3ABRA 4PMXA 4UQCA 4KT2A 4N42A 5D03A 4HJFA 4M1BA 1Q6GA 5HDRA 1L0PA 2VEKA 2WKLA 1X8FA 1PTAA 4I5RA 4C6EA 2OYKA 2QCEA 3MMWA 4KKXA 2P8BA 3ZXWA 3IPWA 2A21A 2ZZ1A 3V16A 1UR0A 4J40A 3CBWA 3R6IA 1NF7A 5FJRA 3KOZA 3IJ8A 5D4YA 4L4MA 2YX0A 1WKFA 3BSGA 3JZUA 1E0UA 4D6HA 1AH3A 3ECQA 1GQLA 1HTIA 4BWLC 4HIBA 3UP8A 3OGSA 4GBUA 3DN5A 5DMMA 4C6DA 4M7TA 2J7FA 3BAKA 5G2WA 5BW6A 3T2PA 4AX7A 3C0LA 1VR6A 5JVLA 4DPQA 1UA7A 2OX4A 1VFMA 2PZNA 1EF3A 1X1ZA 2WZIA 4UCGA 4PBEA 3IIZA 2QJMA 1XYBA 4ROPA 4L6HA 4NASA 2G8ZA 3OIHA 3B9AA 2VFEA 1PTDA 4I9TA 1AMKA 3F5JA 4V15A 3SGZA 2OKTA 1TPUA 4PB4A 4LVGA 4ZFCA 1Q7ZA 1W9VA 1WDQA 1SW7A 5KMYA 4S39A 3AU6A 2PLMA 4GCAA 2WBGA 1HO4A 3I7RA 2XFWA 3O8AA 3VXGA 3DBPA 4XG1A 2GVEA 3W85A 1E71M 3D5HA 5E70A 3WLNA 1OC6A 1LWIA 4EXAA 1SJAA 3WL0A 3PNZA 2WC7A 4EAYA 3L67A 1EC8A 1GUVA 1P1XA 1UPMB 1Y0EA 3GDBA 2ZUUA 1HNYA 3NXFA 1W1PA 2B7QA 1R3TA 4LF2A 3OPSA 1T8XA 5FJPA 3URQA 4ONVA 4AB4A 6A3HA 1W1TA 1GQIA 4PTWA 5HNTA 4GI9A 4H8NA 1IE7C 5FEXA 3KTCA 3N15A 3TQ0A 3G6LA 3BUVA 1NWSA 2IKHA 5AHEA 2DIJA 5F4SA 4Q7IA 3B40A 1FWJC 5G2HA 4H3DA 2GSHA 4DZIA 1NF0A 1XBXA 1H7RA 1K77A 2DUXA 2WBKA 3LNPA 3N2CA 3ARQA 2INEA 4KRTA 4M6QA 1OSEA 2B4GA 2DY3A 1F5ZA 1K7XA 4A2RA 2WMGA 1O1ZA 4MB5A 3CZKA 3ZLGA 1W1VA 1KBIA 2WQPA 4ZL1A 1JYVA 1BD0A 3LENA 3QYQA 1MQQA 3MO4A 2CLKA 3W87A 1LQ2A 3LM3A 1W3LA 4B5SA 1S1RA 3QSTA 3CAVA 4X60A 4DELA 4IL0A 3UPMA 7TAAA 2QJHA 3W7EA 1SO4A 1Z42A 3GRIA 2AAAA 4UR9A 1FHLA 1HGYA 1PX3A 4M51A 4S2CA 1MFUA 2HPIA 3K46A 1CX9A 4HZ6A 4BF5A 3EXTA 1VLWA 4GISA 4NKCA 4D6CA 2E0PA 3C0QA 2P10A 3EDJA 3LPOA 1XBZA 2XN2A 2WPBA 2MUCA 2Z1WA 4IJCA 1XQKA 7REQB 2V3DA 2EJAA 1IZJA 3GB6A 3LMYA 4AZCA 4YTQA 2PI6A 3ZFHA 2E1WA 4LNCA 3PZQA 3BJSA 4JTIA 3T1GA 4LYPA 1IR1A 2XJ7A 3OBAA 1H3GA 1EKOA 1EB3A 3A6OA 2VJXA 1T99A 3EB2A 2YCJA 4KCVA 3R0KA 4NAFB 5FOOA 4AUBA 4LX4A 5L6UA 4JTFA 4UUIA 7PTDA 5TD4A 5C9UA 3ARPA 3PJTA 4NAEA 1DBTA 1J10A 5REQB 4IPIA 2J88A 2PTWA 4BI6A 3GXMA 4GZEA 3HPFA 3WLPA 1F73A 2F2HA 4DYKA 1BWLA 1GVEA 4Z2GA 1XM3A 3WH6A 3CYJA 2XH4A 4LVFA 2HS8A 2IKJA 3SSJA 3WBEA 2H9AB 2D3LA 4ZO8A 4JX6A 2Y61A 3A4JA 4NSBA 4DO7A 1WQ5A 1WCGA 2AL2A 4UQ9A 3APTA 3ITTA 2YKKA 1AZ2A 3MUIA 2YFNA 4DWDA 3GFZA 3UVIA 2P3EA 3UFYA 2AL1A 1KTNA 3ES8A 3GY1A 5H2ZA 2QUMA 1E40A 1EF2A 3CXOA 2VC5A 2XN0A 3SCTA 1T5AA 4R9OA 1F3EA 4MHBA 2DVTA 2OEMA 3VKJA 1UUQA 3EB3A 2HSAA 