3THAA

Tryptophan synthase subunit alpha from campylobacter jejuni.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
248
structure length
248
Chain Sequence
AMVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIADAAKIALDQGVDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVPELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVEEAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKCFKQGNLDIIMKDIEEIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tryptophan synthase subunit alpha from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
total genus 78
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2011-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3thaA00
4H3DA 1SW7A 1XDLA 1L6YA 5D2XA 1I2RA 1QOPA 5F2MA 4DO4A 4FXSA 3LTYA 4X3ZA 1ZAJA 3ABQA 3HQ1A 4WXYA 3WJWA 3I7RA 5F4WA 2PRHA 3V1PA 4UFIA 1FWRA 2A5HA 4FNRA 4IMCA 3O6CA 3U6WA 2Y61A 2QR6A 4NNCA 5KZMA 2J9ZA 2ZYFA 4LVAA 3W1XA 3EB2A 4HT3A 3LTPA 3W7GA 4W9TA 1W5PA 1SO3A 3PS7A 4JYFA 1O94A 1TREA 1Q6LA 2F84A 3FEMA 3HO8A 3M16A 2ZA3A 5AB3A 1TRIA 1BKSA 4BI7A 4K37A 3E0IA 2H8ZA 1TV5A 4WOZA 3QSTA 5KITA 2DZSA 3LHWA 2F7FA 3DAQA 1EEPA 5F2GA 4LRSA 4NZFA 3KRUA 2ZZ5A 3MP3A 2FTPA 1TB3A 4HKPA 1G7UA 2QF7A 2WOQA 1P0NA 3HG3A 4O1AA 2QCCA 3S1UA 5AHNA 3T78A 1M7PA 4FNPA 3LRKA 2PRLA 4AWTA 3GDLA 2X2GA 2B7PA 5I3HA 3LOTA 4R33A 1EX5A 1VQTA 2EF9A 1S5WA 1BWKA 4IXHA 1OX5A 2RH9A 2CW6A 3W1TA 2FFCA 4NNAA 3W75A 3P74A 4RCXA 3UD6A 5ABTA 3LCFA 3QSRA 1TTJA 1OK6A 3NQFA 3OBKA 1KFBA 4EF9A 4Q33A 4TR9A 1SW0A 4JYEA 1JJKA 2V2HA 1ML1A 3QH2A 4Q4KA 4UC5A 1I4NA 4TU1A 3M5XA 3W2MA 3W1NA 2CLLA 3Q94A 2VELA 4LVGA 4QNEA 3MW7A 3S9YA 2A7PA 1WX0A 2JBMA 1ZALA 1H7XA 1W3NA 2V8ZA 1T96A 4TMCA 1B9BA 2YPIA 2QUUA 4YCOA 3G22A 4JTKA 3TXVA 1P0KA 3JRKA 2DZPA 3W87A 3W07A 3TAOA 3JR2A 3LLDA 3STFA 4RKAA 3W7QA 4ICNA 1L9WA 4GWEA 1TPEA 4K38A 1H62A 3UWWA 1O4UA 2V0TA 3L66A 4UTUA 4MY8A 2DZWA 3TU9A 3VE7A 4WQ6A 1KM5A 3ABSA 5EA9A 4CQAA 1CI1A 4BR1A 3UQNA 4CNNA 1AW5A 1KTBA 3PUOA 3PBVA 4NUWA 3NNTA 1QR7A 5D33A 1VCGA 3INPA 2ZRVA 3E9AA 3W1PA 5HR7A 3TFCA 1WBJA 3VFLA 2Z0IA 4PFMA 5F1UA 1KA9F 2W0UA 1ZCOA 2Q3RA 4RJEA 3IGUA 3N3MA 4OT7A 1Q6QA 2FPTA 3B8DA 3T55A 3S5OA 4TMBA 1SO4A 2DORA 3ATZA 3M43A 1KM4A 1FWWA 1EP3A 2ZFAA 1K3UA 4ADSA 4Z08A 4L4MA 3TQ0A 2E1DA 3T4CA 3LI0A 5K4ZA 1ONRA 5CZJA 3TW6A 1N8FA 2YZRA 1HO4A 4UTIA 3IIOA 1H7NA 1I2NA 3W7RA 3GAKA 1EWEA 1GG1A 4JTFA 4NXSA 3W7IA 3THAA 1IXQA 1QMLA 4CNOA 3R2GA 5AN7A 4O12A 4JGDA 2XN2A 2TYSA 4ZQOA 5BNKA 4XKYA 3DFSA 3M1ZA 3LXAA 3PBUA 1SSDA 4AF0B 3CPRA 5CPLA 4Z1BA 3UWUA 7TIMA 4QIUA 4NJIA 1JUKA 1LRTA 1TPB1 4Z1CA 3STGA 4LNYA 4LRTA 1R47A 3IIXA 4JIPA 3NPWA 3DFQA 4DO5A 4NT0A 3B0PA 1F05A 4JTTA 3O05A 4M7TA 6TIMA 5LSMA 3T44A 3HPZA 3L5AA 4KFNA 5LKYA 2YW3A 2Z1BA 3BV4A 4E0CA 4O0ZA 5IBXA 1TTIA 1JCMP 2HMCA 1IXNA 4OE7A 4JTGA 3S1XA 3S1WA 3FOKA 2A0NA 3W23A 4HHPA 5C55A 4YL2A 1F6PA 4MYXA 1YPFA 3UPBA 3NQGA 5IM51 5DBUA 3C52A 1M5WA 3C6CA 4KFPA 4RZ5A 3IIPA 1A50A 2NX1A 4XZ9A 5DCBA 5I3IA 3NQEA 1GVSA 4O10A 5IBXC 1K03A 2Y7FA 1KM2A 2G97A 4I7UA 1I45A 5C6MA 1N55A 1GEQA 1TPH1 3GNDA 1H50A 2ZRZA 4O1BA 3S1VA 3M47A 3P7YA 3LCGA 1I8JA 3UXDA 4POCA 4JXCA 4XQ6A 3W7KA 1AW1A 1PE1A 2OX1A 3OVRA 4FF7A 3UZ5A 3F4NA 3S6DA 2CU0A 1VHNA 3NGJA 2ZCGA 5CPOA 3G3DA 3W1RA 4EOUA 5EL1A 3UWVA 3VE9A 4C1KA 3NQ7A 4WY0B 4MPQA 4GE8A 3BW3A 5AYYA 3DI0A 5BW6A 2XN1A 4QISA 1QNVA 1K8YA 1HFBA 3BG9A 1S3HA 1I2QA 1SUXA 3DKJA 5BOOA 1TPC1 3NPVA 3CQ0A 3CWNA 4K8EA 4YMZA 2OT1A 1VJIA 1KTNA 4JDYA 3P60A 5GVJA 3W2JA 2WNQA 4CCEA 4ZQNA 3FYPA 1GTHA 4M6QA 3CM4A 1FDZA 1PHQA 4IPIA 1VYSX 3CWOX 3FIGA 3W1MA 4LUJA 1M7OA 4P61A 5MHBA 5DY3A 4UNKA 2V5BA 1O60A 1R2TA 1NSJA 3HF3A 1LBLA 1GVFA 3RNDA 5DN1A 5KINA 5HMSA 1SZNA 1YDOA 4JX5A 3H53A 3B0UX 4GJ1A 3TAKA 3A5FA 2ZRUA 3LDVA 5H91A 1KW1A 4IMEA 1W3TA 3QF0A 4IMGA 1ADOA 1AL8A 4M6VA 1NF0A 1O5KA 1ZAHA 4DF1A 3P5YA 1YDVA 4NZJA 4ALDA 3PB2A 3IGSA 1XC4A 3T40A 1THFD 2QCDB 1AW2A 4PTNA 2GVLA 2ZZ3A 3R89A 1W37A 4HSOA 2Y89A 3C3NA 3SY5A 2G5WA 4TX9A 2YFNA 5G4WA 1W1ZA 3B4UA 1YLVA 1G4SA 5E0KA 4LY8A 5K9DA 2ATMA 3KVJA 5HUPA 3W73A 1OYAA 1FWTA 3SR7A 3W84A 3RK8A 1XUZA 3EX3A 4JD4A 3D0CA 1FBAA 1ZHAA 2A85A 3G1DA 5F1VA 3N2XA 3S5ZA 2ZRWA 4G1KA 4M19A 3W2LA 3R5EA 4O19A 5SWUA 4Z0JA 5HNRA 3BW2A 4E2DA 4O4WA 4N9EA 1TRDA 1KM3A 2ZBTA 4OWGA 1P5BA 2WSRA 3GXPA 1NF7A 2A2IA 1XCFA 4BF9A 2DZUA 4N6EA 5LNWA 3TQVA 3LTSA 5BMWA 3AO0A 3EWUA 2H6RA 3DFOA 1WAUA 4MZYA 1JULA 3HMJG 5K9CA 3C4UA 3GR8A 4LUIA 3CEPA 4RZ4A 4TIMA 2YR1A 3E12A 3QM3A 5G2WA 3CIWA 3L2IA 4BWLA 1H1YA 2NV2A 3PSWA 2OZ0A 1J2WA 1PV8A 3BO9A 3OA3A 4O18A 2J9YA 3O15A 2OT0A 1SZGA 3LCHA 3EX1A 3TC6A 4IOTA 5FEPA 2CZ5A 3NZ1A 2CLKA 2C19A 1L2UA 3NYZA 2YYUA 1TCDA 1W5MA 3PF3A 3GDTA 3IEBA 4Y9AA 3WJYA 2TSYA 4MFEA 2FB3A 3W7PA 3NZRA 4HNUA 3L9CA 5F4XA 2NX9A 4UFJA 4O1DA 3QMRA 5DY2A 5L6UA 1QPRA 1OFPA 4MY9A 3P67A 1TJPA 2Y7GA 1IXPA 1GYNA 1WQ5A 2PE4A 3KVMA 3LCLA 1VHCA 4H4IA 3TCEA 1XDMA 4LVBA 5D05A 1LP6A 2ZRYA 3KOFA 2ISSA 2ISWA 3W1QA 1Y0EA 4CQ8A 2RDTA 1R30A 1OVDA 3LRMA 4BK9A 1LDCA 3NQCA 5EPDA 4N2YA 3SIZA 1SZEA 4RK8A 1W5QA 3L5LA 1VC4A 3STCA 1EB3A 2O7QA 1YXYA 3IRDA 3M41A 2NX3A 4UUIA 1F5ZA 1KFEA 2DJXA 