3THAA

Tryptophan synthase subunit alpha from campylobacter jejuni.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
248
structure length
248
Chain Sequence
AMVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIADAAKIALDQGVDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVPELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVEEAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKCFKQGNLDIIMKDIEEIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Tryptophan synthase subunit alpha from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni
molecule tags Lyase
total genus 78
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2011-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3thaA00
1B57A 4K36A 2V9DA 3T4CA 3JR2A 1CW2A 4UTWA 3HQ1A 3W7MA 1LOQA 5EBUA 3RNDA 1H1ZA 2Z6JA 1OFAA 3DFSA 3RU6A 2EF9A 3W73A 2V5LA 1BEUA 3C56A 3FOKA 5F2LA 1VYRA 4HSNA 1VLIA 2QCLA 3UPBA 4QQ3A 2J9ZA 1QAPA 3SY5A 2A2IA 2Y7DA 3ATYA 5AC8A 3LXAA 3NG3A 3VNDA 3W1RA 3TUUA 3VE9A 3MHFA 4O14A 4RR4A 4ONVA 3TQVA 4RZ5A 3GLCA 1S5WA 1Q45A 4MYXA 1QMLA 3VKJA 3KVLA 3LHUA 3C4UA 1LLZA 2CLOA 4QIUA 1H7PA 4WQ6A 3I7SA 3FJ6A 4DEFA 2WOQA 4YL2A 1A5CA 4H3DA 1SW7A 4ZQPA 4O19A 3KAOA 3M41A 3A24A 4GJ1A 4GXMA 1F76A 4JIQA 3P7YA 3DGRA 1KA9F 1W37A 1R30A 5AC6A 2DZTA 4Q32A 4DF1A 2H8ZA 3OBKA 1RR2A 3RLVA 2Q8ZA 4AWSA 1WV2A 4O4WA 3TH6A 3FS2A 1GJPA 3MO7A 3NM1A 4DBEA 1P0KA 3N2MA 5BW6A 4GFSA 5AYZA 3F4NA 4NZJA 5GVJA 3NQ6A 1HL2A 5KINA 4YCPA 4LUJA 2LLEA 2VFDA 2WKJA 5F1VA 3M44A 4R34A 1JUKA 4XWUA 3BW3A 3S1VA 3LCGA 4B5NA 4R33A 2VEPA 3TFXA 1FDZA 3LM7A 3C2OA 1TV5A 1W3IA 1LOLA 1X6UA 3O1NA 4RCXA 4JTUA 4N2YA 1KFLA 2BXVA 2FQIA 2CLMA 3B8DA 1I2PA 4U4MA 3QPYA 4JYFA 4O28A 1XBVA 1PE1A 3QMTA 1RZMA 3SIZA 1WQ5A 4ADTA 1EIXA 3A9IA 3M47A 3NQ7A 5BRBA 2PRHA 3W87A 3W2UA 5EY5A 5U7SA 4S2CA 3GVGA 3H53A 1TPVA 4WD0A 3ELFA 1FWTA 4LC8A 1G6CA 3QF0A 4MZ1A 3EKLA 1S3HA 3W7DA 1OYBA 2JK2A 1PS9A 3I65A 2CZEA 1ZHAA 3NM3A 4JX6A 5D09A 5IM51 5LGZA 1KFJA 4WOZA 3NQFA 3O6CA 2HS6A 1TPH1 3WJZA 4M7SA 3PULA 5FF3A 3N73A 4IMGA 1KTNA 4TX9A 5DN1A 3IVTA 3C2FA 2Y61A 3AO0A 3O07A 4JTTA 2WJZA 4E2BA 1EUAA 5I3FA 4OGZA 3W72A 1ME7A 2J9YA 4N6FA 1L6WA 1OFPA 4FNUA 2WQPA 4FNTA 3CTLA 2V0TA 4I7UA 5H91A 1SU5A 1MZHA 4HSOA 1EWDA 2YW4A 1H62A 5CPLA 2EHHA 1LCOA 3HG5A 3MMTA 4XTIA 3W71A 3MP3A 6TIMA 2JKAA 1FXPA 4MPQA 1EX5A 1QO5A 3PF3A 1QOQA 4RZ4A 3TROA 4L4LA 4K38A 5CPMA 3CM4A 2QCDA 1LORA 1U83A 3TMQA 3GKFA 4UTIA 3N34A 3RF9A 1PHQA 3ZS4A 3HBLA 4HKPA 5AYXA 2P0OA 4WY0A 3P82A 3DH7A 5G2HA 2ISVA 3P5ZA 4A29A 3O6YX 3KRUA 2E5DA 3GXNA 3G1XA 3ZFHA 4AB4A 7TIMA 4NU7A 3EXTA 1TJRA 3LHWA 4LRTA 2J27A 2WV8A 4O54A 1OX4B 2GUUA 2ZA1A 2V5BA 1J5TA 3L9CA 3LHVA 5J5DA 3P67A 4BI5A 1UUMA 2AGKA 4MYAA 3HB9A 3W2LA 3TFCA 1I2QA 2ZZ1A 2ZTKA 1L2UA 3IRDA 2DZSA 4GUIA 1GQNA 4DXVA 3TQ0A 2A0NA 2C18A 1K8ZA 3WK0A 3P8IA 3S0CA 5C55A 4ZVJA 5G4EA 3NL6A 3ANYA 3INPA 3QC3A 1Z42A 1C8VA 2FFCA 3GKAA 3DHFA 2DZVA 1XC4A 4FHAA 1I4NA 2I9EA 1X7FA 1LBLA 4ZQCA 5L9FA 4M19A 1FWNA 1MEHA 3G3MA 3E9AA 3DFNA 3PR2A 5IBXC 4NT0A 4O18A 4HNNA 1AW5A 1QPRA 1EPXA 2QJGA 5CPNA 1H7WA 3S1XA 2FB3A 1JCYA 3NPWA 3S5ZA 1VJIA 1ICQA 4GC4A 1JULA 1ZNNA 3W7NA 3PB0A 5KITA 1EP1A 5AFDA 3EWWA 4BWLA 1FUYA 2BX7A 3MBFA 2Z0IA 3B0VC 3OA3A 1YXCA 4MZYA 2FB2A 4JGDA 3P62A 2X1UA 1K7XA 2XN0A 1H7RA 3W86A 2CLFA 5EKYA 4IPJA 4X22A 4CCCA 4GUGA 1YYAA 1K03A 5D05A 2DZXA 1H50A 2WPBA 3SJ3A 3TJXA 3T40A 1G4PA 3SGZA 1F73A 1F5ZA 2J6XA 2NWRA 2XN1A 2CU0A 2V2HA 2YYUA 1GVSA 1P5BA 1TPB1 4JR5A 1JQVA 1OF6A 2R14A 3E12A 3RFAA 1UBSA 3P80A 3P8JA 3SFKA 4OV4A 3DHDA 2GJNA 4IXXA 1ZCOA 3WJYA 1OFBA 3L5MA 4LUIA 3S5YA 3GXTA 4O16A 4HNUA 1GT8A 3N19B 1J4EA 2B7PA 1GVQA 6ALDA 2BZNA 1L6YA 2JBMA 2QKFA 3G1FA 4N9EA 4TMBA 3D0CA 1PL9A 4Z1BA 1PCKA 3W7LA 4EVZA 1XFBA 3UXAA 1JJKA 1DBTA 1M5WA 5FEPA 3QFEA 3NQAA 1KM0A 3S1WA 4IQLA 1TTPA 2QDHA 2ZYFA 4GE8A 4AWTA 3DFTA 3LXBA 3HG2A 1A5SA 3E0IA 3TC6A 2Z2UA 3NR0A 5D37A 3UNDA 3HIJA 4S1FA 3W70A 1M7OA 2NV2A 4MKNA 3NDOA 3SR7A 1TMHA 3TNOA 5E93A 1TSIA 1K3UA 2Y85A 3TDFA 3LTYA 1LROA 3MHGA 4DBDA 1KLYA 4UMCA 1FY6A 5EA9A 3BARA 3THAA 3HG4A 2NX3A 5CSSA 4LU0A 3EXSA 2QR6A 1GZGA 3TR2A 3EWUA 2DJLA 1A5BA 1QFEA 1TYGA 3GDRA 2DZPA 3L0NA 1O95A 1W5PA 3IIPA 1HTIA 3M5XA 1Y0EA 2OJPA 2VFGA 3C2EA 1FDJA 3BPWA 3R13A 2CFFA 2Q8LA 2PURA 3G24A 4AHQA 1IIGA 3MJYA 2NZLA 5D33A 2E09A 1I2NA 1IXNA 3GXPA 4RKAA 4LVBA 1LRQA 3B03A 5K9CA 2PRLA 3FIGA 5CPOA 4MZ8A 3KVJA 1QPQA 4O0ZA 3RMJA 1KFCA 3GNNA 5IBXA 2NXHA 3TSMA 2A7RA 3G1VA 1RPXA 4IMFA 3W85A 2Q3RA 5K2ZA 3PWAA 1VQTA 5HUPA 1DJQA 1D9EA 3UWYA 1AL7A 3K30A 3LDVA 3PBUA 2G95A 3LCXA 3TXVA 3QEZA 1WOAA 2A85A 4XUGA 3E49A 1KV8A 3NO5A 5A8GA 4DF0A 2ZRZA 4Q4KA 4QITA 3W2JA 2NXIA 1U5JA 4NX5A 5AN7A 3TMLA 3RLUA 4QJ1A 3C3NA 1WA3A 4O11A 3MW7A 1D3HA 4JTEA 3BGJA 5HJLA 3S42A 1Z41A 1W54A 2ABBA 3NZRA 3EX6A 2HTMA 5DBUA 1QNVA 3VFLA 4EOUA 4DO5A 2EKCA 1ML1A 4O50A 2ZDRA 4KFPA 3W1LA 3PG9A 2A6NA 3LCFA 3PVFA 4O8RA 1EB3A 4JICA 1OX5A 1VH7A 4CLMA 2CLIA 3TW6A 1MO0A 4K7VA 1VZWA 2PCQA 3LHTA 2Y63A 3NA8A 4MFEA 4E0CA 3UZJA 1S5VA 3W7PA 1JRBA 3OG3A 1C29A 3EB2A 1FQ0A 1JUEA 3W7CA 1W5QA 4MFDA 3NZ1A 3N2XA 1DQXA 3MI3A 2F84A 4NQ1A 3R8RA 