3THAA

Tryptophan synthase subunit alpha from campylobacter jejuni.
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
248
structure length
248
Chain Sequence
b'AMVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIADAAKIALDQGVDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVPELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVEEAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKCFKQGNLDIIMKDIEEIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Tryptophan synthase subunit alpha from Campylobacter jejuni.
rcsb
source organism Campylobacter jejuni
molecule tags Lyase
total genus 78
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2011-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3thaA00
2V2HA 4TO8A 1YTKA 2OT0A 2C13A 4Y8FA 4LS1A 3MHFA 4MYAA 2A21A 4QM1A 4UMCA 4H4IA 3W87A 2B7PA 1B3OA 4JTTA 2RFGA 2X16A 2Y70A 2ZZ4A 1DJQA 3OVPA 1XBYA 1FWSA 2E6DA 4PL2A 2Q8LA 2FB3A 1DV7A 3FKKA 3IVUA 2B7OA 4OBTA 4GE8A 3VCRA 5F2GA 3KX6A 4NU7A 4HT3A 3BG9A 1L2UA 2WOQA 2C6QA 2CZFA 1J4EA 4NJKA 3O15A 1SO6A 5KINA 4RR4A 1TPEA 5FF2A 4LS0A 2F84A 1P5BA 5L9FA 1VYRA 4K7VA 1TJPA 3BG3A 3WJSA 4JX6A 5AHMA 3B0VC 1D9EA 1IXOA 4LWWA 4YCOA 5DCDA 3H54A 4K38A 4FNPA 1AK5A 4UFLA 1RV8A 1AG1O 1KM6A 1THFD 2ZDRA 4L4MA 3LLFA 4N02A 1IF2A 1O4UA 4A3UA 3UWUA 3TSMA 4QITA 2G95A 3TC6A 3WK2A 1PIIA 2EGZA 4MY8A 1ADOA 4KFPA 4OHQA 4OT7A 1R2SA 1UASA 3W23A 2HTMA 3TQVA 4N6EA 4O50A 2CW6A 4Y6GA 1SFLA 4K8HA 1UUMA 2QAFA 1TYGA 3L0KA 5FEWA 3INPA 3WK1A 5J5DA 3S9YA 5DXYA 1UJPA 2YGYA 5G2WA 1OFOA 2H90A 4OE7A 2QR6A 1ONRA 3TMQA 4AB4A 4JY8A 5EYWA 5G1TA 4U28A 5DELA 1A50A 3W7PA 1GVRA 1PHQA 4DBDA 3MBDA 5D33A 4O15A 3GXNA 2C18A 1H7OA 4Z0SA 3TROA 2XN1A 3NA8A 5TBOA 2B7QA 3LBMA 1OFQA 4N9CA 1BTMA 1YYAA 3FYPA 4ICNA 3GNDA 4KFOA 3SW6A 2QCEA 5HNRA 3P7YA 3PS7A 4XUGA 1GJPA 3HG3A 1EB3A 1C9DA 2H8XA 5HQEA 1K8ZA 3NQ2A 5AYXA 3VE7A 1KFCA 2A5HA 4N9BA 3O6CA 3RLVA 1VS1A 4YWIA 1JRBA 4MY1A 5HULA 3HGJA 2V2DA 4LVBA 3HG2A 5MHBA 3A22A 4MY9A 5D2WA 5F1UA 4HSNA 5G4EA 4NJHA 1KBJA 1RQBA 2PRHA 1W5QA 3W22A 3ELFA 5F4SA 3LI0A 4ONVA 1XUZA 1X1ZA 2J27A 4E0CA 1EEPA 1LLWA 2RDTA 2YDAA 1SFJA 2YW4A 3W76A 4EF8A 1VC4A 1I2OA 5FF7A 2QF7A 5CPNA 3FLUA 4Z1DA 4DBEA 5LHFA 3P62A 4Q4KA 2DZUA 1KV5A 2WKJA 2NUYA 4DF1A 1TJRA 4G1KA 1H50A 3RNDA 1TRIA 5E93A 1D3HA 4AWTA 3W7CA 3CLMA 4CCDA 3PBUA 3FJ6A 3NL6A 2GOUA 4XBSA 1AW5A 5EL1A 1FDZA 3LLDA 5F2IA 1IXNA 1H7XA 1G7VA 2EPHA 5AOUA 4D2JA 1OFEA 3EX3A 4B5NA 3QRHA 1ME9A 5D02A 3LCWA 2HS8A 4JTLA 4OQVA 3GB6A 3YPIA 2WV8A 2CZEA 1C8VA 1P0NA 1ZALA 3G3MA 2ABAA 1LBFA 2KZHA 4NQ1A 1M6JA 5K9CA 