3KAOA 4A29A 4OV4A 3PB0A 1VLWA 1BEUA 2E5BA 1XBYA 2P1FA 4FX8A 2J24A 3IIZA 3W7EA 2QCFA 1I2OA 5D2WA 3A22A 1UJPA 1UB3A 4FX6M 5FESA 4O14A 5FEWA 2VFHA 4TO8A 3EWBX 3PVFA 3E49A 2TRSA 3NQVA 2A7RA 4YCPA 4XTIA 2B4GA 2C18A 1GTEA 2ZRXA 4HIBA 2AGKA 4EVZA 1G69A 4NQ1A 3CC1A 4WX2A 5EY5A 3LV5A 2J27A 3ELFA 3W7JA 4AF0A 4D2JA 1H51A 3ANYA 3Q37A 2TPSA 1TTQA 2BWGA 2YCEA 3N9RA 1KM6A 4WZHA 4MFDA 3G0XA 1XBVA 4UR7A 1K8ZA 1VCFA 2GPTA 1WXJA 3CT7A 2PC4A 1LROA 2YGYA 3B0VC 1SU5A 1JCYA 4MVAA 2RKXA 3EXTA 4PCFA 3BK0A 4QSHA 2ISVA 3LERA 3BW4A 1XL9A 2A1YA 1OYCA 5D02A 3ABRA 1JCXA 5K3VA 3LHTA 3GLCA 3I7QA 4LU0A 3SI9A 3DI1A 3UWYA 3LX9A 4HN4A 2VENA 4AWUA 1EUNA 3R12A 1HUVA 1QPNA 1E51A 3NG3A 1O5XA 2E77A 3IVUA 5AFDA 1G4EA 5LGXA 4IXXA 3QW3A 1B57A 2Z6IA 4B5NA 4QITA 5J5RA 3C8FA 4R7JA 1D3HA 5FF7A 3A9IA 4LW7A 2CZFA 1OG0A 3ZS4A 3RLVA 3DU0A 3TSMA 1FXQA 4N02A 2WKJA 4O4VA 4YXGA 4ORMA 1C9DA 1K7EA 1VYRA 1X7FA 2BLEA 3GXNA 1K02A 5E1QA 1RQEA 4DXVA 5FF4A 4NNBA 3Q58A 1KBJA 4X2RA 2V30A 1GVQA 3NQMA 1G7VA 3W85A 4UFKA 1UASA 4GC4A 1K7XA 1R46A 4JX4A 3W6YA 4O8RA 3SW6A 2PCQA 1R2SA 2WSQA 1U5JA 3SJ3A 1W5NA 3FFSA 1LZOA 2ABBA 1ZY9A 4O16A 4A22A 4GUIA 5DLCA 1T8XA 1ALDA 5G4EA 1MSSA 4O50A 1JUEA 1MEWA 4KWWA 3W9ZA 1X1ZA 3RFAA 5D09A 2QCNA 3W3OA 4NJGA 5G5IA 2QDGA 3W74A 1ME9A 1DV7A 3OG3A 1AL7A 1VPXA 4PL2A 1LLZA 1KLZA 2YXGA 1QO2A 4UFMA 3L0NA 1HL2A 4ZL1A 3G24A 3O6YX 3TJXA 3GNNA 2WO5A 3S8HA 3E96A 3NQ8A 4AXKA 1W5OA 3NM3A 3C2EA 3NL6A 3QEZA 1IXOA 2X30A 2P0OA 5AOUA 3M5ZA 1FCUA 3W72A 2E5CA 2H8XA 4XUGA 1KFJA 1LBFA 4IMFA 4XWUA 4NVTA 4LV9A 2P10A 2DU2A 4CLMA 1C29A 4AHQA 1F6KA 4S1FA 3TA6A 5CPNA 5HINA 2NV1A 2X1SA 3O1NA 4FIRA 1RV8A 3W7OA 2DZXA 5AC6A 5I3KA 3MUXA 1Z41A 5EMUA 2JGYA 4FEZA 2E6YA 1LLWA 3BPWA 3L65A 3S5YA 4UTMA 4UTJA 3HGRA 5FEZA 1GWJA 2IQTA 3QQ0A 5HULA 2VOMA 3PUEA 1I2PA 1L6WA 3EX4A 3W7DA 3T7VA 3NA8A 4X22A 3KVLA 2G96A 5F2LA 3W76A 1G4TA 4UTTA 2YX0A 5CSSA 2ZZ4A 1U83A 5D30A 3O63A 2GUUA 3PBWA 1F76A 4JEQA 2EKCA 4ONVA 4UNLA 2C3ZA 4S2CA 1FY6A 1BTMA 3G3MA 4O57A 3M6YA 5G1TA 1UUMA 3C56A 5D37A 4Z0SA 2D73A 1VR6A 2H90A 4GUGA 3TX9A 1XI3A 5EKYA 3VNDA 1OX4B 3MYOA 1B4EA 1MEIA 5DELA 2CWNA 3GVGA 4K8HA 3THQA 3NVTA 4AB4A 3QMSA 1LTDA 2ZZ2A 3LBMA 2GQ8A 2FPYA 4RLIA 3UNDA 4QJ1A 4K36A 4N9CA 5A8GA 3H54A 5HWNA 3MO7A 1KLYA 3P82A 5CSRA 1AG1O 2V5LA 2VC6A 4JTLA 1OX6A 2J9XA 1EP2A 3PG8A 3Q2DA 4ZQCA 1FQ0A 1G6CA 4AHPA 1OFOA 3GDKA 1UCWA 4XTDA 4A2RA 1YYAA 4MJMA 3LCWA 2JKPA 8TIMA 1DQWA 5U4NA 1T0OA 3ZWTA 1DOSA 1TSIA 2Y63A 1DL3A 3EKZA 3LHZA 4RR4A 3HPXA 1MO0A 5AHEA 1EPXA 2C16A 1LRQA 1SQ7A 3P62A 2Y88A 3BLFA 1X6UA 3QC3A 5J5DA 4J9JA 1DHPA 1A5AA 4FHAA 3V75A 3SGZA 3TJLA 2QCHA 3LHYA 4ZMGA 3KVKA 1TIMA 1SR9A 2B7NA 1B3OA 1YADA 1PHWA 3LB0A 1RR2A 4H6KA 4IMDA 2V9DA 2A6LA 4O54A 3TNOA 2B7QA 4GUFA 3DHDA 1QCWA 2GVJA 3EEGA 3LRLA 1XBXA 1KM0A 5HQEA 2EGZA 4LV4A 1KBIA 2CFFA 2VFFA 4LTSA 2J88A 5FF0A 3FJLA 4UFLA 1VGAA 3B05A 4LC8A 4IJBA 3GKFA 4ORIA 1TV8A 4M6PA 3WK2A 2B7OA 4HNVA 1AK5A 2E6FA 2UV8G 3MP5A 1W3IA 4EF8A 1H7RA 2JKEA 4QAIA 3C2RA 3G1HA 1TO3A 4ZQMA 1TMHA 3ZFHA 2VKZG 4XBKA 3LM7A 2GJLA 3M5YA 1PCKA 2GVGA 2VFGA 3W71A 5LNVA 4JTIA 5D2VA 5F4SA 1S5VA 4LOCA 3IV3A 4DPQA 5F2IA 2C6QA 1GJPA 3NR0A 1J5TA 1WOBA 3DHFA 1LOQA 4K7VA 3MBDA 5LZLA 2CLIA 1OFQA 4FNTA 4I9AA 3LGEA 4ADUA 1FCVA 5KZDA 1N7KA 4U4MA 3G18A 4E38A 1NFBA 2RHGA 1Z42A 2DZVA 3G1XA 2E09A 4NX5A 3A24A 1TQJA 2XFWA 3NAVA 2QEZA 5TQLA 4RX0A 4K39A 4OGZA 1OX4A 2VFDA 1TPVA 3BGJA 1ICQA 3MJYA 4NJJA 3TKFA 3R8RA 3HIJA 5AYXA 1RQBA 3TMQA 2H3BA 4M7SA 2V2DA 4Q32A 1JCLA 3VKJA 3FJ6A 2OCZA 2BTMA 1LORA 1CW2A 2QKFA 5HR6A 2HS6A 4FXRA 4BWLC 4IWWA 1SO6A 2FLIA 2QDHA 3W83A 2I9EA 2R91A 1RQHA 1VCVA 1ZAIA 3MP4A 4AWSA 3TK7A 1JRBA 3HBLA 4UTKA 1S5TA 5KMYA 1BWLA 2VEKA 5T26A 3OVPA 1TTPA 1ME8A 1TJRA 4DPPA 4WY0A 1XM3A 6ALDA 1TPDA 3O16A 3N14A 4O17A 4FO4A 4QM1A 1LRNA 1OK4A 3QRHA 1GOXA 1SO5A 3QFEA 3HGSA 4X9SA 4A3UA 2Z6JA 3TXZA 2BXVA 3BLEA 2BX7A 1LOLA 2YSWA 4UXDA 2W6RA 3G0SA 1KV8A 4LC6A 3L68A 5CPMA 2WNZA 2GQ9A 1P1XA 1EWDA 3A5VA 3GX9A 3LBCA 3CTLA 3DGRA 5DBTA 4DELA 1OFDA 5FEXA 3GR7A 4M5PA 1WBHA 3HOJA 5LNRA 4N9DA 3C0JA 4UMCA 4QNWA 2X1RA 3M7WA 2WQPA 3PAJA 3UPWA 5K2ZA 3MMTA 1GQNA 2CZDA 2YW4A 4E2BA 2KZHA 4UR8A 4ZVJA 3CHVA 4AMAA 4O52A 3GDRA 3MHUA 3BG5A 1CX9A 1GT8A 1M6JA 3CIXA 2HSAA 3QZEA 3MHFA 3LHUA 3DENA 3OVQA 1VS1A 3W88A 1JCNA 4DF2A 4MKNA 3O07A 3B06A 2FDSA 4Y90A 2GJNA 5D32A 4XBSA 2A7NA 2WPBA 5G1YA 2NWRA 3KRZA 3MI2A 3PWAA 1Q45A 5C2XA 3A23A 2QCLA 1Q6RA 3N34A 1TYGA 2ZTJA 1ZFJA 4P2VA 3W1LA 4JTUA 3W1UA 3NQ6A 1J4EA 3EWWA 2RFGA 3P8IA 3TIMA 5H2ZA 2NLIA 1HO1A 3W7MA 4GRSA 1RPXA 1GYLA 3P5ZA 4RXFA 2ABAA 3G1FA 2ZQ0A 3P81A 2AQWA 1TPWA 3IIVA 4LVFA 3PM6A 1GG0A 5LHEA 1F73A 2TMDA 1YXCA 1QPOA 4PEKA 5AC8A 1PL9A 2GOUA 2ZA2A 3LHVA 4HPXA 3GYEA 5KZEA 4LT9A 5LNUA 2Y7EA 5AHFA 4OHQA 3DZ1A 3QMTA 1GPWA 4AHOA 4UMAA 3FYOA 2E5DA 1L6SA 4C1LA 1FWNA 3L0GA 4IX2A 3BGGA 1H7WA 3EWXA 2X16A 4JN6A 5A5WA 3F03K 1IIGA 5DXYA 4ZZ9A 5HWMA 1C8VA 1OJXA 1G67A 4MUZA 3LXBA 3P84A 3PG9A 2EAWA 3LCXA 4DF0A 2PRMA 1QOQA 2FB2A 4BI5A 5HUOA 3NEVA 5D03A 2VEIA 3M5VA 3AJXA 3YPIA 2Y7DA 2CLHA 5L9FA 1FCQA 4PA8A 1SFLA 3S0CA 3E02A 2C15A 4O11A 2CZEA 3QYQA 4KKXA 4NJKA 1X8FA 