4YMZA 3AJXA 4UTHA 3CHVA 1KTCA 1KFBA 2A6LA 4AF0A 4EWND 4E38A 1H7OA 3CT7A 3T78A 5CSRA 1GVFA 2VENA 1FWSA 2RHGA 1WYIA 1GOXA 1JUBA 4UTKA 5D03A 4R53A 4UIOA 3ZR4A 2DJXA 4RX0A 1KM2A 1TCDA 1A53A 1IGSA 1TO3A 1TTIA 3LX9A 2GQ8A 4JTGA 1TRDA 3LXCA 2NX1A 5D38A 3GDMA 4NJGA 1NEYA 4BFAA 4QAIA 1BWLA 3KRZA 2WSQA 2Z1BA 1SFLA 2ZRXA 1XL9A 3SZ8A 3W7GA 1OABA 2I1OA 3NQ2A 4GUFA 4JX4A 1OHLA 2QEZA 3P61A 1TREA 4LY8A 8TIMA 4UFLA 3G8RA 1TIMA 3USBA 1VR6A 4NJHA 3ABQA 5BMXA 3G1HA 2FPYA 3S5NA 3LCHA 1SO6A 3B06A 3EX4A 4CQAA 1F05A 4HPJA 1XUUA 3DFQA 2ZZ2A 3LCWA 4JD4A 1OFOA 1TQXA 2CZDA 1QR7A 4CCEA 3DI1A 1WX0A 3V75A 2ALDA 1OK6A 4RXFA 4JNMA 4UFJA 4JYEA 1DKWA 1PVNA 5D04C 3O63A 4PL1A 1VC4A 4HPXA 2YYTA 1I2RA 5H2ZA 3W7HA 4CCDA 1RV8A 2Y89A 2JGYA 4AMAA 4N4PA 4R7JA 2V2DA 3T7VA 1UB3A 2B0MA 4LS1A 2CLEA 5FF2A 1NAL1 4Y6GA 2P1FA 3GDTA 2C1HA 3TK7A 5LHFA 3R5EA 5CG7A 1EEPA 3GAYA 2DU2A 3ZWSA 1DL3A 3GAKA 3C61A 4ZZ9A 3G8EA 3HGJA 3QH2A 1TJPA 4K8HA 1W1ZA 5FEZA 2YPIA 1JQXA 1FCVA 5F4XA 1OFDA 4U28A 3CPRA 4DELA 1SZGA 4IGHA 1H1YA 2ISWA 5EPDA 4M6VA 4PEKA 1TB3A 2VEMA 2QF7A 1W3NA 3LI0A 1ZAHA 1V5XA 2EPHA 4O1DA 4OV9A 1BTMA 2ZRVA 1W8SA 2EGZA 3SW6A 4N4QA 4Z0JA 3E02A 4WY0F 1VYSX 2WNZA 2DORA 1F6PA 5LZLA 1SO3A 2ZA3A 2ZZ4A 4KWVA 1OX6A 5FEXA 1CI1A 1H51A 4DO4A 2B7OA 2TPSA 4JTJA 3W22A 2A5HA 5I3KA 1IF2A 3EEGA 3LB0A 4O1BA 4UTTC 2GVJA 3QRHA 1KM6A 2NV1A 5C6MA 4MIMA 3L0GA 1XM3A 3UXDA 2H3DA 4JY8A 3NPXA 3TJLA 4LC6A 2BWGA 1GTEA 4PC8A 3V1PA 3LBCA 1F7BA 2ZRUA 5I3GA 3CLMA 2NX9A 3QSTA 3W7KA 5D2TA 3M43A 3QZEA 3NVTA 1YTKA 3PBWA 4JIPA 1HO4A 5FI8A 4A21A 4UFHA 3WFAA 3TU9A 3MBDA 3NOEA 3IEBA 1H60A 3TSBA 1VHNA 3NGJA 4NXKA 3FYOA 3NQEA 4NNBA 2NLIA 2FTPA 1OK4A 1Z44A 3STEA 1Q6LA 1KFEA 3CWNA 3TAKA 1W31A 2Y70A 3KVKA 1YADA 4UTUA 4WXYA 3ABSA 4IJBA 1H7XA 4KFOA 4MUZA 3L5LA 1G4EA 1B3OA 4LT9A 1ICPA 3LTPA 3N9RA 3W3OA 2D73A 1P0NA 3WK3A 4OBTA 2VC6A 4IOTA 1S5TA 1SPQA 3MUXA 4M7TA 2VEIA 3PB2A 1SSGA 2C13A 4FX6M 1TPC1 3PAJA 5K3VA 5F4SA 4DQWA 2GQAA 2VEKA 3ZWTA 2RFGA 2Y7EA 3WJWA 1KFKA 1XBZA 4UCGA 3FKKA 2X16A 3EWYA 2C19A 4MJMA 2RDWA 4LOCA 4NNCA 4L4MA 4O52A 3HO8A 4A2RA 5FF4A 2RKXA 3M7WA 2BSLA 1THFD 3BG3A 1KBIA 2A21A 3PBVA 4Z08A 1GVRA 1WDWA 3OEXA 3W88A 3B04A 4X2RA 3THQA 1QCWA 2ZFAA 1DHPA 3DU0A 2FDSA 4TR9A 1KV5A 5SWUA 2JKPA 1SW0A 3GR7A 2QCGA 1D3GA 5HWJA 5I3IA 5DCDA 4JS3A 4WJEA 3H54A 2ZZ5A 4UTMA 3L0KA 1NFBA 1FBAA 2BTMA 2WSYA 3S6DA 4LVAA 3STCA 5KMYA 4GUJA 4KWWA 4MVAA 4FX7A 5K4XA 2PE4A 3TA6A 1LBFA 3GYEA 5LNRA 3Q37A 3CWOX 1X1ZA 4HIBA 4Z1DA 2V8ZA 4BK9A 4LV4A 4NNAA 2Y62A 2NWSA 4UTTA 3W7RA 4JN6A 2R8WA 3BO9A 3LRKA 1AMKA 3EWBX 2OX1A 1XKYA 2YFOA 1PIIA 4OE7A 4JTHA 1FWWA 1H7NA 3TAOA 3HF3A 4K6AA 4BI6A 4LV9A 4OU1A 3HOJA 1LZOA 3NQCA 1K02A 3MYOA 3TX9A 1TPEA 1W5NA 1G69A 5F2GA 3O06A 4O0KA 3MYPA 5G1TA 3HGOA 1M6JA 2CWNA 3OIXA 3WJXA 1WOBA 2WSRA 3GDLA 2W79A 3BVJA 2E6FA 3W1MA 4Y96A 2EAWA 1QPOA 2OMAA 1SO5A 1G7VA 3QMSA 3EXRA 4K8EA 5KZDA 4PA8A 4JTFA 5F2MA 1W5MA 3Q94A 4RJEA 3UD6A 1F74A 4UXDA 1VCFA 4TU1A 5C54A 4WZHA 1A50A 1W3TA 4CQ9A 4NJKA 4OHQA 1G4TA 4XKYB 2QUTA 1P1XA 4NUWA 2Y7FA 3I7QA 2I14A 3KRSA 2E5CA 3KXQA 3W07A 4N02A 4IWWA 1KLZA 1TRIA 2R94A 4PCFA 1SFJA 3TW7A 3M0ZA 2VOMA 1G67A 1ZALA 2OCZA 2CW6A 5HULA 4ML9A 5CZSA 2DZWA 4P61A 3W2KA 2X30A 3TCEA 1RD5A 3O16A 2BLEA 2QAFA 4UTWC 5D2VA 5EMUA 1PCWA 1IXQA 1L6SA 4D2JA 3NPUA 3I6RA 3TXZA 4YWIA 2ZBTA 2J24A 1KW1A 4OQVA 4NZFA 3G18A 3M5ZA 1BWKA 3Q2DA 3R2GA 1DVJA 2YXGA 1XBXA 3DBPA 1F2JA 3L68A 4JEQA 1ME8A 4O10A 2QCDB 4CQ8A 5KSWA 1QOPA 2B4GA 1ICSA 1K7FA 5TQLA 3P74A 3W1QA 3F1QA 1QWGA 4UMBA 1YDNA 3CB8A 4BF9A 3U2OA 4WY0B 1JCMP 3CQ0A 2NUWA 1NF0A 1IXPA 5HWNA 1F6KA 1T96A 3CU2A 3LBMA 4FXSA 5BOOA 3O15A 3LERA 4WUIA 4UTJA 2Q3OA 5DCBA 3W7OA 5HWMA 2QJHA 3C6CA 1R2TA 2YGYA 3QQ1A 5CGQA 3BG5A 2J88A 1ZFJA 4Z0SA 4OT7A 1GG1A 2UV8G 4MJZA 4X3ZA 5DXYA 1YDOA 1B4KA 3IV3A 1DOSA 4GBUA 4Y9AA 3LHZA 4K37A 5AHMA 1R46A 2Y88A 1AW1A 2DP3A 4A2SA 3EKZA 3B4UA 4NJIA 2H6RA 4RK8A 4M6QA 3NXFA 3LRLA 3LV6A 4Y8FA 3W84A 1WBJA 4N6EA 4XTDA 4JXCA 4LS0A 1MSSA 1NF7A 4FB7A 1DJNA 3E96A 1FWRA 2A4AA 1T99A 1UUOA 3KVMA 3GNDA 4IUOA 4LRSA 3NPVA 1EWEA 2W0UA 5CZTA 2HSAA 2YFNA 3BG9A 3W1PA 3WK2A 3NAVA 4LTSA 2YSWA 4UFKA 4XQ6A 3P84A 3G22A 4M5PA 3PG8A 2NXGA 1LP6A 3UWWA 1SUXA 2C0AA 2H90A 4X9SA 3NL5A 1Q6OA 3S1UA 3LTSA 3QW4B 1T8XA 2Z6IA 5D2YA 5T26A 2FLIA 2A7PA 1GG0A 4OWGA 2HS8A 1KM3A 1UASA 4ORIA 4QNWA 1TV8A 5D2XA 4O1AA 3PM6A 2XFWA 1YTDA 1FX6A 3G1SA 3KX6A 4O17A 3DFPA 3QYQA 3NNTA 3QSRA 3MHUA 1L9WA 4QSHA 3W1AA 1PHWA 3G0SA 3N9SA 1LRTA 4IX0A 3L66A 3OVPA 2C3ZA 1OX4A 4FNQA 4ADUA 4YCOA 4A22A 3WK1A 2O7QA 5KZEA 3L5AA 5LNVA 4C1LA 3FEMA 2E1DA 1ZY9A 3DXIA 1IXOA 1OFQA 1JR1A 2OZ0A 4N9BA 3L67A 4GRSA 4P2VA 1LTDA 3GDKA 3IVSA 3BW4A 1KTBA 2E68A 3HPSA 5AHNA 4EF9A 1W5OA 1LBMA 3L2IA 4GWEA 4JYDA 2E5BA 5D32A 3G3DA 4POCA 5FF7A 1XI3A 1VLWA 1FCQA 2RH9A 4NXSA 2ZZ7A 3TIMA 3W1TA 1RQBA 4I9AA 4S2BA 3M5VA 5CKSA 4LVFA 4O1CA 5F1UA 5LKYA 2QUUA 3PSWA 2VXNA 1TQJA 4JTKA 2YW3A 1R2SA 5I3HA 4ORMA 2X2GA 3ABRA 5DY3A 4TIMA 4GNJA 5U4NA 1VHCA 2HMCA 3UZ5A 3DENA 2ZZ3A 4O13A 5TIMA 4RV8A 2ZTJA 1XXXA 2PC4A 4AXKA 3NQ8A 5G4WA 2VFHA 1HUVA 3UYCA 5BNKA 5F2IA 2AAMA 3ATZA 3W6YA 3BV4A 2YX0A 3T44A 