1MZRA 1XCXA 5CKSA 3U2EA 1TA3B 3BMVA 1M1BA 1JDFA 5CSRA 3IJ7A 4LY4A 4XD4A 5EB8A 3GG1A 2AKMA 4PUKA 4WR3A 3DENA 1E9IA 4DWSD 1VGAA 5CPMA 3NL5A 4JL1A 2VCCA 2ZZ2A 4AEFA 3T4WA 1OG0A 5HMEA 4O11A 4AF0B 3SJNA 3DX5A 1S3HA 2WSRA 4PCPA 3OB8A 2G3IA 1IXNA 4O15A 2HNHA 4PUMA 2ZX7A 4PBGA 3CTTA 1XFBA 2ASHA 3EZ4A 4NNAA 4S3DA 2VNCA 1V3KA 4XO6A 2VYOA 4JNMA 1DXEA 5DEZA 5ABHA 3TEVA 1ONRA 4RZ6A 1QI5A 8XIAA 3QBUA 3AUJA 3W1RA 4AWUA 3UWWA 2PBOA 1OVDA 1R7AA 2KAUC 2VX6A 3K8KA 4KEUA 3T40A 3N4EA 4HPXA 3O2LA 2OT0A 4A05A 3E5PA 3OIXA 4YCPA 4OT7A 3WEOA 4YWSA 2BZNA 4GOAA 1BLIA 2CZVA 3HQNA 4MUZA 3O7UA 3ZSTA 2W27A 3H4XA 3ZJ6A 1JI2A 3C2FA 1WB0A 1IF2A 1EL3A 4Z0JA 5BNKA 3A24A 1SJCA 4CD5A 4D2JA 5C7VA 5AZ0A 4JTSA 2E67A 4FF7A 2Z1XA 4GY1A 3KOFA 1WKDA 1UMLA 2YFOA 5CPLA 2QVNA 3K4DA 4J2MA 5D02A 4ROQA 4L6DA 4BFAA 3OQ8A 4NILA 1U1UA 2R1KA 4JTKA 2J9YA 5IOBA 1YNQA 4XO7A 5CZKA 3FAXA 1T96A 1S38A 3W1TA 2BXZA 2VFGA 3NAVA 1EJXC 3O6AA 1K4HA 1J79A 1YADA 2OU4A 2A3CA 1IYXA 4GQQA 4ZB5A 5FJUA 3ZLHA 5HUPA 2F6UA 2VX5A 3TOYA 1C9DA 1TR1A 2Q3RA 3CQHA 2YGYA 1RBOB 1UKOA 1HZYA 4LRTA 1YIXA 2EAWA 3SCQA 1B3XA 1TPFA 3USZA 3MP3A 1XLBA 4GUIA 1NDWA 1UZDA 1UZ1A 2BHUA 3W37A 1GVIA 1VFHA 2QULA 5I78A 1XLFA 3CK5A 1D9EA 1G94A 3G1HA 2A1YA 2PDKA 2PDXA 2DZPA 3H7VA 4GKLA 3NQ6A 1SSGA 2E5CA 1ZUAX 1IZKA 1WNOA 4KCTA 2BVYA 2OOFA 1UIOA 2GJPA 4IPJA 3T8LA 1XQLA 1M68A 4H6QA 2BVWA 5D32A 1VS1A 3VYLA 2XZ9A 1ZFJA 4CQ8A 3TU9A 3UG8A 3H2FA 3DG7A 3A12A 1TFVA 3EWYA 1QPRA 2VGBA 2BGNE 4GZIA 1J0JA 4LAOA 5A6MA 4HCLA 4H9UA 4U2YA 4RLIA 3BLIA 3WQOA 2EPOA 4KGJA 2TMDA 1U83A 2F7FA 2OSYA 3LN3A 1RK5A 1XKYA 3UCQA 1XIEA 2BVTA 2QLYA 3LGGA 4FIRA 4ACZA 2ZC8A 4ZE5A 2CWXA 1IXOA 1V02E 2PD9A 1J11A 1FWDC 2BSLA 4R34A 1BVNP 2CNCA 2YBUA 3EX6A 1KFLA 1VIWA 3BAXA 3QR0A 2QDHA 3LTPA 2DJLA 3IRSA 1HVQA 2IPFA 1GZJA 4WJEA 2J4GA 4H00A 1VFOA 2Z27A 1FH9A 3A21A 4TVCA 1NDVA 2PP1A 3ITYA 4YL2A 4QNEA 4WZHA 3UY7A 4AMAA 3TYBA 3EA2A 5FJJA 3VKCA 1LJYA 4LVDA 3GDRA 5HINA 4FK9A 2WNZA 4QE1A 1A0EA 3U8GA 3UNDA 3SFKA 1FWSA 2HZGA 1JCXA 3TWBA 2V67A 3HG5A 2GFTA 6XIAA 3EPOA 3QOMA 4S3FA 3ITOA 3KOWA 1W17A 4Q4QA 3MZ2A 3AFBA 4MJ2A 1FUYA 4W86A 1UD6A 5AKQA 2BGQA 3T44A 2W62A 2Z7GA 3NM3A 3VDHA 3RX2A 3LQLA 1J9YA 4FXRA 1WP6A 2EO7A 1BHGA 5FAJA 3W71A 2PDHA 2YB1A 4Q4SA 3BW2A 3WBWA 1ZZMA 1GJPA 2BTMA 3PF3A 3N6QA 3HU7A 4GZJA 1J5TA 4H2CA 3W23A 3W7KA 4Q6XA 2F6KA 