3TMLA 1FWSA 5AYZA 3BARA 1MZHA 5BRBA 2X1UA 3EWZA 3S42A 1JQVA 1W54A 2R14A 5K4XA 1PIIA 5CKSA 4K6AA 2FPVA 4MOZA 1LBMA 3W7HA 2VFEA 3OIXA 1YDNA 3SZ8A 3P61A 1V7YA 2AAMA 3N73A 3G1AA 3UZJA 4O15A 3FLUA 3IVTA 3F1QA 2A21A 4LS1A 1VZWA 4U28A 1VRDA 1WA3A 3K30A 4UTWA 2NUWA 4Z1DA 3M9YA 3CU2A 4OU1A 3C2OA 3G1YA 3WJSA 1DQXA 4R34A 2VFIA 2FJKA 4FIQA 4NX0A 3N9SA 2ZZ7A 1OF8A 3ABOA 2QUTA 4GUJA 2Y85A 3GDMA 1XKYA 4A2SA 4UMBA 3UXAA 1DJNA 4DO6A 3WJZA 1TPFA 1X1OA 3O8AA 1YXDA 1WDWA 5CZ0A 5KTLA 1PCWA 3HPSA 3LI1A 3BVJA 3HGOA 2I14A 4IQLA 3CB8A 4NU7A 3EXSA 4AVFA 3DXIA 4FNSA 3L21A 2VEMA 5K9XA 1H7OA 1R2RA 2YDAA 3TDFA 1EP1A 3B03A 4DBEA 2Y70A 5LGZA 1DVJA 3HG5A 3QJAA 1PVNA 3P80A 3R13A 1K7FA 1SPQA 1OFBA 3NQDA 1YTKA 2C13A 4AEOA 3DH7A 2E68A 3VCRA 3N19B 3O06A 3KX6A 5TBOA 1LYXA 3NPXA 1WOAA 3PY2A 3TW7A 2GQAA 2EHHA 1JRCA 2PURA 3QW4B 4HNNA 2Z2UA 2WSYA 3W2UA 3HG4A 5EBUA 5FF2A 5D2YA 4GBUA 3STEA 1IF2A 4OBTA 3S5NA 4A21A 3QQ1A 2XN0A 3FKRA 3FA5A 1MEHA 5TIMA 1WYIA 2ZA1A 3LXCA 3OHIA 4O1CA 4FB7A 4UTLA 3PBYA 5C5YA 4RZ6A 2DZTA 1A5CA 2V81A 1SW3A 4O28A 3G0UA 4GFSA 3DFTA 4DQWA 2EPHA 3SGUA 2NUYA 1YTDA 4MZ8A 2Q8LA 4DEFA 1H7PA 3KHJA 3WK3A 2CLOA 4MLRA 4MLJA 2E6DA 1EUAA 1LCOA 2V2CA 1JVNA 1H1ZA 1OFEA 3TC7A 1IIHA 3B04A 3DKLA 1PS9A 1ZNNA 2JK2A 4UCGA 1ZENA 3TQKA 1FDYA 4LWWA 1FUYA 1P4CA 1QO5A 5DCEA 1Z48A 1ICPA 3MI3A 3MHGA 4YLWA 1RVGA 3HJZA 4LS0A 1VH7A 3DFNA 4WD0A 3TFXA 4R53A 3SFKA 2ZTKA 3EX6A 3UWZA 3TSDA 3QPZA 5AHLA 3CEUA 4FNQA 2QJGA 1Q3NA 3EXRA 1DORA 4I7WA 3SECA 5LNSA 1KM1A 1ICSA 3U2OA 4FNUA 1XFBA 3UWQA 1O95A 3GIYA 2LLEA 4ML9A 4JTSA 1W0MA 3MYPA 1OYBA 3CLMA 3EX2A 3FKKA 2ATSA 5C54A 1TPUA 4JS3A 1NAL1 3UYCA 4CQ9A 3MI6A 3QPYA 4PH6A 2WJZA 4ZQRA 3G1SA 4JX6A 1MXSA 1GVOA 1WV2A 4NXKA 4MJZA 1V5XA 1JUBA 1H63A 3W22A 2ZZ6A 3F4WA 5U7SA 4LVDA 3RU6A 2R8WA 1HG3A 3L5MA 3TV8A 3NO5A 2CLMA 3NXFA 1G4PA 1W8SA 2QCEA 3GKAA 3C61A 1QAPA 3TUUA 1NVMA 2QCGA 2E6AA 2ZZ1A 1FX6A 3SSJA 5D38A 2NWSA 3GAYA 3TR2A 1KV5A 4JDBA 4UFHA 2VEPA 4N6FA 3WK0A 2VXNA 3W7NA 3TH6A 4I7VA 3PR2A 3GXTA 4Z1AA 1FDJA 1H60A 3ATYA 3NQ2A 4GXMA 3PC0A 2QUVA 2B0MA 4IPJA 2ALDA 1SFJA 1ME7A 4JTJA 4Y96A 5HWJA 5FF3A 3W86A 5HJLA 3W2KA 1RZMA 4O13A 2V82A 4RV8A 1KFKA 3MWAA 3I7SA 3I65A 1OFRA 3L67A 3G8RA 1TV7A 3U8GA 2ZDRA 1NEYA 4XKYB 4NJHA 1A5BA 3P8JA 4N9BA 2BZNA 1JR1A 4N4QA 3GB6A 5AC7A 4DBDA 1OHLA 1XUUA 5DCDA 1H5YA 4PC8A 1W56A 1Q6OA 5K7JA 1UBSA 2Q3OA 4AH7A 1YTEA 4WUIA 3NL3A 1T99A 1QFEA 2HS8A 2W79A 3ZWSA 5I3JA 3DBPA 4UTWC 4JYDA 2YFOA 4WY0F 1EA0A 3RMJA 1F2JA 1K8XA 5KSWA 4WJEA 2DP3A 3EWYA 4MY1A 2Y6ZA 4PODA 1JCJA 1YPIA 4JTHA 3H55A 1OABA 1SZFA 2A4AA 1HTIA 3HB9A 4JIQA 5I3FA 1ZJIA 3MBFA 3BLIA 1SSGA 5G2IA 1LM1A 3WK1A 3PSVA 4JICA 3M44A 1QPQA 1GVRA 1EIXA 2CLFA 4K7YA 3HG2A 1B4KA 4N4PA 2RDWA 5CZSA 4O53A 1F74A 1OFAA 2OJPA 4CNPA 1IGSA 4IX0A 2QCDA 4RXGA 3LV6A 4CCDA 5AHMA 2H3DA 1DBTA 5DXXA 5I3GA 1FCBA 2NXIA 2QJIA 5CGQA 1QDSA 2Q8ZA 4ADTA 4UTHA 3NL5A 1VLIA 1JQXA 2X1TA 3RF9A 1XXXA 2QJHA 2WV8A 3USBA 4BFAA 3KRSA 3NL2A 2JGQA 3C2FA 4HNTA 2BSLA 1QWGA 4WOQA 2NXHA 3WJXA 3KFTA 4OV9A 5D2TA 3A21A 2QAPA 5D04C 4MYAA 4S2BA 4BI6A 1KFCA 3I6RA 1VYPX 3O6DA 4Y8FA 1LOSA 2RDUA 5EYWA 2R94A 3TROA 3HGJA 5LHFA 1DJQA 2DJLA 3DFPA 3N2MA 4IGHA 3LCIA 1A5SA 4JNMA 3BG3A 3W7CA 1KFLA 4ZQPA 4JY8A 3FS2A 2A6NA 2CLEA 2NXGA 2FIQA 3M0ZA 4GNJA 2C0AA 4EWND 1H61A 5CZTA 3OEXA 3VI2A 3EKLA 3GK0A 1TQXA 4HSNA 4QQ3A 5FI8A 4L4LA 1FXPA 3KXQA 3NDOA 2HTMA 1W31A 2I1OA 5G2HA 3W1AA 1Z44A 4CCCA 3IVSA 4YWIA 3W70A 2WNNA 4LS2A 4OQVA 4Y6GA 4FX7A 1XBZA 5CG7A 2C14A 4JTEA 1AMKA 1KTCA 4AAJA 4UTTC 3IGXA 2FQIA 3NM1A 1A53A 4JR5A 2OMAA 3TE9A 3L0KA 2G95A 4MIMA 4KWVA 3W2NA 3G8EA 2NZLA 1RD5A 1GZGA 4O0KA 4HPJA 1OF6A 3WFAA 3C2VA 4WXZA 3ZR4A 2C1HA 3G1VA 3RLUA 4EIVA 2NUXA 3TSBA 2JKAA 3PULA 3NOEA 4GUHA 3GZ3A 3NQAA 3UY8A 5E93A 1DKWA 2QAFA 1D9EA 3LLFA 4UIOA 1F7BA 3JS3A 4MZ1A 2J6XA 4IUOA 5BMXA 3W7LA 3NPUA 1D3GA 5AHIA 4PL1A 2QCMA 2YYTA 3I68A 3UY7A 2Y62A 2O7SA 4JY9A 3PUDA 1UUOA 4KFOA
chains in the Genus database with same CATH superfamily
1SW7A 4B16A 1L6YA 1C9WA 1F3EA 1I2RA 4MHBA 3KDNA 3HQ1A 5MKGB 3BSGA 1GHRA 1WZLA 4B9YA 3P93A 2PWDA 1CZ1A 2QS8A 3XIMA 3UZXA 2WB5A 4BQ5A 4LVAA 4XZHA 3PJTA 3W1XA 3EB2A 1VFMA 1ZB5A 2AQOA 1E6SM 1UWAA 4ZFCA 3PS7A 2VQTA 1Q6LA 2GDUA 3SN4A 3ARZA 1V6XA 3RLGA 1KKRA 2O0TA 1BKSA 3SY1A 1A5UA 3GXDA 1PKLA 1QHPA 4WOZA 2DZAA 2W63A 5F2GA 1BWVA 2WVVB 4LRSA 5I02A 4QS6A 3V4BA 2ZZ5A 3MP3A 1G7UA 3HG3A 1W2PA 4O1AA 4FNPA 2ZUWA 3GDLA 4H83A 1R38A 4R33A 2XH7A 4O0QA 1Y5VA 1EX5A 2EF9A 1GVYA 4J7RA 3W1TA 5FJJA 5M3WA 1SJCA 3P74A 1BQCA 3QSRA 4MMWA 1TTJA 1EBGA 4EF9A 4Y9OA 3Q45A 1JJKA 3PPHA 3CQIA 3C2YA 3APTA 3QH2A 4UC5A 4TU1A 3W1NA 1ITQA 3Q94A 4DI9A 3WLMA 1TG7A 2BOEX 2A7PA 4DJEA 4GVGA 4YCOA 4NYUA 1J10A 3KBVA 4MSSA 2HBXA 1ODUA 1VBGA 3W7QA 4P7RA 1OGBA 3UWWA 3RX3A 2O9PA 4V27A 2DZWA 3TU9A 4IQJA 4WQ6A 5CZKA 3ABSA 4NZCA 5EA9A 1YMYA 4FA3A 4CNNA 3UQNA 1AW5A 3PUOA 3LMYA 2X0YA 3T9PA 3SUTA 3EB4A 5A6TC 1RY8A 3W1PA 5HR7A 1HKIA 2Z0IA 1ELSA 1NWSA 1IWBA 3MTWA 5C70A 1VD6A 4U3AA 3WQWA 4JIHA 1W3JA 2DORA 5KETA 3ZSSA 3OLIA 2IS7A 4E8DA 3U57A 4UTFA 3GG0A 5AKQA 2E1DA 3T4CA 2QMKA 1BVNP 1ONRA 2BODX 1TWWA 1MDLA 1N8FA 3WD0A 