4UFMA 1GYLA 3FLUA 1IIHA 5AHIA 2E6DA 4A3UA 1HO1A 3MWAA 1NVMA 1B4EA 1OVDA 2JGQA 3R12A 4UTLA 1QDSA 4IXHA 5AHFA 3GZ3A 1TPUA 2C16A 3UQNA 3M6YA 1N7KA 3LV5A 3NYZA 3LCIA 5CZJA 2ZRYA 4AWUA 1ZAJA 1J2WA 1SQ7A 1ZENA 2WO5A 1YDVA 1C9DA 1JCXA 2QCFA 1W56A 5HINA 3TV8A 4ICNA 3LGEA 4TO8A 4UC5A 1VCGA 4LVGA 3W74A 5HUOA 2A1YA 3W1XA 4N9CA 4HNTA 3TQKA 4ZQOA 3QJAA 1JCLA 1WXJA 3F03K 4RLIA 1RQHA 4BWLC 5HMSA 2QAPA 5CZ0A 1VPXA 3LLFA 4J9JA 1CX9A 4XKYA 4JTIA 3O05A 3IIZA 2XN2A 3MI2A 4LS2A 4FX8A 5LHEA 3YPIA 1OYCA 3PSVA 4ZQRA 1VS1A 1DQWA 3O8AA 3L65A 1Z48A 3W9ZA 5AB3A 3NQDA 4RXGA 4AHOA 4CNNA 3FFSA 3UWVA 3CEUA 3BW2A 5EL1A 2O7SA 3W23A 4YXGA 3UY8A 1MEWA 2YCEA 3W2MA 3N14A 3WJSA 4GUHA 3NQGA 5D02A 1N55A 3IVUA 4AHPA 3W75A 4FEZA 2GJLA 4JDYA 4Z1AA 5K4ZA 1SZNA 4QISA 2GQ9A 4I7VA 1BKSA 4IMDA 2X1RA 3W83A 5G2IA 2QJIA 3G0XA 3U6WA 4IMCA 3FYPA 2YR1A 3CEPA 3PUEA 1KM5A 1GVOA 4O12A 2ZCGA 4PFMA 1MEIA 4ZQNA 1Q6QA 1ADOA 2JKEA 1YXYA 2TMDA 5AOUA 5HR7A 2ATSA 2V2CA 3DZ1A 3TSDA 5I3JA 2VKZG 4C1KA 1RVGA 2CLHA 3DKLA 3NQMA 1X1OA 4MOZA 1OJXA 3ABOA 4NX0A 5D2WA 3M1ZA 3F4WA 2VELA 3QM3A 1GPWA 4QNEA 2NUXA 2GPTA 3W7IA 1SZFA 4JTSA 4WXZA 1LOSA 4IPIA 3SGUA 1TTJA 4ZMGA 4LVDA 1SZEA 4AF0B 1SO4A 4H6KA 1MXSA 1K8XA 4MY9A 5FF0A 3A5FA 5DBTA 1VCVA 1VGAA 2PRMA 4MLRA 3G0UA 1ZAIA 2E6YA 1LDCA 1GYNA 4JX5A 5J5RA 3TKFA 2C6QA 2E77A 1WAUA 3L21A 4FXRA 3VCRA 5E0KA 3LI1A 5DY2A 5FEWA 2G5WA 3C2VA 4PODA 3OVRA 4HHPA 1SW3A 4N9DA 5HQEA 2QUVA 2QCHA 3GK0A 2ABAA 3A22A 2YZRA 3W1UA 2C15A 3P5YA 1XBYA 4XBSA 3IIVA 5K7JA 5FESA 3CC1A 1K7EA 1X8FA 2F7FA 3M5YA 4K39A 4Z1CA 4DPQA 1AK5A 1Q6RA 2KZHA 4EIVA 1DORA 4ZL1A 3BK0A 5D30A 5MHBA 3STFA 2ZQ0A 2E6AA 3DKJA 3LRMA 3LHYA 1O60A 4IX2A 5HR6A 2X1SA 4AH7A 4LW7A 1Q3NA 3PUDA 3LLDA 3UWUA 2TSYA 3VI2A 1N8FA 3MP4A 3B0UX 3H55A 4FO4A 3C52A 1TPFA 5DXXA 3BGGA 2QCEA 1LM1A 3DFOA 1H61A 2A7NA 4DPPA 2R91A 2VFEA 1JRCA 2G97A 1QPNA 3QMRA 3STGA 5KZMA 2Y7GA 5ABTA 4BI7A 1LRNA 2Y6ZA 5AYYA 2OT1A 5K9DA 3NQVA 3PY2A 1K8YA 2X1TA 4G1KA 1ME9A 4H4IA 1I8JA 3C0JA 4O57A 3FA5A 2TYSA 2V82A 3SI9A 3PUOA 3A5VA 3W7QA 3N3MA 1FCBA 1GTHA 4KFNA 3IIOA 3C2RA 1YTEA 2GOUA 4RZ6A 3EX2A 5AHEA 4FNPA 2ATMA 3G1DA 2ZA2A 1OFEA 3QPZA 5G1YA 3T55A 4XBKA 3B05A 2CLLA 1KBJA 1XCFA 3UY7A 3BLEA 4CNPA 4I7WA 1B9BA 5K9XA 1UCWA 3R89A 3HGRA 3Q58A 1GWJA 3GIYA 3EWZA 3NEVA 1OG0A 3EX1A 3LOTA 1A5AA 5LSMA 1HFBA 1NSJA 3UPWA 1YLVA 3HPZA 3JS3A 1XUZA 5E1QA 4O15A 1XDLA 3HJZA 1O5XA 2QCCA 3KOFA 3IGUA 1ALDA 1O94A 3NL3A 1FXQA 4DO6A 3QQ0A 3G1AA 1YXDA 5A5WA 1XDMA 4MY8A 2RDTA 4UNKA 3PC0A 3TC7A 3QW3A 3A23A 5LNSA 3W2NA 4O53A 3EWXA 3PS7A 2DZUA 2G96A 5DCEA 1H63A 2TRSA 3B0PA 3MI6A 3HGSA 2OT0A 3CIWA 5LGXA 5KTLA 1TTQA 3P81A 1FCUA 3FKRA 2QCMA 4TMCA 2FJKA 1OF8A 3O6DA 5DLCA 3EX3A 3W7JA 2C14A 5AHLA 3CIXA 4CNOA 1PV8A 1O4UA 1EP2A 1P4CA 1SR9A 1QO2A 3IGXA 5L6UA 5G2WA 1EA0A 1R47A 3BLFA 3M9YA 1JVNA 4ZQMA 1GEQA 5BMWA 1DV7A 3NL2A 1H5YA 2B7NA 2V30A 2GVGA 4WX2A 3HMJG 2QDGA 1LLWA 5C2XA 3S9YA 1JCJA 4UR8A 1YPIA 3MP5A 4LWWA 4DF2A 3I7RA 4PTNA 2FIQA 4UR7A 3TE9A 5HNRA 3M16A 3C8FA 3UWQA 1OYAA 2H8XA 2QCNA 4UNLA 3DAQA 1G4SA 3GB6A 1WBHA 2ZZ6A 1G7UA 4XZ9A 4UFIA 4NJJA 3KHJA 4E2DA 5LNUA 1TV7A 1EP3A 1V7YA 1VYPX 3PBYA 4JTLA 5EYWA 2IQTA 3S5OA 2VFIA 3DI0A 4HT3A 4MY1A 4AAJA 1M7PA 3SSJA 5G5IA 4MLJA 4K7YA 1JCNA 4PL2A 1W0MA 3A21A 1ZJIA 3GR8A 4BR1A 1KM1A 1AG1O 2FPTA 1EUNA 1UJPA 4Q33A 4EF8A 3U8GA 4UMAA 4QM1A 2W6RA 4ADSA 2J9XA 4FF7A 2CZ5A 1AW2A 3VE7A 2AQWA 4WOQA 2V81A 4KKXA 5C5YA 1LYXA 3W1NA 1TPWA 1R2RA 3FJLA 1VRDA 3GX9A 1YPFA 2ISSA 3IIXA 4Y90A 4AVFA 2VFFA 4LNYA 2CLKA 5F4WA 4PH6A 4M6PA 1OFRA 4ALDA 1KM4A 4FNSA 1TPDA 1ONRA 3W76A 2YDAA 3RK8A 3W7EA 5LNWA 2ZRWA 4JDBA 4W9TA 4O4VA 1O5KA 1SSDA 5TBOA 3HG3A 3LCLA 5DELA 2RDUA 1RQEA 3JRKA 2H3BA 1HG3A 3IGSA 3BLIA 2WNNA 3KFTA 2WNQA 1AL8A 3I68A 2CZFA 1I2OA 2GVLA 5AC7A 1E51A 3OHIA 4IMEA 2FPVA 3SECA 3UWZA 2NUYA 3S8HA 4FNRA 3HPXA 4JY9A 4FIQA 4UUIA 4AEOA 3G1YA 2B7QA 1T0OA 3P60A 1FDYA 2P10A 3OVQA 4NVTA 4HNVA 4FIRA 1I45A 4HN4A 4YLWA
chains in the Genus database with same CATH superfamily
4WHBA 4O8AA 4F0KA 3N9KA 2V9DA 3KS5A 2V3EA 3PP7A 2OZ8A 3SRFA 3W7MA 3REQB 4CD6A 3RNDA 3QY6A 4QFUA 1QI2A 3DFSA 2X41A 4HGXA 2VEGA 3FOKA 1VYRA 4K2SA 2GLKA 2QCLA 2X09A 2JIEA 2J9ZA 4PTMA 1BHGA 2CERA 1KBLA 3LXAA 3NG3A 3W1RA 1BRLA 4I5RA 3LNMA 2CKRA 4O14A 4RR4A 1IEIA 1W9DM 3UERA 3CIVA 2XFYA 1Q45A 2JF7A 2Z2BA 4MYXA 3AS1A 3VKJA 3GXIA 3C4UA 4OVXA 4DHGA 4NAEB 4LF2A 5IRPA 5HAOA 4QIUA 1H7PA 3KS6A 3I7SA 4AZ5A 3EA1A 1XQKA 1KR0A 1CLXA 4AWEA 2BHYA 1Q6GA 3GW3A 3M41A 3A24A 4GJ1A 1JAEA 3TN6A 1XSIA 4P7RA 4JIQA 3P7YA 3DGRA 3Q65A 3L23A 3OBKA 2OFJA 3RLVA 1IYXA 1XYMA 2Q8ZA 1WV2A 2UWFA 1M04A 4GNVA 1A47A 3NM1A 2V38A 3N2MA 2J8TA 5AZ1A 2RAGA 5AYZA 1Q6EA 4KESA 3SM0A 5LIYX 1E5NA 1TX2A 5EMJA 5F1VA 3VO0A 4R9XA 3BW3A 3S1VA 1FWJC 3C0LA 4R33A 5IHRA 2VEPA 4V27A 1XH1A 1W3IA 1X6UA 4RCXA 3KEHA 1KFLA 3WYZA 3B8DA 1QPKA 4NI3A 4U4MA 4JYFA 1LQ2A 3CQHA 3IK4A 4ADTA 3ZZ1A 3HM7A 3M47A 3NQ7A 4U10A 2AMXA 3DYPA 1IEXA 3H53A 4WD0A 1VPYA 1JZ7A 3WEZA 4MZ1A 2HISA 3QF0A 3IJ7A 1XGZA 3EKLA 3W7DA 1EGZA 2XYLA 2JK2A 3WDIA 4M80A 3WH6A 2ACSA 1A5NC 1JDEA 2NVAA 1L0PA 3L4YA 4H9UA 1W8GA 1GOQA 1SGJA 3AYVA 5FF3A 