3THAA

Tryptophan synthase subunit alpha from campylobacter jejuni.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
248
structure length
248
Chain Sequence
AMVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIADAAKIALDQGVDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVPELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVEEAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKCFKQGNLDIIMKDIEEIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan synthase subunit alpha from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 78
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2011-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3thaA00
4ZMGA 3HOJA 1VPXA 1H61A 3O63A 1ME8A 4AF0B 1VYRA 3I68A 4UTLA 1X7FA 3V75A 2TRSA 4Y9AA 4X3ZA 4HT3A 4MFEA 2Y7DA 3HGJA 3BPWA 5BNKA 3SECA 1T96A 1WQ5A 4FO4A 1E51A 4LRTA 4MLJA 2DZUA 5CZTA 3MI3A 1BKSA 3WFAA 4ICNA 1I45A 3P8IA 2A2IA 3IVTA 3PM6A 4JICA 4R34A 3W2JA 3CEUA 3QQ0A 2C16A 5FEWA 4UTUA 2XFWA 3TV8A 1PHWA 4WZHA 3TSBA 1PIIA 3EB2A 5D38A 5H2ZA 1W8SA 1H60A 2YSWA 3G18A 4AVFA 4K38A 1EA0A 4R33A 1RR2A 3IIVA 3W76A 4ZQPA 1GYLA 1HO1A 3NXFA 3WJYA 3F4NA 3PG9A 2Z1BA 3B04A 1FUYA 2Y61A 3NOEA 3MHFA 3GR7A 3GZ3A 2A6NA 5A8GA 3G8RA 4Y6GA 5CPLA 3W07A 5U7SA 3BG9A 3VI2A 4IXHA 1XL9A 3A5FA 5AN7A 3FYPA 2Z6JA 1VHCA 3NPVA 3GNDA 3U8GA 3O16A 2PRLA 2YYUA 4UTIA 3S5OA 1VCVA 5E0KA 3W73A 1UB3A 2EGZA 5G4WA 5G2WA 4J9JA 3ABSA 2A7RA 2XN1A 1AG1O 1RPXA 2ZZ1A 1PS9A 1W5OA 5I3HA 5FF7A 1PV8A 3M5ZA 4IMDA 7TIMA 3T40A 1GWJA 4AAJA 4N2YA 2GPTA 3K30A 1G6CA 1VR6A 2Y62A 4JDYA 6ALDA 3W7MA 4UFMA 4OQVA 3W7CA 5TBOA 2CLFA 2J27A 3SIZA 2Y7GA 5K3VA 5FI8A 2BLEA 4P61A 2Y63A 2QCCA 1VC4A 3NM3A 2ZYFA 4BF9A 1JCMP 2X1TA 4K36A 2I9EA 5BMXA 2ALDA 3P5ZA 1ALDA 4GXMA 3W1LA 2F7FA 3PG8A 3B4UA 4JTLA 4LU0A 1GQNA 3LTPA 4Y8FA 1MEIA 4IJBA 4N9DA 3KX6A 1FCQA 3G1FA 1FX6A 3NL5A 4MFDA 3VFLA 3CM4A 2QCMA 1J2WA 2CZEA 1FY6A 3LCFA 3E96A 1LLWA 4RZ5A 4CQ8A 1Z44A 1H5YA 4ZQMA 2JGQA 4MOZA 3HO8A 3CIWA 3TE9A 3FA5A 2EKCA 3RF9A 2HS6A 2PE4A 3N9RA 1EP1A 2R94A 4PL2A 5HNRA 3W1XA 4DO4A 1G7VA 2X1SA 1KFJA 3PF3A 3M47A 1IIHA 4NNCA 4LVBA 4HPJA 4RV8A 4CQAA 4JXCA 1UBSA 3HIJA 2QUVA 1S5WA 4WQ6A 3QH2A 4LW7A 1F6KA 3QJAA 4HPXA 4O4VA 1XCFA 3HB9A 3OA3A 1LCOA 3LTSA 3W3OA 4BR1A 1G69A 3TXVA 1KW1A 1D9EA 1TV8A 1SZGA 4UNKA 3W7IA 1NSJA 1KM0A 3N14A 4O14A 1GPWA 2WQPA 4XTIA 2NXIA 2DJXA 3NZRA 3CPRA 4A2SA 5LNVA 1IXQA 1QPOA 4O0KA 2OZ0A 3T7VA 2AGKA 3FKKA 3B03A 1ZAHA 4RKAA 3TMQA 3P82A 1VS1A 4JTEA 2DU2A 2BTMA 3QC3A 4AWUA 2QCNA 1KBJA 2CZDA 1KFEA 4S2CA 3T78A 3MBDA 5D04C 5FESA 3W1RA 3THQA 5C54A 4RLIA 3ABRA 4H6KA 3P67A 4NNBA 3PVFA 4IMCA 2FDSA 2Z6IA 1VCGA 1W37A 4RCXA 4YCPA 1N55A 5HMSA 4O54A 4D2JA 3UWZA 1LYXA 4DQWA 3S1UA 3MYPA 1OX4A 2VFDA 2QF7A 3GDMA 3NYZA 5EPDA 1SW3A 1SZNA 2QKFA 3SZ8A 1W5QA 3EWYA 3NQGA 3PB2A 3DI1A 3NR0A 3TC7A 2NX1A 3UXDA 4NXKA 5AC8A 3W7PA 3M9YA 1Z48A 3W7DA 4LC8A 3C2VA 5LGXA 3TSMA 3UWWA 3C2OA 1EEPA 3OVPA 2VOMA 3Q58A 3DFQA 3L67A 3UQNA 5LHEA 2E6YA 1OK6A 2OT0A 1P4CA 2P10A 4TX9A 1NVMA 2P1FA 3W2NA 2TMDA 3HF3A 1A5AA 2Q3RA 4CLMA 1QO5A 1K7XA 1JUKA 3LV5A 1VHNA 3TUUA 3N73A 3FOKA 4NNAA 3V1PA 2E5CA 5F4WA 1KM3A 1FCBA 3OEXA 1M5WA 1RQHA 2QDHA 4FX8A 1I4NA 1L6YA 3W1MA 3W2MA 5D2TA 3QMRA 2GQ8A 5KSWA 4IUOA 2FFCA 3JRKA 1B4EA 1I8JA 4NVTA 3HG3A 1SFLA 2C19A 4QNWA 3B8DA 2UV8G 2WO5A 4FHAA 2R91A 5FEPA 3TU9A 4XKYA 4QM1A 1O94A 5KZMA 3MBFA 3W7RA 3W70A 1RZMA 2VXNA 4JTIA 4O19A 4BI7A 1Z41A 5EBUA 5I3KA 3EKLA 3NAVA 3OHIA 3W7GA 3QMSA 3OBKA 3KVKA 3HJZA 3BLEA 1FQ0A 2D73A 4JR5A 1KA9F 1YADA 2XN2A 3G8EA 3LXAA 4JY9A 1AMKA 1B4KA 3O8AA 1FDJA 2C6QA 4EVZA 1TV7A 1VYSX 3NM1A 1AK5A 4ZZ9A 1T0OA 4UMBA 2C14A 3VNDA 4XQ6A 3AO0A 1EWEA 4UC5A 2NUWA 3NQEA 3C56A 4O1CA 3MI2A 1K8YA 1SW7A 4ZQRA 3SGUA 4AWTA 3NL6A 3L5AA 1G4PA 3SFKA 2OX1A 2HS8A 3NZ1A 4QSHA 4WUIA 4Z1DA 2QAPA 3QPZA 1TTQA 4A21A 2WSYA 3PUDA 4NU7A 5F4SA 1LOLA 1LBLA 4DBEA 2JGYA 4IMGA 5KZEA 3QW4B 1DQWA 3CWNA 4XKYB 3W7LA 2QCEA 2C0AA 4I9AA 2V5BA 3R13A 4AHQA 4K39A 4QISA 2Y7EA 4O8RA 1AW1A 2HMCA 2E09A 4KFNA 3DAQA 2FPVA 2YDAA 4MZ1A 3W7NA 3D0CA 2ZA1A 3L9CA 3KRSA 2V82A 3HG5A 5LNRA 3UY8A 3DKLA 3M41A 3CU2A 3TMLA 5AYZA 3BG5A 2BZNA 2Z0IA 2V81A 3LCIA 3GXTA 1OABA 3HG4A 3L0KA 1KV8A 3S42A 4DF2A 2H8XA 4FIRA 3UXAA 3KVMA 3VE9A 1R47A 3E02A 5K7JA 4AHOA 2WOQA 3L0GA 1DQXA 2VKZG 4LV4A 4N6EA 3DENA 3TH6A 2J24A 4ADTA 3UWQA 4WXZA 3TXZA 5HR6A 3G0UA 5AOUA 4HSNA 2A6LA 5K9XA 3GXPA 3A5VA 4LUJA 2ZA2A 2Y85A 3S6DA 5IM51 3E49A 5AYYA 3B06A 4JX6A 1TPB1 3E12A 4MVAA 5HQEA 2QDGA 3MO7A 3NGJA 4QNEA 1FWWA 4X9SA 5CG7A 4K7YA 1JJKA 3OVQA 1TSIA 3NL2A 1LM1A 1JUEA 2QJHA 1MSSA 3F1QA 3HPSA 4GUGA 3WK0A 4UFIA 4YLWA 2J9ZA 1TTJA 3NPUA 3G1XA 2WPBA 1LRTA 1L6SA 3QW3A 2ZCGA 2HTMA 4JTUA 2NXHA 1NEYA 4GE8A 3GAYA 1FCUA 4M7TA 5CPOA 1JRCA 2V9DA 3MHGA 2DZXA 3O6CA 3PUEA 1R30A 3LV6A 1GJPA 1YPIA 2A4AA 2H3BA 2NX9A 1J5TA 1XUUA 1LORA 1OFQA 4CQ9A 1KM6A 3KOFA 1KFCA 3ZWSA 1T8XA 3TQVA 5I3JA 3I7RA 3TFXA 3UD6A 1ZAJA 4NJGA 5F2IA 5CZJA 3W7EA 1VLWA 3L0NA 1KFKA 1PCWA 3L68A 5DCEA 2FTPA 5CKSA 3O06A 1W3NA 2DORA 1OJXA 3CHVA 4M5PA 3BO9A 1D3HA 1LLZA 1LBMA 1NF0A 3LRKA 2DZWA 3RLVA 5ABTA 2QCDB 2ZZ5A 2Z2UA 