1GG1A 4JTFA 2VC9A 4IIDA 1U1HA 3THAA 3R2GA 1XHGA 2TYSA 5BNKA 3DFSA 2Z26A 3KHDA 2PDUA 4HZ6A 4AF0B 3OO2A 2VC5A 1KNWA 4ACZB 1Q2RA 2O55A 2P50A 1R47A 1I75A 1KXHA 3TP4A 1V08A 3VIGA 1VIZA 4E5TA 1FVPA 4DAFA 4JTTA 3TCSA 4J3XA 3O05A 3SQMA 3T44A 3HPZA 3CYVA 2Z1BA 4W85A 1TTIA 4AZHA 4ZOBA 4RNIA 1JCMP 1IXNA 1DXIA 2BG5A 2G41A 4PTMA 3N15A 2A0NA 1V8EA 3QKEA 2P3EA 4HHPA 1F6PA 3WNKA 3GH4A 5IM51 5DBUA 4G2DA 3C6CA 3IIPA 1TWZA 5I3IA 3TYAA 5IBXC 1K03A 3VDCA 1K9TA 3IAPA 2YXXA 3WH6A 1CWYA 5CLTA 3PNZA 1TPH1 4XZMX 4B5WA 3AS1A 3WFLA 1I8JA 2VO5A 4CQCA 2PD9A 4XQ6A 1CT5A 4JXCA 2OLHA 3SAZA 1VHNA 1BFNA 3OODA 3KOZA 2ZCGA 5CPOA 3G3DA 4CN1A 3W1RA 1UQYA 2CBUA 5IFTA 5EL1A 4IICA 4MPQA 4MNLA 1XFCA 3AHVA 5AYYA 4INFA 4U5KA 3BXWA 1HVQA 2XN1A 3HFYA 1QNVA 2XG9A 6A3HA 1GOWA 3MU7A 1HF6A 4M8UA 1S3HA 3DKJA 4QBXA 3WX7A 3G2GA 2WZIA 3NPVA 4R9XA 3UJEA 3CQ0A 2A3LA 3AS2A 2ZX7A 4ROQA 3JZUA 4PTDA 2FHCA 4IIBA 3P60A 1K6WA 3GZAA 1JD7A 2WNQA 4F0LA 3HQOA 4GJJA 1A4MA 2GGEA 4S23A 2Z1KA 3VD9A 3TOPA 3I4EA 1PHQA 4IPIA 2YDRA 1EO7A 2DUZA 4LUJA 5MHBA 4UNKA 1HJUA 2W61A 3DESA 3H4GA 3ZIZA 2V3DA 1VPQA 3HF3A 4MPKA 1S2UA 3CHEA 4HSHA 1SZNA 4FMVA 3H53A 1IWPA 1WO2A 2PWFA 3LDVA 3APYA 2OWCA 3RCMA 3UF9A 3QF0A 1H09A 1YDVA 3PB2A 4Z42C 4AX7A 3T40A 4PTNA 2BY0A 3OYXA 2KX9A 1XW8A 2AKZA 4BHYA 1M9HA 4JTDA 4D1JA 2YA0A 4TX9A 5G4WA 2OOGA 1W1ZA 2VEFA 1DP0A 7ENLA 4LY8A 4L4PA 2INEA 4PUKA 5K9DA 3KVJA 4QTGA 5HUPA 1OYAA 3CJPA 3W84A 4O1FA 3T8QA 3D0CA 1FBAA 2A85A 5ABEA 4G1KA 3E2QA 2WCSA 1Q63A 3W2LA 3FYYA 1JI2A 1R3SA 3BW2A 2J77A 4N9EA 1TRDA 4XZIA 2ZBTA 4OWGA 4Q8PA 4WF7A 1G1YA 1HJSA 4BF9A 1G0CA 1C90A 2BVYA 3PZMA 4NAFB 5LNWA 2OGJA 1HJQA 2PDJA 1BVWA 3LENA 1HKKA 5K9CA 2XIIA 4BQ2A 1J0JA 3U2ZA 5G2WA 1H1YA 4JFWA 2DT0A 3RJXA 3DG7A 1UR4A 2XUCA 3BO9A 8XIMA 3W4RA 3O15A 2OT0A 3LCHA 3EX1A 5FEPA 4Y9AA 3Q4DA 1EA9C 3AZTA 3VIIA 3L9CA 5C9WA 3QMRA 3TONA 1QHOA 3VIFA 4GY1A 4QE1A 1WQ5A 4ACYA 1EKOA 4TXEA 3GYCA 1FHDA 1JZ6A 1SVDA 1XDMA 3PAOA 2ZRYA 2ISSA 4PUWA 4A3QA 1J96A 5HBFA 2Y2WA 5EFDA 1U1JA 4BK9A 5I79A 4IQEA 3BTNA 5EPDA 4N2YA 2QV4A 1SZEA 1W5QA 2J47A 5FACA 1YXYA 3R8GA 4H9YA 1M1BA 2DJXA 1KFEA 4A29A 4WGXA 1BEUA 4UQAA 1U1UA 3QTPA 3RITA 3M0JA 1I2OA 4MAZA 3A22A 3A13A 4FX6M 5FESA 4TO8A 5FJRA 5XINA 2TRSA 2A7RA 1XIDA 4XG1A 2B4GA 1PZ1A 2UBPC 2C18A 2AGKA 3CC1A 2O9RA 3Q37A 2BVWA 1BXBA 2TPSA 3FK4A 4C60A 5A6LA 1WUFA 1GYMA 4LGXA 1VP5A 2PCEA 2PWEA 4WZHA 2REQB 2CKRA 4MFDA 1P7TB 1VCFA 4E4UA 5EBAA 3FX4A 1A47A 1SU5A 5I24A 3NWRA 2RKXA 3BK0A 3QVQA 1UWQA 3A12A 4UQDA 1QASA 1YQ2A 2D2JA 4Q8QA 4XIAA 1S2CA 2O4MA 4LU0A 4S3GA 1JZ7A 3P0WA 3B9OA 4Q4SA 2VENA 3COTA 3APGA 2HXUA 3FXGA 4F48A 2E77A 1G4EA 5LGXA 3V18A 2PWUA 1B57A 1V6UA 4HJWA 2FH8A 2Z27A 4B5NA 4QITA 3VK5A 3C8FA 4R7JA 1D3HA 3MMWA 3AIEA 3TSMA 1IZKA 4N02A 2WKJA 2ZE3A 4EK7A 4FALA 5HNTA 4J40A 4NZ3A 1UKQA 4LYQA 4NNBA 1KBJA 4X2RA 3CMJA 3PPFA 4MAVA 1GVQA 3W85A 1UC4A 4PFHA 3W6YA 4JX4A 1AQ0A 2WKGA 1PTDA 2ON3A 4CVUA 3BJSA 4A4AA 1V79A 1U5JA 4JKMA 4DM1A 4DRSA 2PS2A 5DLCA 1ALDA 5G4EA 3WLHA 4O50A 1RD6A 4V33A 1JUEA 4AZ6A 3W9ZA 2VQUA 1VB9A 4NJGA 3W74A 2PSNA 2V69A 3OG3A 3VYLA 1RP8A 4MB5A 1MUCA 1JCTA 2D0GA 2YCJA 1YNPA 3L0NA 3AHYA 1UA3A 3VDBA 2JF6A 2NV9A 3VDAA 3A64A 1JDFA 3GNNA 3S8HA 4G6CA 3NM3A 4UOZA 3C2EA 1VBUA 5HAOA 2P0OA 4JAWA 4ILSA 4AU0A 4XUGA 1R7OA 3V5FA 2BOFX 1XX1A 4XK2A 3N04A 4GZEA 1W1PA 3O3RA 3WSUA 4AHQA 2CXEA 3ISIX 5HINA 2X1SA 1E9ZB 3O1NA 1RV8A 4KIRA 3SRHA 5AC6A 2FKPA 2C1GA 3MUXA 4LQ1A 3KTSA 5EMUA 2E6YA 3M0HA 3AIBA 1WCGA 3BPWA 1IWAA 3S5YA 2AL2A 3T05A 4GJIA 1CLXA 3WYZA 1XH2A 3W7DA 1HVXA 1JAEA 4NHVA 4C6OA 3BMXA 3NDYA 3KVLA 4E8CA 5B80A 4IUGA 2GUUA 2XIJA 2Y8VA 4UNLA 4CNUA 4S2CA 4ENLA 1BTMA 4O57A 4IFKB 5D37A 1W9XA 1QI4A 1WPCA 3SM0A 1XI3A 3MYOA 2ZUTA 4UB9A 4AB4A 3NVTA 3B40A 3QMSA 2PDPA 1MFVA 2WVTA 3VD5A 3WEMA 4HNLA 1M68A 2FPYA 3UNDA 5A6SA 4QJ1A 4K36A 1VFLA 2ZUNA 3MO7A 2ZDSA 3P82A 1ZBCA 1AG1O 2CBJA 4JTLA 1IR1A 3MUAA 1OX6A 3ARWA 3PG8A 3Q2DA 4ZQCA 1G6CA 4WKHA 3UA3A 3HFTA 4AHPA 1UCWA 4XTDA 4GGHA 3ES8A 4JQ4A 3GNXA 4FLSA 5EMKA 1XLMA 3LCWA 1C3FA 1Q7ZA 4L6DA 1DOSA 2Y8KA 3LHZA 2HEJA 4KT2A 1B1YA 3E5PA 4JHMA 3WEZA 1XG3A 1LRQA 1VBHA 1SQ7A 3H4XA 3DX5A 3N2OA 1NARA 3LNMA 4TV6A 1DHPA 3V75A 1EGVA 3STPA 4AD4A 1RR2A 1TUFA 2E40A 4H6KA 1MVYA 3DG6A 4PULA 4ZO6A 4HTYA 4GUFA 3EEGA 3ITGA 3LRLA 4C6DA 4WDTA 2AKMA 4DWSB 1KBIA 3AQUA 5FF0A 4H9MA 3TYDA 4LUTA 4LC8A 4ORIA 1TV8A 4M6PA 1UPPA 1AK5A 2E6FA 2UV8G 1VEOA 4MNKA 4UQBA 4ZO9A 2JKEA 1PX3A 1B3YA 1IYXA 2VKZG 4CNTA 3M6DA 1DPMA 3V3WA 3EKGA 3LPFA 4AG0A 1W1A1 1JZ5A 2GVGA 4LY4A 4JTIA 1RJRA 4LOCA 3IV3A 2QDEA 4DPQA 2C6QA 2DZBA 4ZB0A 1W9UA 4JZ5A 3AIVA 1WOBA 3DHFA 1CIUA 2DUXA 2VD8A 1NP2A 4H9UA 1OCBA 1L8PA 1OFQA 1H0GA 3NGFA 3LGEA 1FCVA 5KZDA 3TYBA 4M81A 4LH8A 4E38A 4XAPA 2W67A 1OZQA 4NX5A 3AICA 1TQJA 2XFWA 1RAKA 3BH4A 2WNWA 4OGZA 3WMBA 5CEWA 2VFDA 4N42A 4JTCA 1C7SA 2PODA 1YE4A 3TKFA 4IIFA 3ITLA 4EXQA 3FJ4A 3AFBA 8RUCA 5JU6A 2ZXAA 2H3BA 4HTBA 2V2DA 4Q32A 1LORA 1S38A 5HR6A 5HPCA 4IWWA 3S1GA 1RQHA 1VCVA 3HURA 3CB3A 4AWSA 1YDYA 4X0NA 3SCSA 1B3XA 4UTKA 1S5TA 5MF5A 2Y5SA 2CC0A 2WMJA 3CAVA 3KRBA 3CASA 1TJRA 2DW6A 3UCDA 1W9DM 1RBAA 5JMUA 1PX4A 1XLAA 2ZXQA 