2WWCA 3N73A 3CHFA 1KTNA 3VD7A 2ZX8A 4TQTA 4ZXLA 4JTTA 1J6PA 5BU6A 1EUAA 3H12A 2J9YA 4FNUA 2WQPA 4FNTA 3CTLA 2WQDA 1R85A 3F7JA 1DEDA 2F9RA 2H9AB 1GQJA 1GNXA 4H8HA 4E2OA 1V6WA 3H7UA 6TIMA 1UG6A 3MSDA 4ICMA 4WRHA 1QOQA 3CK5A 1M7XA 1A3HA 4ZBCA 1Q7ZA 4US5D 4ZTYA 4YWSA 1LORA 3OLGA 4UTIA 5A6TC 3CAQA 3ZLFA 2WMGA 1XIJA 3QLLA 2ISVA 3P5ZA 1J6OA 4A29A 4GQGA 2WM1A 3OODA 5A95A 1R9ZA 3LHWA 4QS5A 4GQRA 4G7EB 1BYAA 2VGFA 4O54A 4H7ZA 4QEHA 2ZA1A 3E2VA 3LHVA 4XD5A 4H1ZA 4MJ4A 1QBAA 3TTYA 3E0WA 1RCQA 1X97A 1J96A 2QGYA 1I9CB 1JNDA 4MUPA 4GUIA 1CCWB 3VGEA 3BCJA 3BAKA 3PK7A 4G56A 4JNZA 4XZIA 3BV7A 1NFPA 3UGVA 3ANYA 3GKAA 3KBSA 3LPGA 4XK2A 4XBJA 1HJVA 4ZQCA 3UVIA 1FWNA 3G3MA 4PBEA 3ONCA 1PX3A 3DFNA 4BHYA 4O18A 4HNNA 5JIPA 4CCZA 3VZYA 1A5UA 3VIMA 2CBIA 1UPPA 3BLDA 2VC5A 3RUBL 1ZBVA 4GC4A 1JULA 4V2XA 5BYWA 3EWWA 4BWLA 1FUYA 4OUIA 4ZO9A 2Z0IA 5FJTA 1QWKA 1DJIA 3RX2A 1CXLA 4MZYA 4U33A 1NU5A 1K1DA 5CC7A 1NOWA 3CXOA 2FDMA 3QR1A 2NW0A 2DZXA 2WPBA 3SJ3A 3U48A 1XRVA 3AOFA 2J6XA 4AZCA 4BEQA 4GZ7A 1P5BA 1JCTA 1JQVA 1MW2A 3DECA 3RFAA 1EH9A 1UBSA 4LAZA 3K8LA 2BB0A 4Q8MA 3DHDA 4IXXA 1FTXA 2G50A 2PWEA 3L5MA 1NP2A 1GW1A 3GXTA 4O16A 1GT8A 1J4EA 4QJ4B 1EO7A 2CC0A 1PZ1A 2DPEA 1NTHA 1PL9A 3BH4A 4P7NA 5ABGA 3EOEA 4EVZA 1XFBA 4LSBA 1H0IA 3TC3A 4EE9A 1CECA 5HANA 1TTPA 2QDHA 1L8NA 3LSCA 3HG2A 4BCEA 1TWWA 3TC6A 4PUNA 4DY1A 2Z28A 4HU8A 1M7OA 2NV2A 3N2CA 1A5KC 3SR7A 1SJBA 3TNOA 3H21A 1LQAA 4UCFA 4LBSA 3GXDA 4YTTA 2VX6A 3CHEA 1LROA 1UMYA 2G3NA 4UMCA 2G0WA 2FYMA 4LU0A 2EPLX 3VIFA 3B9DA 1E6SM 2WB5A 1YMYA 3L7RA 1RVKA 2DZPA 4WLCA 2YLLA 1J0IA 4F4RA 3R13A 2REQB 2PTDA 4YHEA 4AHQA 2NZLA 2PWUA 2C91A 5GNYA 1IXNA 3GXPA 1O6IA 1LRQA 4GIEA 5K9CA 4CVWA 4MZ8A 4G6CA 4O0ZA 4AC1X 1KFCA 3GNNA 4PTVA 2NXHA 3TSMA 1RPXA 4NZ3A 1OCNA 1R3SA 4F0HA 3TXVA 2OO0A 1UA3A 4AUBA 2A85A 4PMJA 1V02A 1KV8A 5A8GA 5A69A 2NXIA 4QE5A 4QJ1A 2WBKA 3SN0A 2Y2WA 4Z2LA 4XO7A 1CB7B 3HFTA 4UR9A 4ATWA 1WDSA 2WC4A 3VFLA 1QW9A 2PCEA 3U4FA 4DO5A 2P8CA 1ML1A 4O50A 3VM5A 4QE4A 3WD0A 1B30A 1EB3A 3UF9A 1JFHA 1P6WA 2Y63A 4Q4RA 3DN5A 1S5VA 9XIMA 1C29A 4CD4A 2AQOA 3WD4A 4R85A 1ZZMA 2NQ9A 1M41A 1WP6A 3NZ1A 1C91A 4KEZA 2ON3A 2A3AA 1F3TA 4XSLA 3SQSA 3CHVA 3EOSA 3WLRA 2UY3A 4LYQA 4EWND 3WLMA 4UB9A 1H7OA 1UD8A 2OGYA 4I8YA 1GVFA 4RDWA 3D6NA 4UTKA 3JU2A 4UIOA 3ZR4A 1E72M 1TVNA 3TTEA 1A53A 4GINA 1TO3A 2ONEA 2UBPC 1V02E 4JTGA 3KRZA 4H9XA 2ZRXA 1FVPA 1XL9A 2JFEX 1FKWA 1UP2A 4JX4A 4LY8A 2GK1B 4NAFA 1W2VA 3G8RA 4R5EA 3QHOA 3ABQA 5BMXA 2HE8A 3G1HA 1M68A 2G3FA 4PUUA 4DNHA 4MNJA 3LCHA 8XIMA 4HPJA 1CTNA 3VMNA 3S5SA 2XINA 2DUXA 1TJ2A 1QR7A 3DI1A 4JYEA 1DKWA 4OOUA 1PVNA 3UT0A 3IWPA 5H2ZA 1RV8A 3M07A 2Y89A 2XVKA 1R5YA 4N4PA 4R7JA 4G2DA 3WDHA 1DXEA 5LHFA 1EEPA 3GAYA 5T91A 2ZVIA 1ONEA 4W8BA 4ZZ9A 3G8EA 3HGJA 1TJPA 4K8HA 3AZSA 4DI9A 1WDPA 3K1DA 1EOMA 3UJRA 5F4XA 5EBAA 5REQB 2D2GA 1J2BA 2QQ6A 4M6VA 3TEVA 4DBSA 2VEMA 3P0XA 2QF7A 5CEWA 4Y9OA 3LI0A 2YA2A 1ZAHA 4IH3A 1V5XA 2EPHA 4O1DA 1Q2RA 4JIRA 1W8SA 3SW6A 2YA0A 1PKYA 1VYSX 3S9IA 2WNZA 3G2GA 4ILSA 2DORA 3LQGA 2PD5A 2ZA3A 5FEXA 1OX6A 3E5PA 3W22A 3M0YA 1XYCA 3M0HA 2A5HA 3DESA 4KS0A 4AD4A 2Y8VA 1AJ2A 2OX4A 1IF2A 3KLLA 2OVLA 3QRHA 7ENLA 4MIMA 2I57A 3CL8A 4JY8A 1HQTA 3IAPA 2BWGA 4E2VA 3H7VA 2GUBA 1EGVA 4ERIA 2NX9A 3TZFA 1A80A 5D2TA 3MU7A 3GO2A 4IFKB 3PUGA 1CXFA 2DW6A 4HN8A 3TU9A 1UP3A 2PMQA 1ITUA 3NOEA 4W7VA 1H60A 3TSBA 1E0VA 5G4HC 1DP0A 1Q6LA 1W31A 3GUGA 4UTUA 4L6HA 1GVYA 5IFPA 3UZZA 4OBRA 3DHUA 4F0SA 3THUA 1ICPA 3PANA 2X1IA 3N9RA 4HOXA 3T42A 1JZ2A 3UESA 1BQGA 1WKEA 4S38A 2PWDA 3OZPA 4C7DA 2DEPA 2VJXA 4DM1A 1SSGA 2C13A 1O66A 5DEZA 1TPC1 5K3VA 4DQWA 2VEKA 3PTMA 2Z00A 4FAMA 2Y7EA 2X16A 3SQLA 2Q8XA 2RDWA 3OYXA 3NSXA 3OZMA 2BSLA 2WJFA 1THFD 3BG3A 1GZ1A 2GSJA 3MVIA 1Z8AA 1WDWA 4DWDA 5MF5A 1TA3A 2PSNA 3KZSA 4W7WA 3PZNA 3O2LA 3W88A 3B04A 1B1YA 4W88A 3DU0A 1KV5A 2WVVB 3L4VA 5CLTA 1D3CA 2JKPA 4FPSA 3I6EA 2CHOA 1D3GA 3SURA 1TKKA 2ZZ5A 4UTMA 1NFBA 2ACUA 2I16A 3AFBA 2GGGA 1V7AA 1CBGA 3SB0A 3STCA 3V7PA 4MVAA 2VHLA 3M0IA 3BL3A 5K4XA 4ZTXA 4OKDA 3VDBA 3GYEA 1KO0A 4Q4MA 5I09A 1JZ5A 4ZA0A 5CSUA 1FHDA 3PZUA 4HIBA 4BK9A 3I4KA 4NNAA 2NWSA 3EWCA 4CD8A 1FWAC 1DIKA 3FJ4A 3BO9A 3OVGA 3RLHA 4XVEA 2XIJA 3RDKA 5E5CA 1ECEA 2CEQA 3SQMA 1PIIA 4JTHA 2OQYA 4K6AA 4BI6A 4QEEA 1MXGA 1LZOA 3TX9A 1TPEA 4JTQA 1HKVA 4NZ5A 5ABEA 4O0KA 4TVDA 2F6XA 1PX4A 3PZMA 2OODA 1M6JA 3OIXA 3AWNA 4HHLA 3GDLA 3ABZA 3DC8A 1LWJA 1X96A 2E6FA 4GYJA 3W1MA 4Y96A 3VK5A 2OMAA 3KRBA 3PZOA 2PDCA 3QMSA 3EXRA 7CGTA 3KBVA 4PA8A 4X61A 3Q94A 3AXXA 4RJEA 4F0LA 1F74A 3OW1A 4UXDA 4WZHA 1A50A 1W3TA 3BOFA 2PDUA 4HYVA 2WKLA 4IIGA 3W07A 2AKMA 1TRIA 2R94A 4KRZA 1K9DA 1P0DA 2AL2B 3FJNA 2P53A 2NV9A 1G67A 4NRSA 3W81A 2PDBA 4P61A 1E9IA 4FF5A 4HOWA 1RD5A 4WDXA 2G8ZA 1UZ4A 1ECQA 3WUEA 2QAFA 4WKFA 5D2VA 4UTWC 3WNNA 5FA5A 1IXQA 4D2JA 1E55A 3T9PA 1SYTA 1UC4A 2VX7A 4GC3A 3BCDA 4OQVA 1V0LA 4NZFA 1JNEA 3M5ZA 1BWKA 1FWCC 3LPFA 1XBXA 4KH2A 1Z32X 1TJ0A 3UG4A 4B9ZA 1ZPTA 5TQLA 3W1QA 1W9BM 3F1QA 4UMBA 3D47A 3KTXA 3CV6A 3MB9A 2WHKA 1E4IA 4RDYA 1CXKA 3BOXA 3LBMA 1XICA 1E70M 3UP8A 1S1PA 1DJYA 2QJHA 3UFYA 4DLFA 2EPKX 3BTNA 2RJHA 2VCCA 4JFSA 