3TR2A 3LBCA 4UR7A 3P60A 4QAIA 5HWMA 1W56A 4E2BA 3P80A 1JULA 4ADUA 3TDFA 3PBYA 4BWLA 4LS0A 4FX6M 3SW6A 3W1PA 4N9EA 3CC1A 2BSLA 1Q6QA 1G7UA 5F2GA 1C8VA 3ABOA 5CPMA 4MY1A 4U28A 4M6QA 1DOSA 2VENA 1QOPA 3IIPA 4O1AA 4QITA 3QSRA 4CCDA 4NT0A 2CZ5A 3RFAA 4IPJA 4H4IA 2F84A 3W83A 4EF8A 3PY2A 5K2ZA 3NQ2A 3W72A 4AWSA 5G1YA 3CTLA 3LCGA 4ZQOA 4CCCA 1YTEA 3KRZA 3C6CA 4O1BA 1KTBA 1LRNA 4GC4A 1SUXA 1GOXA 1TPFA 1VH7A 2VC6A 4Q4KA 4EWND 1TPUA 4QJ1A 1XC4A 5AHIA 4MPQA 3W84A 4FNUA 4XZ9A 3W7QA 3W1UA 1NAL1 1GZGA 2CZFA 1IXPA 1QPNA 1PHQA 2B4GA 1ICPA 2CW6A 3MP4A 3EXTA 4C1KA 1OF6A 2PRMA 1KTCA 4HN4A 1Q3NA 4K37A 3GXNA 2FQIA 3I7SA 1FCVA 2GQ9A 3PS7A 4N4PA 1J4EA 3GK0A 5F1UA 3TAKA 1JCNA 4Z0SA 1TO3A 2RKXA 2GQAA 4LUIA 3W6YA 2VEPA 3IIXA 1ONRA 4LVGA 4TMBA 1H7XA 1OX4B 1EUAA 1TPWA 1EIXA 3PUOA 2EPHA 3WJXA 3LLDA 4N4QA 1GTHA 4LY8A 5CPNA 3G0XA 5A5WA 1QOQA 3UZJA 2ZRVA 3CEPA 4LT9A 4UR8A 3NQ8A 2ZTJA 1A50A 1UASA 1LOSA 1QDSA 1QR7A 1XBVA 2VFEA 2ZRYA 4RK8A 3CQ0A 5IBXC 1HG3A 5KTLA 5DCBA 5AC7A 1K02A 1WXJA 3N2MA 4H3DA 6TIMA 1WYIA 1TTPA 4GBUA 3VE7A 3C2EA 1A5CA 3NDOA 1YDVA 1XI3A 4MUZA 2R8WA 3BLIA 1H63A 2BXVA 3DFNA 3A21A 1IF2A 4YMZA 2GVJA 4GUIA 4OE7A 5DELA 1B3OA 3GDTA 4FNPA 1G67A 1SO4A 2FB3A 4UTTA 1GTEA 5D2YA 3NQFA 1XFBA 3ZWTA 3GLCA 3LCWA 2Q8LA 4JD4A 1W3IA 8TIMA 2G97A 4LVDA 1XBZA 3RNDA 3FYOA 3UPWA 1SFJA 3NO5A 1P0NA 4UIOA 1KLYA 3STFA 2QR6A 1WDWA 2A5HA 1DKWA 3IGXA 2NLIA 5I3FA 1MZHA 1F2JA 4PC8A 2NWRA 2WSQA 5CSRA 3L21A 1M7PA 3DZ1A 4JTKA 1RD5A 2RH9A 4JIQA 4GFSA 3TCEA 4FNTA 3SJ3A 2V30A 4N9CA 3NQAA 3GDRA 1XBXA 1OG0A 3DFPA 4ML9A 4DBDA 1H7WA 1X8FA 3TFCA 1RQEA 1FDZA 2B0MA 3EXRA 3FS2A 4O4WA 2W6RA 3S0CA 2BWGA 2DZSA 3G1SA 1TQJA 2CLOA 2ZRXA 4M7SA 3DHDA 1KBIA 5LNWA 1IGSA 1LP6A 1Z42A 5AFDA 2TSYA 1OX5A 3DGRA 2CU0A 3LX9A 4JS3A 4K8HA 1QFEA 1DBTA 3NPXA 1JRBA 2J9XA 1OFAA 3GX9A 3U2OA 5SWUA 3C4UA 1EX5A 4AH7A 3WK1A 3WJSA 1OFEA 4KFPA 2J9YA 5FEZA 3HGSA 3G1DA 4FIQA 4JTFA 4TIMA 5D02A 4NJIA 2QUTA 4LS1A 3IVUA 5LNUA 2QAFA 5G2IA 3S9YA 4C1LA 3HQ1A 4KWWA 4ZQNA 1U5JA 2E6FA 4UFKA 4YCOA 3MUXA 1T99A 3F03K 1HL2A 3EWUA 3LXBA 1PVNA 2GVLA 1QMLA 4O17A 1OYAA 2VEIA 4O18A 4JX4A 4XBSA 4UCGA 5D37A 3IEBA 4L4LA 3W7JA 1YXDA 2CLMA 3G1HA 2NV2A 1KV5A 2YPIA 5D32A 4XWUA 4PODA 3TC6A 1B57A 3QRHA 5C55A 3DFOA 1EP3A 3DH7A 4FXSA 3GVGA 2ABAA 4M6VA 5FF0A 4OU1A 4JTTA 3HMJG 3PBWA 4YWIA 4DF1A 5CZ0A 4UFJA 4JYDA 1TPVA 4MYAA 2TPSA 3LHZA 1JCXA 2IQTA 3UNDA 1GYNA 2J88A 3LGEA 4RZ6A 1YDNA 3QFEA 4JTSA 1JQXA 1OK4A 1R2RA 5H91A 2YW4A 3LRMA 3UWYA 3MI6A 3N2XA 3W88A 3YPIA 2QUUA 4N6FA 2ZZ3A 5LNSA 3S1XA 1S3HA 3GIYA 3O1NA 1ML1A 1TV5A 1BWLA 5LZLA 1RVGA 1VZWA 1X1OA 5BMWA 1H62A 2ZZ7A 3C61A 1Q6RA 4MKNA 4HNVA 3JS3A 2NUYA 4MJMA 5AHNA 1AL7A 5CSSA 3R2GA 2OT1A 1K7FA 2JKAA 4TO8A 3O6YX 4K7VA 2B7PA 4BWLC 3C2FA 4O15A 5DY3A 4K8EA 1SW0A 1MEWA 2GJLA 4P2VA 5HUOA 1BTMA 1W54A 3UWVA 3B0PA 5K4ZA 1PE1A 3HPZA 1QO2A 3GKAA 3M5VA 4LWWA 1WAUA 3A23A 5DXYA 1GG0A 1LTDA 4JIPA 5L9FA 1GT8A 4NJJA 4O52A 3GKFA 2A85A 3W1QA 2WNQA 1TRDA 3HPXA 4TU1A 2A7PA 4JEQA 2WNZA 2ZFAA 2Y70A 4RZ4A 4ALDA 4EOUA 1SZEA 1THFD 3R89A 3UYCA 1IXNA 4JTGA 1YPFA 3PAJA 4Z0JA 3UPBA 3B0UX 1QWGA 3P61A 3R12A 1PL9A 3N34A 4OT7A 1TREA 3O15A 2X1UA 5AHMA 5EKYA 3KFTA 1OHLA 4N9BA 4S2BA 5TIMA 4LNYA 5C2XA 1G4EA 2TYSA 3Q37A 3QEZA 3IRDA 2WNNA 2CLIA 2Y7FA 3NVTA 4LV9A 1LZOA 3TW6A 3W7HA 1KLZA 1I2QA 3QMTA 3LB0A 1DV7A 3T55A 1MO0A 3IGSA 1LDCA 4O16A 3PC0A 1SO6A 4AMAA 3G3DA 4CNNA 4CNOA 5LKYA 3L5MA 3O6DA 1ICQA 1P1XA 3LLFA 4NJHA 1F5ZA 1OYBA 4UUIA 1JCYA 1EPXA 4NXSA 4UMAA 3Q94A 4HSOA 2FLIA 2OMAA 4JX5A 5BOOA 3TJXA 3HGOA 4Q33A 3H53A 5AC6A 2WSRA 2X30A 1Q45A 1RQBA 3BLFA 2X16A 4IX0A 3W7OA 1WOAA 3B0VC 4IGHA 1YTDA 4L4MA 1H51A 5DY2A 4WY0F 2QJIA 3DFSA 3MP3A 3U6WA 5AHFA 1LRQA 1TTIA 1XDMA 2E6AA 2YFNA 3SI9A 1I2OA 5K4XA 1TCDA 3N9SA 1XUZA 2VELA 3DFTA 3W71A 3DU0A 2GVGA 3FKRA 4FNRA 4WY0B 4RX0A 1O95A 4DPPA 1YLVA 3Q2DA 3L5LA 4O0ZA 5F4XA 5D05A 4WJEA 4GNJA 5EA9A 1JUBA 4IXXA 4OHQA 4UTWC 3LHWA 2V5LA 4GUJA 5FF2A 3CLMA 2B7OA 1EB3A 3EWXA 3O07A 1DHPA 3ZS4A 5KZDA 4A2RA 5LHFA 4PL1A 1H7RA 3MYOA 3W74A 4PTNA 4UTKA 4JNMA 3FJLA 1Y0EA 1GVQA 2YFOA 1ME9A 1G4TA 1I2NA 1TB3A 1YXYA 4UFLA 3FLUA 2V8ZA 4O57A 1OFRA 1B9BA 1KFBA 1TJPA 1SPQA 1C9DA 3MJYA 3CIXA 1Q6LA 3KHJA 5DN1A 4LVFA 3W2LA 2C15A 5BRBA 3S5NA 2AAMA 4Y96A 3M5YA 1WA3A 1JCJA 3BW2A 3M5XA 1WBJA 3NG3A 2G5WA 3GYEA 1FWNA 2ZDRA 2GOUA 4HIBA 4DPQA 3BG3A 5EL1A 4O53A 3UWUA 2V0TA 1L6WA 3TJLA 2E1DA 1ZJIA 5DXXA 4IMFA 2LLEA 3BVJA 4KWVA 1ZNNA 4E2DA 3IVSA 4ORIA 3DI0A 4QIUA 4AHPA 5F1VA 1S5TA 4WOZA 3QF0A 4PEKA 2YXGA 1AW2A 3LXCA 2CLKA 3KVJA 4IOTA 3VCRA 2E6DA 3LI1A 1N7KA 2YCEA 3G1YA 3I7QA 2H6RA 3OVRA 1TPH1 2G95A 1F73A 1NF7A 1XM3A 2ZA3A 4GUFA 4O28A 2DZTA 4EIVA 5I3IA 1ZCOA 3PSWA 3FFSA 1W31A 3E0IA 3MP5A 2WKJA 2C18A 4LRSA 2ISVA 1K8XA 1A5BA 3S1VA 1WX0A 2ZZ4A 3S8HA 4BK9A 3P81A 5G5IA 3L66A 2PRHA 1TJRA 1ICSA 1MEHA 3QYQA 2GJNA 3NQCA 2E77A 5IBXA 4OWGA 1RV8A 3LHVA 5J5RA 1K7EA 1OFDA 2FPYA 1C29A 2FIQA 1FWTA 4BFAA 2ZRZA 4JY8A 3EX6A 2A21A 4NX0A 5DBUA 4CNPA 4R7JA 2ISSA 2RDTA 1BWKA 1D3GA 3ABQA 4OV4A 5L6UA 4JTJA 3W75A 4DXVA 2JBMA 1A5SA 4GWEA 1SSGA 2ABBA 2VFFA 3MWAA 1F05A 2ATSA 4Q32A 1HFBA 3C2RA 3DKJA 