1M7OA 1G4PA 3CHVA 1MZHA 3C2OA 2FB2A 1PL9A 1YADA 4DPQA 4UIOA 2PURA 1W31A 5D2YA 1NEYA 1KM3A 2CLKA 3HPSA 3O06A 2QUUA 4ZQMA 1FWWA 4FO4A 2JKAA 3NPXA 2A1YA 4IQLA 5K4ZA 4IMDA 2VC6A 4AWUA 1KLYA 5K3VA 3F03K 3OIXA 1WV2A 5F4WA 3N2MA 3DFTA 1BWLA 2FIQA 2BZNA 4MPQA 4NT0A 1RVGA 1X6UA 5I3GA 3UWQA 3S1UA 2NV1A 3W2UA 3V75A 5AC8A 3W71A 2QKFA 2AQWA 1G6CA 2QCHA 1LCOA 2GQAA 2ZZ7A 3W1QA 1EUNA 3HGSA 2E1DA 1PS9A 2J88A 1VPXA 2GJNA 3KRSA 3IIOA 1DQWA 1TRDA 4POCA 3UNDA 3G8RA 4UMAA 7TIMA 3OVRA 1VGAA 3MP4A 3W70A 1SR9A 2ZTKA 3DH7A 3BK0A 1ZJIA 1ICSA 3NOEA 3DFSA 4UTIA 1VZWA 3BARA 5AYZA 2NWRA 2ZA2A 3P5YA 1TQXA 4FEZA 5IBXA 2ZRXA 3W7QA 5D09A 2C16A 2UV8G 4MZYA 1V7YA 1H7NA 3L9CA 4NX5A 2DZTA 2QCLA 1D3GA 1LOSA 3LRMA 3DXIA 4UTWC 3HG4A 4WZHA 5G2IA 1I2RA 3C8FA 3B04A 4JY9A 1LOQA 4O14A 3VFLA 1NVMA 1JRCA 1XUUA 4JYEA 1F6PA 3O1NA 2A0NA 2ZZ2A 4DELA 2VEPA 2DJLA 3GXPA 4Q32A 2CU0A 1VLWA 1ALDA 3LHYA 4R33A 2O7SA 1QO2A 2Z1BA 1JQXA 4FX6M 1MXSA 3TXVA 4JTIA 4GC4A 4AAJA 2E68A 4JN6A 1TTQA 4UTKA 3UPWA 2QCCA 1ZAJA 2DJXA 4BWLA 3P81A 1L6WA 3ABQA 4XKYB 3PVFA 3M0ZA 5DY2A 1R47A 3NR0A 3W1UA 3A5VA 3PSVA 2G5WA 1QPOA 4JTEA 3IGUA 3KAOA 3W7JA 2X1RA 3TW6A 4FB7A 1LBMA 3TQKA 2BXVA 1FDJA 3VNDA 3PF3A 3NGJA 1IXPA 3I65A 4I7WA 4LUIA 1UBSA 3LXAA 5KZMA 1ZCOA 5I3IA 5KZDA 2DORA 3R8RA 2JKPA 1I4NA 3W9ZA 3MHUA 1YTDA 3ATYA 1YDOA 3TAOA 5DY3A 4CQ8A 2V9DA 2NZLA 5CGQA 2XN0A 1QPNA 3ZWTA 5K2ZA 3IV3A 4PCFA 1QDSA 1VYSX 4LVGA 3R2GA 4LT9A 1ZAHA 2Y61A 3QW4B 2OX1A 4LNYA 2BWGA 5LGXA 3W7EA 3I7QA 3TX9A 1OX4A 4PL1A 3W1LA 2H6RA 3PB2A 3G3DA 3A9IA 3NZRA 4JIPA 1VCGA 4KKXA 4NNAA 2ZFAA 4K7YA 2VKZG 4AVFA 1K7EA 3S5OA 4L4LA 3G1YA 2DU2A 3PULA 1W5MA 3R13A 4H3DA 5DXXA 2E6FA 5FF3A 1CW2A 2XFWA 1LDCA 3L66A 4UXDA 3HMJG 4UTTC 5KMYA 4A29A 1H61A 2E6AA 2Y7DA 1P0KA 1F5ZA 5FF0A 1AL8A 1A5SA 4JGDA 4TR9A 1TPH1 3W1NA 3LXBA 2ZA1A 4RKAA 6TIMA 3UXAA 5FEPA 1W37A 1I2QA 4CLMA 1VQTA 3PG9A 3GR7A 4ADUA 3UZ5A 3D0CA 3NPVA 5D04C 1G4EA 1DQXA 3EX4A 1JCNA 3LM7A 4LOCA 3T55A 1KM1A 4R34A 3LTPA 1YDVA 5EA9A 1I2NA 4IMGA 1W3TA 1FDYA 3CEPA 1OYBA 2A4AA 3EKLA 2AAMA 1SZFA 4MZ1A 5CG7A 5U7SA 1GVFA 3UZJA 3V1PA 5LKYA 4DO5A 3SJ3A 3MW7A 1AL7A 3ZR4A 2R94A 4NXSA 3QQ0A 4HNUA 2QJIA 2CLEA 1YXYA 2FDSA 4AHQA 4BK9A 4LC6A 3L2IA 3M6YA 4JXCA 1LTDA 3OVQA 1LBLA 4CNOA 2Z6IA 3N3MA 1F73A 4Z0JA 1T99A 2GVGA 3QC3A 3BVJA 1XFBA 3G1AA 5LHEA 1RQHA 3FIGA 4JIQA 3NQFA 3PUOA 4MYXA 3I7SA 1VHCA 4XBKA 1JCYA 5KZEA 2ZTJA 4YXGA 3NQAA 2C15A 1J2WA 3PUEA 5T26A 1PVNA 1OX6A 3NEVA 4WX2A 3C61A 2FPTA 1CI1A 2ISVA 4CQ9A 4IPJA 4RZ6A 1LRQA 3HPXA 2Y7EA 5D38A 1LRNA 1P4CA 2W0UA 2P1FA 3LHZA 4M6QA 3DBPA 3G0XA 3M44A 