4EXAA 1PKYA 6ALDA 1TPDA 2E3ZA 4G1NA 5I09A 2VTFA 4D6GA 1SO5A 3R94A 3HGSA 5M1TA 2OEKA 4LX4A 1NH6A 2BX7A 3WLKX 4LBUA 2UY3A 3DYOA 2YDQA 3GX9A 2DSWA 2BHYA 3GY1A 4R9OA 1J0ZA 4M5PA 1WBHA 3HOJA 5LNRA 3VKCA 2J74A 4HGXA 4NRSA 2HE8A 2WQPA 3PAJA 1E71M 3MMTA 1RH9A 4E2BA 2KZHA 4F4RA 3R7MA 4O52A 1GUVA 1GT8A 2I7GA 3CIXA 4LCQA 4PB4A 3SFWA 3TTSA 2QPXA 4HQVA 1VS1A 1V93A 2OR2A 1TMLA 2E8ZA 3TR9A 3GXIA 1MNZA 1PPIA 2Z1VA 4C91A 2WPBA 1JGMA 1V77A 2EG7A 1I9CB 3MI2A 2WZMA 5C2XA 2XIOA 4DJED 4EANA 2QCLA 1Q6RA 2ZE0A 2V3GA 4TVDA 3VXGA 1K9FA 3WNMA 2JFEX 3LN3A 1ZSXA 5GNYA 3TIMA 1DE5A 1VKFA 2CNCA 3UR2A 1E9IA 3MS8A 1N8WA 1HO1A 4IM4A 2FGZA 4TTUA 3ERPA 2CPUA 4JFVA 3URQA 3UG3A 4D6IA 5LHEA 2TMDA 3N6HA 3B9EA 3N2BA 2XVNA 3GD6A 1EEXA 1UUQA 3LHVA 3QKZA 2J7EA 3GYEA 1E0XA 5FA5A 5LIKX 3R6IA 1POKA 5AHFA 4UQCA 2QGHA 3QMTA 2HROA 3WNNA 3RM4A 3VGFA 4C1LA 3CZEA 1XYBA 4IX2A 4YNGA 2OFJA 3AYSA 1H7WA 2X16A 4JN6A 4I8YA 3F03K 4D72A 1G67A 3P84A 3VGHA 3CAQA 3VIKA 2PRMA 1QOQA 1SGJA 3MKKA 3NEVA 3M5VA 3YPIA 2Y7DA 1BXNA 4ASTA 1SFLA 4TX8A 2VUYA 5D8WA 3S0CA 4NAFA 1UMLA 4FK9A 3CL6A 4AW7A 4NJKA 5FAJA 1FWSA 3LZ5A 5BRBA 3VCCA 1W54A 3AHZA 3AISA 2YA2A 2WK2A 4MWAE 1CXLA 3IK4A 3CL8A 1V7YA 2AAMA 4UCFA 3N73A 3VOHA 4DUWA 1ONWA 4LS1A 1BG4A 1Z7AA 4U3CA 1CXHA 4UTWA 3WNLA 2DQXA 2UWFA 2NUWA 1WDRA 4OU1A 3GE7A 3WJSA 1DQXA 4G9PA 3AS3A 3S3GA 2VRKA 4D6FA 1P0DA 2FJKA 3TTOA 4FIQA 4NX0A 4GYJA 3ID7A 3RM9A 3L23A 1YHTA 1GGOA 4DIAA 4UMBA 1TCMA 1TX0A 3CUFA 1TPFA 1QHZA 1WDWA 3UZWA 1KB3A 3HPSA 3BMWA 2CKSA 4FOKA 4IQLA 3CB8A 3V7PA 4QG9A 2EJ1A 5ENLA 2VEMA 4DBEA 4N0RA 5LGZA 1NFPA 3QJAA 1PVNA 3NXLA 2XU2A 2OQHA 2W91A 4AZ5A 7TAAA 3DH7A 3I6TA 4C6BA 4K1WA 4NILA 4L1XA 2PC8A 3N9KA 4HHMA 1ITCA 5M2FX 5C9XA 3BZGA 2PTYA 3TA9A 3QW4B 2Z2UA 3E2RA 4Y9MA 2QDDA 1GQIA 3STEA 3AMLA 3S5NA 4A21A 3CQKA 2XN0A 3QR0A 1E43A 2D69A 1KRMA 4WKAA 3OHIA 4UWMA 4O1CA 4RNJA 4DWSD 1GPFA 3QY6A 4Z17A 4KETA 3ME3A 1A5CA 2YCLA 4LPCA 3G0UA 1UD3A 2NUYA 4MZ8A 3KHJA 3LEPA 2CLOA 4MLRA 3FJNA 5A2CA 1EQPA 1EUAA 4E3TA 1GZ1A 4A8IA 3AU6A 3QZAA 1OFEA 7PTDA 4J1OA 4JKLA 5LA0A 3BJFA 3UETA 2FH6A 1FUYA 1P4CA 1AH0A 4E4FA 4RDWA 3OBAA 2WKLA 3VOFA 3ORWA 1ICPA 3MI3A 4YLWA 1RVGA 4GOAA 1Q2SA 3H12A 3K5XA 4R53A 4CCZA 5BXSA 4FNQA 3EXRA 1K70A 4I7WA 4GPNA 4YS1A 3QZ6A 2UY5A 2EKGA 3CHFA 4ZOAA 1KM1A 1EFZA 1XFBA 3RX4A 4F0KA 1W0MA 3WF0A 2SFPA 1Q6GA 1XLCA 2R9RA 1OYBA 3CLMA 3FKKA 1CLVA 2HVMA 1TPUA 1DJGA 2R1PA 4PH6A 2ANUA 5KZ6A 1J01A 4ZQRA 1MXSA 1G94A 1GVOA 1UYQA 1H63A 3TZNA 2VX6A 4LVDA 1GQJA 1HP5A 3RU6A 3A3HA 1TFVA 3L5MA 2FJUB 3TV8A 1KXTA 3IS4A 4IJCA 5GPRA 2PTWA 4ATWA 2QCEA 1QAPA 2QCGA 4D6DA 2E6AA 2ZKMX 1FX6A 1OD0A 3SEPA 4BF7A 1GKRA 2G37A 2OELA 3GVRA 1KR1A 4I7VA 2WHJA 2WWDA 1E6QM 2EG6A 5E9AA 3WQDA 2BBFA 4JTJA 3NEHA 3W2KA 3PFRA 2PWVA 4O13A 4CD8A 1KFKA 2D2GA 2Z1WA 1QNSA 3I65A 5FJUA 2PTXA 2QJJA 4GI9A 1NEYA 2CBIA 1B9ZA 2E0PA 3BZJA 3WLRA 4CQDA 4IP5A 1JR1A 3SN1A 4Y2WA 2F9RA 3SUVA 4PBFA 4GZJA 1M53A 4L4OA 4PC8A 2PU1A 1X97A 2R1KA 2X7WA 1UBSA 4D8LA 3LS9A 4K68A 3NL3A 1XWYA 1QFEA 2HS8A 5I3JA 1LT8A 3DBPA 1XLLA 2XHYA 2YFOA 5JBDA 1F2JA 1Q65A 1K8XA 2UY4A 4J3TA 1VPYA 3MUIA 3IJIA 4PODA 1YPIA 3UFYA 1SZFA 3PP7A 4WEVX 4ICMA 5G2IA 2VWTA 3PSVA 4F0HA 1UWUA 1EJXC 1OG6A 3CH0A 4O8AA 5CZSA 1N82A 4LB3A 4CNPA 3LA4A 1L6FA 1TVNA 1J9YA 3LV6A 4CCDA 3KBNA 1DBTA 2WC3A 5I3GA 5CC6A 1FCBA 3WY1A 1O7AA 4HPNA 3DOPA 2D0FA 3DEQA 2QJHA 1XC6A 4Q3MA 4OOUA 3WQVA 4GY7A 4JTRA 3F4VA 2E9BA 2WCAA 2NXHA 4ZFMA 1UKOA 4F8XA 1KFCA 2Z7GA 1KRCC 1VYPX 4W86A 2RDUA 1R9ZA 3GFXA 1N2VA 2DJLA 3MO4A 2JF7A 5TAOA 1TWIA 4DBWA 1A5SA 4DYJA 1XSKA 3BG3A 2EPOA 6TAAA 2GQ3A 5DX7A 4CD6A 4JY8A 3B8SA 1W9VA 4GQQA 3EOSA 3FS2A 2A6NA 3KS5A 1YIXA 2OEMA 1KGWA 3M0ZA 4GNJA 1P0EA 1R3QA 1IZCA 2W27A 4EWND 4UQEA 3VI2A 3GK0A 1TQXA 3HU7A 4MWAB 3KXQA 3ZYZA 2PDCA 1BHGA 1IEIA 2OU4A 1FP8A 2DEPA 2PAJA 1UA7A 3VOIA 3A4WA 1HT6A 1UKSA 3S47A 3KL3A 2Z1XA 3UCCA 1E6ZA 3SDOA 3F2BA 3VIJA 3QLDA 4MIMA 1BGGA 1DYSA 1J11A 1GZGA 3M0YA 5E5CA 4GXWA 3KCJA 1AODA 3OLGA 2ZUSA 4RZBA 3WBYA 4EE9A 2VZSA 5E9XA 3RPDA 3RLUA 3UXLA 4H8UA 1FTXA 2V68A 3H7VA 4M1RA 3GZ3A 4QFUA 3F2CA 3UY8A 3WFZA 7REQA 3S2CA 1DKWA 1UR9A 3R25A 5H8PA 1F7BA 2QPSA 4MZ1A 4K2SA 4I9TA 2AAAA 1P6WA 5BMXA 3UG4A 4G5DA 3S83A 1D3GA 4PL1A 2QCMA 2YYTA 1MW1A 4JY9A 3PUDA 1UUOA 2J8FA 1H5VA 4BZYA 2PWGA 3HZ3A 4H1ZA 3MUY1 4WXYA 2YL6A 3I7RA 5F4WA 3BWWA 3V1PA 1FWRA 1OADA 1X6LA 4DUXA 1SMDA 5I07A 3WLLA 4LAMA 5A6KA 1E3XA 2NT0A 3LTPA 4W9TA 3WLPA 1AD4A 3NO3A 2ACSA 4HMEA 3QHNA 1TREA 3WBWA 1A0DA 3HO8A 3L4ZA 4AZCA 3LBOA 4W88A 1JDEA 3BCDA 1X39A 4HN8A 2PFHA 3VGDA 1JDCA 3N13A 3QSTA 4C6QA 5KITA 2DZSA 4PYSA 3DYPA 4P8WA 4LJ3A 3S2NA 1EEPA 1GCYA 1GVEA 2XVLA 4NZFA 2JIEA 2QQ6A 4A8NA 2QF7A 3D47A 4WSKA 3VKKA 1JPHA 4HA0A 1UP0A 4AWTA 2B7PA 3TN3A 3ZT7A 1V3HA 4NP7A 1BWKA 2E4TA 2RH9A 1REQB 2CW6A 3WO8A 3S5SA 3W75A 5A3HA 2C91A 3UD6A 1YW1A 5ABTA 3LCFA 4HK6A 3IUHA 1OK6A 3OIHA 3SADA 3NQFA 3OBKA 1VFUA 1KFBA 4NAEB 1YNYA 1SW0A 4NI3A 4PMJA 1S2WA 3UWEA 1NTHA 7CGTA 2V2HA 4OBRA 3W2MA 2CLLA 3AIQA 4LVGA 1WX0A 2JBMA 1ZALA 4PMQA 3VCNA 1H7XA 1T96A 1BAGA 4TMCA 1B9BA 2YPIA 3K8MA 2PGFA 4GIYA 5FAGA 4PSRA 4WGHA 3CPUA 3AIRA 4TVCA 3LLDA 3STFA 