1ZFJA 3F4WA 2E5BA 3PBUA 2VFGA 3DXIA 4YXGA 3P8JA 1ZAIA 5MHBA 3W2KA 3NPWA 3T4CA 1GVSA 2QEZA 1OFPA 5K9DA 3WJWA 1F7BA 1CW2A 1LOQA 3TA6A 1JR1A 1VCFA 3BGGA 3P62A 3SR7A 1S5VA 4IX2A 1VYPX 4GJ1A 4UTWA 3H54A 3W9ZA 5K9CA 2W0UA 2X2GA 4A22A 1H50A 3LCXA 4RXFA 3C0JA 4RJEA 5J5DA 2WV8A 3HBLA 4ZL1A 3STEA 3ANYA 1SO5A 1JVNA 3NQ7A 1JQVA 1MXSA 5DCDA 1KTNA 2PCQA 3NQVA 2YGYA 2A0NA 1TMHA 2QCDA 3PB0A 3GB6A 1L2UA 3TQKA 1W1ZA 2NZLA 3MHUA 3W87A 4NUWA 4PFMA 4AXKA 4R53A 1Q6OA 2A1YA 1W0MA 3W85A 3M1ZA 3HG2A 3PULA 2I14A 3TAOA 3DHFA 1DJQA 1H1ZA 3I6RA 3G24A 1DORA 4MLRA 2RDUA 1WV2A 4WY0A 1HO4A 1EWDA 1L9WA 4HNUA 1SSDA 4LS2A 5DBTA 1FWSA 3LHUA 3M7WA 4ORMA 4BI6A 3M6YA 2J6XA 2I1OA 1OVDA 1W5MA 2YZRA 3NA8A 3CT7A 4NJKA 3RK8A 2CLHA 1UUOA 4GUHA 4JDBA 2B7NA 2CLLA 1GG1A 1V7YA 1FDYA 2H8ZA 5HJLA 1OYCA 3P84A 4MZ8A 5E1QA 2H90A 4Z08A 1O5KA 4FF7A 5FEXA 5I3GA 3GAKA 4AB4A 4E0CA 4GRSA 5CZSA 3W1TA 2NV1A 1AL8A 3HGRA 4NX5A 3QM3A 1CX9A 4JYEA 1F74A 4O50A 1U83A 2ZRWA 5BW6A 4U4MA 5AHLA 4ZQCA 5EY5A 1SO3A 4RR4A 3EX1A 2R14A 4ZVJA 2ATMA 3BW4A 2ZZ6A 1TYGA 3W2UA 4JYFA 1GVOA 3IIZA 2JKEA 1XDLA 4WXYA 3NEVA 4LVAA 5HULA 1GVFA 3M16A 4I7VA 1HUVA 4EF9A 5F2MA 1YDOA 1XXXA 3ZR4A 5T26A 4Y90A 1H1YA 1H7OA 1DVJA 4BI5A 4WX2A 1JCLA 2G96A 4KFOA 1EUNA 1IIGA 1SZFA 1CI1A 4W9TA 2ZRUA 2EHHA 1QAPA 5C5YA 3N3MA 4XUGA 1QPRA 2V2CA 3LHYA 2XN0A 1ZHAA 2NX3A 2V2HA 5EYWA 1ZENA 1XKYA 1TRIA 3G1VA 5AB3A 3EX4A 3SY5A 3C3NA 1XBYA 4ONVA 3W86A 1OFOA 2VEKA 3MW7A 2Q8ZA 4UTTC 5D2VA 3W23A 2QCLA 1O4UA 5D03A 3LI0A 2C13A 3EKZA 5LGZA 1O60A 5LSMA 1FXQA 3L2IA 4NZJA 1F76A 4Z1BA 1KFLA 3S5YA 3R8RA 3M0ZA 1W5PA 1DJNA 4ADSA 5E93A 3P5YA 2HSAA 2YX0A 1TIMA 4POCA 4O10A 4UXDA 1TQXA 1G4SA 4O13A 3S5ZA 3UZ5A 2YR1A 1WBHA 2EF9A 3NNTA 4DELA 2NWSA 1K03A 3ZFHA 1R2TA 1WOBA 2C1HA 1ZY9A 3SSJA 2ISWA 3G3MA 2AQWA 3WK3A 4QQ3A 3RLUA 2O7QA 2RHGA 1EP2A 3LRLA 3PSVA 2ZBTA 3KRUA 1YTKA 3FJ6A 2QJGA 4UMCA 4MZYA 4IMEA 3LOTA 3TQ0A 4FX7A 3VKJA 3H55A 2FB2A 5HR7A 5DLCA 3QSTA 5AYXA 2Q3OA 2EAWA 2VFIA 1P5BA 3BW3A 3ELFA 5D2WA 3P7YA 2OCZA 4IPIA 4AEOA 3TW7A 1AW5A 3ATYA 1LROA 4JN6A 4RXGA 4Z1CA 1I2PA 3TNOA 2YYTA 2BX7A 4UTHA 3S1WA 3KXQA 3LCLA 3EX3A 1UCWA 4LOCA 1M6JA 4KKXA 4O1DA 2Y89A 1VRDA 3LBMA 5AHEA 3TK7A 2V2DA 1K3UA 2Y88A 3DBPA 5GVJA 2A7NA 1X6UA 2PURA 1KM2A 4I7WA 3C52A 3TKFA 4UTMA 3EEGA 1QCWA 1W5NA 5TQLA 3QQ1A 2KZHA 4NQ1A 2PC4A 3GDKA 2ZZ2A 3PBVA 4FNQA 2CFFA 3W22A 2E68A 3GR8A 5U4NA 5C6MA 2E5DA 5KMYA 3M44A 1UJPA 3BK0A 4X2RA 3INPA 1GVRA 4JTHA 4NZFA 1IXOA 4TR9A 5F2LA 4E38A 1F6PA 3QPYA 3LDVA 4DO5A 3CB8A 3L65A 2OJPA 4M19A 5KITA 3EXSA 5FF3A 3UY7A 1OX6A 1UUMA 1KM5A 1OF8A 3OG3A 1K8ZA 4Z1AA 1FBAA 1SR9A 1N8FA 4MY8A 3KVLA 2RDWA 3A9IA 4K6AA 4LTSA 5KINA 5CGQA 4UTJA 1P0KA 3STCA 2NXGA 5EMUA 3PWAA 3FIGA 1OFBA 3NQ6A 4OGZA 4OBTA 3WK2A 3LHTA 1VQTA 3C8FA 2RFGA 4YL2A 4O12A 4FB7A 3A24A 4I7UA 2JKPA 4HHPA 4XBKA 3THAA 4AF0A 2QCGA 2DZVA 1V5XA 3PR2A 2DP3A 4IWWA 2JK2A 3RU6A 4B5NA 3AJXA 3USBA 3JR2A 3CWOX 3TIMA 1DL3A 1BEUA 2YW3A 1ADOA 2WJZA 2O7SA 1H7NA 3IV3A 3IGUA 4M6PA 1W3TA 5D09A 3EX2A 4DEFA 3MMTA 2H3DA 1YXCA 2ZTKA 3FEMA 3QZEA 4UFHA 5D30A 4CCEA 4FEZA 5G1TA 3TROA 3WJZA 3BARA 1KM4A 2DZPA 3BV4A 2X1RA 3EWBX 4TMCA 4MY9A 1NFBA 2VFHA 3GDLA 5FF4A 2P0OA 1YYAA 4LC6A 3TSDA 2ZQ0A 3SGZA 2C3ZA 3GNNA 1TPC1 4HKPA 4FNSA 2FPTA 3T44A 4PA8A 1TPEA 1FWRA 3P74A 3RMJA 1SQ7A 3EWWA 1HTIA 3LCHA 1QNVA 4MIMA 4O11A 3TX9A 3I65A 4S1FA 1TPDA 3O05A 3G1AA 3W1NA 2B7QA 3G22A 2DJLA 4PH6A 1A53A 2GUUA 4MJZA 4PCFA 3KAOA 2CLEA 4HNNA 3LERA 5HINA 3NQDA 4DO6A 1VJIA 1R2SA 2QCFA 4A29A 4MYXA 1KM1A 2NUXA 3B05A 1GEQA 5HWJA 1VGAA 3BGJA 3IIOA 1I2RA 1ZALA 3LM7A 3W7KA 1X1ZA 4DF0A 2VEMA 3N19B 1H7PA 2QCHA 3NL3A 2CWNA 5D2XA 3W1AA 4IQLA 1O5XA 4X22A 3M43A 4G1KA 3OIXA 5D33A 3R5EA 4UNLA 1M7OA 4XTDA 4WD0A 2W79A 5HWNA 3ATZA 4FXRA 1VLIA 5G2HA 3E9AA 1QPQA 4OV9A 4A3UA 4HNTA 4WOQA 4N02A 3A22A 1LBFA 2FJKA 3EWZA 3STGA 1PCKA 5HUPA 5G4EA 3G0SA 1ME7A 4JGDA 3NQMA 3LTYA 1R46A 1FXPA 1SU5A 2Y6ZA
chains in the Genus database with same CATH superfamily
1H61A 4ROPA 1ME8A 3KLLA 4AF0B 3I68A 2HPMA 1X7FA 2TRSA 3R0DA 4Y9AA 3RPDA 4AW7A 2VO5A 3HGJA 5D4YA 5JIPA 2PDWA 3BPWA 3IJIA 4C6PA 1T96A 4QFUA 2DZAA 3DDMA 1BQCA 1KKOA 1UZ4A 2DZUA 4M80A 1BKSA 1WZAA 2PWFA 1XIBA 2PCEA 3PM6A 2INFA 3SQMA 1ITXA 2C16A 4BJHA 4X63A 3E2SA 4AVFA 1AODA 4K38A 4X60A 4S3DA 1OM0A 3IIVA 2CC0A 4RUBA 2I5GA 1W9DM 3UA4A 4J40A 1GYLA 5A6BD 3WJYA 3PG9A 2Z1BA 5HPCA 1IZCA 2OOFA 3NOEA 3N04A 3MHFA 3GR7A 2YKKA 3P14A 4YVXA 3DHUA 1EJWC 3W07A 2AOSA 3VI2A 3PJXA 3FYPA 3GNDA 3O16A 3LPPA 1VCVA 2PWDA 1KQZA 1QI2A 5G4WA 2YDRA 4Y9MA 3UXKA 1IWBA 2A7RA 2E0PA 2ZZ1A 3W28A 1PS9A 2G41A 4ZB0A 3M5ZA 2VZTA 3B9OA 4M8UA 7TIMA 3F4CA 3BJTA 2WMKA 3AC0A 1GWJA 1G6CA 6ALDA 1EQCA 4QQUA 1HKKA 5A6SA 2R1MA 5TBOA 2CLFA 1V08A 5LIUX 3SIZA 2Y7GA 1HKVA 4HZ7A 2PS2A 4P61A 2QCCA 1NARA 2XGZA 3NM3A 4C6KA 2CKSA 1AQ0A 1W1YA 3UR8A 2ACUA 3H12A 3WELA 4DJFC 1ALDA 3SUSA 4GIRA 4JTLA 1Y5VA 1GQNA 3R0UA 4ZBCA 3AWOA 3LTPA 4N9DA 2D0HA 4MFDA 4CQCA 3CM4A 2QZRA 4HU8A 1KBKA 3E96A 2V67A 4JBRA 3HO8A 3CIWA 3UCQA 1OC7A 2HS6A 4RNHA 4XZWA 3MANA 1FFRA 2R94A 1G7VA 3WQ5A 1KFJA 3PF3A 3M47A 2PD5A 4M29A 4NNCA 4LX4A 4LVBA 4MB3A 1C7SA 1O5RA 