1S5TA 4LVDA 3IEBA 3RU6A 4IMEA 3DAQA 4A2SA 3LBCA 1TCDA 3LHUA 4N2YA 2IQTA 3BW2A 3CU2A 1VLIA 1NFBA 1SO5A 4GJ1A 4WUIA 3QFEA 4WXZA 4FIRA 1VJIA 2CLFA 2VELA 4BI5A 5CSSA 1X7FA 3LXCA 2PCQA 4BWLC 2GQ8A 2NV2A 3E96A 3W83A 3SI9A 1NAL1 3KFTA 2QCMA 1FXQA 4A2RA 1QNVA 4JTJA 1GYNA 4CNNA 5J5RA 1RZMA 2JKEA 3LHTA 1C29A 1OVDA 5CZTA 3GDTA 2NX9A 2Y89A 3NPUA 5BMXA 5TQLA 4IOTA 3LTYA 5KSWA 5CSRA 3QMTA 2BTMA 2VFHA 4HNNA 3SZ8A 2E6YA 3W2LA 1ZAIA 3P80A 3EWWA 1OX5A 1XI3A 1UB3A 4FXSA 2NLIA 3KOFA 2OT1A 3CTLA 1EWDA 3PBYA 2NXGA 3LERA 1P1XA 3B06A 1GEQA 2PE4A 2VFEA 1JR1A 3RF9A 3HGOA 3GDMA 3EWBX 3TA6A 4HPXA 2EHHA 1IXQA 5HWMA 2F7FA 3GDRA 2OJPA 4K37A 3DFNA 1EP1A 4O52A 4M5PA 1AW2A 4UNKA 4UTWA 3NAVA 2C1HA 2V5LA 4UTHA 1VR6A 2C14A 4PA8A 1SU5A 3SSJA 3C2RA 2Y6ZA 5HUPA 4MUZA 5KITA 1ML1A 3TFCA 4Y96A 1FCVA 4S1FA 3O07A 4FNQA 1JCMP 3S8HA 3SGUA 4ZQOA 3W7OA 3W7NA 3M9YA 4O4WA 3MI2A 4A21A 1A5CA 5LZLA 1ZENA 3TSBA 2YPIA 4O53A 3W1AA 3C2EA 3C4UA 4U4MA 1L6SA 4CCEA 4NXKA 1HFBA 1W1ZA 4MLJA 1H51A 1EP3A 1Z48A 2ZRZA 1XDLA 2JK2A 2XN2A 4RXGA 1OK4A 2DZWA 1JVNA 2V8ZA 3W7IA 3LRLA 3JS3A 1W5OA 1K3UA 3LHVA 4AF0A 5F1VA 5G2HA 4HIBA 1F05A 1TPB1 2ZA3A 3P8IA 1J5TA 3NQMA 4GFSA 4YCPA 2RHGA 1O60A 3USBA 1T8XA 4FF7A 3KVJA 4O57A 4J9JA 2WJZA 3MP3A 5FEZA 3KVKA 2JGYA 3WJWA 3AO0A 4ZQPA 3HPZA 2Z0IA 3MBFA 4GUJA 3WJZA 3M47A 3IIPA 4X3ZA 1SPQA 2WSRA 3W2NA 5DBTA 3W1XA 5FF4A 4N9DA 2B4GA 2DP3A 4IXHA 1G67A 4NJIA 4WY0F 1FXPA 3LI1A 1LYXA 3PC0A 4O19A 3TCEA 1XKYA 3I68A 1FY6A 3F4NA 1H63A 3G1XA 2E5BA 4NNBA 4JR5A 1QAPA 3CPRA 3NQGA 3QEZA 4C1KA 4XTDA 2H8ZA 4XQ6A 4IUOA 3MJYA 2X1TA 4QNEA 2ZQ0A 1JUBA 3LGEA 2ZYFA 5LSMA 1OK6A 1VCFA 1TSIA 4UTTA 2OCZA 3QZEA 1W56A 1R30A 1O5XA 1EUAA 4LTSA 2P0OA 4LVAA 5HMSA 3FYOA 1I8JA 1ZNNA 3L65A 2X2GA 3M5YA 2HS6A 3DU0A 3TC7A 3OBKA 2ZZ1A 4UFIA 4IGHA 4GUFA 4IMFA 3UWWA 4MZ8A 1JCJA 2FLIA 2P10A 1H60A 2NUWA 2GQ9A 1Z42A 3KRZA 3KVLA 2YZRA 3EWYA 4QNWA 2J9XA 3BLFA 1LOLA 3STGA 4ZMGA 3IGSA 4HSOA 3QMRA 3PSWA 2TMDA 4O4VA 4PEKA 3ZWSA 2R91A 3BO9A 4JEQA 1F76A 4M6PA 1ZY9A 1TIMA 2Z2UA 4CQAA 1GTEA 5I3HA 5A5WA 3G1HA 5I3FA 3IIZA 3TSDA 2C3ZA 3EX1A 1W5NA 3W6YA 3UWVA 3TE9A 1LORA 2VEMA 2QUTA 3GIYA 3W7GA 1JUKA 3EEGA 3FEMA 3GX9A 2QDHA 3QH2A 3HF3A 4DO4A 4WQ6A 4UTUA 1U5JA 3NQEA 1TTIA 2DZXA 4NJJA 3DKLA 3HB9A 1JCLA 3Q37A 1U83A 3OEXA 3HO8A 3JR2A 3TU9A 1OFBA 3UPBA 3S1VA 3NPWA 4FNUA 4O1DA 4HNVA 1DHPA 3QSTA 1GVQA 1TPVA 3G22A 1KFEA 4PFMA 3EX6A 2YW3A 3S5NA 4O0KA 4BFAA 1WBJA 1G69A 3WK0A 4NZJA 3BG5A 2C19A 1YXCA 4O1AA 5E1QA 4HN4A 1ME7A 1E51A 1XXXA 2DZSA 2ZRWA 4RV8A 1WOBA 3A21A 3HG5A 1F74A 2NXIA 3W75A 3TV8A 2G96A 1V5XA 4WD0A 