2CESA 3M0KA 5IBXC 1J96A 3I7QA 3N11A 4O1EA 2DIKA 1I2OA 1S3TC 1XRTA 5JBEA 5AHLA 1O94A 1UA3A 1QPNA 3REQB 4JX5A 1K9FA 2ONEA 2J7GA 3NFUA 5EMMA 3G1XA 3ABOA 1O68A 3GKFA 4W7VA 3BANA 4QDWA 1B5TA 3V5FA 4C1LA 3EWXA 2HQAA 2YDQA 4N0RA 2AGTA 3MKCA 4PCSA 4PRTA 4E8GA 1W8SA 5BYWA 3W82A 4DLMA 3UXAA 5AECA 3Q58A 3RPDA 4DNMA 1XC4A 2WWDA 3NQAA 1H2JA 3W53A 3SY5A 4DX3A 3VCRA 1OHLA 3DOPA 3DKJA 2EKGA 1U1HA 1PE1A 2VVSA 3OYZA 3SCRA 3H21A 2CXGA 1JRCA 4YVPA 2ACUA 1RBLA 3S9YA 5HR7A 4YWIA 1R3SA 3VKBA 3KBMA 1RD6A 2VR4A 4HU8A 5A8QA 1R47A 4H7CA 1E1FA 1VLIA 1FVPA 4Q8MA 4Q32A 3EDKA 3EOUA 2CZFA 3CV7A 4W5ZA 1OFDA 2QCFA 3VOFA 2Z2AA 1W3KA 3MBFA 1QR7A 2OXNA 3KM8A 5I06A 2WANA 1K02A 1C3FA 1DVJA 2Z7KA 3GUWA 4XD5A 4AZHA 2GUYA 3AMDA 3GFYA 4FSAA 4WSKA 3LMZA 2QDDA 2J9XA 2ZX5A 3EXRA 4MF4A 1IWAA 3IV8A 4AWTA 5I02A 3P14A 3STPA 2YCLB 2HS6A 1N7KA 2PWVA 3H23A 1TR9A 2PDBA 3EWDA 4REQB 4WIWA 3BSHA 5HQMA 1FFQA 3PBYA 2Z0IA 5EY5A 4US5A 3LBCA 3O0FA 3H7UA 4LF1A 2WHLA 2HJPA 4AVNA 1VB9A 5FJOA 3VIGA 3BJTA 1LG2A 1ICQA 2A4AA 3C4UA 3M43A 3FVDA 2J77A 5DCEA 4HQVA 1GKQA 1ZPTA 1F07A 1IZCA 1UHVA 4EX4A 3S5ZA 4PMUA 2CLOA 4U3CA 3THQA 1AH0A 3EOEA 3G2GA 1UD3A 2GK1A 3VD3A 4AD2A 4S3EA 2AGKA 1XIIA 1S2WA 5H8UA 1CLXA 3N9SA 3M5ZA 3HZ3A 3L2MA 2VGIA 3AI0A 1JZ2A 2WXDM 4XZLX 2R1MA 1KCKA 4X9YA 4H9YA 2BASA 2D2HA 4XSMA 3AXXA 3TFCA 1ZJBA 1XF0A 3DFQA 4M56A 1CNVA 3OOQA 5JBFA 1AA1B 1TJ0A 1W1B1 1PWLA 2ISSA 1B3OA 3WF4A 3BCDA 3S5OA 1O4UA 3VILA 1ICPA 1TMLA 3TVAA 4XTDA 4LBRA 1E4IA 2QDEA 1ISYA 4UR8A 3MCNA 3S46A 2X7WA 5FAGA 1W9DM 3WD0A 4D6JA 4GIRA 3PBMA 5GVJA 3H2CA 2J74A 4XZIA 3W7DA 2HWGA 3H7RA 3NPVA 1GK8A 1E73M 3RLHA 3UGVA 3S2JA 2Q71A 1OX4B 1EGVA 1EC9A 4GYKA 4ZA0A 3FHAA 4DI8A 3KAOA 3HJZA 4AD3A 1CXIA 1XLAA 1MW2A 1Q7MA 4J3WA 1LRNA 1V7AA 4DZHA 4LCRA 3V7PA 3SGGA 3W7GA 1UJPA 1QNVA 2O9PA 4CGTA 1DKWA 1XRSA 2YBTA 3ANUA 1I0BA 1V3IA 3BE7A 3WNOA 4QJ4B 1Q7QA 1X1OA 3W88A 3G1FA 2QEZA 1AQHA 4XZ9A 4IGHA 5IM51 4P8XA 2RDWA 1KC7A 3NG3A 3BQ6A 4P2VA 1TVPA 3HGRA 1FP9A 4HPNA 1V4YA 1D8WA 4IPLA 2A85A 1S1PA 1UH2A 3GU9A 4CU6A 3LCFA 1T0OA 1E55A 4KEMA 1A5CA 1TMQA 3GIPA 2ZA3A 3UG5A 2LLEA 2OMAA 4QM1A 4K6AA 3G1SA 1ZBKA 1R9ZA 1E51A 5EMJA 3DHDA 3IUDA 1K6AA 3BMWA 2JK2A 4JKKA 1DYSA 4JYFA 2X1IA 1QI4A 4PMVA 2VHLA 2F61A 3CT2A 4XIMA 1QU4A 2GDVA 2QCGA 2OSXA 4UTTA 5F2IA 3FJLA 2QKFA 2R94A 3D0CA 3E3HA 1EWDA 3B8DA 4WRHA 