1UBSA 4XAPA 3WL1A 2G3IA 4HPXA 1ZJAA 1LT7A 3S2JA 1K77A 3LTSA 1XICA 3W3OA 1G69A 2OX4A 3TXVA 3IJDA 2FZ9A 1KW1A 3S2LA 3WENA 1IWAA 3GXIA 2DT0A 4XAGA 4O14A 1GPWA 1NWRA 1QNPA 2DJXA 4YTUA 5HA7A 4FALA 2X2YA 3I10A 3AS2A 2XYLA 2ZADA 2NQ5A 3PZVA 2XH2A 3TMQA 1CLKA 4Z42C 2F9RA 4GZJA 3TJIA 5D04C 1RY8A 4LB4A 4S3EA 2Z1WA 1BRLB 3PK7A 3BZJA 4RLIA 1H49A 4H6KA 4NNBA 5FCZA 3ZM8A 1W37A 4RCXA 1XFCA 4D2JA 1DWJM 1QBBA 3URNA 2Z1SA 1QVBA 2QF7A 1RALA 3BJFA 1BVNP 4DO7A 2QKFA 3DI1A 3PZTA 4I6VA 2OSXA 6REQA 3UXDA 4NXKA 2ZC8A 3AHTA 4CU8A 3M0IA 4WSJA 3N6QA 1Z48A 3C2VA 1ISXA 3TSMA 3UWWA 1PTGA 3Q58A 3DFQA 3FHAA 1UPPA 3BSGA 4D6HA 2X0YA 1J10A 1A5AA 4JCMA 4UZUA 3I3BA 3UFYA 1M01A 3XIMA 3VGHA 3EYPA 2E5CA 3SCTA 4JN8A 3OEXA 2HBXA 3AFBA 2QDHA 4FX8A 3LPGA 3UNTA 3W1MA 1C90A 1XLIA 5D2TA 1FTXA 3QMRA 2NVDA 1WE5A 4HGXA 2G8ZA 4FA3A 4NVTA 1PPIA 3A4XA 3B8DA 4DX3A 5FEPA 1XLMA 4QM1A 4EPBC 2XH4A 5KZMA 1XYAA 4PMQA 3MBFA 2RAGA 2YOCA 1RZMA 5BRPA 2YXXA 3GDBA 1RH9A 3VD5A 4WKFA 5I3KA 1EGZA 2QIIA 3NAVA 3URQA 1MZRA 3QMSA 4WF7A 3OBKA 3GNOA 1YX1A 2XU2A 1YADA 3G8EA 4C5YA 4LB3A 4Q6JA 3N2CA 1TV7A 2ZX9A 4ZZ9A 2C14A 4XQ6A 4UC5A 3HMCA 4YNGA 3DHPA 1JZ6A 4JFUA 2GWNA 1J12A 4Q7BA 3RLHA 3BH4A 3UETA 4AWTA 5T9CE 1G4PA 3AS3A 2HNHA 1GVEA 4IQDA 1YRRA 4DBEA 1R7AA 1KB3A 3ISIX 1QI5A 3CWNA 4XKYB 1XWYA 2QCEA 3GG7A 4MM1A 3R13A 3AXXA 2E09A 1PBGA 1YMYA 2FPVA 3SSZA 5A8OA 3WLNA 4MZ1A 1HP4A 1P43A 3KRSA 3DKLA 1AFSA 3TMLA 5AYZA 3BG5A 3SUWA 2BZNA 3IJ7A 3LCIA 3HG4A 1KV8A 2AKZA 1DIEA 4ZB5A 3KVMA 1KWGA 4GI8A 1R47A 5FL1A 1BKHA 3L0GA 2MNRA 5M17A 3MT1A 4LV4A 3DENA 3TH6A 2J24A 2QW5A 3NJ3A 4GACA 1US0A 3WIJA 4HSNA 2A6LA 5K9XA 2VI0A 2J77A 3CQKA 2ZA2A 2Y85A 2W91A 3E49A 3FX4A 4JNZA 1TPB1 3ZJ6A 4MVAA 2YA0A 3NGJA 4B9ZA 1EJUC 4FXFA 1TSIA 3CJPA 2XZ9A 4IZGA 1A5MC 3F1QA 3A4JA 3A12A 2P8BA 3ES8A 3G1XA 4BS0A 3NO1A 3VOCA 3QW3A 4OOUA 2ZCGA 4JTUA 2UBPC 1QPKA 3GAYA 3IGHX 2FYMA 4GE8A 4L5ZA 4A3QA 2V9DA 3GFYA 2VX7A 3O6CA 1CCWB 1R30A 4R85A 4RE3A 3VC5A 3N4FA 2CBUA 1KM6A 2VM8A 2PLKA 3NWRA 2R1PA 2Y0FA 3TFXA 3UD6A 1S46A 1VLWA 5E0FA 2Q09A 4GO8A 4B4FA 5CKSA 3O06A 2E25A 3WDJA 4ZFMA 1IZKA 3U5YA 3OZYA 3BO9A 3RLVA 1NDVA 4Z2KA 1XCWA 2BHZA 4PCNA 5HWMA 2VHLA 3WMBA 1XYBA 3OU8A 1J0ZA 1DWFM 1GW1A 3VIMA 1R9YA 3T0AA 1J6OA 4LS0A 2OLSA 3EOUA 1H3GA 4K3ZA 4EPEC 4GYKA 3CC1A 5GQBA 2IQ0A 4KCVA 1Q6QA 3FGCB 1ONEA 2PGEA 5F2GA 1C8VA 1R3SA 5CPMA 4U28A 3GG1A 4LAOA 2XSBA 1QOPA 4O1AA 3RFAA 4IPJA 3LD5A 3NQ2A 2PP3A 3W72A 4AEEA 3LZ3A 4LAMA 3VDHA 4X9YA 3CTLA 4CCCA 3U4FA 3C6CA 4O1BA 1KTBA 5BYWA 3TN4A 4G5DA 1TPFA 1EJVC 4Q4KA 3CUIA 1XC4A 4TV5A 4IJCA 5AHIA 2PGRA 2CZFA 1PHQA 4HMDA 1P0BA 1MVYA 4W8LA 2CW6A 3MP4A 2BBFA 3EXTA 4P7RA 3QHMA 3ZJ7A 4K37A 3GXNA 1NFPA 1FCVA 1J4EA 3TC3A 1JCNA 4S3FA 3T0DA 3IPWA 2GQAA 3W6YA 3M64A 2VEPA 5CPSA 1Q2SA 2YXOA 4H9VA 1MRAA 2YL5A 1H7XA 3WNOA 5RUBA 3UZZA 2AAAA 1NQKA 4OVXA 3E38A 4NZCA 4H7CA 3REQB 1B3YA 3IAPA 4G8TA 3U2ZA 3WMLA 1P6BA 1DHKA 3V18A 1NFGA 2ACQA 4LXFA 3E0LA 3NQ8A 4IIEA 4J28A 1LOSA 2GDVA 7TAAA 1KRBC 2HVNA 1UH4A 5AKQA 2OSWA 3V7PA 4DI8A 1H41A 1UUQA 3C2EA 1A5CA 1XI3A 4JHZA 1F3EA 5IFPA 4MUZA 1SFSA 4G7EB 1B31A 4EXQA 7REQB 1FHDA 4ATWA 3BLIA 3GH4A 2BXVA 4YMZA 2GVJA 4OE7A 2PA6A 1B3OA 4ILSA 4N42A 4FNPA 1UKTA 4PUKA 2WM0A 4WK9A 4DM2A 2CIPA 1EQPA 5D2YA 2DY3A 4MWAC 3PPCA 3CAWA 3SUUA 4H2CA 3SQLA 1SR0A 1V3HA 2G97A 1XBZA 1SFJA 2HK1A 2RJHA 2A5HA 1HXJA 4Q22A 3O0KA 2NQHA 1F2JA 1BTCA 5CSRA 1TA3A 3DZ1A 2XWEA 4J5NA 3GH7A 3KUMA 4JIQA 3H2NA 1PIGA 4KT2A 1SGJA 3CHCA 3GDRA 2A3EA 3VGDA 2WVVA 4ML9A 1X8FA 4DUOA 3AS1A 1RUSA 5A8MA 1UIPA 1PSCA 2J7DA 2BWGA 3IS4A 2CLOA 2ZRXA 3FNDA 1LP6A 1Z42A 4HA3A 3FCPA 1PYFA 2CU0A 1JNDA 3LX9A 1DBTA 4KETA 1FVPA 1E1FA 3MQTA 1A0DA 4C60A 3OHMB 1UZHA 1OFEA 1R0MA 1O12A 1KRCC 4W7VA 4J27A 3HGSA 4JTFA 1NQ6A 5A3HA 2XTKA 1V02A 4K8GA 4ZB2A 3F4DA 1XD0A 3K8KA 3AISA 4UFKA 3MUXA 1V0MA 2OELA 3F03K 1HL2A 3ALGA 4Z2JA 4XBSA 2O56A 5CJMA 3IEBA 3AWNA 3W7JA 3H8AA 3EPMA 1XIJA 3BWWA 4QE5A 4AIEA 1CT5A 2VX5A 3DH7A 3DC8A 4OU1A 4ENLA 4NAEA 2AL1A 3PBWA 3GBDA 3GTFA 2CESA 4DF1A 5CZ0A 1ZZMA 4Z2GA 4MYAA 3QZAA 1CXFA 3IK2A 3LGEA 3CPUA 2GVYA 8A3HA 1YNYA 2PDFA 3PJWA 2YW4A 5FIPA 2P53A 3UWYA 3BMXA 2DIKA 2A3AA 1QATA 2V5JA 4L1GA 3NDYA 2ZZ7A 3EZ4A 3GD6A 3TN5A 4LCSA 3EPOA 2J7CA 4PMYA 4AXNA 2NUYA 4MJMA 1Q8AA 4JIIX 1K7FA 3N12A 3W81A 3IWPA 1WB0A 4A8IA 2QHAA 1F9CA 2B7PA 2BGQA 1EIBA 2O9PA 5DY3A 3M0LA 3VDBA 1OY0A 1VKFA 4H8NA 1HX0A 4DWSB 4P2VA 5HUOA 4UOZA 1W54A 3MUY1 4LY4A 5K4ZA 3HPZA 1QO2A 3KOXA 3UGVA 3UR5A 1E55A 5DRIA 3FVMA 2OWWA 5L9FA 4O52A 2NQJA 3NOYA 1TRDA 4TU1A 1B3ZA 2QJMA 4JEQA 2Z1XA 2X42A 3BAJA 3MU7A 3HTWA 3QV6A 4HCDA 4ALDA 3H4XA 4EOUA 3UYCA 1EYWA 1IXNA 1YPFA 3PAJA 4XB3A 2XVPA 3UPBA 3N6JA 4B5VA 1UZDA 3VDAA 4IMAA 3MUIA 4OT7A 3O15A 1X39A 5EKYA 1NH6A 2GJXB 1RK5A 4F3HA 4S2BA 4JL2A 5TIMA 5C2XA 2PDJA 1GW9A 1OZMA 4J4KA 3CHEA 1JD9A 2CLIA 2Y7FA 3TW6A 3W7HA 1HKMA 3ONBA 2VX4A 3AHYA 3PC0A 4EACA 4AMAA 7PTDA 1WZMA 3G3DA 2YB1A 3L5MA 3O6DA 3IV8A 1ICQA 4EXBA 3LLFA 4MPKA 4NJHA 1F5ZA 1OT1A 1OYBA 1EPXA 1OD8A 1V3JA 3CMJA 4HNOA 2WLZA 4UMAA 1FWDC 4J2PA 5BOOA 1Q85A 3TJXA 3HGOA 1HJUA 1AH4A 4Q33A 5I2UA 3ZVHA 1MDRA 1UC5A 4DAIA 1LWJA 1J18A 