3LCIA 3MUXA 1WDWA 2WO5A 4GUGA 2WSYA 2FQIA 4IJBA 3EXSA 3GKAA 3GDLA 5I3KA 3WFAA 5SWUA 4S2CA 1LROA 2TPSA 3E02A 4OWGA 3MYPA 3VI2A 1MEIA 1GVOA 4BR1A 3C6CA 1PE1A 1EPXA 3SGZA 1G4TA 2JGQA 2J9ZA 3PB0A 4LRTA 4JYDA 2ATMA 5K9DA 3FA5A 1WYIA 4O54A 1O94A 1M5WA 1SSGA 3O63A 4ZL1A 4YMZA 5D32A 3STFA 4TIMA 4UNLA 2E09A 3ZFHA 2A7RA 3C0JA 3P8JA 3GNNA 1VHNA 1VH7A 3W7DA 1DORA 1K8YA 3CQ0A 1G7UA 2QCDA 1TREA 2J24A 3O6YX 3BW3A 4I7VA 4WY0A 1Q6QA 1H1ZA 4HPJA 3UXDA 5LNVA 2Z6JA 2FPVA 1LLZA 1X1OA 3L0NA 4GBUA 2W6RA 4JTKA 3CM4A 2NUXA 2WSQA 3E49A 4AWSA 4UTLA 4DPPA 3W74A 4UC5A 5HR6A 1KW1A 1EIXA 5I3JA 4UFHA 3NL2A 1YLVA 4NZFA 3M7WA 3E0IA 4TMCA 4NUWA 1WXJA 3OHIA 1GZGA 1Q6OA 3R89A 3W7LA 1W5PA 3DI1A 4OV9A 1OHLA 2W79A 1PHWA 1FUYA 2H3DA 1KV8A 5D2XA 4O11A 4MIMA 1QMLA 1RD5A 2RDUA 2RKXA 1RR2A 2FFCA 1PCWA 3CIXA 1DVJA 3C2VA 4RLIA 3QJAA 5GVJA 5HINA 1OABA 3UD6A 3B8DA 5LNSA 2GJLA 5C2XA 4KFNA 4OU1A 3N9RA 2H3BA 4UFJA 3T4CA 4UR7A 5C54A 3STEA 5AB3A 3S1WA 4UFKA 5AYYA 4NNCA 1KBIA 2QCNA 2A7NA 2TSYA 1OJXA 1HG3A 4ZQRA 5FI8A 3N73A 3SFKA 1H7RA 3NQCA 3RFAA 3GZ3A 2TRSA 4M19A 3W07A 1JULA 4EWND 3WJYA 1JJKA 3NZ1A 1Y0EA 2X1UA 4WOQA 1T96A 1BKSA 5LNWA 3MMTA 2PC4A 1VYPX 4MFEA 2Q3RA 1EX5A 3G1VA 2A2IA 2VFDA 2X1SA 1L9WA 5CZSA 3FKRA 4MOZA 3A24A 3MHGA 3U6WA 3F4WA 1FWTA 1TV8A 4X2RA 5C6MA 3DFPA 3N2XA 1LP6A 3PY2A 2CLLA 4JS3A 2A6NA 3EXRA 4GXMA 3W1MA 2CLIA 3LDVA 4R53A 1QR7A 3IVSA 3QPZA 4ADTA 4OGZA 1JCXA 2CLHA 3PBVA 4C1LA 4JYFA 1S5VA 3STCA 1GVSA 3G1DA 3W7MA 4BI7A 3KVMA 1O5KA 4ZZ9A 1S5WA 3C2FA 3BLIA 4N4PA 4ZQCA 5F2LA 2ATSA 3P67A 5U4NA 1A5BA 3MWAA 1K7XA 4WOZA 3BLEA 1LRTA 4PC8A 5LNUA 3A5FA 1K02A 4YL2A 3B4UA 2GVJA 4IX0A 2NX1A 3PG8A 3NG3A 3SECA 1GWJA 1NF0A 2YX0A 2Q8ZA 3QW3A 3FS2A 4NVTA 4IWWA 2HMCA 3W7HA 1YXDA 3H53A 3PM6A 1A5AA 4LY8A 3MI3A 1SO4A 3M5VA 3L5LA 3N9SA 4N6FA 4GUHA 4BF9A 1A53A 3S42A 3G0SA 2ZRYA 4LS2A 5BNKA 3LTSA 5AC6A 3G0UA 3UY7A 2CLMA 1KTNA 2WNZA 4K8EA 5K9XA 1QPQA 4AEOA 4YLWA 2B0MA 5IM51 4N4QA 1TTPA 5LNRA 1DL3A 3E9AA 3H55A 2OMAA 3GR8A 2YYUA 4MFDA 2ABBA 2NX3A 3DFQA 1YDNA 1F7BA 5BRBA 4H6KA 1PV8A 3L5AA 3EX2A 5EY5A 1KTBA 3UWZA 1OF8A 1Q3NA 1TO3A 1TQJA 2ZZ6A 1MEWA 4NJGA 3JRKA 1K8XA 3SY5A 2E5CA 3CT7A 4AMAA 2WPBA 3GAKA 2YFNA 4FNRA 1Q6RA 3ABOA 5D37A 3PAJA 3O16A 3L21A 1GG0A 1TPC1 3CIWA 1WBHA 3P5ZA 2WQPA 3ABRA 3FFSA 1B9BA 2ISWA 4JD4A 4LRSA 4ZVJA 3M41A 3IVTA 3NQVA 1BEUA 5E0KA 4HKPA 2DZPA 3B0PA 5HUOA 3P74A 4FX7A 1HO4A 1FBAA 3CEUA 4RCXA 2CZ5A 3TXZA 4KWVA 3VE9A 3LV5A 4DF2A 3W2JA 2VENA 8TIMA 1SW3A 4X22A 5CPOA 1HL2A 5D30A 4M7TA 1OYAA 1K7FA 2VXNA 2ZCGA 4S2BA 2WNQA 4QISA 5C5YA 3G1FA 4OV4A 1NF7A 3W2KA 