3AXKA 1KCLA 1L9WA 4K38A 2WHKA 4B4FA 1U5HA 2V0TA 3L66A 4M6UA 4XAYA 2QPUA 4PGLA 3VE7A 1MW3A 3OZOA 2QVHA 4FOUA 3FN9A 3K1GA 1CI1A 3KEHA 3QHOA 4BR1A 2WWCA 1B5TA 4RW3A 3LG3A 4PRTA 4MKSA 3CK5A 3NNTA 3HPFA 1WKYA 5D33A 1VCGA 1NP0A 1YNQA 1LL4A 3E9AA 1Q5MA 3WDIA 1DWHM 2J62A 4LAOA 3TFCA 1WBJA 1QVBA 2FMOA 1QI2A 3AXIA 3T4WA 1K8CA 2Q3RA 4F0MA 3N3MA 3REQA 1Q6QA 4OJYA 3MV01 3T55A 3S5OA 4TMBA 1CBGA 2IKHA 3DHPA 2OSXA 1M04A 3RILA 4IGNA 1EP3A 4ADSA 2WZTA 4Z08A 3TQ0A 1GKQA 4PUMA 3H6OA 3LI0A 3GXMA 3AZSA 1HO4A 4UTIA 4P8VA 2HPMA 2CLPA 4V15A 3W7RA 4DX3A 3W7IA 1F3XA 1IXQA 2PBGA 1ONEA 2XN2A 2X2YA 3MSRA 3LXAA 3D5HA 3CPGA 1SSDA 3AYRA 3CPRA 5CPLA 1UG6A 1PZ2A 4NJIA 3ZJ8A 1JUKA 1LRTA 3STGA 1KQZA 1EXBA 4LNYA 1F9CA 3MKCA 1TELA 2E1WA 4JIPA 1X38A 2WMIB 3DFQA 4DJDC 4NT0A 2XSXA 4DZHA 3IK2A 4H8HA 3B0PA 5M5DA 2PDIA 4ES4A 1F05A 3OJGA 1HKJA 5XIAA 6TIMA 3LUTA 4KFNA 6REQA 3MMDA 4S3AA 1YKWA 2YOCA 2HMCA 2QJMA 3ZLFA 5C55A 1XLKA 3C52A 1M5WA 1R3RA 2HK1A 3DERA 4XZ9A 3L4WA 2FZ9A 2DUAA 3ALGA 1GVSA 1V51A 5CJMA 1KM2A 4I7UA 1I45A 4PR4A 3WQ8A 3ARTA 1GEQA 4Q7NA 4O1BA 1O12A 3P7YA 4UOQA 2UY2A 3WH5A 3GM8A 2C1IA 4QG8A 1AW1A 1PE1A 3IAQA 3M7SA 1TZ7A 3ARUA 3OVRA 2AMXA 2VCCA 1NOFA 2CU0A 2I5QA 2DVXA 1XINA 4DLMA 5BRPA 5I3DA 3UWVA 4AZBA 3NQ7A 1TV3A 2PZ0A 2OO0A 3IACA 2PZNA 1JPDX 3L2MA 3DI0A 1V0LA 5BW6A 4MF4A 5HNUA 3TN4A 1AQMA 3T07A 3ZJ7A 1HFBA 3QGAC 1XF0A 3BG9A 4D8ZA 4HA4A 4GCAA 5REQB 1FFQA 3KM8A 4GNVA 1WZAA 4K8EA 1QU4A 3MQTA 5FSDC 2V5KA 4DJFA 2XYLA 1EJWC 3SCQA 2GJRA 3BOLA 1O1HA 1KRAC 3SJNA 3W25A 1GTHA 1UMYA 3FIGA 3CWOX 3VZZA 1E9YB 2V5BA 1MUWA 3O6AA 3C5QA 1EQCA 5I23A 1LBLA 3G6MA 1POJA 1J12A 5KINA 3KOXA 4JX5A 3B0UX 1LQ2A 4GJ1A 3A5FA 1IGWA 5CGMA 3MC5A 3MCMA 2QHAA 2X1IA 4KQNA 1HKVA 3OQ8A 4M51A 4DM2A 4ALDA 1UWSA 1AW2A 3R89A 1W37A 2G5WA 2YFNA 1XLFA 1G4SA 3RDKA 1UC5A 4GIEA 3W73A 1EOMA 2OZ3A 3R4IA 1FWTA 3CAWA 4YTQA 3RK8A 3EX3A 5GQBA 3G1DA 3S5ZA 1TE1A 1SFTA 3GG1A 4AVOA 1S2VA 4O19A 4HD5A 4L9YA 4Z0JA 3ECQA 4O4WA 3A4JA 4C5ZA 1P5BA 2WSRA 1NF7A 3SY8A 1OINA 3TQVA 5BMWA 4IPNB 1ODZA 3EWUA 4ZEPA 1WAUA 4MZYA 3VC6A 1EHAA 3BMVA 3KOWA 3THUA 3CZJA 3GTHA 4BWLA 3VIHA 3R10A 4RE2A 1W1IE 1J2WA 3WELA 4XX6A 1ISWA 2VL4A 4O18A 2J9YA 4EPDC 5B7ZA 4IOTA 3ZJKA 5CC5A 3WF3A 2CLKA 5DO8A 2ESCA 3GDTA 3AC0A 3RN6A 3W7PA 4HNUA 1K9EA 2WCGA 4NYYA 2NX9A 3KTXA 4O1DA 4Q4OA 4E3VA 2PPGA 1BYAA 2Y7GA 1XIJA 1GYNA 3E38A 5FJPA 2PE4A 3KVMA 4KWUA 3EEZA 3LCLA 3WMLA 4H4IA 1J18A 1NM9A 5FCZA 1D3CA 1LP6A 2WMGA 2OYLA 2ISWA 3W1QA 4GKLA 4B90A 1E56A 4CQ8A 1R30A 4B2DA 1OVDA 3TOYA 6ENLA 3PZTA 1LDCA 3TQPA 1DIEA 3NQCA 1BQGA 3SIZA 3TJ4A 3HV8A 4HK5A 1XS2A 4HNOA 2O7QA 5E0CA 3FHAA 3VNYA 4GQBA 3HM7A 2VZOA 2XDFA 4GINA 3WDPP 1O68A 2NX3A 4PBEA 2O9TA 1SJBA 1F5ZA 3KAOA 3R58A 4YPJA 4OV4A 2OGYA 5HMEA 3KZPA 3ITOA 5CJ5A 4JFUA 2Q8XA 3IJLA 2Y1HA 1UJPA 1UB3A 4O14A 4GG9A 5FEWA 4HVXA 3MCNA 3PVFA 3NQVA 4W5UA 1TX2A 1RCQA 4NKCA 5E6ZA 2XZ7A 2ZRXA 1A5OC 3RPTA 1G69A 4WX2A 2FFIA 5EY5A 3LV5A 5M03A 3ELFA 2Y5JA 3ANYA 3QY7A 3P6LA 4C6KA 2GGHA 1TTQA 2BWGA 5ABGA 4DHGA 2YCEA 3EOOA 4G7EA 2PLKA 1KM6A 1TWDA 3SURA 3VILA 3B0VC 1JCYA 1NOUA 3O0KA 2ISVA 1C8QA 4AFYA 3OB8A 1JFXA 3BW4A 2A1YA 4AC7C 4L6OA 2BY2A 4TTGA 2IKJA 3GLCA 3I7QA 3SCRA 2ZOXA 2J6VA 3UWYA 3LX9A 2ZX5A 4HPHA 1EUNA 2HCVA 1VBJA 2PD5A 4PTVA 5CAHA 2J13A 4QGCA 3PJUA 5JIPA 3VINA 5A94A 3CO8A 3TN6A 3QW3A 1WZKA 1V03A 2GZXA 4KIEA 2JE8A 5J5RA 1TJ0A 2V38A 2PEVA 5FF7A 4X9YA 4LW7A 3ZS4A 4AIUA 3DFHA 1EX1A 4O4VA 1C9DA 1K7EA 3E3HA 1VYRA 1AH4A 4Q8MA 1K02A 5E1QA 1RQEA 1K77A 2V30A 5DT7A 3NQMA 3P0XA 2XH2A 2QIIA 5BU9A 3TTYA 3WMCA 1A3WA 1R46A 3CZ8A 3SW6A 4Y7EA 1R2SA 2WSQA 3HQNA 4MG4A 1W5NA 1PKNA 1HL8A 4F2UA 2ABBA 1ZY9A 4O16A 1T8XA 4AD1A 2GJXA 5D09A 2HK0A 2QDGA 4CNSA 3ARQA 2WMIA 4Z2KA 4IL0A 4FP1A 1FFRA 4Z1YA 2YXGA 4AY8A 4UFMA 2GUYA 2WJEA 2XIMA 2I5GA 2J7HA 3AXXA 1RCXB 3O6YX 3GFZA 4JHZA 2WO5A 4H9ZA 2QZRA 3WD2A 3E96A 3L4XA 3H21A 1OC7A 3TYZA 3NL6A 4EP8C 2Z2BA 2X30A 5AOUA 1FCUA 4CU6A 3W72A 2E5CA 2H8XA 1KFJA 1PJ9A 2PU0A 2VC7A 4XWUA 1B2YA 3LYEA 5KEZA 4HZMA 4LV9A 2DVTA 2DU2A 2X05A 4BS0A 4AUBA 4S1FA 3BUVA 5G1MA 4FIRA 2G3IA 3W7OA 2DZXA 3V0UA 4GZIA 1UR8A 2NQLA 1TUXA 4FEZA 2PDBA 1LLWA 3B8TA 1Q6EA 1JZ3A 4UTMA 4UTJA 3ZQ9A 1GWJA 1V3JA 2IQTA 3PUEA 3EPOA 4AZGA 2OZ8A 3EX4A 2QMJA 4TV5A 3WF2A 3V0TA 2GSEA 3EB3A 4EX4A 2YX0A 5CSSA 5A6JA 1U83A 2GL5A 5D30A 3EA2A 1F76A 1Z9AA 1FH9A 1FY6A 3GRIA 3M6YA 4H9TA 3PPGA 1B3VA 2W5FA 4U2ZA 4B15A 3TX9A 3VNDA 4AY7A 1B4EA 5DELA 1P6CA 3SRFA 3GVGA 4K8HA 5IFPA 1AZ1A 1V6WA 3FAWA 2DH2A 2ZZ2A 1XV8A 2OKOA 1WZMA 4XO7A 2PDFA 3LQGA 2HE5A 3TTEA 3FVDA 2XVKA 1Q6DA 2HBVA 2V5LA 2HRWA 3WL0A 2R24A 1Q7QA 1G01A 2GJPA 4GYPC 4BEQA 2MNRA 1FOBA 5G4HC 3GDKA 2DT2A 4OTKA 2Q09A 4KWOA 1W1YA 3NSNA 3AMCA 3B8UA 1DQWA 1MI3A 5EFFA 5U4NA 1TSIA 2Y63A 3B9AA 3WQFA 3OW1A 4G56A 2BXZA 1MO0A 1I6NA 1JF6A 3MA8A 5AHEA 3RIKA 1RY0A 1EPXA 4HMNA 1EC8A 2P8CA 3LMZA 3LGDA 3P62A 2Y88A 1X6UA 4QROA 3QC3A 3RM8A 1A5AA 4FHAA 1D8WA 2Z29A 2DY3A 2QCHA 3LHYA 3NFUA 1SR9A 3WUGA 1YADA 1PHWA 1V3LA 3VDGA 4W8BA 2A6LA 3WH7A 3TNOA 3DHDA 1KM0A 2WLZA 4HPGA 5LXXA 1UZ1A 4GCXA 2J88A 5T9CE 4ZBCA 3VNJA 1BG9A 4DYKA 4GZ7A 4IJBA 3WQ4A 5AYBA 3GKFA 2JEQA 