4I9JA 4XZLX 3KZSA 1HVXA 2DT3A 3T2QA 2GSEA 1EJ7L 2W3ZA 1EOMA 2QJIA 3MP3A 3U9IA 4YHGA 4GD0A 3W71A 1OGBA 3AMGA 4FNRA 1YLVA 3L5LA 4YTSA 2G3FA 1UWUA 5D05A 9RUBA 4GNJA 1QOXA 2HCVA 1K6WA 4H6RA 1EB3A 3RITA 3O07A 1DHPA 1KXTA 3ZS4A 5KZDA 2ZX5A 4PL1A 1RPKA 1UWSA 4KQNA 1GVQA 2YFOA 1ME9A 4UFLA 3VTRA 2XVKA 1FWBC 3HA1A 4PUWA 2WMHA 1SPQA 3USZA 1C9DA 3SN1A 1UD3A 3CIXA 3VAVA 1Q6LA 1E9LA 3GW0A 4LVFA 2C15A 3DCPA 3QZ6A 5BRBA 3S5NA 4WGXA 4Y96A 4F9JA 1E0VA 1CPUA 4O0QA 4DWSC 3NG3A 3S47A 2XFRA 4L9YA 3DUGA 4HIBA 5JXQA 5A6AA 2ZUVA 3UWUA 1RP9A 2E1DA 2DUXA 1ZJIA 5DXXA 2VP8A 4IMFA 1U5HA 3VIJA 1ZNNA 4ORIA 1TX2A 3DI0A 4DWSD 5F1VA 2VR5A 2YXGA 3WQVA 1Q66A 4PBEA 1UG6A 1BSIA 1XLDA 4PGLA 4IGMA 3E0WA 1PAMA 4IOTA 3VCRA 4GBDA 2YCEA 3I7QA 1TPH1 2PDGA 1F73A 2J8TA 4P7OA 2XHYA 4IIDA 5I3IA 3PTMA 3FFSA 1PZ2A 3E0IA 1SFTA 1UQYA 2QUMA 3WL0A 4F0SA 3RX4A 3P81A 3DESA 3L66A 4F9DA 3L4YA 3VNJA 2XIOA 5BXRA 3EPNA 3W38A 1W8GA 5J5RA 3N4EA 3GH5A 3CO8A 3EX6A 1JPIA 2PWGA 4I90A 3WFZA 3BC9A 4CNPA 4R7JA 3ARXA 4M56A 1BWKA 2J7EA 5L6UA 3NGFA 5CJNA 4MAVA 2VFFA 4GWEA 3MWAA 4UQBA 1KKRA 2BMBA 5A94A 2ATSA 4XBJA 4Y7EA 3VKCA 3PBUA 5FJPA 4OUEA 1R86A 4YPJA 4MKSA 1ZAIA 4CD4A 1RJQA 2DGAA 4OKDA 3NPWA 2V3EA 3O7UA 1GVSA 1R3VA 1CW2A 2QPXA 3P62A 1W91A 2D0GA 4UTWA 3S46A 1LLOA 3M0YA 1S1PA 4A22A 2QDEA 1FFQA 4DBUA 2QLYA 3KHDA 3HBLA 3BAKA 4PE8A 4E6MA 1W9VA 3ANYA 1SO5A 1JVNA 3NQ7A 1U5VA 4RZBA 1JQVA 1A5OC 3NQVA 2A0NA 3ITXA 2AL2B 3AU2A 4US5D 2QCDA 3TQKA 3MHUA 3PZ9A 1GOWA 3W87A 1UWQA 4R53A 4DJFD 2D2HA 1W0MA 3K46A 1V02E 4ROQA 4AZBA 3QTGA 5C7HA 3PULA 3C0SA 1XRVA 3TAOA 1DJQA 3WDHA 4LAUA 2Y4SA 1A0EA 1L9WA 3BLOA 3WNNA 2WZIA 4BI6A 1F07A 4IQEA 1VBUA 5BWFA 3M6YA 4HMCA 2YL8A 1DYSA 4ICMA 3NA8A 1HKIA 2WYSA 1UUOA 1EXBA 3EDJA 1OIMA 3SCNA 5HJLA 1GZJA 4EPDC 3P84A 2H90A 4IPNB 4AB4A 1EJRC 4GRSA 1ZRQA 2AQVA 1QW7A 1CX9A 5KETA 4O50A 5JH2A 5C7VA 3RU8X 1SO3A 3MVTA 2PTYA 2GJRA 4HA1A 5FKYA 2ATMA 1QI0A 5FJJA 1E6XM 3W2UA 4DZ5A 3V1HA 5FSDC 1K1DA 1E0TA 4LVAA 5HULA 5HNNA 3M16A 2J79A 3S6OA 1CECA 3PTKA 5A8NA 4EF9A 5F2MA 1UKSA 2WZTA 3BAXA 1UR8A 2J74A 4KGLA 4WX2A 4RDYA 2G96A 3AHZA 1SZFA 1CI1A 3QOMA 2ZRUA 2EHHA 4GKLA 1AD4A 4WDTA 3BCDA 1E4MM 2GK1A 2PLJA 1EDGA 1ZHAA 2V2HA 1ZLPA 3V0UA 4ZFCA 1TRIA 1V79A 1MNSA 5AB3A 3EX4A 5FJRA 1OFOA 2I7GA 5D2VA 4UTTC 2YDSA 4C6EA 2VRQA 3LMYA 4Y8EA 3EKZA 1V7AA 4Q4SA 1O60A 5LGZA 2PLCA 4PCPA 1FXQA 3L2IA 2C1GA 2E28A 3R8RA 3M0ZA 3WN6A 1DJNA 3LSCA 1TMQA 3VIPA 5E93A 4NAFB 4D1JA 1HF6A 2YX0A 2JIEA 4POCA 4OUIA 2CZVA 1ISWA 1G4SA 4C6NA 3DERA 3UERA 1F8IA 1K9FA 5JBDA 1K03A 2C1HA 3SSJA 3G3MA 3H7VA 3WK3A 3VZXA 1LJYA 3E5PA 3OBEA 2W5FA 3RG6A 3RLUA 1ZBCA 2ZBTA 1YTKA 4ZXOA 3FJ6A 4B5UA 1EF3A 2P0IA 2A3HA 1E1CB 4W5UA 2VUNA 4QJ5B 3AYRA 4DJDD 4D6DA 3MZ2A 4M81A 4ML4A 3VNYA 4S3GA 2YL6A 4J7RA 5CPQA 5CH9A 3KOWA 1EA9C 4GNKB 4GINA 1S1RA 3ELFA 3T07A 5D2WA 3LEPA 3AIVA 1AW5A 1E43A 4YTRA 1LROA 1JL8A 3SBFA 1CLVA 3ABZA 3TNOA 2BX7A 4MADA 1CXHA 4CGTA 1VF8A 2IKJA 5C70A 4PBFA 3VUPA 1VRDA 1VFLA 3H21A 2Y88A 3E5BA 4XVEA 2A7NA 1X6UA 2PURA 3EA3A 2DW7A 1JZ3A 2PEVA 2XSXA 4R3UA 3AJ7A 1PTAA 1W3HA 1QNOA 1MMFA 4B5XA 3GU9A 1T40A 3GG0A 3UESA 4E5TA 3BK0A 4X2RA 2C91A 1NY1A 4JTHA 4NZFA 4YJ5A 5F2LA 4DO5A 3CB8A 5GJMA 1EGVA 5LXXA 4A8RA 1QHOA 1XSIA 4Q4MA 1A5LC 1KM5A 1VIZA 3OG3A 1HGWA 1K8ZA 1L6FA 4Z1AA 1SR9A 4MY8A 2WWDA 4HCLA 1TVPA 5KINA 1XSJA 5CGQA 4UQDA 2VVNA 3PWAA 4GIAA 4HK7A 3SCQA 4B16A 3TTEA 1PKMA 5AVHA 4FB7A 4Y9NA 3RMEA 4GHRA 4F79A 3DG7A 4D6FA 1UWTA 1FH9A 1OIFA 5A8QA 2X41A 5A6TC 1H7NA 3IV3A 1E1EA 3ARUA 4M6PA 2XGIA 3MMTA 3T42A 4UFHA 3AUOA 1Q6FA 2XPKA 3JUGA 2OWXA 3WJZA 1FWGC 2DZPA 3A4WA 2X1RA 4WKAA 4QS6A 1NFBA 2OGJA 2EJAA 3GDLA 2AKMA 4B3ZA 1T7LA 2O9OA 2ZQ0A 3ARTA 3WYZA 1QTWA 4PA8A 4S3AA 2BP1A 3T0TA 3P74A 1MQRA 3RMJA 3EWWA 1N8IA 1TFVA 3LCHA 1V6XA 3WMCA 4YTTA 1BVZA 1TPDA 4P5UA 1Q63A 4ICCX 4Q4RA 3VINA 4HA4A 4JTRA 3U2EA 2PPGA 3QR0A 3ARRA 3WLRA 4DWDA 1DXFA 2DQXA 2QCFA 4MYXA 3BL3A 4PUDA 1BXBA 3B05A 3AIEA 1VGAA 3IIOA 1XSKA 3RCYA 4E4UA 1ZALA 2F8QA 5BXPA 3VD9A 1POJA 1X1ZA 2GSHA 4ERGA 1I60A 2VEMA 4U2ZA 1H7PA 2QCHA 2CWNA 3W1AA 4NP7A 4WRHA 3OTRA 4IQLA 4X22A 3M43A 3VD4A 3OW1A 4FXRA 1XYLA 3VC6A 3E9AA 4LANA 1XH1A 3WD2A 4N02A 3UEQA 2XIJA 3A22A 3STGA 4GCAA 4I3GA 3RCMA 4JGDA 3O0FA 3CASA 3LTYA 1GK8A 2Q6ZA 3H6OA 1AL8A 5KTLA 3GRIA 4HBKA 3O63A 1WUFA 3COTA 1EL3A 1VYRA 5M5DA 2YCLB 4DXKA 2ASHA 1TWSA 4MFEA 3RJXA 4XG1A 4U5IA 4GIYA 3MC5A 3Q45A 1W2VA 4U3AA 2J6VA 3SECA 4DLMA 1E51A 2HPIA 4AIBA 4LRTA 1FKXA 5M1TA 2G3NA 4MLJA 4ZXLA 4CNTA 4X0VA 3MI3A 4FR1A 4DJEC 2ZICA 3T8LA 3WEOA 4ICNA 2BVWA 3P8IA 4AYSA 3URBA 1E40A 3IVTA 3CEUA 5FEWA 4UTUA 1PHWA 1JYXA 1PIIA 3EB2A 1TZZA 5D38A 3VIIA 5H2ZA 5JIWA 4R33A 3VYLA 4WIWA 1RLDA 3G6MA 4ZQPA 3IAQA 1DEDA 2YCJA 2VDHA 3MSYA 2VRKA 2VR2A 3NXFA 1V3MA 3F4NA 4A3RA 2JE8A 5IHRA 1FUYA 2EG7A 3GZ3A 2A6NA 4Y6GA 5CPLA 4A8NA 3ITVA 1X1NA 3A5FA 5AN7A 3ZT6A 3NPVA 1RAKA 3GFZA 2YYUA 1JI2A 2PDXA 4UTIA 3S5OA 3W73A 4IISA 1UB3A 2OZTA 4V1XA 2NV9A 1Q7MA 3ZT7A 1F3TA 2E9BA 4K1WA 2XN1A 5JH1A 1RPXA 2IPJA 3HJEA 1W5OA 2I5QA 4NASA 5I3HA 1PV8A 2AGTA 3GY1A 1ONXA 1R3RA 3T40A 1SJAA 3WLQA 1O5QA 1V6VA 4NI3A 1L0PA 2GPTA 3K30A 1VR6A 1WDRA 