1QO2A 1VAHA 3AHXA 1ZP3A 2EPKX 4N2YA 3R0UA 4DBDA 3SO7A 2REQB 1W1YA 2VDIA 3TP4A 1OCJA 3WQCA 1EIXA 3OA5A 3P3BA 3SCOA 3MSRA 1SFSA 3WNKA 1FY6A 4O1DA 4DO4A 4UQAA 4Y6GA 4HYWA 3B8SA 2WNQA 1PX4A 1HF6A 4WOQA 4PRWA 4WXZA 4CD4A 1V0KA 2XM1A 5H8MA 3QY7A 3BZGA 1BKSA 1V6UA 3VGGA 3TNBA 2POZA 4ADUA 3IVTA 1SQ7A 3D6NA 1P0KA 1Z8AA 4BEUA 3DGRA 5CBBA 3M0IA 1LLZA 3IGSA 1GOWA 1Q66A 2A0NA 4X22A 4ICMA 3WMCA 4LWWA 2PWGA 2H8XA 3T2QA 4O52A 3W28A 5E1QA 2GWNA 4UNKA 3WF0A 5EPDA 4JFTA 2QMJA 3WLLA 4NHVA 3EB4A 2BY1A 4AH7A 4IP7A 3W1AA 4AAJA 1W6TA 5HANA 4RXFA 1A47A 1VFLA 4F0MA 2FB2A 3QV8A 5DRIA 3HPSA 3QFWA 4D8LA 4KIRA 3COTA 4AD4A 4AIUA 3F4VA 3DI1A 4GVIA 2G97A 1G5AA 2J13A 4GMEA 1V3JA 4A3RA 3I4EA 3MUZ1 2XWEA 1LBLA 4IIGA 1UW9A 3AZRA 5LIYX 4GQBA 3IVSA 1JJKA 5CXPA 3LXBA 1VEMA 4CVUA 1V0MA 1GG0A 1K9TA 1NWUA 1A4LA 3CZ8A 4JN7A 4LXFA 4KH2A 4QG8A 5ENLA 2IKIA 2OYMA 1OWQA 1V6WA 1Z9AA 3UWZA 1YTEA 1J4EA 4PSRA 4WDWA 1P0DA 1TX0A 4MADA 4GH3A 3VNKA 1VPYA 3NZQA 2W6RA 4S3JA 5HPOA 4UNIA 4NZ3A 4HKPA 4W5UA 3NA8A 1FWBC 3E0LA 4X9SA 3LHUA 5LIUX 5T9BG 1WDRA 4QISA 2PWDA 3UR8A 2AAMA 4LVAA 1BVWA 1K9DA 2OLHA 3L68A 4WY0F 2WW5A 1TZ7A 2YCEA 3FLUA 4J3SA 2BOFX 1ZAIA 4IZGA 4CCZA 4KPLA 1XW8A 3PZTA 2GOUA 4QLLA 1GPWA 4CN4A 4AZ5A 3FCPA 3ZSSA 2CPUA 4DO5A 1HL9A 1ONXA 2VC9A 2VD9A 3WYZA 4GI6A 3ZR6A 3KL5A 3OLEA 4YTSA 4P8VA 4HA3A 2ESCA 2O9RA 3VD9A 1Q6FA 3MYOA 4L9XA 2PTYA 3TN5A 1HT6A 3EXSA 3GTNA 2XVPA 2FGBA 2I14A 2I16A 2V5CA 4O57A 2J7CA 3TTYA 1LORA 1YXDA 3R8HA 5HR6A 3ZO9A 3AIQA 4B91A 4XX6A 3AAMA 4AHOA 4HU4A 5CPNA 2E6DA 2GJNA 4YN5A 4XQ6A 1OT2A 3UYCA 3IWPA 4K36A 5C9WA 4BWLA 3O0KA 1FWNA 4LB4A 3B8VA 1EYEA 2DUAA 1FCQA 1X96A 4P5UA 2FVMA 2DZVA 2PFHA 3VGFA 3NXLA 3O6DA 1WDPA 1KGXA 4NZ4A 2Z6IA 4OOZA 5SWUA 1TIMA 3C2VA 2Z6JA 1Q2SA 3QW4B 2BDQA 3QPZA 5HNNA 3WNMA 1H62A 1NDYA 2ZUWA 3C3NA 2GL5A 3G1YA 2CLMA 4Y7EA 4W8LA 3HMCA 3VZYA 5T26A 3RJYA 5B7ZA 4IIEA 1HUVA 5CC6A 5LNWA 2PF0A 4KF1A 5CGTA 3ARZA 3S1UA 4O4VA 3VNMA 1X97A 4ZTXA 3BICA 1QRQA 2ZADA 4DJEC 4ECLA 1ZNNA 1XBVA 2V2DA 1HJVA 1UYQA 5HWJA 3BWWA 3GVVA 3WZ0E 3O15A 1E15A 1T41A 4H8UA 1O6IA 4EPDC 3LX9A 2RKXA 1GVOA 3WQEA 1PTGA 3M16A 1EBHA 4ATDA 1UROA 4IF2A 4IICA 2E9LA 3AS2A 4UTWA 4P7RA 5ABFA 3CASA 1LQAA 3T8QA 4B2DD 2CZEA 3AIVA 3W1LA 3M1ZA 2PDQA 4CEXC 5GJPA 1UMYA 1GVRA 4GGHA 2VR2A 1V51A 1Q6RA 2EGZA 4M19A 3EDDA 5KZEA 3NOEA 4PEKA 9XIAA 4FOKA 