1XL9A 5L6UA 3W3OA 3CWNA 1Q45A 1EWEA 1YPIA 3IGXA 4UR8A 1WX0A 1XBZA 3G18A 4FHAA 4E2DA 2A6LA 4ALDA 4PH6A 5DN1A 3I7RA 2YYTA 1W8SA 1TB3A 3TJXA 2QEZA 1YTEA 5EKYA 3LB0A 4JNMA 1TMHA 1SW0A 1FCQA 1XBVA 4IX2A 2I14A 3TDFA 5LGZA 3HIJA 4PODA 3HBLA 3GXTA 4EIVA 3KRUA 5AHLA 1N55A 4HHPA 2J9YA 5G5IA 3F1QA 4EVZA 3RLUA 2I9EA 3FJLA 3L5MA 3IRDA 4O0ZA 3M43A 3CB8A 4RK8A 1QCWA 3P61A 2HSAA 3DZ1A 3TQ0A 4QQ3A 4FXRA 4TU1A 3GDKA 4W9TA 3EXTA 5K4XA 4NX0A 3M5ZA 1KFKA 3UY8A 5CKSA 4AHPA 2AGKA 1SZEA 4WJEA 2EAWA 3W72A 2Q3OA 1BWKA 1TV5A 2YR1A 3ATZA 1ICQA 1GQNA 4MKNA 4FIQA 1HUVA 2CWNA 2I1OA 2TYSA 3PUDA 4DXVA 3N14A 3LOTA 4JTFA 3QM3A 3THAA 2V30A 3G1SA 2VOMA 4M7SA 3QMSA 4AHOA 3Q2DA 3ZS4A 4CCCA 3KXQA 3T78A 4MLRA 2ZRUA 1SZNA 3Q94A 1SW7A 1H5YA 3TJLA 2NXHA 1T0OA 1TPUA 5G1YA 4EOUA 3W1PA 3MP5A 1JUEA 5HJLA 1KFLA 4AF0B 3NXFA 3W85A 5A8GA 5BMWA 1KM2A 4R7JA 1ICPA 3U8GA 3W7KA 2J6XA 4ZQNA 4PTNA 4MJZA 3P60A 3HJZA 4UUIA 1XC4A 3A23A 4P2VA 1X8FA 3TK7A 1OG0A 1WQ5A 2BSLA 4EF9A 3KHJA 5BW6A 2RDWA 3T44A 1SO3A 3W86A 1TPWA 1QO5A 2FJKA 1KTCA 4Y9AA 2O7QA 4TMBA 4MVAA 1K03A 3EKZA 3P84A 1LZOA 1B4EA 1GTHA 3GVGA 6ALDA 1AW1A 1RPXA 2E5DA 1IIGA 3TMLA 2FPYA 5H91A 4K36A 4N9EA 5H2ZA 4GRSA 1VCVA 2WNNA 1OFDA 5CZJA 3G8EA 3NM3A 1FWRA 4IMCA 5CZ0A 3HQ1A 4JTHA 5DCEA 3L67A 4IPIA 3TIMA 3W7RA 4FX8A 5ABTA 1KM0A 4HNTA 2QJHA 4O10A 1DKWA 3NQDA 1GOXA 5D2TA 3LCFA 3T7VA 1TTJA 1FCBA 1S3HA 1OFRA 4DQWA 1UCWA 2VEKA 2Y7GA 3MYOA 3SIZA 4CNPA 1MO0A 1QPRA 4GNJA 3O8AA 1GT8A 2X30A 3WJXA 1GG1A 3BW4A 1H7WA 2R8WA 4LVFA 3E12A 4O28A 3QYQA 3NQ7A 2V81A 4E38A 4ADSA 3S0CA 1W3NA 4RXFA 2Y88A 4FNTA 2JBMA 3QF0A 5D05A 3HGRA 1CX9A 1OFAA 2Y62A 4IXXA 4M6VA 5D2VA 2A85A 2BLEA 1F2JA 5EPDA 4XKYA 3GLCA 2ZZ5A 2QUVA 1N7KA 4UFMA 4Q33A 2Y85A 4LC8A 3Q58A 3DKJA 1IIHA 4DO6A 3ABSA 4O16A 3TKFA 3GYEA 4Z1BA 1O95A 2QCFA 1R2RA 1W54A 3LCGA 4JICA 4RX0A 2ZRVA 3S1XA 3K30A 1QOQA 5HWJA 4QSHA 2PRMA 3W2MA 4DEFA 3B03A 4LV4A 3DHFA 1EA0A 1QWGA 3EWXA 4XWUA 3QPYA 3I6RA 1Z44A 2FTPA 3QSRA 1DOSA 3O6DA 3BPWA 2B7NA 3TR2A 4UTMA 1GYLA 4ORIA 4KWWA 1WA3A 4O18A 4BI6A 1R2TA 1XM3A 2LLEA 5TIMA 4RJEA 3SR7A 2G97A 3NL5A 5AHEA 4WXYA 5FESA 1OYCA 2NWSA 1XBXA 4ORMA 4O8RA 3NQ8A 1KM4A 1DBTA 2Y63A 4UTJA 5G4WA 1FQ0A 5AHNA 4LUJA 3RMJA 1SUXA 3R5EA 4JDYA 5F2MA 3T40A 4O17A 3M5XA 1SQ7A 1B4KA 2VEIA 2EKCA 3M16A 3LCLA 3OA3A 4I9AA 2Y7FA 5FEXA 1SSDA 4JTGA 4XTIA 1VRDA 3BGJA 3IIVA 1QFEA 3BV4A 1WAUA 4O1CA 1W3IA 3QQ1A 5AHFA 3W88A 4MJMA 5HR7A 3MI6A 3HOJA 3G24A 1RQEA 5CPMA 2QAPA 1L6YA 3C56A 3W84A 2ZZ3A 3NVTA 2VFGA 1F6KA 3P82A 1MEHA 4UCGA 3DFOA 3NQ6A 4AH7A 1DJNA 5EBUA 4RZ5A 2VFIA 2E77A 3DHDA 1OFPA 