3W7MA 4UFMA 5LYRA 2J7BA 3W7CA 2J27A 1Q2RA 4C91A 4XD6A 2BLEA 2E8YA 2Y63A 3I4KA 2ADAA 1VC4A 4BF9A 4H1ZA 1JCMP 5IDIA 4K36A 2I9EA 4YN5A 5BMXA 5CQ1A 3P5ZA 4GXMA 3W4RA 2J47A 3PG8A 1E0WA 1TWIA 3RRAA 3RPTA 4IJBA 1FCQA 1VBGA 5I79A 2Z27A 2QCMA 1J2WA 2CZEA 4J3SA 4H2HA 2F2KA 4V33A 1LLWA 4JKLA 2GUYA 2JGQA 4MOZA 3FHQA 3T0BA 3TE9A 3PBGA 2CHRA 2WHMA 2PE4A 1DE5A 4EX4A 1GKRA 1EP1A 1W32A 1GQJA 2X1SA 3BLKA 4C7FA 1R3QA 5B80A 4R9OA 5E09A 3HIJA 4WQ6A 1PKNA 3QH2A 4NZ4A 3LNMA 2ALRA 1LCOA 3OA3A 4BR1A 2HZGA 2D0FA 4NILA 2QPUA 1SZGA 1GGOA 4GXPA 1NSJA 3N14A 3AMKA 1Q6GA 1DXIA 4QCEA 2WQPA 4XTIA 4GX8A 1VFUA 1JGIA 4Y9PA 3CPRA 1WCGA 4JHOA 4XAZA 5LNVA 4O0KA 3N2OA 3R8GA 3CZGA 2OZ0A 1X6NA 2WMIA 4S3KA 3B03A 4RKAA 3P82A 2DU2A 2BTMA 3P6LA 4UNIA 2QCNA 4FLRA 4RNFA 4S2CA 3T78A 3THQA 4DY1A 5C54A 4DRSA 3CPGA 3P67A 3BTNA 3PVFA 4IMCA 2FDSA 3WUBA 4YCPA 1JAEA 4JQ2A 4O54A 4QEEA 1LYXA 4DQWA 2IS7A 1E6PA 3BOFA 4GISA 4DJDC 3RM4A 3GDMA 4QG6A 3FSUA 3L12A 2BASA 2DEPA 1W5QA 1D8WA 3QLDA 4XAYA 3PB2A 1CDGA 1AVAA 4FPSA 5AC8A 2WKGA 4W8BA 3DG3A 3M9YA 3E74A 4OOZA 4XUYA 1WKFA 2QVHA 5LGXA 2X7VA 3IJ6A 1DWIM 1W1PA 3K8LA 3OVPA 1Z3NA 3LBOA 4PCSA 3L67A 1OK6A 5HATA 3W2NA 1NVMA 4Q3MA 2TMDA 3ITYA 2WVUA 2OEMA 3DYOA 3WUGA 1OZQA 4CLMA 1YW1A 3CK5A 1U1JA 1VHNA 4DUXA 3B97A 3N73A 4BCEA 4NNAA 1NOUA 3K4DA 3VDGA 4V28A 3P0XA 4WDUA 1Q6DA 1RQHA 3A47A 1I4NA 2EPNA 1OQFA 4C6QA 2GQ8A 4IUOA 1B4EA 2P50A 4LYRA 3HG3A 1A5NC 4QJ4B 4OBRA 2C19A 4QNWA 2UV8G 1UP2A 2R91A 3UW6A 3TU9A 4XKYA 1O94A 3NSXA 4RW5A 2GK1B 3A64A 1LQ0A 4BI7A 1QK2A 3EKLA 3GYCA 4LAKA 3UXLA 3HJZA 4WY0A 5J04A 3VUSA 3H4WA 4EVZA 4HD5A 1VYSX 1T0OA 4DZAA 1EWEA 3QVQA 2V5DA 4KMQA 3C56A 1QWKA 4PRRA 3MI2A 2DSKA 2PTXA 4CQDA 4ZQRA 3M7SA 3SGUA 3NL6A 5DMMA 3L5AA 2GJPA 4TVUA 1XYMA 3FJ4A 1BYAA 3NZ1A 5D9MA 4WUIA 1M7JA 3A3XA 3ARWA 4HHLA 1TTQA 4A21A 5F4SA 1J0HA 1LBLA 1LUCA 3QW4B 4B5TA 1T41A 3G1RA 3G2GA 1BXNA 3L7RA 3U0HA 3MV11 3WNPA 3QYSA 1E73M 3DAQA 1UIOA 4XIMA 1CNVA 2VC7A 2YDAA 1ZB5A 2EG6A 2ZA1A 2OSYA 2VVSA 2VR4A 1NM9A 3M41A 3CU2A 3KCJA 2Z0IA 4GVGA 1W2PA 2V81A 4XD4A 3GXTA 4MHBA 3L0KA 3FGCA 3S42A 2JQXA 4FIRA 2C79A 3ENLA 3E02A 2GUBA 3UVIA 1PWLA 2CXGA 4GQQA 1KXQA 1DQXA 2VKZG 1OT2A 1JG9A 1SM9A 1V4YA 1DPMA 3OO2A 3HV8A 4C7GA 2ZWYA 4GVHA 1IYXA 3G0UA 5ECVA 1O6IA 1ISYA 1IT0A 3UJFA 2GDUA 1OB0A 4GVIA 3M0KA 4LUJA 1HIZA 4TTGA 3S6DA 3PJUA 3AZTA 5AYYA 2ZX7A 4PEEA 3EDKA 3QQWA 2QDGA 1Q5MA 5CG7A 3WDPP 1VFSA 4REQA 4INFA 1LM1A 4FAMA 2G3JA 2EJ1A 3WK0A 4AZIA 4UFIA 5BOEA 2J7FA 1HJVA 2J9ZA 1OSEA 3EA1A 4IL0A 1LL6A 2HTMA 1MRQA 1J0JA 1NEYA 1FCUA 3CUFA 3AYVA 2DZXA 5DQPA 2XUCA 2XWDA 4ERIA 1X96A 2PWEA 1ZUAX 4CNSA 1L6GA 3ZWSA 1KCXA 5CZJA 1Q4WA 3OGSA 3GSMA 4A05A 1PCWA 5DCEA 2FTPA 3VM7A 2DIEA 1W3NA 4GKTA 2VYOA 2WNWA 4M5PA 1LBMA 1NF0A 3LRKA 4MNMA 2QCDB 2CBVA 4G7EA 2PDPA 2Z2UA 1KRAC 1R6WA 5BXTA 1Z8AA 5D8WA 3OGRA 1Z7AA 5H8PA 3P80A 4GNVA 4L1WA 4FZIA 4GI9A 3TDFA 5HJYA 3KL0A 1QI3A 1WZLA 3SW6A 1BGGA 2OZ3A 1BG4A 4JFSA 1G7UA 3LQLA 4L9XA 1W9UA 2VENA 3R94A 3JVAA 4QITA 4H4IA 1FH8A 2R1LA 4EF8A 2X0HA 4UOQA 5ABFA 2VZOA 1YTEA 3KRZA 1BD0A 3V5FA 3U2CA 2Y8VA 1LRNA 1SUXA 4AY7A 1XISA 4MWAE 4EWND 3OG2A 3UJ2A 4MPQA 4PTMA 4GY7A 4AFYA 4E4FA 5LIYX 3V0TA 1NAL1 1BG9A 5CBIA 1YQ2A 4RNJA 1S2TA 4J3ZA 1ICPA 2VCCA 1J6PA 3AUJA 3B8WA 2NT0A 4F66A 1RHCA 3EBVA 2FQIA 3PS7A 1V3IA 5F1UA 3TAKA 3VKDA 3FA4A 2Y8KA 1TO3A 4XVDA 4LUIA 4BZYA 3MS8A 3IIXA 4PBGA 1OX4B 3AXKA 3MVIA 3VABA 3PUOA 3WJXA 6XIAA 3F5KA 3WLKX 3V4BA 4N4QA 4Q8OA 1GTHA 3E2QA 1H4PA 4R7OA 5CPNA 3G0XA 1UA3A 3CEPA 4LT9A 1HVQA 1MWOA 4L61A 1A50A 4LBSA 5M3WA 2ZRYA 4PUNA 4RK8A 3CQ0A 2PWHA 5IBXC 2Z29A 3TOPA 3KCLA 4G56A 4HP5A 3JZUA 4H3DA 2VTFA 3H2CA 2E67A 3MMDA 2XFFA 4FOKA 3NDOA 1YDVA 2WBGA 1VBRA 4PZVA 3U48A 1A49A 3DFNA 3A21A 1IF2A 4QSFA 5DELA 3GDTA 1XRTA 2R24A 5I09A 4KEUA 1G67A 2FB3A 1E0UA 1GTEA 9CGTA 1P7TB 2X05A 1XFBA 4DVOA 4HU0A 4IGSA 3UA3A 1W3IA 4W7UA 4S3BA 3A3HA 3FYOA 3NO5A 4UIOA 2QGHA 2AQOA 3STFA 5FA5A 3I6TA 1BGAA 1T6MA 2DVUA 3WH7A 1WXYA 1WDWA 4JIHA 2HXUA 3N6HA 3CL6A 1E6ZA 3ZSTA 4ECLA 1LF1A 1IZJA 1M7PA 4GFSA 2V30A 3UR2A 2WVTA 1RBOB 3TOYA 3AICA 1FA2A 3QFWA 1A4LA 1XBXA 3ZQ9A 3K1DA 3TFCA 4OTKA 2B0MA 2KX9A 2W6RA 5LIXX 1TQJA 3GC2A 3DHDA 1KBIA 3PP7A 2QULA 3WQOA 1YBQA 1XPYA 4MB4A 5E9AA 3DGRA 2QUNA 3QY6A 1WP6A 4JS3A 4K8HA 1TUXA 1LWHA 3NPXA 2Z25A 5G1MA 1UWAA 1OFAA 1FRBA 4E4PA 1VPQA 3ZT5A 4JOMA 1EX5A 3WJSA 4GABA 2EG8A 5I78A 4KFPA 2J9YA 5FEZA 2E9MA 4NJIA 1A5UA 3TA9A 4Q8NA 5LNUA 2QAFA 1Q7ZA 4L9ZA 3HQ1A 4KWWA 4ZQNA 4GVFA 3OJGA 2O4MA 1A80A 3RR4A 3VPLA 1JDFA 2GVLA 1TA3B 1QMLA 1AQFA 1PJ9A 3LNPA 5D37A 1YXDA 3G1HA 2NV2A 2EPMX 1KV5A 2ZKMX 1DE6A 4M1RA 2YPIA 4JNYA 3ARSA 5CSUA 1C8XA 1B57A 4W85A 4FR6A 3SRDA 3WLTA 3DECA 5C55A 3DFOA 1EP3A 3PJTA 4IG2A 4M6VA 2XVGA 1REQB 4NY2A 1J5SA 3HMJG 3AMDA 3QV9A 2IXVA 2ICSA 3M0HA 4H19A 3LYEA 4YYFA 1JCXA 3DGBA 4RZ6A 3BAIA 5AZ0A 4BF5A 5JQ9A 4UQEA 3N2XA 3BICA 4M24A 1TIWA 4J2MA 2QJJA 4H8VA 1ML1A 4B5SA 1BWLA 2WZHA 1X1OA 4TTUA 5BMWA 1H2JA 1H62A 3POCA 2CERA 4HNVA 1JXKA 5CXPA 3HPFA 3JS3A 1E5JA 4LYKA 5AHNA 4HPNA 3OBAA 2JKAA 4HCHA 2JIWA 1X8CA 1VENA 4K7VA 2B31A 4BWLC 5FL0A 3KOYA 3EWDA 4O15A 2E3ZA 3SB0A 1MEWA 2GJLA 