3TJXA 4AW7A 3PANA 5CJMA 1E1CA 2ZRUA 4ILSA 3TTOA 3WNLA 2YW3A 1W5PA 3TSBA 3FVMA 4IFKA 3GC5A 3Q4DA 4WDTA 4HBKA 1G0CA 4M8UA 1LQ0A 1VEPA 2ZRVA 1FCBA 1XLDA 3PPCA 6XIMA 4GX9A 5MKGA 2GQ8A 1GZ1A 3IK2A 1KRAC 1H1ZA 3ITVA 5DXXA 2C91A 4DUVA 4W4QA 2CEQA 2VOMA 1F9CA 3Q45A 2WHMA 3PBUA 4L56A 1M41A 2B7OA 3PUEA 4DRSA 4KWSA 3WUBA 3G1AA 4MSSA 2V5LA 5F4XA 2V6AA 1D3GA 3F5LA 1FWGC 3NEVA 4OUEA 3W26A 1XLCA 2OEKA 2BB0A 7ODCA 4HMCA 1US3A 1ZBWA 1M5WA 1F6PA 3SCWA 1J93A 1MW1A 3W7NA 2WM1A 2D0GA 5HXMA 1S5MA 2VZTA 3D3AA 1ODZA 2PGEA 4K8EA 2OZ3A 4L7ZA 2E4TA 2HRWA 3BV4A 3LZ5A 3WD4A 1SM9A 2GGEA 2FGZA 4CKQA 4Q8OA 2G4FA 1BYCA 1KQYA 3K4WA 4WLCA 2CZDA 3VIKA 3VX0A 1B1YA 1MNSA 4L4PA 3TR2A 1TTIA 3GU1A 3SECA 2QV4A 3E0IA 1YBQA 3WQ5A 1WXZA 2X1UA 4LUTB 3AZSA 1IWBA 1XLEA 4GO8A 1JPIA 5C70A 3S1VA 5CLTA 1XLHA 2VUNA 4DO6A 1X7FA 4QLKA 3WFZA 4WUIA 1A5BA 2E1DA 3L0KA 3V35A 2P0IA 3S0CA 3CO8A 1KNWA 1XCFA 3I6EA 1XHGA 4W93A 3WDPP 1Y65A 1FWRA 4CNSA 1ZSXA 3RDKA 4MIMA 3NYZA 1Q4WA 4A2SA 1MMFA 1IEXA 3VVGA 3K8MA 2C79A 3RFAA 3TA6A 3NL3A 2FPVA 4MY9A 1M7XA 1V6VA 3PR2A 2F38A 1B31A 1AQFA 4B3ZA 4GUGA 2OWCA 2Y8VA 2QCDA 1ZALA 1WDWA 4TX9A 3MP5A 1DEDA 2E9BA 3VTRA 2DIEA 4QIUA 4L80A 3FIGA 3CAWA 3WDJA 3RLUA 4OV4A 4CQCA 3THDA 3B0YA 2VFFA 3HJEA 4DXXA 4S3BA 3QRHA 4QQUA 1EOMA 1PHWA 1E6QM 3K5XA 1EZ2A 2NZLA 2ZXDA 3CV2A 1C8YA 3JS3A 3DC0A 5C2XA 4JICA 3OP2A 4DM2A 2YDAA 2OTDA 5TBOA 3GM8A 3PWAA 1OX6A 2DSWA 2QJJA 4E4FA 1RPXA 1SZEA 4JS3A 3EEGA 5A6TC 3UJSA 4WX2A 4W88A 3VKDA 4V33A 1TV3A 5XINA 4TV6A 2FFCA 3BLDA 1MW0A 3L7RA 3N14A 4NZJA 3WQ6A 2ZA1A 5A8MA 2CXEA 3THUA 1GEHA 3OGRA 3MUY1 3HOJA 5BRQA 1GOIA 2E25A 3Q67A 2X7VA 1XLGA 1H0GA 1GVYA 2FZ9A 3R25A 3EMCA 4NIRA 1M53A 3QOKA 1RXOB 4KWVA 1H7WA 1P48A 1EYWA 2CITA 3DUGA 2BOEX 4Q33A 2CHNA 5DT7A 2E6YA 1DTUA 3FJNA 3TN6A 1EHAA 3FW6A 5AHMA 4AFYA 1RCQA 2E8ZA 4IFRA 3W6LA 4KESA 5G1MA 4JTLA 4YCOA 4C91A 4QITA 1QNSA 1IGWA 4Z2HA 3E38A 3IANA 5I3JA 5FF2A 3TDFA 4XAYA 1KTCA 3TYUA 1TPEA 1YDOA 3VD4A 3WFAA 2X40A 3OZPA 3WK1A 1S5WA 4UFMA 3ZYZA 1AUSL 1JZ5A 1O12A 2HK1A 4K1GA 2TAAA 3MDUA 2ZA2A 1W2PA 3GNXA 5DO8A 3O9NA 2A6LA 3PAJA 3KBWA 1V0LA 3VMOA 3E9AA 5XIAA 4GVHA 5LXXA 3EPMA 3RRAA 4OE7A 3ERPA 2X09A 1TMHA 1ECQA 3KP1A 2Q02A 3VA8A 9CGTA 4C6KA 2AMGA 4A8NA 1HKWA 2O7SA 4C6FA 4JDBA 3WENA 2J6VA 1DWAM 4B90A 4GXMA 4J4KA 1LTDA 4MKVA 3GH4A 3GH5A 4RR4A 3T78A 3L9CA 