2ISSA 4E2BA 3TW7A 4JTUA 1B57A 3PWAA 2QCDB 5DCBA 2EF9A 1FX6A 2GVLA 4WY0B 3EB2A 1EP2A 1JQVA 3N19B 4AXKA 2YSWA 1I45A 3LCHA 2CLOA 3L68A 4O13A 1H62A 3BGGA 1OF6A 3EWUA 3DENA 3LX9A 1PCKA 2V2CA 1FCUA 4A22A 2OZ0A 5CPLA 1ME8A 3EWZA 2V5BA 3ANYA 1LM1A 3CC1A 1TPDA 3S5YA 4LV9A 4JX5A 1MSSA 5K7JA 3M1ZA 3TFXA 1ZHAA 1OX4B 3NM1A 1NSJA 1R46A 4TX9A 1KFJA 3L0GA 3LHWA 1KLZA 3DI0A 1HO1A 4GWEA 2QDGA 3OG3A 1Z41A 2BX7A 2YXGA 5DBUA 4O12A 1TV7A 1KA9F 4XZ9A 4O1BA 3AJXA 3GKFA 4QIUA 2V0TA 4LW7A 2V82A 5AN7A 3C52A 1KM5A 4JTSA 3TNOA 3NDOA 5AHIA 4UMBA 3UQNA 4Z08A 4JDBA 3W1TA 2QJGA 2YCEA 3IIXA 4LU0A 5AC7A 3LRKA 3C3NA 3UYCA 1TPFA 2ALDA 1XDMA 1M7PA 1W0MA 3UWYA 1SZGA 2RH9A 3R12A 3MO7A 3GK0A 4DF0A 5KTLA 4FNSA 3NL3A 2CZDA 1IGSA 1Q6LA 1G4SA 2GPTA 1H7PA 4Z1AA 3NO5A 4P61A 1AMKA 5D03A 3GAYA 3FOKA 1WOAA 2C0AA 5DLCA 2A7PA 4RZ4A 4JX4A 3S6DA 4I7UA 5C55A 5EMUA 4X9SA 3NYZA 3S5ZA 2VFFA 4ML9A 3LCXA 1KFBA 1YPFA 4QAIA 4Z1CA 1N8FA 1QOPA 5IBXC 4K6AA 3RK8A 2PRLA 3TH6A 4GUIA 3NNTA 4K39A 4Y90A 3B05A 2D73A 2QCGA 3B0UX 1UUOA 1H1YA 3W73A 5AFDA 5HWNA 3PR2A 3CWOX 2ZBTA 3TAKA 3VKJA 5BOOA 3O05A 3THQA 3DGRA 3PBWA 1XCFA 2DZVA 3W1RA 3N34A 5F4XA 3TUUA 1FWNA 1I2PA 4QJ1A 2GUUA 1ZFJA 2CFFA 2R14A 3U2OA 3LV6A 3WK3A 1HTIA 2YFOA 1GPWA
chains in the Genus database with same CATH superfamily
2V2HA 4TO8A 1V02E 1YTKA 4RW3A 1QASA 4Y8FA 2CCRA 3W87A 2B7PA 2Y70A 1GOIA 1GVYA 1OT1A 3OVPA 3S9IA 5M3WA 1FWSA 2E6DA 4PL2A 4WDUA 5LA2A 1DV7A 3B4YA 3VMOA 3D46A 3BG9A 1TJ0A 4R5EA 4L61A 5C7HA 1E43A 2QZRA 1J4EA 1D8WA 2OLSA 4RR4A 4LS0A 2F84A 4FPSA 3TCSA 3CV1A 3BLOA 1BVZA 2WZHA 3BG3A 1V6TA 4B16A 4PMNA 4W8LA 4QP0A 4DWSC 3N2BA 1AD4A 5AHMA 4LWWA 4YCOA 5DCDA 2WNWA 3SRDA 4K38A 3IK2A 3V0UA 3K1DA 4QJ4B 2XVPA 1JF5A 4AZ6A 1IF2A 3ONBA 3WQ4A 4MAVA 3EOOA 3CT2A 1PIIA 1E6PA 4MY8A 1ADOA 4KFPA 4AD2A 3UG3A 3HU7A 1R2SA 1UASA 3OU8A 3TQVA 2X7WA 4Y6GA 3GVRA 1R9YA 1UUMA 4ZCWA 6PTDA 3WK1A 7A3HA 4FOKA 2WVVB 2YGYA 1CGWA 3A47A 4OE7A 1S2UA 3EZ4A 1ONRA 1RLCL 4IQJA 4GINA 3TMQA 2E0PA 1J2BA 2C8NA 1ZJBA 1MUWA 4DBDA 3MBDA 1JZ6A 4Z2JA 3QR3A 3GXNA 2C18A 1H7OA 3TROA 4F0SA 2YDRA 3T2QA 4MMWA 3AFBA 3LBMA 1OFQA 4N9CA 1E9IA 4JL1A 3FYPA 3GNDA 1V7AA 1P43A 4KFOA 2QCEA 5HNRA 3P7YA 1JXKA 3PS7A 5AYBA 4XUGA 1GJPA 4NAEB 2H8XA 2ZUNA 5HQEA 1K8ZA 4TVUA 3NQ2A 3VE7A 2A5HA 3LD5A 4N9BA 4AZCA 1OZMA 1JRBA 2PWFA 3URNA 3Q45A 5MHBA 3A22A 5CH9A 1PKNA 5F1UA 4PSPA 5G4EA 1RLDA 4X9YA 3AHZA 3D3AA 3RU8X 4LF1A 2X42A 3ELFA 5F4SA 3RO8A 3W22A 3NTYA 1V51A 2QULA 4ONVA 1F61A 3EDEA 1LLWA 1WDPA 2VURA 1R6WA 5FF7A 4AEEA 1O6IA 3FLUA 5CPNA 5LHFA 3P62A 1HW6A 4DF1A 2GWGA 2R1KA 1TELA 4B92A 