4OT7A 4GI4A 3V1HA 1DIDA 4F9DA 2A3EA 4QLKA 4MJZA 4M3PA 2D0HA 1VJSA 1X39A 4GBUA 2YBTA 2QDEA 1AW1A 2VGIA 3A4JA 1MUWA 1W1B1 3F5JA 4ZSTA 3P2VA 5A6BD 2P50A 2BVYA 1XRSA 3OQEA 2XH4A 2RGMA 3JUGA 2GSHA 4XTDA 1TJ1A 4DLMA 1XIDA 4AEEA 1KKRA 2A4AA 1T99A 4FI4A 4KGJA 4EPKA 3WLKX 2HSAA 2YFNA 3BG9A 4UFKA 2EG8A 2AOSA 1MZRA 4M5PA 3PG8A 3SAZA 1I1WA 5CJMA 2C0AA 1P43A 1HJSA 1MFUA 2H90A 1ZP4A 3NL5A 1UPMB 3EMQA 2KAUC 3LTSA 3QW4B 3SUVA 1V3KA 5D2YA 1BAGA 1K6WA 4A8LA 1WZLA 2G41A 2DVXA 1QNQA 3CQIA 4OWGA 2JF6A 4QNWA 1BXBA 2WCAA 2BGSA 1QNSA 3H4XA 5D2XA 2XFWA 1FX6A 3BSMA 3URNA 4O17A 3H26A 3NNTA 4AX6A 1QVBA 1HZYA 3MHUA 4HMNA 4JQ3A 1IWAA 4QSHA 3SY1A 5CCZA 1ISXA 1ZQ5A 2C3ZA 1NOUA 1RD6A 2BOEX 3DYOA 3UJ2A 3BAJA 1EBGA 1E1CB 2OZ0A 3GWQA 1JR1A 4G8TA 3N6JA 4F0RA 1E1FA 4BJHA 3VNIA 4GRSA 2OWXA 2PU0A 2F2KA 3ITOA 3WNOA 5A6JA 3BW4A 1NARA 1UD5A 4AZBA 2GZXA 3L2IA 5E6ZA 1XLMA 2E5BA 5IDIA 3VKDA 3CO4A 1VLWA 2J25A 1FCQA 3TIMA 3W1TA 1MRQA 3ITLA 5CKSA 1JAKA 4O1CA 2VURA 1XLHA 3PSWA 3KTSA 4ZSUA 2PGEA 1TQJA 2VXNA 5JUVA 2IQ0A 5I3HA 4D6HA 2HK0A 3EB3A 1R7AA 5H6HA 1GVIA 4TIMA 4Q7NA 1RALA 2YL9A 3GHUA 1B3WA 3IGHX 3M4HA 5TIMA 3R7MA 1QOXA 2ZTJA 3T8LA 2VFHA 5BNKA 5F2IA 4WR3A 3H6OA 1GQLA 2ACQA 4HHHA 4LGXA 1IIHA 4IQDA 2GGEA 2PDQA 1V3LA 1XYLA 2JGQA 1CYGA 4D71A 1RCXB 1QDSA 2VNCA 4XAYA 1N7KA 2V5KA 3NYZA 5CZJA 1EZ2A 1J2WA 1SQ7A 1ZBWA 3FV9A 3WLQA 3GR4A 1W56A 1VIWA 5JBEA 1LWIA 2BXZA 3TV8A 1OZQA 3GIPA 4TO8A 2DVUA 1VCGA 4UC5A 3A3HA 1BLIA 5BZAA 4N9CA 4KQNA 3E6EA 4HNTA 1XIFA 2HRWA 3QOMA 1WXJA 3E5BA 5I77A 3BMWA 2PF8A 2HVNA 2OLHA 3SRDA 1VPXA 1IEWA 1UZ1A 3BSGA 3MPGA 1NQKA 4LAUA 1J0ZA 2HVOA 2WSKA 4XKYA 4J3TA 5T9BG 4ZCWA 3O05A 1JZ6A 3VGBA 1KR1A 4D1JA 2YCKX 2X8RA 5LHEA 3YPIA 1OYCA 4ZQRA 1VS1A 1DQWA 5IHSA 4AHOA 4RXGA 5A6SA 3B8IA 3OGRA 3FFSA 3UWVA 1WKFA 3LENA 3T05A 2R9RA 3W23A 1FWFC 1H49A 4JKKA 1MEWA 1OG6A 4GUHA 3MCMA 3NQGA 3IVUA 3W75A 2GJLA 2XIOA 3PJXA 4QISA 3P0WA 1HW6A 3W83A 7PTDA 2WHMA 3U6WA 4IMCA 4I5XA 1R9XA 2QS8A 4Q6XA 4QS6A 4ZQNA 1ADOA 3F5LA 2ZC1A 1XLCA 4CU6A 6REQA 2TMDA 3TW9A 2QPUA 5AOUA 1BYBA 3GD6A 5BXPA 4PZVA 3NQMA 3EMZA 1CENA 4WKHA 2WZHA 1YNQA 2E9BA 1GPWA 2F61A 3A9BA 1RHCA 2NUXA 4JTSA 1HGWA 4LVDA 4IP7A 3A5FA 2WMIA 4KEMA 4DAFA 1XYAA 1PDZA 4S3CA 2OSWA 1PKNA 3QXBA 1LDCA 1GYNA 4IT1A 1YHTA 2HXUA 4PMRA 1YBQB 5HK4A 1E43A 1LG1A 2C6QA 3LGGA 4W8LA 3L21A 2CZVA 4PUWA 1BRLB 3VCRA 3UG8A 2OYLA 3VOJA 5FEWA 2FGZA 3WMCA 3GK0A 4JL1A 2C15A 1XBYA 3ITYA 5K7JA 4XKMA 5FESA 1T5AA 4HQVA 1Q6RA 4EIVA 3RMEA 3STFA 2ZQ0A 3R0UA 3OTRA 1FH7A 3DKJA 3QGAC 4S3KA 1T41A 2ANUA 4MF4A 1Q3NA 2G37A 3UWUA 1NH6A 1DJXA 2FHCA 1PDYA 1MW1A 2BASA 5DXXA 1LM1A 1ZP3A 2HDJA 4ZO6A 4I90A 4LBRA 4MNKA 2VX4A 1QPNA 3TNBA 3STGA 2Y7GA 4BI7A 5BOEA 2WCGA 5A2BA 4NKCA 3NQVA 3WKZA 1Z6KA 4H4IA 3C0JA 5I6SA 2TYSA 3S2JA 4V28A 4L56A 1GTHA 1W91A 3IIOA 1BGGA 4L7ZA 2QV5A 3WNLA 4D72A 3EX2A 4AZIA 3G77A 1OFEA 1UKSA 3HV8A 1PIGA 3B05A 2CLLA 2D1ZA 3GNPA 4M8UA 4R7WA 3BLEA 4A35A 1TG7A 5D9NA 4H6RA 2OTDA 3R89A 3Q58A 5H8PA 1PJ9A 3AMDA 4IICA 2X7WA 3LOTA 1YLVA 1AQFA 4MB1A 2X7VA 2OEJA 4O15A 1P6BA 1XDLA 5DX7A 1US0A 2VVSA 3M0LA 1NQ6A 3VAVA 1O94A 1G9HA 4FZIA 2RDTA 4UNKA 2PDKA 1BD0A 4JTDA 1TV3A 1AD1A 5LNSA 3EWXA 1TMQA 2DZUA 2G96A 3R8GA 3JW7A 5FKYA 2WKGA 2QIIA 1V08A 2OT0A 4HYRA 1IHIA 5LGXA 1TTQA 1FCUA 3FKRA 2FJKA 1I60A 3TYBA 3EX3A 2C14A 2QXWA 2WHLA 5E09A 3TJIA 3HQOA 4Z1YA 4MB3A 4GXPA 1SR9A 1P4CA 1UD3A 1QO2A 4LFYA 4LUSB 4L6OA 3BLFA 3GE7A 3M9YA 4E8CA 2F8QA 3GH5A 1GEQA 5D9PA 1DV7A 5BMWA 4C6IA 3WLOA 2IQDA 2GVGA 1NDWA 4WX2A 3HMJG 4F79A 2YJQA 1ODUA 2NVCA 4OTKA 3MP5A 4DF2A 4MWAD 2E9LA 5DQPA 4ZO8A 2O55A 2WW5A 2GGHA 3ANUA 2H8XA 5H8UA 1E0XA 3SIMA 4NJJA 3KHJA 3QKEA 3VDGA 2X40A 9XIAA 2HK1A 2J66A 2I5GA 1V3MA 4GNKB 3II1A 3CAVA 1SFTA 1ZJIA 1OT2A 1KM1A 1AG1O 5CLWA 2BOFX 3B8UA 3WZ0E 3U8GA 4UMAA 2DY3A 1XLGA 4JEJA 4FF7A 2Z27A 2AQWA 4WOQA 1UH3A 1Z89A 1OWQA 5C5YA 2CNCA 3K4AA 3GTIA 3OU8A 1VRDA 3GX9A 3H2EA 3IIXA 4GVHA 4Y90A 4US5A 2CLKA 1OFRA 4FNSA 2PP1A 1TPDA 3ARUA 1H2JA 2GQ3A 3RK8A 3W7EA 2PZ0A 4W9TA 2BY1A 5TBOA 5DELA 1RQEA 1XGEA 2H3BA 3CTTA 2GJRA 3FSTA 1UIPA 2BP1A 2CZFA 3EPMA 1OD0A 3T0CA 1K77A 1CIUA 2FPVA 2J7CA 3SECA 1TUFA 4FNRA 4C6MA 2PDYA 3GFYA 4UUIA 4F0MA 2E8ZA 5DT7A 4FOKA 3G1YA 3P60A 1T0OA 4NVTA 2DSKA 1I45A 4DUXA 4KCVA 4K36A 4MNLA 1IEVA 1EJXC 3JR2A 3EOOA 2HBXA 4XZLX 4E4UA 4AG0A 4H9MA 1LF1A 1EF3A 5EBUA 1OFAA 4QTGA 2EF9A 4ZOCA 4H2CA 4MPKA 1BEUA 1V03A 1TIWA 4QQ3A 4OBSA 1IGWA 1DYSA 3W4RA 2Y7DA 3VNKA 4RZBA 4DX3A 3E0VA 1H1NA 4QX4A 2VL4A 4RW3A 1YNYA 4ONVA 5C9RA 1MNSA 3GLCA 1OCQA 1UWRA 4LAKA 3KVLA 4JTAA 1HF6A 2YBUA 2CLOA 1EJTC 4I9TA 4DEFA 1SW7A 2FTWA 1LL6A 3MVTA 1TZ9A 1JZ8A 3KAOA 4HU0A 1E6PA 2CWXA 3ONBA 3T4WA 1XD1A 5AC6A 1GPFA 2DZTA 4DF1A 2H8ZA 2O92A 3SGGA 2G3JA 5LXXA 1XHGA 4LYKA 4AWSA 4O4WA 3GTNA 1CXIA 1OC6A 1DJZA 1GJPA 3MO7A 1P0KA 5BW6A 4GFSA 3F4NA 4JNYA 1TMLA 4DN1A 3SN4A 4NZJA 3LZ5A 5GVJA 3C86A 4DIAA 3DUGA 5KINA 2OSXA 2CHRA 2O9RA 4LUJA 2LLEA 4S3GA 3V36A 1JI2A 4XWUA 4B3KA 2ODOA 5BU9A 1QI5A 1GYMA 1ZL1A 4B5NA 4TTUA 4KRUA 4LANA 4PB4A 3C2OA 3E2SA 2P3ZA 4JTUA 1EEXA 4N2YA 2FQIA 3URBA 1I2PA 3QPYA 1XBVA 1Z69A 3QMTA 4ECLA 1RZMA 3SIZA 1EIXA 1MVYA 3A9IA 