5IHRA 1H7RA 3G1HA 3ZFHA 4PE8A 1YRRA 4XBKA 3LM7A 9CGTA 2J7CA 3H4WA 5IDIA 2GJLA 4Q22A 1J0HA 1A0CA 5AC5A 3GTIA 1Q7MA 2HQAA 5D2VA 1S5VA 4JPGA 4WHBA 1BLIA 5F2IA 1GJPA 3NR0A 4DWSC 4LCRA 1J5TA 4A8LA 3W01A 1IT0A 1LOQA 4HMCA 2OPJA 3N1AA 2Z24A 4FNTA 1NDYA 3T0BA 3TNBA 1ZP4A 1JYVA 3PN8A 4CQBA 4OBSA 4HCLA 4XUYA 3A24A 1HJXA 3O7UA 3NAVA 4DN1A 4Q8WA 1T7LA 5TQLA 4NAEA 4RX0A 1ZGDA 2XFYA 2BGSA 4ZE5A 4B5UA 2V5DA 1TPVA 4R7WA 1G5AA 3MJYA 3R8RA 2F8QA 3TMQA 4M7SA 3FJ6A 2OCZA 2BTMA 4CD5A 3ITYA 2FGBA 3PTMA 4BWLC 1XPYA 3G77A 1SO6A 4W84A 1VAHA 2R91A 3LPOA 4YTUA 1E1CA 3ICJA 3HBLA 5GJNA 1JDDA 5KMYA 2VEKA 5T26A 1TTPA 2WYSA 2ZUVA 3ANVA 1XM3A 1Q85A 4DNMA 2VGBA 5BXPA 1PO9A 4QM1A 2WJFA 4V2XA 3ZLHA 2X41A 3EOLA 1H49A 4A3UA 4D6JA 1GOOA 4UXDA 2W6RA 2E67A 4M3PA 1UQZA 1KV8A 3UW6A 4I5UA 1P1XA 3LBCA 3CTLA 4PB5A 3BV7A 1OFDA 3L4TA 5EB8A 1VENA 2POZA 3BLKA 5JH2A 3VKBA 1UD4A 3C0JA 4N9DA 1WP6A 4QNWA 5BXTA 4GBDA 1RVKA 3UR7A 2EG8A 5K2ZA 3G5EA 1GQNA 2YW4A 4LAKA 1W3KA 4ZVJA 3CXOA 1UWTA 4TQTA 3GDRA 1K4GA 3EWDA 1JZ4A 4L64A 1EC9A 1NQKA 3VGBA 2JQXA 4DYEA 1KKOA 4E4PA 3DENA 2QT3A 2L5HA 3OVQA 2EEXA 1JCNA 3SQLA 4DF2A 4URIA 2ZX9A 1UIOA 3AIWA 4IP7A 4JHOA 2HNEA 3PANA 5AVNA 4XBSA 5G1YA 1JZ8A 4PSPA 1R3TA 4RW5A 3WUBA 4MNMA 1TJ2A 1M03A 1K6AA 4LAZA 3C3UA 1Q45A 5BCAA 4XKMA 2G0WA 1Q4WA 3JU2A 4XSMA 4ERIA 3W1LA 3NQ6A 1NWTA 2W9MA 3EWWA 3P8IA 2BGQA 2NLIA 1J2BA 3KBWA 3EOUA 4ZTYA 3E2VA 1T8QA 3WL1A 5D8ZA 1BKHA 4RXFA 2NSXA 5C2CA 2AQWA 3IIVA 4LVFA 2C7FA 1YXCA 4AYGA 4WJXA 1QPOA 1RJQA 2F2HA 4HU0A 4PEKA 5AC8A 4GGBA 2ZA2A 4S3BA 3O0FA 1EDGA 4R27A 4ZR8A 1O5RA 4A35A 5LNUA 1LUCA 4XD6A 3DZ1A 4KRTA 1X7IA 1ZQ5A 1L6SA 1RUSA 1IEWA 3L0GA 2PP0A 5A5WA 2VDHA 5A2BA 1IIGA 5DXYA 4ZZ9A 1FWEC 2FZBA 2IMRA 1AD1A 4PMNA 4EAYA 4MUZA 2EAWA 2IKGA 3LCXA 6PTDA 3F5KA 3V36A 3RLHA 2PDYA 5HUOA 3IWPA 3AJXA 1FCQA 2GK1B 4V1YA 1MRQA 2C15A 4MJ4A 3S2MA 2CZEA 3P14A 1C8YA 3TMLA 5C7VA 2ISFA 1UPMB 2X1UA 6REQB 3H2CA 4PMDA 3S42A 5D9PA 3KZSA 1R5YA 3U5YA 3CS2A 3W7HA 3OIXA 1YDNA 1QUMA 3SZ8A 3P61A 2P8BA 4DZIA 1KCXA 4GYPA 4IGSA 2A21A 3ZLGA 3H26A 3TLLA 3M9YA 5I00A 1QT1A 4JCLA 4F79A 1OC5A 3GNRA 2VFIA 4JNZA 1AA1B 2PWHA 2BP1A 2WHMA 1OF8A 1XIHA 5CG0A 2BMBA 1DQUA 3MDWA 4W87A 2Z7KA 4KESA 3D46A 1PWLA 3GIPA 4P8UA 5CSYA 3MSDA 4FSAA 3MZ2A 1BRLA 3HGOA 2I14A 3MB9A 4L80A 4F3HA 1UH2A 1UOKA 4J2MA 1HKWA 4FR6A 2CIPA 3TDFA 1H7OA 1R2RA 1EP1A 3B03A 1DVJA 2B31A 3KW3A 1EZ2A 5HQLA 3R13A 2J25A 3CGTA 1OFBA 1VJZA 2C13A 4HB7A 4AEOA 4LEFA 3FGCA 3H22A 3VCRA 2WMFA 3O06A 3KX6A 5TBOA 3QTGA 1WOAA 3RR1A 4F2TA 2EHHA 2RJHA 1JRCA 2PURA 4HNNA 5FJIA 3BURA 4W8AA 5EBUA 1IF2A 1FKWA 3S2JA 3WLSA 3W28A 4PMXA 3CL7A 4AZIA 2CHNA 1MEHA 1WYIA 1HGYA 3LXCA 2IXUA 2PLCA 4FB7A 4UTLA 3PBYA 5C5YA 3B9NA 1YX1A 2D3NA 4GFSA 4DQWA 4JBRA 2EPHA 4L5ZA 2Q8LA 3WK3A 2E6DA 1MDRA 4KCVA 1LCOA 3ZT5A 1FWAC 1R3WA 3SCOA 1IIHA 3PZGA 1T40A 4KCUA 3GXFA 3OPSA 2DSVA 2VZTA 1ZNNA 4IQDA 3W29A 2JK2A 3WEOA 3GU9A 2CBVA 3KWXA 4GHRA 3TQKA 1EJVC 4IT1A 4GVHA 1Q66A 1CGXA 1KFWA 3HJZA 3DFNA 5F7UA 4WD0A 2GGJA 2W4XA 1HQTA 3TFXA 4G7FA 2ZTKA 4H00A 3TSDA 1ZJBA 3QPZA 5AHLA 3BLDA 3ITCA 1Q3NA 5H8UA 2WXDM 1A4LA 1ICSA 4FNUA 3UWQA 1O95A 3GIYA 3ARVA 2HXTA 3OBEA 1Q4NX 3CV7A 4X60A 5C54A 1JDAA 1S1RA 3PUGA 1NAL1 1FWHC 3PBGA 4CQ9A 3MI6A 2D20A 4JX6A 4NZ1A 2NVCA 4NL1A 3RMEA 4MJZA 2OWWA 5GNXA 4GQGA 1UIPA 1LG2A 4GI8A 3NVDA 1NDWA 3VNLA 3C61A 5GJMA 1XJBA 4QCFA 4DZAA 3IUDA 3C0QA 5DRIA 3UXKA 3B3DA 3VAVA 4AZCB 3WQGA 2IW0A 2QIWA 1BXCA 5GNZA 1EHNA 4P7QA 3FSTA 3KLKA 3WBAA 4DZ5A 2F6KA 2YCKX 4UFHA 3UR8A 5ECVA 2VEPA 3WK0A 4Z2GA 3W7NA 3WQOA 4Z1AA 3AJ7A 2Y4SA 2QUVA 4IPJA 3VNKA 4R85A 3MT1A 4QE4A 3W86A 3W0KA 5HJLA 1GOIA 3IANA 2W62A 3LSBA 4RV8A 2XIBA 4PMRA 2WMKA 3TLQA 3UR5A 1Z3NA 1TV7A 1PBGA 4NJHA 1A5BA 3P8JA 1JNEA 4ZSTA 1JXKA 3CV1A 4L9ZA 1E73M 2DW7A 2HPIA 3U7BA 4DBDA 1CECA 1XUUA 5DCDA 1QW8A 1H5YA 1XIGA 2GVYA 1W56A 1Q6OA 4PRRA 5K7JA 3K4WA 4H01A 3URAA 1NDZA 4PUNA 4WDUA 2E9LA 3T2QA 1DEDA 4JYDA 4AD2A 5KSWA 3A9BA 4WJEA 2DP3A 1XYZA 4TOQA 1V7AA 2D3LA 4P5UA 4RDYA 3LNPA 1OABA 5CXPA 1ZZMA 3K2GA 5I3FA 1WE5A 1SSGA 3BLIA 1LM1A 5I03A 3CTTA 2CEQA 2X09A 4JICA 1QPQA 1EIXA 4B5SA 3UCQA 4K7YA 1O66A 4N4PA 4RV3A 3OGSA 2PI6A 4IX0A 2VRQA 2BOGX 2PP1A 2XINA 3FAXA 1I1WA 2NVDA 3E2SA 5A1AA 3AROA 2POTA 4B5XA 3CLWA 2OLSA 1QDSA 3TYEA 3URNA 4UTHA 1X1NA 3NL5A 1JQXA 1R8LA 2X1TA 3BAIA 3RF9A 2OYMA 2WV8A 5HJXA 3USBA 4MNJA 1XRTA 3KRSA 4YVPA 4AY1A 2J75A 1V0NA 2BSLA 4NI8A 5BRQA 9XIMA 3WJXA 3KFTA 3WKZA 4OV9A 3IARA 3HPAA 4MYAA 3I6RA 3O6DA 4Y8FA 1LOSA 1S2TA 3VKDA 1BYDA 4EPEC 5DEZA 2DSZA 1DJZA 5BOEA 4IGHA 3LCIA 1GQLA 3T0AA 3U2CA 3OTRA 2CLEA 2QW5A 3OLEA 1DIOA 2A79A 1E1EA 4UZUA 3DYMA 3GC4A 5CZTA 3OEXA 4HSNA 1DWIM 4QQ3A 1XYAA 4L4LA 1ITUA 1A3HA 2Y8UA 1EF3A 1EGZA 5CQ1A 1W31A 3W1AA 5C7HA 4YWIA 3W70A 1J6OA 4OQVA 4I6VA 1PXGA 4FX7A 3UERA 5CBBA 2C14A 2ZADA 4IFOA 3T8LA 4QX4A 4BQ3A 5FJTA 4AAJA 4UTTC 3IGXA 4J2PA 1A53A 3TE9A 3L0KA 3W2NA 3GG7A 3WLTA 3OU8A 1OF6A 3WFAA 4LUYA 3AUJA 3KS6A 3B0XA 4PTWA 3G1VA 4EIVA 2NUXA 3TSBA 2JKAA 3CWHA 4DWDA 3MUZ1 5CBIA 5AY7A 3TW9A 3NQAA 5E0FA 3NOYA 5E93A 4A8RA 2OSYA 4YVXA 5BXRA 1QNPA 3DGBA 2FZ8A 3LLFA 4MWAA 1C8XA 3R0DA 3LPPA 1JPKA 3GBDA 