4LV9A 3WQGA 2OLAA 2A6NA 4JKLA 1GNXA 3A9IA 4GNVA 5FF0A 1AFSA 2GZXA 7CGTA 3ARSA 1KLZA 2EQDA 3QJAA 1EJUC 4DBEA 1VFTA 3B8TA 1SYTA 2ISVA 4G7EB 1RJRA 3OVQA 4PODA 4Z1YA 2OR2A 5DLCA 2AMXA 1VIZA 3GC4A 4OIFA 3VKAA 3WQFA 3LLXA 3PSVA 4UQBA 1O66A 2VD8A 3EDEA 4JXCA 2WPGA 5EFFA 3PTDA 3SN0A 1WOAA 2P8CA 3THAA 3QMSA 4UQEA 4Z1DA 3PJWA 4ZOAA 4Q8QA 1I2NA 1KM2A 3G77A 4DZ5A 3L65A 3ZWSA 2DFAA 2VC7A 4ACYA 1E6PA 3BLFA 3D46A 4DM1A 4Y8FA 3NQEA 4OECA 2YLAA 7REQA 2WHKA 4D6GA 3RPTA 1TRDA 2ADAA 2RDTA 3ZVHB 1GTEA 1OIMA 2GVJA 3WG6A 1SFJA 3CMGA 5FF7A 5E5CA 3RGTA 1AJZA 3VDCA 3K13A 4EPKA 3GDTA 2X16A 4CNTA 3B8UA 2GWGA 4XKYB 1U30A 4NAFA 2GUBA 3KW3A 3VIOA 2ZRXA 3P2VA 3WUGA 3E0FA 1FH8A 4DWSC 5I2UA 1KM4A 3L2IA 4NP7A 2OGJA 1KTBA 2VFHA 5CGMA 3SURA 2D0FA 3V36A 3NUKA 4RZ5A 3BG3A 3I68A 1XS2A 3ARVA 3DCPA 4GQRA 1Z44A 4R7JA 1W1A1 2BNJA 1DIEA 4WJXA 1PWMA 2Y85A 3M0VA 4AWEA 1DWGM 5C7HA 2Q3OA 3W76A 1PS9A 3VDGA 1KBKA 2E6FA 1MDLA 1VD6A 1EP3A 3GIQA 4C5ZA 3E2RA 5BXTA 5F2MA 2WJDA 3R1ZA 1NP0A 4JIPA 2JGQA 2JEPA 3QZAA 1DJWA 3N25A 3LS9A 5I79A 4G1KA 1XH1A 3EKLA 4F9JA 4ZZ9A 1Q65A 2X2GA 3KS5A 4KERA 4PUDA 1M65A 2W63A 4IGNA 3TAOA 4GJJA 5HPCA 1BWVA 3UXKA 4Y8EA 3OJGA 4DQWA 1TA3A 2FTYA 2NX9A 2V30A 4F8XA 1VQTA 4R53A 4UIOA 3TK7A 1Y5XA 2DSZA 2VGGA 3KCLA 4EANA 1LOLA 4DJDC 3UETA 5A8GA 1WUFA 1M6JA 3SRDA 1E5NA 3IRDA 2QF7A 1UWUA 3S47A 5A2BA 1B9ZA 2PC4A 5LNRA 3AS1A 3WD3A 1F6KA 5FF4A 5AC4A 1RLCL 4ZQPA 4AF0A 2VFDA 3JR2A 2WMHA 1NWRA 3AISA 1W9XA 3OLIA 5IBXA 2Y6ZA 3N12A 1LCOA 2VDGA 4JTUA 1O5QA 1JFHA 1YE4A 3QGVA 3BCJA 3W02A 3GH7A 2XVNA 4LAKA 3ZS4A 3URAA 3VNZA 5D09A 3O1NA 4TV5A 4TXEA 5CBJA 4QFUA 4H9TA 5TF0A 4TMCA 3CYVA 1HKVA 4ML9A 3H24A 4H1ZA 1G9HA 1CECA 1KRBC 1C8VA 2PB1A 1V3LA 2G95A 2QUTA 1UR8A 2ZRWA 1I75A 5A94A 4FI4A 1BG4A 2JF6A 3FN9A 5HQLA 4C65A 5CPQA 3A5FA 1BKHA 1CTNA 1P6BA 4DB7A 4GABA 1L2QA 4JAWA 1BTMA 1QVBA 1S2CA 3MV01 1FWFC 4Q4MA 4P7QA 3LCIA 4HPGA 3LCHA 1Q6QA 2NVAA 1XYMA 2V69A 4AWSA 1RBAA 3IARA 1PVNA 2IW0A 3F4NA 1US0A 3VFCA 3RR1A 5I0DA 1JGIA 5BU6A 4P7NA 1VJIA 3ITGA 1SPQA 1JPKA 1EOKA 4E8DA 2ZFAA 5I3GA 1YNPA 1SMDA 1SFTA 1OZMA 1XRVA 4N4QA 5EKYA 2XFYA 5CJNA 1MUCA 1JCJA 4W85A 2G96A 1IIGA 1K1DA 1NDZA 3E96A 3M6YA 1H4PA 4EF8A 1NH6A 3ZJ8A 2G3NA 5D30A 4HN8A 1A5LC 3GE7A 2E3ZA 1XJBA 4WKAA 4IH3A 2PGFA 3N6JA 1JXJA 3PTQA 3VGBA 3FJ4A 4D6EA 3ONCA 3GSMA 2PRHA 1KM1A 2TSYA 3DYPA 