3UJFA 1V0NA 5A8NA 1OCBA 2PRHA 4BF5A 3BJSA 5EY5A 3ARWA 3QV7A 4AIBA 3GVGA 1HKMA 3VNMA 1TPVA 1Q4WA 3ALGA 3BANA 3NURA 1S3HA 1OYBA 4AVNA 2DSVA 1QATA 2WHJA 3NM3A 3VOCA 4GH3A 3OBEA 1V6XA 1FP8A 4JX6A 5IM51 3NFUA 1KFJA 1X6NA 1W1YA 3O6CA 3CHCA 1TPH1 4W7UA 4LAOA 3S1GA 4WK9A 4IMGA 2O4MA 1S46A 3IVTA 3VIIA 3C2FA 3WQ6A 2Y61A 3O07A 1HVQA 3B9NA 2WJZA 1ZUAX 1Q2SA 3PAOA 1ONWA 1L6WA 1W9UA 1LUCA 3S46A 3UGRA 4QGCA 4I7UA 3EPNA 4C6CA 3WELA 3PJWA 1S2TA 4HSOA 2YW4A 2JEPA 5CPLA 4D6IA 1SM9A 2EPNA 4HK7A 1I6NA 3MMTA 2FZDA 3ITXA 1Y65A 2PDPA 1EX5A 1FWIC 2E9MA 4B3ZA 3FDGA 4L4LA 4QROA 4K38A 1GQKA 4IPNB 3T81A 3K8KA 2QCDA 4Y9NA 3TMQA 3GKFA 3RXZA 3GXMA 2OU4A 3N34A 4P7OA 1E6QM 1PHQA 2W66A 3ZS4A 1M01A 5AYXA 2P0OA 3CMJA 3LYEA 4WY0A 3J7HA 1A0CA 3K1GA 4F40A 3KRUA 2W63A 4DJED 3A6OA 1NIUA 3GXNA 7TIMA 1B90A 4KCTA 3EXTA 1UWQA 1MQPA 3PZIA 4LRTA 4HNCA 2PODA 2WV8A 3FVMA 1BVWA 2ZXAA 1IT7A 2IPFA 1VEOA 2E7FA 5XIAA 3A47A 3CPGA 2CESA 3FYYA 1UUMA 3SFWA 4GHRA 1J0KA 3GH4A 3HB9A 3GRIA 3ORWA 3VU2A 4TVCA 2CKSA 3TFCA 1I2QA 2ZTKA 3PJUA 2AKZA 2DIJA 4NAFB 5FSDC 2C18A 3ZJ7A 4ZVJA 3NL6A 1IEQA 2DSWA 3INPA 3DHFA 4J1OA 2DZVA 3EA3A 4FHAA 4LXFA 2I9EA 1X7FA 1LBLA 2GVEA 5L9FA 1JD9A 4B9YA 2R6OA 3N4AA 2DQWA 1E0UA 1EDTA 4Y2WA 1QPRA 1JF6A 2WMJA 3LZ3A 1KQZA 2QJGA 1DWAM 8RUCA 2FZBA 3WQ8A 3QZ6A 2R24A 1HN1A 4GBDA 4YHGA 2W9MA 1UOZA 1AH3A 3VD3A 3B0VC 1EJRC 3T07A 4M82A 2CHNA 3GHRA 5CPQA 1VFMA 2FB2A 4JGDA 4BEUA 2J47A 1Q6FA 1UZDA 1VFSA 1ODZA 2VP8A 4D6DA 3PWGA 1LT8A 1SMDA 3WBYA 2ZUMA 4CCCA 4ZOEA 1H50A 3L2LA 3TJXA 3T40A 1UD6A 2YL6A 1T7LA 5ABFB 2XN1A 2I7GA 4GMEA 1HL8A 2HWGA 1TPB1 3DX5A 4U5IA 1OF6A 2R14A 1JGMA 1FFQA 2QPXA 2FVMA 3WJYA 4XZBA 4WCJA 3N19B 4GABA 1GVQA 1MUCA 2CETA 1L6YA 7ODCA 2OKTA 1Y5XA 3CASA 4N9EA 3G1FA 4TMBA 3D0CA 3CZLA 4FALA 3W7LA 4ROPA 4C6PA 1U2YA 4QDWA 3SN1A 5TAOA 4GA8A 3K8MA 1HJQA 1KM0A 3S1WA 4GE8A 3DFTA 3FNDA 3LXBA 4RNJA 3E0IA 1Q7QA 4DYKA 5D37A 3V0SA 3A4AA 1BSIA 3W70A 3FHAA 4LEFA 5KETA 1TMHA 5E93A 3BWWA 2Y85A 2OG9A 3VA8A 3FGCA 3KOYA 3LTYA 1PEZA 1ADSA 2BS9A 4DBDA 1FY6A 5LA0A 2NX3A 5CSSA 2IKGA 2XVNA 1FWGC 3ZYZA 1JIBA 1W5PA 3IIPA 1HTIA 3TZNA 2OJPA 2P3EA 3RITA 1W3LA 1FHLA 2VFGA 3C2EA 3BPWA 4QAWA 1DIOA 2PURA 3GVRA 5D33A 3SCWA 2E40A 1KKOA 1ZGDA 4NHVA 2OYMA 3VVGA 3FIGA 9RUBA 1KXVA 3KVJA 3S2MA 3RMJA 3DIPA 4JN8A 3MWCA 3G1VA 3MDWA 1VFUA 3KL3A 2Z25A 1J12A 3W85A 4P8VA 2VC9A 5HUPA 3WDPP 1D8CA 1IR1A 4L9ZA 1TZ7A 1FH9A 3TLQA 2ZUUA 3CQKA 3PBUA 2G95A 3PBMA 3EDEA 1UR8A 1U1HA 4XUGA 1UWSA 3E49A 3NO5A 3FA3A 1CDGA 1V77A 3W2JA 4GY1A 3QQWA 1U5JA 4HZ6A 3SEPA 4CU8A 4HOZA 4NX5A 4ROQA 3TMLA 5DO8A 3GC2A 4JTEA 5ABHA 3BGJA 1XC6A 3AAMA 4URIA 1V6TA 3S6OA 4NZ1A 4FS9A 4ZR8A 1QNVA 3VZZA 2PLMA 3RR1A 4PN2A 3ID7A 4EOUA 2C1GA 4OIFA 1KQYA 1UR2A 1ZB5A 2VDHA 3VDCA 2A6NA 3LN3A 4FOUA 3H22A 3PVFA 5CC5A 1ISYA 1VH7A 3WSUA 1NY1A 2CLIA 3TW6A 1W17A 3OLIA 3RJXA 2PCQA 4GK8A 4E0CA 1M9HA 1EJSC 1TELA 2VQUA 1QHPA 3LG3A 2HXTA 3EB2A 4M24A 2B31A 3W7CA 3N12A 3WNKA 2VZSA 1JGIA 2UY2A 3FX4A 4GIRA 2EBNA 1BYDA 1DQXA 1UQZA 3ECQA 3MJMA 2F84A 4HPGA 4NQ1A 4GQBA 4YMZA 4UTHA 2BVWA 1KFBA 2WMHA 4AF0A 4J2PA 4ZB0A 3T78A 5CSRA 2VENA 1FWSA 2PP0A 5AVHA 1WYIA 1GOXA 4R53A 1ZS2A 2YL8A 4RX0A 3W00A 4WDWA 1TCDA 1IGSA 3KOXA 4CKQA 3F2DA 1W9PA 4L1GA 1TTIA 4XD6A 1PUDA 1G1YA 3H2AA 2VTFA 1P7TB 4PMZA 2NX1A 2I5IA 4NJGA 1G5AA 2HE5A 1NEYA 4QAIA 3AS0A 1BWLA 2PDHA 3P14A 1SFLA 3KWXA 2OKOA 1CLKA 2YCIX 3SZ8A 3W7GA 1OABA 2L5HA 4GUFA 1XGDA 2FKPA 4P8UA 4GGBA 4UFLA 2IUZA 3LLXA 1VR6A 1KD0A 1MDLA 3AQUA 1ISVA 4CEXC 2FPYA 3H2OA 2GFTA 3B06A 3EX4A 4CQAA 1XUUA 3DFQA 3WMLA 2ZZ2A 3ARRA 4JD4A 2YDSA 1TQXA 2CZDA 4M1RA 2XVLA 4U31A 3TOPA 4YVPA 1WX0A 4MNMA 4YTUA 3JVAA 2ALDA 5PTDA 4RXFA 2VVNA 3UETA 1T40A 4DJFD 2VRQA 2VQTA 3EAUA 1X6LA 3AIVA 5D04C 2C1IA 3ITVA 4PL1A 3XISA 4HPXA 4E4FA 3W7HA 3AMKA 4HMDA 2JGYA 4M56A 3E38A 1GOIA 2V2DA 2V6AA 1UB3A 3PN8A 5BRPA 4DZHA 3GHSA 4Y6GA 3VYLA 1UR4A 3TK7A 5IFTA 3VIGA 5CG7A 4JQ1A 4BQ4A 3GAKA 2ZWYA 1S2UA 3EMCA 3QH2A 2XIBA 1W1ZA 5FEZA 1JQXA 1XF0A 1OFDA 2POZA 4IGHA 1B9ZA 4QDPA 3WQWA 3PNZA 3GU1A 2ZX6A 1RP8A 1BTMA 2V3FA 3KLKA 2EGZA 4Z0JA 5HA7A 4WY0F 4GKTA 1WKYA 1EX1A 3NEHA 4Q4OA 3WUGA 2PLJA 2PDGA 4KWVA 3U9IA 1CI1A 1XD0A 2TPSA 5CPSA 4GVGA 2V63A 1QW7A 3M0VA 2DQXA 4LEQA 2PI6A 3EEGA 3LB0A 2WXDM 4GACA 1KM6A 2NV1A 1XRTA 4ZEPA 1RBAA 2X0HA 2H3DA 3TJLA 4DNMA 2OEKA 4FOJA 2O9OA 4TXEA 1GTEA 3QBUA 3V1PA 3K13A 1PZ3A 2ZRUA 5I3GA 3BQ5A 3CLMA 4BKNA 3W7KA 5M5DA 5HQMA 5AC5A 3PZGA 3QZEA 2P8BA 3GG1A 4B90A 4X0VA 3PBWA 1HO4A 3UG3A 3WFAA 1RCOB 3WQFA 5FACA 1HT6A 1AD4A 3UBPC 1XLDA 3RRAA 1ITXA 2VM8A 3NGJA 4QCFA 3FYOA 3NQEA 4GY7A 2VOTA 3B8WA 1OADA 4C5YA 2FTPA 5FJRA 3BJTA 3I10A 2Y70A 3KVKA 4KCUA 2DSUA 4WXYA 3ABSA 4LUTA 4KFOA 1OZMA 4BQ2A 4LT9A 2ZICA 5AYBA 3LTPA 1TE6A 3W3OA 2D73A 1V51A 2NQZA 1CGXA 4F2UA 3DOPA 1VPQA 3H4GA 3V0UA 3LQLA 5J04A 3O0FA 4C6LA 1S5TA 1UKPA 1SPQA 3MUXA 2VEIA 3PB2A 3FHQA 1FWHC 3PAJA 4PMVA 3BE7A 2ZWZA 1VFLA 4AIOA 1ESWA 1N82A 3STPA 4LOCA 1AUSL 3SUUA 3GZAA 3HO8A 3IARA 4A2RA 1A5LC 5FF4A 4KGLA 3R10A 3OA5A 4Z08A 1HJUA 1REQA 4K68A 2VEFA 1MRAA 3EB4A 1ZBCA 1F4HA 4J3SA 2YL5A 2ZFAA 3WUBA 2OOFA 2FDSA 4TR9A 3HPFA 5ENLA 4I9JA 1Q8JA 