1Q8AA 3NPUA 1TVPA 2NQ9A 3CV6A 1VIWA 3L12A 3S9ZA 1KQYA 4DXXA 1E70M 1XDLA 4FAMA 3TYUA 4DO4A 3LTYA 1SR0A 3WJWA 4JKKA 2EJAA 3UPMA 1KCKA 4IMCA 4GQRA 4F40A 3U6WA 2XJ7A 2PDNA 1CGUA 1DTNA 3AI0A 4XD4A 4NNCA 2J9ZA 2FGLA 2ZYFA 2WSPA 4HT3A 1WB0A 2VR2A 4MM1A 1ITXA 3W7GA 2G3JA 2I56A 4FLOA 2VD9A 1W5PA 4KGJA 3POCA 1O94A 1WKFA 3FEMA 1V02A 3N4EA 4BF5A 4LBRA 1TRIA 4BI7A 4HA3A 4K37A 3BE7A 1TV5A 3BSMA 4I90A 2WHLA 3LHWA 3EGJA 3N6JA 2F7FA 4PEEA 3C86A 4DNHA 4GACA 2Y5EA 3SQSA 2FTPA 1GHSA 3UEQA 2WOQA 2GDQA 2QCCA 3S1UA 1M7PA 4W7WA 3LRKA 2PRLA 1QI0A 5IXEA 4S3EA 1S5WA 1NELA 4B9ZA 1OX5A 2JEPA 3DDMA 5IHSA 3GVWA 3VIOA 1V6VA 1F07A 1EJRC 3B0YA 3QBUA 3WDQA 1ML1A 3W6LA 1I4NA 3M5XA 1V4YA 3N11A 4QNEA 3KTCA 1A49A 3MW7A 3S9YA 4GLEA 2V8ZA 4LNCA 1FHUA 4P7NA 3ZR5A 3G22A 3UG8A 3TXVA 1P0KA 2DZPA 3W87A 3TAOA 3JR2A 4RKAA 4ICNA 4GWEA 1TPEA 1H62A 3PZQA 1KXVA 1OD8A 4AIBA 1O4UA 1RA5A 5HMFA 1WDPA 5DMNA 4ZCWA 1A5NC 4PBGA 3T81A 4NASA 4LXFA 1MZRA 3PJWA 1K1DA 2PTZA 3ONBA 4I9MA 4NUWA 4GK8A 1OCQA 2QLYA 3AMDA 2ZRVA 5DMLA 1BGAA 1KGUA 4ZA0A 3PHAA 4DUVA 1ZCOA 1P48A 3VD7A 4RJEA 4OT7A 4LUSA 5A8PA 4V1XA 3I3BA 2FPTA 1PDYA 4FLRA 1OC6A 1CLKA 2HDJA 4FPSA 3ATZA 4AZ7A 3M43A 2XM2A 1K3UA 1C91A 2Z2AA 4C90A 2IKIA 3M0MA 3RX2A 4DJDA 4HBKA 1ESWA 1I2NA 1EWEA 1VBRA 4NXSA 1BF6A 1QMLA 4CNOA 5AN7A 2UZ9A 4O12A 4JGDA 4ZQOA 1OM0A 3VIMA 5TD4A 1R3YA 4Z1BA 3UWUA 3VO0A 1ISYA 2FHBA 4XAFA 4R3UA 5HQMA 5LYRA 3E1F1 3NPWA 3TN5A 3QHMA 5FIPA 4HZ7A 4OFCA 4M7TA 5LSMA 3SN0A 2DV0A 2X8RA 1E4IA 2YW3A 3G1RA 1V3MA 1H41A 2ACRA 4O0ZA 1S5NA 4DJDD 2PLMA 5H8MA 4JTGA 3S1WA 1XGZA 4GI6A 3FOKA 1W17A 4ATLA 1ZJAA 2G8ZA 1SM9A 1UBPC 4YL2A 3UPBA 1YPFA 3WLQA 4RZ5A 3M64A 1AJ0A 2EXOA 2NX1A 3NQEA 5BYWA 2G97A 5C6MA 1N55A 3KWSA 3BDKA 3GNDA 3UJRA 1H50A 2ZRZA 3QOKA 3S1VA 1JYXA 4AD3A 3CMFA 3LCGA 3UXDA 1XSJA 4Q7BA 4POCA 4DWSA 3IV8A 3R79A 2OX1A 4FF7A 5IDZA 3UZ5A 3VOCA 3S6DA 3NGJA 1DXFA 4EOUA 3BLPX 3QC0A 4GE8A 3BW3A 1F4AA 3K13A 1DXEA 4LYRA 3WCZA 4QISA 1RSCA 2PLJA 1Y5WA 1K8YA 2R6OA 2P5NA 1EYEA 2XWEA 1SUXA 5BOOA 1TPC1 1HN1A 2F61A 4US5A 1H2JA 1QTWA 2YB4A 3CWNA 1UKPA 3GHTA 2TAAA 5HOSA 2OT1A 1VJIA 1XD1A 1X96A 3CUXA 3FDKA 4JDYA 5A2AA 5GVJA 3W2JA 3W37A 1JL8A 2H9AA 3F4CA 1Q6FA 4IHCA 1PSCA 5E70A 3REQB 4M6QA 1O5QA 3VFCA 4AMCA 3BGAA 3ZOAA 1OT2A 1XLEA 2YIHA 1R2TA 1GVFA 3T0DA 4H9VA 1YDOA 3TEVA 3DCPA 4HOXA 2ZRUA 5H91A 4IMEA 3W02A 3T0CA 1W3TA 3WF1A 4IMGA 2XM1A 5JVLA 1ZAHA 1O5KA 3DFYA 4DF1A 3P5YA 4NZJA 4DBUA 3A4XA 1LJYA 2QCDB 2YCIX 2ZZ3A 3UVIA 1EPVA 2Y89A 4Q7IA 3SY5A 4RUBA 3U4AA 3CHDA 3KP0A 1W91A 3E0VA 3B4UA 1MQQA 4PB3A 2ATMA 4GH1A 5H1WA 2PTDA 3SIMA 3SR7A 1ZJHA 4L7ZA 1XUZA 4ZOCA 4JD4A 2WM1A 3N2XA 4ZO8A 2ZRWA 4M19A 5REQA 1OQFA 1GNXA 4XZBA 1TR1A 3R5EA 2V5JA 1NY1A 4I8DA 3QLLA 3KCOA 4E2DA 2J4GA 4NY2A 3OQEA 1XCFA 2DZUA 3LTSA 3AO0A 2OEJA 3ARXA 3HMJG 3C4UA 1UD5A 4LUIA 3CEPA 4RZ4A 2G4JA 1DJIA 3E12A 3L4UA 3QM3A 4YYCA 2C0HA 2NV2A 3PSWA 2JALA 2OZ0A 1PV8A 1RLCL 1ZCCA 3OA3A 1W8GA 4LB4A 3BCJA 1SZGA 3TC6A 2CZ5A 4ZSUA 2EPKX 3NZ1A 2C19A 3NYZA 4HU8A 3PF3A 3WJYA 3CZKA 4MFEA 4KRZA 2FB3A 5F4XA 3VA8A 1QBBA 3IJQA 4TUFA 4UFJA 5M17A 5EMYA 1F3TA 4RNFA 5L6UA 1S1PA 3CIVA 1OFPA 3TWAA 3NYDA 4MY9A 1TJPA 3NCOA 2X7VA 4OOZA 4KW2A 1Z6KA 1XR2A 1VHCA 2FVLA 1IZJA 5D05A 3KOFA 1OIMA 5A69A 2RJGA 4LANA 3N25A 3V1HA 1TV4A 1UD2A 3LRMA 1EJ7L 1JIBA 3VABA 2D2OA 3AZRA 5JQ9A 3L5LA 4A6GA 1VC4A 1EB3A 2A3CA 2ZIDA 3CBWA 1LWIA 3M41A 3GH7A 1UR1A 1HP4A 2YZ5A 4QEHA 4XAZA 1XBYA 1DJXA 2Q02A 4MB1A 3W7EA 2QCFA 5HK4A 2G3FA 4JTAA 3RRAA 3PZOA 1C92A 3UJFA 3WQCA 4MKVA 4XTIA 4JL2A 5FD0A 1KR0A 4HIBA 1AQHA 4MDOA 3SB0A 3PZNA 4AF0A 1H51A 2IUZA 1H11A 2OXNA 4H7ZA 2WC7A 1AVAA 4H8NA 4PMOA 5FOOA 4ERGA 3G0XA 1MFUA 1K8ZA 2GPTA 3CT7A 2XSAA 1LROA 2YGYA 3U0HA 3ENLA 1DJWA 4MVAA 5FL1A 4KH2A 2NQZA 3EXTA 4PCFA 4QSHA 3LERA 3QGKC 1XL9A 1XRVA 3EA3A 2XIQA 3ABRA 1JCXA 3BQ5A 3U4FA 5K3VA 3UESA 3IRSA 3SI9A 4WJ8A 4JL1A 4KRUA 3MSGA 4AWUA 3R12A 1HUVA 4OUEA 1XLBA 2V5CA 1E51A 4C6MA 4Y8EA 1O5XA 3IVUA 3NG3A 4CVWA 5AFDA 1NQ6A 5A8OA 1W2VA 4JN8A 5I5RA 3AHXA 1GVIA 2H9AB 3DU0A 1FXQA 3GHRA 4YXGA 3N3TA 1X7FA 1XYMA 2OB3A 5HMDA 4OECA 4DXVA 2F2KA 1PZ0A 1EYWA 1UASA 4GC4A 1K7XA 2XGZA 5I2UA 4QDWA 2XZ9A 1GORA 3ALFA 3NUKA 5LIXX 3SJ3A 9XIAA 4WIWA 4IG2A 1LZOA 3CT2A 1MSSA 1QOXA 1MEWA 1MNSA 5A6AA 1X1ZA 3L2LA 4QS5A 3ONCA 1RCOB 2QCNA 3W3OA 1E4MM 5G5IA 1UR3M 1TZZA 1VPXA 4PL2A 1LLZA 1KLZA 1FP9A 1QO2A 3I3EA 3W6MA 3VX1A 1UZ4A 3RPMA 2NSOA 3N18A 2E28A 4JQ1A 3TJXA 1WXYA 3UXIA 1W5OA 1W3HA 2WVSA 1IXOA 1QWKA 3M5ZA 1XYCA 3TWBA 2OSWA 4H7CA 4IMFA 3QR3A 1AJZA 3FV9A 5CPNA 1IEXA 2RDXA 2NV1A 3S9IA 4EAMA 2GSJA 1KCZA 2VVSA 5I3KA 1MXDA 1OBAA 2BHZA 3CO4A 2J8GA 1AQFA 3QQ0A 4Q8VA 4QJ4B 2VOMA 1FKXA 1I2PA 3B97A 3GHUA 1LT7A 1QW9A 2QYGA 3T7VA 4HZ8A 3NA8A 3BL3A 2G96A 2BS9A 1EDQA 4M24A 2BGNE 1WAWA 2PGEA 4QQUA 1MRAA 4JEQA 4FXJA 2EKCA 4A3HA 4ONVA 2OX4A 5G1TA 4Q4MA 4Z0SA 3WQ6A 3OGVA 1E55A 2XWDA 1LTDA 2OWXA 3AAMA 3D3FA 2KAUC 4D6HA 2GQ8A 2QGYA 1REQA 1I1XA 5I77A 3H54A 5HWNA 3PPCA 1VF8A 4PMUA 2J9XA 1EP2A 1OY0A 4MJ2A 3D3AA 1FQ0A 1DJYA 3TJIA 4A2RA 1EIBA 1PUDA 1HIZA 1YYAA 4MJMA 4NZ4A 4B91A 4FS9A 5AYIA 4IH3A 2JKPA 5LXEA 8TIMA 1RJPA 2WZEA 3MSYA 4RPQA