4IHCA 1BTMA 3WLSA 3MZNA 1BYDA 5H6HA 3BAYA 3GKAA 4G9PA 2QPSA 3VZYA 1IE7C 3A23A 3QPEA 2BNJA 5DXYA 1GG0A 4CU6A 4XO7A 1ITCA 3BQ6A 2O92A 3CMFA 3GKFA 2Z26A 2I16A 2WNQA 2A7PA 1BLIA 2ZFAA 2DSWA 2EPKX 5HBFA 1THFD 4LUTA 4JTGA 2VUYA 1OCNA 2Q71A 3ARPA 2CLPA 3HFYA 2XH7A 4HMEA 3G5EA 5C0QA 3KS5A 1PL9A 2D3NA 3GM8A 2X1UA 1OHLA 2DUAA 4N9BA 3D3AA 4LNYA 3GTXA 1G4EA 2TYSA 2Q01A 4GYPA 3IRDA 4NZ5A 4LV9A 1KLZA 3LB0A 3QMTA 1DV7A 2VX6A 3GIPA 1LDCA 4O16A 4CNOA 4D8ZA 5MKGB 4UUIA 4GO9A 2I17A 3B8TA 4EAMA 4F2TA 4AISA 3IJQA 2OMAA 1UH2A 3MCOA 3L4WA 1UW9A 3H22A 2CXEA 3QKEA 3S9IA 6XIMA 1GONA 3EEZA 5AC6A 4KS0A 2WSRA 2PAJA 1EF2A 3D3FA 3BLFA 2X16A 1WOAA 2X0SA 2HE5A 5BU9A 5DY2A 2OPJA 4WY0F 3DFSA 3MUCA 1ITUA 1LRQA 3FDKA 2ZXAA 3SI9A 4PMNA 2BOFX 1I2OA 2VELA 3DFTA 2XIMA 3DU0A 1LWIA 4WY0B 2BY3A 3Q2DA 4XZIA 1AJZA 2WSPA 3WH9A 3CUZA 1RCOB 1JUBA 3RCNA 4GUJA 4NG3A 3EWXA 1UR9A 1XW8A 5IDZA 3L4ZA 1KQYA 3MMWA 2QV5A 4A2RA 1H1NA 4UTKA 4JNMA 1G1YA 4EP8C 4J3UA 1E3ZA 1YXYA 4JHMA 3R1ZA 1EHNA 3LPFA 4KW2A 3S6TA 2X09A 2V8ZA 1MXDA 3GHSA 4IUGA 1MW3A 4C90A 2G4FA 2OEKA 5FD0A 1CYGA 2FGBA 3RO8A 3QY7A 1JFHA 3E2RA 5DN1A 1KCZA 3LN3A 3GVWA 4MTVA 4Q8VA 2IKHA 1WBJA 4DUVA 3GYEA 4GQ0A 2ZDRA 3EOLA 4F2UA 1F3XA 5EL1A 2RGMA 5CBJA 2V0TA 3DBNA 3TJLA 3R79A 2Q02A 3MO4A 1AH3A 1OINA 4GH1A 4E2DA 2YA1A 4YWSA 3RM8A 4WOZA 3OZOA 3WQEA 3QF0A 4A35A 3PPFA 4PEKA 1JPKA 4IP7A 5BXSA 1DJYA 3LI1A 1N7KA 1VEPA 4KIRA 1HW6A 2G95A 1XM3A 5AY7A 5D9NA 2XM2A 3PSWA 4A4AA 4WJXA 3T1GA 1PTDA 1O68A 4K1GA 3MP5A 5HQMA 4F4RA 3R7MA 4LRSA 3B4YA 4WCJA 1A5BA 2ZZ4A 4BK9A 3T81A 2PRHA 1TG7A 5HPOA 1ICSA 3DFHA 2PDHA 3NQCA 2E77A 5FSEC 4A6GA 1GOIA 1OG6A 3VNLA 2FPYA 3V36A 4BFAA 5T8GA 2REQA 3TP4A 4H8UA 3KBSA 5DBUA 4AVNA 2QDDA 4OV4A 3VGEA 3NDZA 3W75A 4DXVA 5C2GA 2GGIA 1AQHA 3SQSA 1TVLA 3DKJA 3H2OA 5C9XA 3F4WA 3RHGA 5XINA 3WQPA 1G94A 3ITCA 4QRNA 1X38A 3P8JA 1PO9A 2PWVA 1CXIA 5MHBA 1VFHA 2QEZA 2A79A 1OFPA 3WJWA 4JQ3A 3TA6A 1VCFA 1S5VA 4MWAB 2IPWA 4D9PA 1UD4A 3OP2A 3C0LA 2V5KA 4DXXA 2X2GA 3GNRA 1H50A 3N4AA 2VGIA 3IJ8A 4RXFA 3GVRA 3B9DA 1HJWA 3M4HA 3GB6A 1L2UA 1W1ZA 4HHMA 1K8CA 1Q6OA 4KRUA 4FS9A 5JUVA 3M1ZA 2I14A 1XRSA 1DJIA 3DHFA 2P3EA 4MLRA 4HYRA 1EZ2A 4KBXA 2RDUA 3SRHA 5CCZA 1WV2A 1HO4A 1XLKA 1SSDA 4LS2A 5DBTA 5CAHA 1FWSA 1DQUA 2QNEA 3AQUA 3MMUA 5CGTA 3WQDA 4JAWA 1ZQ5A 3FVDA 1CXEA 2Z4GA 3ZSSA 2J6XA 1IR2A 2I1OA 1OVDA 1Q7QA 4QBXA 1JCTA 3B8VA 1DWHM 4WHBA 2ZWZA 3FAWA 3CT7A 4B2DD 4NJKA 2CLHA 2J8GA 4JDBA 4A3YA 2X8RA 3M6DA 1OYCA 4MZ8A 1WKDA 2GGGA 4Z2HA 3CQJA 3GVQA 3SRFA 4WDXA 5H8UA 3UG4A 4PB3A 4D6CA 4AD5A 4E0CA 2NV1A 1SJDA 1RSCA 2PTDA 1U83A 4HJWA 3KBNA 1JNEA 3EX1A 4ACZB 4ZVJA 1GCYA 1UJQA 1TYGA 1GVOA 3S2MA 3GU2A 3ITTA 3W00A 4AVOA 3WH8A 4WXYA 1SJCA 2XVNA 3FV9A 1GVFA 3NURA 2V3GA 3C86A 3CL7A 4I7VA 1HUVA 2UY2A 3TONA 2PZNA 1GPFA 4GQGA 1A5KC 2P3ZA 4ZO8A 4TX8A 1JCLA 2J8FA 2BB0A 3SCPA 2VURA 2CCRA 5C2CA 4DLFA 4F0KA 1DXEA 5EYWA 4H9YA 1XKYA 4I6KA 2FDMA 3SY5A 3C3NA 5CLWA 4ONVA 1MNZA 3W86A 4EE9A 4HPHA 2CBJA 3W23A 5IXEA 1FP9A 3QHNA 4CD7A 1EBHA 5D03A 1DWAM 2PTWA 4LEFA 1SMDA 4PMVA 4NHVA 3S5YA 1GZ1A 1W5PA 1H0GA 1RK6A 1YIXA 2WHJA 5DT7A 3P5YA 2HSAA 1TIMA 1VIWA 1FWIC 2H9AA 4O13A 3WH6A 2YR1A 1WBHA 3NNTA 4HMNA 4DELA 2NWSA 4NYYA 4OIFA 2RDXA 3ZFHA 1WOBA 5EMKA 2ISWA 5A6MA 4QQ3A 2O7QA 2RHGA 3ZLGA 1EP2A 4BKNA 4JTAA 4WSHA 2BVTA 3VX1A 2D1ZA 1WDPA 4IMEA 4OECA 2F38A 3VXGA 2XIBA 3ARYA 4ZO9A 3HV9A 5HR7A 3QSTA 5AYXA 2EAWA 2VFIA 2DVXA 3RJYA 5CZKA 3T2PA 3H2MA 4JN6A 3U7VA 4RXGA 4Z1CA 1FHUA 2BOEX 4UTHA 5DT5A 2BY0A 3KXQA 3LCLA 3EX3A 4KCUA 1DJWA 1UCWA 4NYUA 4GX9A 5HXMA 3VU2A 3LBMA 1SJBA 3TK7A 2NQLA 5ABHA 1K3UA 3H7UA 3QXBA 5GVJA 4IPLA 4QEHA 3O9NA 1U2YA 2BHYA 3QGVA 5BRQA 4I7WA 3C52A 4UTMA 1W5NA 1BFNA 3QQ1A 4NQ1A 2PC4A 4WLCA 2JEPA 2HV5A 1ZBKA 4I5RA 3W22A 2HROA 2E68A 3AAMA 1P48A 4M82A 3GR8A 1FKWA 5C6MA 2E5DA 2O9RA 3C3UA 4E38A 3L65A 4U33A 2OJPA 4P7LA 3UPMA 4IH3A 4PMZA 2ZOXA 1UBPC 5CJ5A 2CNCA 1FBAA 4B2DA 4LTSA 2F6XA 3HFTA 4I9TA 2CETA 2NXGA 3AMLA 4F48A 2IUZA 4KWOA 4OBTA 3WK2A 3IACA 5B7ZA 3CYVA 2RFGA 4I7UA 2JKPA 2WC3A 3B0YA 2QCGA 4LJ3A 1V5XA 4MMWA 2H9AB 3AU6A 4S3CA 4B5NA 1XG4A 3HN3A 2O7SA 3K4AA 3IGUA 4DEFA 1S2WA 1I1XA 2MANA 2UY4A 3FEMA 3QZEA 1ZSXA 2ZC1A 3Q67A 3QN3A 3TROA 4AZ5A 1KM4A 3BV4A 4E8CA 5I77A 3KP0A 1B9ZA 3GU1A 4TMCA 4MY9A 1VEMA 2CWXA 2HEJA 4AMCA 4LC6A 1TPC1 5ECUA 2PDUA 3A3WA 1CBGA 2OGYA 3CT2A 1P6CA 4EANA 1I75A 3TX9A 4S1FA 2B7QA 1R9XA 3BE7A 4XIAA 5FJTA 3WF1A 3SY8A 3NQDA 2UWFA 4DO6A 4A29A 1Y8BA 1KM1A 5E6YA 5CC3A 4NL1A 5HWJA 3BGJA 4O8AA 1I2RA 2HDJA 4B15A 1T8QA 3ARQA 1WZKA 2X40A 4JKKA 5EMLA 1KGUA 3L4XA 2DV0A 4G1KA 5D33A 3T9PA 2DT1A 1M7OA 4UQAA 3KE0A 5C9UA 5E6ZA 3GO2A 4H6QA 1XLHA 1QPQA 4OV9A 3OB8A 3I3DA 2GVEA 1LBFA 4Q4QA 3KP1A 4HJFA 1PCKA 3G0SA 1EYEA 1ME7A 2WSKA 4QROA 4GPNA 2J4GA 3SEPA 4NZ1A 1TELA 2Z00A 2FKPA 1E6RA 3HOJA 4CCZA 2OU4A 4UTLA 1LQ2A 1TKKA 3V75A 3THUA 5M03A 4X3ZA 4HT3A 3BURA 1UR1A 2Y7DA 3CGTA 1JEZA 3VCNA 4PTWA 5BNKA 1VB9A 1E6NA 3CNYA 4FO4A 5CZTA 1I45A 3JU2A 2A2IA 3KWXA 3UU0A 4JICA 4R34A 3DN5A 1E0XA 3DYMA 4YIWA 4WZHA 1RJPA 1J01A 2ZE3A 3KRBA 1W8SA 3G18A 3WF3A 4S38A 1EA0A 2P5NA 1LL7A 4I5UA 2WK2A 4XK2A 1OGSA 2VGFA 1HO1A 