2OO6A 4AEFA 4P5UA 2V5JA 5I3IA 5DCDA 4WJEA 3H54A 4DZ5A 5HMFA 2Z7KA 1Q63A 4JIEA 1BF6A 2BTMA 2C0HA 3HZ3A 4DM2A 3E1F1 3MV01 3TONA 5KMYA 4GUJA 2WPGA 4DUWA 3KBWA 3CQJA 1YDYA 4C6BA 4KWWA 3WQDA 1XKJA 2WJDA 5EMYA 1YX1A 4ZOBA 1E3XA 1W3JA 3Q37A 3DBNA 3C0SA 3CWOX 3OP2A 2QNEA 4Z1DA 4JCMA 3SBFA 2QGHA 2V8ZA 4W85A 2BOGX 1FHUA 4UTTA 3W7RA 1OB0A 1J8VA 1AMKA 4Y9MA 2JEQA 4GYPC 1XKYA 3VXGA 4LQ1A 2YFOA 1FWWA 2Z1KA 3TJ4A 3HF3A 1XX1A 4TVUA 4C91A 4D6CA 4GX9A 4IHCA 5E0CA 3W6LA 3AS3A 5G1TA 3MSYA 4W87A 2WSRA 4ZXOA 4V1XA 2HVMA 5C9WA 9CGTA 3RO8A 3MS8A 3BMXA 1SO5A 3T0DA 4H83A 4H6EA 1G7VA 4J3WA 1R6WA 4ZO7A 1HKJA 3QKZA 1R3RA 2VGBA 3ABXA 5F2MA 1W5MA 1RSCA 1XV8A 1VCFA 1X38A 1SJCA 4XAFA 1UHVA 4XKYB 2VYOA 4HZ8A 1EYEA 2VWTA 4KEVA 1JPIA 3DFYA 4PCFA 1GCYA 1SFJA 4E5TA 3MSGA 3EDJA 4MGGA 5DFAA 1ZALA 2D23A 3N4FA 3WX7A 2X30A 3TCEA 5AYIA 1MYRA 4FLSA 1L6SA 2E3ZA 3I6RA 2J24A 1QNOA 2J77A 1ZBKA 3Q2DA 3R2GA 6REQB 1DVJA 2IKIA 4JEQA 4O10A 3PNUA 3APGA 3AHXA 2DGAA 1ICSA 4LNCA 2GGJA 3P74A 1UWUA 3ZJ8A 1QWGA 1XCXA 1K8CA 1FKXA 2QW5A 3UW6A 3VC5A 1B3YA 4JIHA 3A3XA 2NUWA 4FR6A 3W38A 5HWNA 1F6KA 2WMIB 4FXSA 4UTJA 1IWPA 3WIJA 5HWMA 1JF5A 3C6CA 1R2TA 5CGQA 3R8HA 4AC7C 1GOKA 3QY8A 3M0XA 2J7EA 2UV8G 2HCVA 1EFZA 4WF7A 5DXYA 1B4KA 2XIMA 2BVDA 4Y9AA 2VR5A 2QYGA 3LHZA 4IZGA 4K37A 5AHMA 1R46A 2Y88A 2FMOA 3UR8A 1DTNA 3DHPA 3EKZA 3B4UA 1WDQA 4H7VA 2Q71A 4RK8A 4JN7A 4M6QA 2PDJA 4KWOA 4WDUA 2YXOA 4F66A 1IE7C 1TWDA 4CD5A 1O12A 1WBJA 4C6JA 1S38A 4JXCA 4Q8UA 4LS0A 1HIZA 3OIHA 3M0KA 3QN3A 4DWSA 1NF7A 1DJNA 3IUDA 5ECVA 3CUGA 4J35A 2H9AA 1VIZA 5KEZA 4LRSA 5BWAA 4EP8C 2V67A 2JIWA 4XQ6A 3P84A 2NXGA 1LP6A 1SUXA 4J3UA 1K4HA 2XGBA 4QG9A 3ZIZA 1G94A 2Z6IA 3ZXWA 1ZJBA 2VDGA 1JYVA 2XZ7A 3V4BA 2A3HA 1KNWA 2A7PA 2CCRA 2HS8A 1UASA 4ORIA 4US6A 4GI9A 2Y4SA 3ITCA 4UOQA 4FMVA 3LM3A 1F8MA 2VZUA 3WBWA 2FZMA 4DYEA 3QYQA 1KRBC 3QSRA 1PHWA 3G0SA 4JKMA 4ZODA 1MNZA 3N9SA 1LRTA 2GGIA 4GPNA 4YYCA 2PGWA 1VBJA 3WK1A 4A22A 5KZEA 3KCLA 4C90A 1OC7A 4MSSA 3GFZA 3EOUA 4HB7A 2E1DA 3N13A 1ZY9A 3I3BA 3DXIA 3PPFA 3AZTA 3L67A 4BF7A 4P2VA 3GDKA 2PA6A 3IVSA 2AGTA 1KTBA 3GNOA 3OGSA 1JL8A 4IQJA 3WDRA 1E4MM 1CGVA 1WE5A 4GVFA 3G3DA 5FF7A 3MUAA 3UA4A 2RH9A 4NXSA 4M29A 4KIEA 3N3TA 2ZVRA 1B3XA 1Q8AA 5LKYA 3D3AA 4HSHA 3M64A 3P93A 1R2SA 4IPLA 4ORMA 1G01A 4GNJA 1UKQA 3VGDA 1BKHA 2FVKA 3DENA 1BFNA 3ALFA 3MUZ1 4PGLA 1NELA 3NQ8A 5G4WA 2AAMA 1XLBA 1UD4A 2YX0A 2PLKA 3VNJA 3TN3A 4YS1A 5FD0A 3UCQA 5AHIA 3MCNA 3MWAA 3QOKA 4A3YA 1NVMA 1QHZA 2J8GA 1KBBA 3U2ZA 1OIMA 4UTLA 3BAWA 2Y5EA 4U2ZA 3GZ3A 3PZ9A 3GHTA 1TPUA 1U5HA 3PZVA 1GONA 2C16A 3M6YA 4A05A 3A12A 3N15A 3MUCA 3GY1A 4W4QA 4X60A 1C9DA 5LA2A 3ZT6A 3NO1A 2QCFA 4HU4A 5AKQA 3LNPA 2GDVA 1WO2A 3CBWA 3G1RA 3WD3A 4ICNA 3C5QA 1J0YA 5HNNA 3BLKA 4QJ3B 3GC5A 4JHMA 3W1XA 3F5KA 3KZPA 2OB3A 5GPRA 1N8IA 5C70A 4GFIA 1YE4A 4IISA 5FOOA 1B3ZA 3EOLA 4G9PA 3QJAA 4GZEA 4U3CA 1JCLA 1QI4A 4PMDA 2PD9A 3KCOA 4DB7A 2QAPA 3AHVA 3CH9A 1XG3A 4GCXA 4JTIA 2QPSA 2AAAA 3WMBA 2XN2A 2WZEA 4LS2A 1QI0A 1OINA 2Q01A 1KB3A 3L65A 3GC4A 3NQDA 3CZ8A 4EPBC 3BW2A 2O7SA 2J13A 1DQUA 5D4YA 2YCEA 5GQBA 2EG7A 1N55A 2PBOA 4JDYA 5K4ZA 4AQLA 2GQ9A 3ICJA 2OZ3A 2XHYA 5G2IA 3RIKA 3R79A 4LF1A 3FYPA 2YR1A 3CEPA 3PUEA 2Z29A 4MHBA 1KM5A 2I5QA 1GVOA 1CNVA 4UNIA 1T8QA 1Q6QA 2JKEA 1YXYA 4S3DA 3CMFA 1FWBC 2UY4A 5I03A 2REQA 5HR7A 2V2CA 3GVWA 1TV4A 4C1KA 1YRRA 1X1OA 4MOZA 1OJXA 3F4WA 1XIGA 1WZMA 3FCPA 3N4EA 2NQLA 4RE4A 4AY7A 3SGUA 4ZMGA 1SZEA 1K8XA 1I0BA 5GJNA 3VOIA 4QP0A 2BG5A 3RPMA 1VCVA 3WQEA 4MLRA 1NDYA 1ZAIA 7XIMA 2VD8A 1QNPA 5J5RA 1S5MA 4AU0A 1UP0A 2DT2A 4TV6A 4P8XA 3V5OA 1WAUA 1E40A 4CNSA 3DEQA 3PFRA 5JQ9A 3HJEA 5HQEA 3VMOA 2ABAA 4UQCA 3P5YA 3IIVA 4TX8A 5CXPA 2F7FA 3M5YA 2KZHA 1E5JA 1DORA 3LSBA 3ZO9A 3BK0A 1RA0A 5MHBA 4AW7A 1KWKA 1IQ8A 2XGIA 5EFDA 3LHYA 4ERAA 1EJVC 1X8CA 4LW7A 1OY0A 4HK6A 3PUDA 1N8FA 3MP4A 3B0UX 1QK2A 3H55A 4FO4A 1MDRA 1TPFA 5DT5A 3BGGA 3WQVA 1CWYA 1H61A 4DPPA 3GXFA 2VFEA 1JRCA 2G97A 4NI8A 1NWSA 5AYYA 5K9DA 1AODA 3FAXA 3URQA 1FHVA 3ZSSA 1ME9A 1I8JA 3C2YA 3W7QA 3N3MA 1U5VA 4H19A 1YTEA 1W6TA 4RZ6A 4M0XA 4DI8A 2V5DA 1OM0A 2ZA2A 5G1YA 3UJSA 1PZ2A 4J4KA 4XBKA 2ZXDA 2E25A 3N04A 4HZMA 3R6IA 2XM2A 3DG3A 3VNLA 3AI0A 3TYCA 4ATDA 4GZIA 3KL5A 4I7WA 3B9OA 5K9XA 1E6ZA 3HGRA 1A0EA 1GORA 3ARZA 1GWJA 3PJTA 3EWZA 3N18A 3CB3A 1XISA 7REQB 5HNTA 1HFBA 1NSJA 5JH1A 2GK1A 1JZ3A 4NSBA 3HJZA 3Q4DA 2D2JA 3KOFA 3IGUA 4HMCA 1KC7A 2YB4A 4WJ8A 1ALDA 3NL3A 1M3UA 1PWMA 1CZ1A 1XDMA 1RAKA 3PC0A 5I24A 4O53A 1KGUA 3PS7A 3B0PA 1DWIM 3TN5A 2PF0A 2QDDA 4GIYA 3WF2A 3HGSA 3CIWA 5KTLA 3P81A 4DJDA 2WK2A 5ECUA 3RG6A 3M0MA 4DAIA 2QCMA 2ZXQA 1OF8A 4MKSA 5DLCA 5AHLA 4G5DA 4GJIA 3QFWA 4YN5A 5G2WA 1R47A 1L2QA 1KCKA 4OZOA 4MWAB 1JVNA 4ZQMA 4XD3A 3VC6A 4GKLA 3GU9A 3IJ8A 4FLQA 1XLIA 1H5YA 2B7NA 5XINA 3XINA 1R8LA 2J7DA 1GJWA 4GYKA 5B80A 1LLWA 4XZMX 2IPWA 1JCJA 3SCTA 2WZMA 2PTZA 4UR7A 4H2HA 4EPDC 2XVGA 4O1FA 3VDHA 4H8VA 2QCNA 4UNLA 3GB6A 1WBHA 4EK7A 3VD9A 1EOKA 2CITA 4XZ9A 4W5UA 3BLOA 3APYA 1EP3A 3PBYA 1DE6A 2IQTA 2VFIA 3DI0A 1YW1A 5G5IA 4MLJA 1ONXA 4K7YA 4F3HA 3NZQA 3TTSA 4PL2A 3V16A 3A21A 1YNPA 4BR1A 1EUNA 4Q33A 5C2CA 2Y24A 4QM1A 