1R0MA 2B31A 5K4XA 1ISVA 1CLVA 1PKYA 4KRZA 1X6UA 2XYLA 4GNJA 2A79A 4Q4RA 4FHAA 2ZXQA 4UC5A 5DANA 3STFA 4DBUA 4G56A 3PBWA 5DN1A 2Z29A 3G3DA 1JF5A 1BQGA 2PE4A 1E0WA 3NPWA 2QJGA 5BZAA 1GYLA 3AIUA 1A53A 1Y5WA 5GNZA 5U4NA 3W74A 3OYXA 1W3NA 5I6SA 2IUZA 5EFDA 3H2NA 5D05A 4C6CA 4PH6A 4JCLA 4IQEA 5LSMA 1WPCA 4JPGA 1YPXA 3R11A 7XIMA 4O8AA 3EA3A 4Q4KA 1K7EA 4QDPA 4AZ6A 2X2YA 1KKRA 4C6OA 7ENLA 4FNQA 1DJXA 4UZSA 1K8YA 1IT0A 1UB3A 3PUOA 1TELA 3UY8A 4H4IA 4DXKA 3LD5A 1KW1A 4BEQA 2W91A 1YDNA 1XLKA 4LNYA 2PWFA 3MWAA 4LVBA 4DXVA 4L61A 3AIEA 1HN1A 4ZXOA 3PB0A 2IQ0A 2YLLA 3AJXA 4LYQA 1VFUA 3SDOA 1VP5A 3N2BA 2A3EA 1J0YA 3B9OA 4LGXA 4HB7A 1TKKA 1XGZA 4RUBA 3STCA 3WLJA 3AZTA 2Y7FA 2B0MA 1RA0A 3DEQA 4E2BA 5D38A 1J2WA 1IEIA 3W7PA 1OGSA 2VWTA 5JMUA 3NSXA 4F0HA 2UY2A 4TR9A 1JCNA 4AISA 3RLVA 2YA2A 3VAVA 3KBNA 2BODX 3EAUA 3O63A 1KFJA 5HWMA 2CU0A 4OU1A 3DGBA 2PU1A 1BTCA 3JVAA 4OBRA 1OX5A 3V3WA 3KX6A 2QJIA 1FX6A 1S5VA 5DMNA 3VE9A 5C71A 4O18A 4WSJA 3DDMA 1YNYA 3GXTA 3OW1A 1UWQA 4RCXA 3HQ1A 3ZVIA 3K1GA 1P7TB 4JYDA 4LS2A 3WK0A 1ONWA 2AKZA 5D9MA 2NVCA 4B5VA 6REQB 1JYXA 1OY0A 5J04A 2PDIA 2ZZ3A 2QNEA 4FR1A 3TIMA 1TYGA 1YE6A 5G1YA 4LEFA 1UD5A 4GK8A 4XAZA 1N82A 4RJEA 1A49A 4ENLA 2NXIA 2XPKA 2ZE3A 5AYBA 4QJ3B 3S2MA 3CB8A 2IKGA 1EO7A 5KITA 1R38A 4EWJA 4CU7A 3MUCA 2VC6A 1AMYA 3UG4A 1NU5A 4GLEA 5JH2A 4RDVA 1QI2A 1P6WA 4HCDA 3FX4A 2G37A 4Y9AA 3AMKA 3VINA 1ZLPA 3XIMA 3KRUA 2CBJA 5CQ1A 1VBHA 3C0JA 4QXIA 3BK0A 5G5IA 5U7SA 4UR7A 1R9XA 3BC9A 1G4PA 1OF6A 1U2YA 3WQPA 4YPJA 5LNUA 3C56A 4YTUA 1WZAA 2YW4A 3KCJA 1G4EA 2VMFA 1W9BM 4S2BA 4OFCA 2F8QA 3M0ZA 2ZTJA 3EOOA 3REQA 2Z1SA 1Q8JA 3MHGA 5E9AA 3LQGA 1V77A 1DV7A 4QGCA 1JZ6A 3I10A 2X42A 3T0CA 3TXVA 2EJ1A 4DEFA 1A0DA 4Z2JA 1XINA 2CLFA 4XZHA 1SSDA 4JHOA 1XLJA 1M7OA 3UWEA 1VH7A 1W0MA 3WF2A 4H6KA 1XYAA 3LB0A 3NZRA 1GYMA 4AZCB 1LL6A 1DQWA 3P8JA 4MY1A 4JN8A 3HPZA 3TCEA 4TVUA 4BZYA 1Q8AA 5AC6A 3TC3A 1KXHA 1EA0A 4I7WA 1JGMA 3CHVA 1XYCA 5T8GA 5BCAA 1W54A 4AQLA 2Q01A 1J6PA 4ORMA 1EA9C 1F6YA 2V9DA 1UKPA 3KDNA 3MVTA 2DZXA 1FWHC 2DW6A 3PG8A 4Z1AA 3RO8A 3DXIA 4OQVA 4AY8A 1BRLA 1H11A 2PBGA 1DWJM 3H6OA 3GXDA 3MS8A 2XINA 4JIHA 4UNLA 4G1NA 1HX0A 4ZOEA 3F7JA 1RJPA 3RU6A 3QV7A 4HHLA 1A5OC 1XLMA 4B5WA 2FLIA 4UFHA 1R3RA 3TLLA 2AL2B 3B0VC 1A5MC 4GUFA 1VHCA 2QJNA 1KFBA 1PZ0A 4LEQA 3UEQA 3IJDA 1NOWA 4BI7A 