4CNSA 1AZ1A 4C5YA 4BQ4A 2J7CA 4AWTA 1KCZA 1WDQA 3CB3A 1E6XM 5EL1A 2GUBA 4JCMA 1G7VA 2EPHA 4D2JA 1OFEA 2X0YA 3EX3A 4HTYA 1YQ2A 5D02A 3LCWA 3R4IA 1YMYA 2CZEA 3MKKA 4U5IA 3VD3A 4NAFB 3AYSA 1M7OA 1L8NA 2FB2A 3KTXA 5D2YA 3KBNA 2W5FA 3WLPA 1DEDA 4U2YA 1FWWA 2J66A 1TMQA 2JKAA 3NPXA 4IQLA 5K4ZA 1UD2A 1FWBC 2VC6A 3IACA 5K3VA 1J0IA 5E6YA 2JALA 3PPHA 4YYFA 3GC4A 4AD1A 4ZB0A 2FIQA 3E0FA 1RVGA 5I00A 2NV1A 3A4JA 3W2UA 4HMEA 1BG9A 3ARPA 3W71A 1EYEA 1FWGC 1XIFA 5E70A 2GQAA 1TR1A 3OLGA 4RDWA 1NDWA 3HGSA 3B40A 2E1DA 1PS9A 1VPXA 2OODA 2GJNA 3KRSA 1JZ7A 1KXHA 4POCA 4IL0A 3G8RA 1HJQA 3EYPA 4WF7A 3GNPA 1XYBA 1VGAA 3DFSA 4W87A 3AUOA 3BARA 5D9PA 1TQXA 4FEZA 4H9ZA 3U2CA 3ZOAA 2QVHA 8XIAA 5D09A 2C16A 1FA2A 4NX5A 1Y7VA 4UTWC 5HAOA 6REQB 3LMZA 3S6TA 2V6AA 4HOWA 1R86A 1NVMA 1JRCA 3CO4A 4F2TA 2O9PA 3ARWA 2ZZ2A 1PYMA 2VEPA 3GXPA 4F2BA 1MDRA 3MSGA 4R33A 1ONEA 2Z1BA 2KAUC 4JFVA 1GQLA 3TXVA 4JTIA 5CC7A 2VOTA 1WO2A 3UPWA 1ZAJA 2DJXA 2PGWA 3GDBA 1P1MA 2XIMA 4XKYB 1JD7A 1E0TA 3PVFA 2WW5A 5DY2A 1R47A 3WL0A 2V3EA 1HJUA 4KGJA 3NUKA 3VU2A 2QQ6A 2R1MA 3PSVA 3BSGA 1QPOA 1XIJA 3KCLA 3W7JA 3TQKA 3QHNA 4S3DA 4X60A 3NGJA 1IXPA 4F0KA 1UBSA 3LXAA 1ZCOA 5HOSA 1CGUA 1OWQA 4BQ5A 1KR1A 2EG8A 2R6OA 1ISWA 3VGEA 4CQ8A 1WE5A 1PJ9A 4QDPA 3IV3A 4PCFA 1QDSA 4EWJA 1OGSA 3U7BA 4LVGA 4KMQA 3PJTA 1TWDA 4LNYA 5M2FX 7ODCA 2WJEA 3I7QA 3QYSA 3V0SA 3ICJA 4PL1A 3W1LA 4KH2A 2H6RA 3G3DA 1HQTA 4W89A 1FWIC 3ITGA 4JIPA 3NZRA 1VCGA 4GCAA 4NNAA 1J0KA 4KIRA 4J35A 4DUXA 4A8NA 1K7EA 4L4LA 2VP8A 5FJPA 3AS3A 3WLHA 5PTDA 3CV6A 1EJWC 3SRFA 1LDCA 2GOKA 1BXNA 2Y7DA 1OCQA 1F5ZA 1A5SA 4RKAA 4HK5A 4I5UA 6TIMA 1N2VA 1PX4A 4CLMA 4NYYA 4C6JA 1E71M 4ADUA 3D0CA 4Q8TA 5D04C 3H12A 2WZEA 4XZWA 5HNTA 4KEZA 3T55A 2XIIA 4DAIA 1W3TA 4NRRA 1XQLA 1OYBA 1PDZA 3WIJA 1J6OA 4LB4A 1UH3A 1XRVA 1G5AA 5CG7A 1Q85A 2GDUA 2D2GA 1AL7A 3ZR4A 1A3HA 3HMCA 4HNUA 4S3CA 3SCTA 4BK9A 3B0XA 1S2CA 1UR8A 4GK8A 4ZOEA 2PLMA 4J3VA 4E8DA 3DYOA 1UWSA 4CNOA 4YJ5A 4D72A 1F73A 4Z0JA 2Y0FA 2GVGA 3QC3A 2ZADA 2V5KA 3ZMRA 1GOKA 3FIGA 1ITQA 3HQNA 3PUOA 2EPKX 4G6CA 4KCVA 2PDWA 1IWBA 4X61A 1DYSA 5KZEA 2ZTJA 3ZR6A 2C15A 3HM7A 1YNPA 2D3LA 1IZJA 4WX2A 5FJRA 5T9BG 3CHDA 1CI1A 4Q4SA 3OG2A 1NY1A 1GNXA 4YHGA 4RZ6A 3HPXA 3O6AA 5M17A 3K1GA 2W0UA 2P1FA 1MI3A 5I7GA 4BA0A 2DW7A 1DHKA 1S5TA 4H2HA 1B2YA 1W1PA 4DBSA 3DAQA 1HJSA 2QV4A 1D7FA 1DJIA 3A4AA 3CGTA 2DEPA 4OBRA 2DPEA 2VELA 4BI5A 5A94A 3LXCA 3CIVA 1WDDA 1RCQA 4BWLC 4LUSB 1HP5A 2EEXA 3SI9A 2QCMA 1FXQA 1VD6A 2E9MA 1US0A 1GYNA 4RDYA 3ZIZA 1C29A 1XLFA 4H9VA 4MWAA 2PS2A 3GHTA 3GG7A 5KSWA 5CSRA 2BTMA 5DANA 