4U5KA 1AW2A 4Q7IA 2V81A 3ZR5A 3W1NA 1TPWA 2XIIA 3FJLA 3PBGA 1NFGA 1YPFA 2ISSA 5A8QA 2VFFA 3MUIA 4IFKA 3V5FA 4M6PA 1W1A1 4W5ZA 1V0KA 1S5NA 1FH8A 4O4VA 1SSDA 2BY0A 3IJ6A 3JRKA 3EDDA 3CV1A 3IGSA 3BLIA 3S83A 1BPLB 3S4TA 4IUGA 1V3HA 2QJJA 1JPMA 3OHIA 3UWZA 2NUYA 4QJ5B 4PCNA 3S8HA 1K6AA 5I5RA 2BNJA 4JY9A 1RJRA 4FIQA 1XIHA 1RPKA 3L4UA 1GKPA 1UJQA 4QQUA 1VD6A 1S3TC 3B3DA 4YLWA 1DE5A 2Y8UA 1XDJA 3HQPA 1ZJHA 1CLVA 2ICSA 4NYYA 4UTWA 3HQ1A 5EB8A 1LOQA 3POCA 1PSCA 2Z6JA 5LIWX 1A5OC 3RU6A 3F4VA 2V5LA 3NXLA 3C56A 5F2LA 2R1LA 2PDWA 1J93A 2A2IA 4L9YA 3ATYA 5AC8A 1WB0A 3TUUA 3MHFA 3VABA 4RZ5A 3AALA 1S5WA 3UEQA 4MWAC 4Q8OA 2WVVA 1O1HA 3UXKA 2DT0A 5GNXA 3UA3A 3FJ6A 1WZAA 4EAMA 2VUNA 4H3DA 3TP4A 2WMKA 3MV11 4IG2B 3AIUA 3TYUA 1F76A 4PTWA 1W37A 3DDMA 1R30A 1EF2A 4D8LA 2J8FA 3TH6A 3FS2A 1IWBA 4DBEA 3T0AA 3NTYA 2QJMA 1GW9A 1HL2A 2W27A 4YCPA 2WKJA 3SUWA 1QTWA 4R34A 2JQXA 1JUKA 3PZQA 3LCGA 5LYRA 3TFXA 4F48A 1YEYA 3ZLGA 3FEQA 1DJGA 3VTRA 1LOLA 1LQ0A 3WCZA 3V35A 1XWYA 1P48A 5BXRA 3O9NA 3RCNA 3IJQA 1CGTA 1PE1A 3EA2A 5LXEA 1E4NA 1WQ5A 3RX3A 2VRJA 5G1MA 2YDRA 3IJDA 4H9TA 5BRBA 2PC8A 2PBGA 3W2UA 5U7SA 4S2CA 3CH0A 3ZSTA 1GZJA 1G6CA 1XLEA 1PS9A 4ACZA 1TUXA 2CZEA 4IPPA 4DBWA 5D09A 1XIIA 4WOZA 4O0QA 1WDDA 2HS6A 3ARQA 1WKDA 1TVLA 3THCA 3DGBA 3PULA 4JHOA 2WC3A 2VCAA 3AO0A 1KXTA 2AL2A 4QHRA 3FY1A 1S39A 4GI6A 1RH9A 4E2BA 3NGFA 4OGZA 4N6FA 1OFPA 1NOFA 3WLPA 5AVNA 4EACA 3WLSA 1MZHA 1EWDA 1RLDA 1GK8A 2W92A 1LCOA 3HG5A 3W71A 4XTIA 1JPHA 3CHDA 3OBAA 3WO8A 4ML4A 4UQ9A 4Z2JA 4W93A 5C7HA 4RZ4A 2YCLB 3CMGA 1U83A 1EDQA 4QCEA 3O3RA 3VGGA 4W84A 4DO7A 4AYSA 3HBLA 4HKPA 5LIUX 1MUMA 3E0LA 3P82A 3DH7A 4A3RA 5G2HA 4Y8EA 3O6YX 4J27A 1XYFA 2E5DA 3G1XA 1UW9A 4MKVA 4QXIA 4GGHA 4NU7A 4GY0A 4NRRA 3H8AA 3R94A 1OX4B 1B3VA 5J5DA 3P67A 3BURA 2PZNA 3TYDA 2ZZ1A 4ZFCA 3IRDA 2DZSA 1GQNA 3GU2A 4DXVA 3GG8A 3W6MA 2A0NA 1J01A 2WJEA 1T6MA 3WK0A 3P8IA 5C55A 3KBMA 5G4EA 3VIHA 3GTHA 4XIAA 1Z42A 4JQ4A 2ZX7A 1XC4A 1AH0A 4I8DA 1PYMA 4M19A 1MEHA 3E9AA 1VF8A 3PR2A 5TF0A 4NT0A 1AMYA 1AW5A 3MZNA 1EO5A 3O6AA 5I79A 2OWCA 2PDLA 4LCQA 3ENLA 5D9OA 1H7WA 1UWTA 2FB3A 1JCYA 3NPWA 1GQIA 1F4AA 1VJIA 1ICQA 4RNHA 4XZWA 4EWJA 1GOOA 3W7NA 2DH3A 3PB0A 5KITA 2BX7A 3MBFA 1TX0A 4H8UA 1YXCA 2E8YA 3OLEA 1UWAA 2GWNA 3QC0A 1K7XA 3RR4A 1WXYA 1H7RA 2P88A 4EX4A 4B2DA 5EKYA 4X22A 2DW7A 4GUGA 1TWSA 1YYAA 2BHZA 5D05A 5CGMA 1G4PA 6XIAA 2NWRA 2CPUA 2HNEA 3V5CA 2BMBA 2J78A 4GJJA 4JR5A 2A3LA 3G6LA 3E12A 3P80A 3SFKA 4A3QA 4OV4A 3CS2A 4ZE5A 1RK5A 1DHKA 1E1CA 1OFBA 3WEMA 3BDKA 5RUBA 2O56A 5C7VA 1GJUA 6ALDA 2BZNA 4REQB 8A3HA 3FDKA 2VO5A 2FTYA 3USZA 2GVYA 4C7FA 3TTQA 4PSPA 7A3HA 1H09A 4W86A 1BWVA 3UXAA 1JJKA 4DJEC 5FEPA 3QFEA 3R43A 3BSHA 1VBHA 4HCLA 2ZYFA 4AWTA 1RBOB 2X0YA 4Q4QA 3UNDA 3AXKA 4MKNA 3NDOA 4HA3A 2C79A 1TSIA 5A6KA 1K3UA 4K1GA 1C9WA 2BFGA 3MHGA 2ZDSA 3U0HA 1KLYA 5HJYA 4PMNA 3THAA 3IPWA 3EXSA 2PLCA 3RU8X 1GZGA 3EWUA 3GDRA 1QFEA 1TYGA 3L0NA 4IFRA 2F6KA 3UNTA 1PYFA 4LUTB 4XAGA 2R1KA 4C1NB 2D69A 2CFFA 2Q8LA 4IL0A 3MJYA 2E09A 1I2NA 4UOJA 3AIBA 4LVBA 3B03A 2PRLA 4J2MA 4PBGA 3PTDA 3OPSA 5IBXA 2A7RA 6A3HA 4CVUA 1L8PA 3DG7A 4JKLA 1D2KA 4IMFA 5IXEA 1AJ0A 5EU9A 2Q3RA 5K2ZA 3PWAA 4U3AA 1DJQA 1D9EA 3RILA 1Q7MA 1AL7A 1NDZA 3K30A 3IACA 2BY2A 3LCXA 3ES7A 5JMUA 2IXUA 3QLDA 3MA8A 4UOZA 4DF0A 2D0FA 2XSAA 1REQB 3WL0A 3MKCA 3UPMA 3BGAA 5LA1A 4GX8A 2OLSA 2E1WA 3RLUA 3CUZA 3WD1A 2O0TA 3M0JA 2PTXA 3C3NA 1PBGA 4AFYA 1WA3A 4O11A 3MW7A 4HTYA 2E28A 2JE8A 3S42A 1Z41A 2CBUA 1W54A 2ABBA 2EEXA 2HTMA 3OQ8A 1WAWA 4J3VA 2E67A 2PTYA 6CGTA 1BXNA 2BHUA 1J0JA 4C6DA 1YIXA 1B0IA 2EKCA 2ZDRA 4KFPA 3W1LA 3VIKA 3LCFA 4O8RA 1EDGA 1OX5A 3WBXA 3CAKA 4CLMA 2RDXA 4K8GA 1MO0A 4V1YA 2BVTA 3NCOA 3NA8A 4MFEA 3A4XA 1JRBA 2W61A 3BZGA 1JUEA 1RY0A 4B16A 1W5QA 4KF1A 2MANA 1PTGA 3B8SA 4ZFMA 1XQLA 1NDVA 1E56A 3MI3A 5I02A 1UYQA 5HOSA 3R8RA 5LIXX 3KTCA 1KTCA 2A6LA 4ZENA 1KCZA 1KCLA 1VFFA 1LJYA 5MKGB 3CT7A 1PTAA 2RHGA 4JQ2A 1VEPA 1A49A 5D03A 3GVQA 2DJXA 3AISA 1KM2A 4HPNA 2D20A 1YBQA 3ANVA 1JDCA 1F61A 3SY8A 3LXCA 5D38A 1YQ2A 4BFAA 5I00A 4DXKA 1LL4A 3A3WA 2NLYA 2Z1BA 1E73M 2J7HA 1V3JA 3GVVA 8TIMA 3P61A 2QEZA 5CAHA 4GG9A 1TIMA 4NJHA 4DZIA 4S3AA 4LB4A 4QR6A 4GOAA 3FAWA 4S3EA 3S5NA 3H2MA 3TWAA 1SO6A 5I06A 1MI3A 1OFOA 1V0MA 4CCEA 3V75A 3NVDA 3ZVHA 5IDZA 2HV5A 1XW8A 4H9YA 5FL0A 1EKOA 2YYTA 3HV9A 1BG9A 5EMLA 4MG4A 3PZTA 4TUFA 4KEUA 4MDOA 2VDIA 4UQDA 4AMAA 4QG6A 4LS1A 5FF2A 3EPOA 2P1FA 2C1HA 2EO7A 3R5EA 4CQCA 1OT1A 3ZWSA 1DL3A 3AZRA 4LYRA 4H00A 4PTXA 2PWFA 1UKOA 1E9LA 3H2NA 3T09A 4DELA 1SZGA 2ISWA 2BBFA 4PEKA 2P76A 1TB3A 3M46A 4YTQA 5AZ0A 5HJXA 1W3NA 4L9XA 5CSYA 3GDBA 2GOKA 3IRSA 4N4QA 1E0TA 3FXGA 5A2CA 1RUSA 3ARXA 4IIHA 3S2NA 1PKMA 1F6PA 5LZLA 2EG6A 1EIBA 1H51A 2YOCA 1I1XA 3D5HA 1FA2A 2FZ8A 5FJIA 5I3KA 2QUMA 1EJUC 4UTTC 3WF0A 4AY8A 1C3FA 2GVJA 4CEUC 1W1IE 4YJ5A 5C6MA 4N0RA 4C6FA 1EJWC 4DWSB 1XM3A 4LALA 3HMCA 3UXDA 3NPXA 1X1NA 4ASTA 4E4PA 1J0HA 4PC8A 4H9ZA 3VX1A 3W28A 4QLJA 4UZSA 3M43A 4P7LA 1C7SA 4ZGYA 5FI8A 3AHYA 5GJPA 3MBDA 1DJHA 3IEBA 3OYZA 1VHNA 1ZJAA 2INFA 4NXKA 3UR7A 3B97A 3DG6A 2EXOA 5E9XA 2GDQA 4LUSA 3STEA 1Z44A 4N42A 4RNFA