1QBAA 2CERA 4OTKA 3GYCA 4G8TA 4GKTA 1QASA 2FH8A 1V7YA 1QW7A 1POJA 1ZBVA 2IPWA 2Z2BA 4F66A 3ELFA 3M0MA 2PWUA 3WDHA 3MJYA 3N3TA 3F4DA 1VFFA 1SMAA 5I09A 2E77A 5AHIA 2WNNA 1MWOA 3KEHA 1J0KA 4GC4A 1R6WA 3EX4A 4XISA 5KSWA 4FNSA 2VGFA 2DZTA 2QCHA 2ZC1A 3R5EA 3W7IA 2UV8G 3FA4A 3VCNA 2VZSA 4DHGA 2WOQA 3AS0A 2PLCA 4RW5A 3N4AA 1V0NA 1E0VA 2IXVA 3CPRA 2Q8XA 1RVKA 4DJFD 4A8IA 3ZZ1A 5A5WA 2VP8A 2W3ZA 2PDJA 3RX3A 4XBJA 4HCHA 3MB9A 2X30A 4F2UA 4PRRA 1BF2A 2Z25A 3CAKA 1GORA 3OVPA 2V0TA 5D04C 2WC4A 3A4XA 3NPXA 1H5YA 3DFOA 3SZ8A 1VZWA 1ISXA 3T55A 4HGXA 1C7SA 2OPJA 1KXTA 4TOQA 4D71A 2BVDA 2I7GA 2D1ZA 3C2YA 3AC0A 1GT8A 1TVLA 4GACA 3OQEA 3NQGA 1YX1A 3BARA 1V6TA 2ON3A 1QPQA 3NPUA 2A3BA 2P88A 4NZ5A 4PMZA 3FSTA 3OVRA 1T7LA 3TROA 2WVUA 1LYXA 3HQOA 3U48A 1MNZA 1JAKA 3KBJA 2GGGA 2Q09A 4A29A 2NX1A 4KWOA 4LYRA 3EWZA 4HNUA 1OEPA 1YTDA 4RNFA 4Q7BA 3VMNA 4U10A 1VC4A 2BMBA 2OYLA 1OIFA 2KX9A 2WZMA 1O60A 3WEZA 3NQ8A 3L5AA 2WLYA 5LHFA 1HVXA 4XB3A 3IS4A 3ANVA 3T6CA 3WN6A 1HKIA 1ZBCA 4WGXA 2BOGX 1J0ZA 4DUOA 2NQZA 5K7JA 1CYGA 3KRBA 4DJEA 1S46A 3ZQ9A 5TNVA 1GQNA 3ITLA 4PUNA 3WJXA 2V68A 2DU2A 5JIWA 3UCDA 1VHNA 3FKRA 1HJWA 3UR2A 3BZJA 1LOQA 1ISZA 3VUSA 3NDYA 1UZ4A 2WJFA 2F84A 3NQ7A 4AD5A 3SFWA 2W92A 3S42A 1F8MA 3KP0A 4OBTA 3C8FA 1QDSA 1DPMA 1TG7A 3ARTA 1JQVA 5AHFA 2OWWA 3LGEA 4FOUA 1QXLA 4LS0A 2X41A 1CBGA 3E5BA 3RLGA 5GQBA 1GW1A 4OGZA 3S2NA 3G22A 4CVWA 3E2VA 3EX3A 1LUCB 1TCMA 2C3ZA 1E6RA 2ALDA 4F2BA 2YL6A 1REQB 4K1WA 1KO0A 3KUMA 3B4UA 1PJ9A 1RUSA 4NJJA 3WO8A 2FB3A 3CEPA 4MWAA 1YHTA 3QGAC 5A6BA 2PPGA 1UWSA 4QG6A 4NU7A 1VENA 1BQCA 2X1SA 4GUHA 1AW5A 1OD0A 3N17A 4N02A 1CXFA 2XHYA 3L66A 5DCBA 4E2VA 1C9WA 3HG4A 1G7UA 2FH6A 3W1PA 3WQDA 3CLMA 4D72A 4XZBA 2GQAA 5TIMA 2VX4A 1VYRA 2HROA 2QQ6A 1AH4A 3HM7A 5FKYA 3OEXA 5C2CA 2HDJA 2IS7A 4D6IA 4YYCA 1RAKA 3GWQA 3VIIA 2OO0A 3L4YA 4W8BA 4L9ZA 1WZKA 3S6DA 3VO0A 4ICNA 4LTSA 2TRSA 3AWNA 3WK2A 4D8AA 2XG9A 1SR9A 3AXHA 3E74A 4MG4A 1HJXA 3VNJA 1OT1A 4ACZB 1ML1A 4LU0A 3VABA 4AZBA 6PTDA 3PUGA 1VYPX 1BXCA 5A69A 1H50A 2RGLA 1I0DA 2J7EA 5M03A 2V38A 2YPIA 5LXEA 4MJMA 2NQ9A 2FPTA 1LLOA 3MU7A 4TTUA 3QLDA 3LTYA 1N8WA 1OFQA 4E0CA 1QW8A 3LHWA 3QFEA 2X0HA 1GVSA 4LSBA 3TJIA 4Q8PA 3BQ5A 1B30A 1OFEA 2QCNA 3GS6A 4FPSA 3MZNA 4GUJA 4QG9A 4IGSA 3I7SA 3RNDA 2XIOA 4Q4OA 1M03A 2E5BA 4ZO7A 3KTSA 4PBFA 1H0IA 2J75A 4QX4A