3V0SA 2XH0A 1E4LA 2YCLA 5A69A 3HU7A 3B04A 2C71A 3W53A 5A8GA 3N2BA 1B5TA 3G8RA 3W29A 2VD8A 5U7SA 3BG9A 5ABEA 1VHCA 3U8GA 3VIFA 1V0KA 2FMNA 1KCLA 1Q4NX 2PRLA 3VX0A 4IP5A 5E0KA 4AD4A 2W4XA 2QMKA 4J9JA 4HU4A 1JYNA 1NWUA 4AX7A 2CITA 3NYDA 2EBNA 2QXWA 3MWCA 4AAJA 2UY5A 3LM3A 3SN4A 4GA8A 4X61A 1V6WA 1YDYA 3EMZA 2ISFA 1KWKA 5DRCA 5FI8A 1R3WA 2VWTA 2Z1VA 3WDQA 1AH0A 3T09A 4AG0A 1UKPA 4H04A 3W1LA 3B4UA 1C92A 1ZP4A 2JEQA 4Y8FA 4PCTA 2QJNA 1MEIA 4ZOAA 3KX6A 3VFLA 1HNYA 2REQB 3WFLA 5JVLA 3LCFA 5LIKX 4GH3A 4CQ8A 3MA8A 1H5YA 4ZQMA 4LUTB 2HXTA 4W84A 1QJWA 3FA5A 4DUWA 2EKCA 2VD9A 4LBUA 3TZNA 4PL2A 5HNRA 3UG5A 1NDYA 4D6EA 1VFOA 4CQAA 4LNCA 2V69A 4LW7A 3Q4DA 1XCFA 1JIBA 1EO5A 4L4OA 1TV8A 1QUMA 1UPMB 3PNZA 2OWCA 1KM0A 3CV6A 2QV4A 1XH0A 2HWGA 1XS2A 4MNJA 1A3HA 3G77A 1AJ0A 3CAKA 4AEFA 2B81A 2EPLX 1QPOA 4QTGA 3T7VA 1EBGA 4IGNA 4GYJA 3FKKA 1B54A 4HNLA 1S2UA 4ZODA 4Q8PA 1VS1A 3QC3A 4AWUA 2CEQA 3NSNA 4XD3A 1UD2A 3MBDA 5FESA 1K6AA 1L2QA 2BODX 4P7QA 1XLFA 3GHRA 3VM5A 4B9YA 4B91A 2PU0A 2Z6IA 3AOFA 1N55A 5HMSA 2G0WA 1PEZA 3UWZA 1VP5A 3DG6A 3MYPA 3S1UA 1OX4A 3NYZA 3GC4A 1BF6A 1JZ8A 1TZ7A 4WGHA 4GQBA 2VCBA 3BMVA 5FAJA 3TC7A 1XQLA 4UZSA 3W7PA 1TV3A 3WNKA 3GQYA 1ISZA 3C2OA 1EEPA 2VOMA 1GYMA 2DH3A 3C8NA 4DI9A 2OT0A 3MSRA 1P4CA 1V0NA 4TX9A 2P1FA 1RVKA 3ZMRA 4IQJA 2J62A 2Q3RA 3F5JA 4H01A 2GWGA 1K7XA 1VPYA 2PP1A 1JUKA 3UG3A 1XYFA 1Q6EA 3V1PA 1VEOA 2WAGA 3TNBA 3KM8A 3QBUA 1M5WA 2GDQA 3LLXA 3W2MA 5I06A 5KSWA 4PUEA 3WLHA 1JD7A 1HJQA 1I8JA 3GNPA 3H4GA 3ICJA 2XDFA 4MB5A 3RN6A 1EOKA 3KDOA 3W7RA 3W70A 1WDSA 4B3LA 2YZ5A 4O19A 1E5NA 3GUWA 1Z41A 2Z7GA 5EBUA 5D9PA 4H00A 2PDNA 3DIPA 3GE7A 4XSLA 3W7GA 3KVKA 4V1YA 3BLEA 4F2BA 4JIRA 2NLYA 3PZUA 2FHCA 1KA9F 2XN2A 4JY9A 1B4KA 3O8AA 5ABGA 1FDJA 1PX8A 3IUDA 4RDZA 1EDQA 3W02A 4UMBA 3VNDA 1CZ1A 1M68A 2CKRA 4AD1A 2NUWA 1SW7A 3BOLA 5FJUA 3ZJ8A 3SCVA 2WKLA 3SFKA 2HS8A 4IL2A 4QSHA 1EDTA 3WBEA 4Z1DA 1FHLA 2QAPA 4HTBA 3NZQA 2WSYA 3WQ4A 2JGYA 1DQWA 4KWSA 3W7LA 2C0AA 2OLHA 3JZEA 4I9AA 1D3CA 7ENLA 2Y7EA 1AW1A 1EFZA 2R6OA 3B8IA 4KFNA 3B40A 2VZUA 1XIMA 3W7NA 1GOQA 3L9CA 2V82A 4PUMA 3TEVA 1KBBA 4DJFA 3PZNA 1H09A 1OABA 4DJED 5EBAA 3UXAA 1UA7A 3CH9A 1XLEA 3VE9A 5A95A 2WCGA 1PX4A 3F5LA 1X98A 3PPGA 5BU6A 4N6EA 3UZWA 3UWQA 1Z69A 1S2VA 4WXZA 5EMMA 3TXZA 5AOUA 5HR6A 1ZJBA 3TTQA 3SCRA 1UR4A 3WX7A 4ATLA 3GXPA 2BY1A 5AYIA 2FVMA 2BS9A 5IM51 2J13A 1EX1A 3B06A 4A8LA 1HP5A 5HQEA 5DANA 2CBIA 1FWWA 2OQYA 3NSMA 4K7YA 3OVQA 4NRRA 3OLGA 3POHA 4YVPA 4I8YA 1KO0A 4E8GA 4AYGA 3HPSA 4YLWA 4RPQA 3SY1A 2WPBA 1LRTA 3GFXA 2CHOA 3QKZA 5I03A 4QG9A 1XLLA 4XV0A 5REQA 1W9BM 1U22A 2OYMA 1R85A 3ANUA 3RLGA 4C1NB 3CUXA 2W61A 1CB2A 1GJPA 2A4AA 2H3BA 2OEJA 3ANVA 6A3HA 3CQHA 2NX9A 1XUUA 1LORA 4CQ9A 1KR0A 5DMNA 2FTYA 3KOFA 1KFCA 1CGVA 3VILA 5EFDA 5JBEA 3RIKA 1ZAJA 3AXMA 4EK7A 1KFKA 3ITOA 2DORA 2INZA 1OJXA 3CHVA 2F61A 4YS1A 1LLZA 3TTSA 3ZYZA 5ABTA 2HJPA 1IT8A 2RJGA 3TR2A 3LBCA 4UR7A 4GCXA 1UR3M 4F0LA 1W56A 2J75A 4S23A 4E2BA 1GQIA 3PPHA 2Y24A 1JULA 4ADUA 8XIAA 4PTVA 4DJDA 3CIVA 4TVCA 4BWLA 3V3WA 4FX6M 4BQ3A 4L6DA 3W1PA 4E3TA 1W3LA 4CEUC 5A2CA 4ZR8A 4C6FA 1KR1A 2BSLA 1UMLA 3CS2A 1Q8JA 5AC5A 3L4UA 2D23A 4J3WA 5CBBA 4M6QA 2V3DA 2IW0A 1DOSA 3QSRA 4JTQA 4W8AA 2CZ5A 1U1UA 2F84A 3W83A 3PY2A 3RAOA 1BXCA 1JDAA 4H6EA 4GC4A 2FZBA 1GOXA 3FN9A 4FLSA 4HNCA 3W84A 3IJ9A 4ZOBA 4FNUA 4J1OA 4D72A 4XZ9A 1FOBA 4YTQA 3N13A 3ZZ1A 3W7QA 3W1UA 5KZ6A 3PANA 1YE4A 1IXPA 1QPNA 3UGRA 1OF6A 2PRMA 1KTCA 1AQMA 4HN4A 2GQ9A 4N4PA 3GK0A 1JYVA 1QW8A 4Z0SA 2RKXA 1XD1A 5CC6A 5G4HC 1TE1A 3S83A 3ME3A 4IM4A 3BCJA 3ZXWA 1EIXA 4H9ZA 4KF1A 3LLDA 5FOOA 3RPMA 2Z2AA 3ECQA 2PBOA 4MDPA 1OCQA 1B3XA 4HZ6A 4HZMA 2VRJA 1UASA 1QDSA 1QR7A 1TWDA 4W86A 2PGWA 2EQDA 1PXGA 5AC7A 3N2MA 3RILA 2QVNA 1A0CA 4U2YA 1UD8A 2OLAA 2PDQA 2R8WA 3BLPX 2NT1A 1E9IA 1W17A 1G9HA 4P8VA 6PTDA 3TYUA 1SO4A 1H5VA 3RYSA 4HQVA 2YJQA 3NQFA 2GGHA 4L7ZA 3IK4A 2L5HA 2Q8LA 4ZE4A 5JU6A 2TAAA 4JD4A 1GOMA 8TIMA 4LVDA 3N11A 3RNDA 3UPWA 1XLAA 4MNLA 1KLYA 1M1BA 3LK6A 2QR6A 2CHNA 3IGXA 2NLIA 1BAGA 1QT1A 2Z28A 1D8CA 1MZHA 2BVDA 7CGTA 4PC8A 4F40A 2WSQA 3EKGA 3JW7A 3L21A 4J3TA 1ESWA 4Q4PA 1N2VA 1RD5A 2RH9A 4FNTA 2XM1A 4N9CA 4O1FA 3VCCA 1NJJA 1OG0A 1XF0A 4LFYA 4DBDA 1H7WA 5C8BB 1RQEA 3EXRA 5A6KA 4O4WA 3MJMA 2ZXQA 3AIWA 1KFWA 3G1SA 4KGJA 5LNWA 1IGSA 3VMPA 3BXWA 4BQ5A 4IIGA 1OX5A 3VIOA 2GQ3A 3M0XA 1QFEA 4AC1X 3SCUA 4RDWA 2ZUTA 1EHAA 3V5OA 2J9XA 3U2OA 2HBVA 5SWUA 1MUCA 3C4UA 4CNUA 5HQLA 4QX4A 3G1DA 4TIMA 2QUTA 4NIRA 4DJEA 4LS1A 1TJ2A 5CC5A 4HZ8A 3S9YA 4C1LA 4HVXA 3I4EA 2KAUC 4GFIA 1NDZA 1F8MA 3CV7A 1T99A 3UZXA 2PB1A 3GVVA 4ZSUA 3PAOA 3WNMA 3LXBA 4O17A 1OYAA 2VEIA 1XP3A 4UCGA 2CPUA 3N25A 4QDPA 2CLMA 3FDGA 1P0DA 5D32A 4XWUA 4GY1A 3TC6A 1YBQB 3QRHA 4FXSA 3GVGA 2ABAA 3N17A 4F0RA 4UFJA 3OZPA 4GI6A 3DYPA 4K2SA 2BGSA 1V93A 2IQTA 3UNDA 5FJIA 1GYNA 2WBKA 4JTSA 2OZ8A 1JQXA 1OK4A 5H91A 3VOFA 3LRMA 4W7WA 3ORWA 4PMDA 1LQAA 3S1XA 1S3HA 3GIYA 3KBJA 2OYLA 1Z9AA 1ADSA 1YEYA 1TV5A 1RVGA 3HQPA 4BEUA 3C61A 3QY8A 4PN2A 3M46A 1POKA 5GJPA 3R2GA 2OT1A 2WC4A 3UJSA 4HOXA 4R27A 3O6YX 5CSYA 2O0TA 4PRTA 4K8EA 3UP8A 4C6BA 4S39A 2A3LA 1JXJA