5HPCA 3C3UA 2E6YA 2ACRA 1OX5A 5ABGA 1M04A 3KOFA 3R8HA 1EWDA 7TAAA 3JZEA 1J0JA 2BVYA 2VFEA 3VIHA 5TF0A 3KRBA 4WLCA 4OKDA 5DMMA 4YHEA 2EHHA 2WVVA 3GDRA 4EK7A 1G9HA 2HEJA 3MMDA 4GH3A 3D47A 1JZ4A 4H9MA 2C1HA 1E6SM 4G56A 2V5LA 1H11A 1VR6A 3GXFA 4PA8A 4K2SA 1TWWA 1Q6GA 4J4KA 3SSJA 4KWSA 2Y6ZA 5ECUA 5HUPA 1CXFA 1K77A 2NT1A 5KITA 1ML1A 3TFCA 4GY7A 4ZQOA 2P5NA 4PULA 3FA3A 3ZVIA 4Q4MA 1KGUA 4A21A 3N4AA 2BGSA 1Q63A 2E28A 5AZ0A 2VGFA 2ZUWA 1W1IE 1Z48A 3JW7A 2HE8A 3GVVA 4GX8A 3RIKA 2JK2A 4JNYA 3WH9A 2DZWA 1JVNA 2UY3A 1V6YA 1W5OA 3LHVA 4I5RA 3BLLA 4REQB 4MKSA 3NWRA 1PUDA 2ZA3A 3BJFA 1XYFA 7CGTA 2UY4A 1T8XA 3NZGA 4O57A 1RP9A 3KL0A 4IPPA 3MP3A 3WBXA 1S39A 2J74A 3VD9A 1K6WA 3WMSA 2WCGA 1XLHA 4ZQPA 4US5A 2IPGA 4XZHA 2Z0IA 3VUPA 1CDGA 3M47A 1SPQA 2WSRA 4FLRA 3W1XA 1AQ0A 1EH9A 4GZJA 4N9DA 4WIWA 1B5TA 4NJIA 1YX1A 4O19A 1LYXA 3TCEA 1XKYA 4AIOA 1KC7A 1HL8A 2CC0A 1QAPA 3ZJ7A 3QEZA 4NAFA 1FVPA 4XX6A 4AX7A 4XTDA 3TOYA 4M51A 5EFFA 2ZQ0A 2Y8UA 5LSMA 1OK6A 3WENA 2BG5A 1R30A 4ES4A 4LTSA 1US3A 1JDEA 4H9XA 4ZFMA 2HQAA 1EGZA 4IMFA 3RX4A 2UY2A 1JCJA 3C0QA 1CLXA 2P10A 2NUWA 4JCLA 2WHKA 2YZRA 1JFXA 3BGAA 1NTHA 3PP7A 3STGA 1JXJA 5ECVA 3ZLFA 3THUA 3PSWA 1YE4A 4CCZA 3TLQA 3ZWSA 1XLDA 1TIMA 3II1A 4GISA 1I0DA 5I3HA 1X1NA 3G1HA 1R3TA 4DX3A 2DDXA 2C3ZA 2V63A 2XVLA 1XLKA 2G3IA 3TONA 1U33A 3GX9A 2QDHA 3HF3A 4G7EB 4DO4A 4IFOA 6REQA 4UTUA 4NG3A 3EOEA 5F7UA 4HHHA 4NJJA 3HB9A 1JCLA 2JEQA 5A6BA 4AQLA 2QXWA 4PE8A 3JR2A 3TU9A 1OFBA 3GYCA 3QSTA 2C7FA 1TPVA 1CGVA 5AC5A 3EX6A 3WNMA 4PFHA 1XX1A 1G69A 3BG5A 2VHLA 2E9BA 1YXCA 3R58A 4HN4A 2DZSA 2ZRWA 1WOBA 1C9WA 4PMJA 3TV8A 3VDCA 2Z1SA 2WO5A 3EXSA 1R3YA 3GBEA 3GDLA 5I3KA 3WFAA 4S3FA 1EC7A 2P8BA 3WQVA 3VPLA 2TPSA 2BASA 1WPCA 3MYPA 2I9UA 1QNPA 2PDKA 2OOGA 3VI2A 2PSNA 2E3ZA 1GVOA 2OGJA 1UP2A 3SGZA 3ITXA 2J9ZA 2QLYA 3PB0A 4LRTA 5A6MA 1ZB5A 2F6XA 3HFYA 2ATMA 1UC4A 4IF2A 3FA5A 1WYIA 2CLPA 1B54A 5M1TA 1SSGA 2VJXA 4PUUA 3AIBA 3G6MA 5DMLA 4JFTA 2XGIA 2E09A 4KERA 3C0JA 3VIMA 3GNNA 3DX5A 1VH7A 1WB0A 1G7UA 4AZ5A 1ZTVA 3LA4A 3VGHA 1UWQA 2J24A 3AISA 3BW3A 4WY0A 2QPSA 1Q6QA 4HPJA 5D8WA 1GHSA 2ZE3A 1R0MA 1LLZA 4HPNA 3ZT6A 1FHUA 1GKRA 4CU8A 3CYJA 4GBUA 2W6RA 3E49A 4R9XA 3SGGA 3I3EA 3VKAA 4DPPA 3W74A 1NU5A 2WAGA 4RZBA 3H4WA 1KW1A 1EIXA 1RBLA 3PPFA 1A5MC 1YLVA 4NZFA 1V3LA 3E0IA 4TMCA 1XKJA 1E4LA 2XINA 4KETA 1LUCB 4GIAA 5JVLA 3AALA 1Q6OA 4B2DA 1U5VA 3DI1A 1OHLA 3MWCA 2GL5A 4Y9PA 1FFQA 2W79A 1E1EA 4YWSA 1FUYA 2H3DA 4D8ZA 1KV8A 5D2XA 4MIMA 3SY8A 1RD5A 2FFCA 3GZAA 3UFYA 3CIXA 3C2VA 3WNNA 1XLIA 1OABA 3UD6A 2XM1A 3B8DA 3IS4A 3HJEA 2NSOA 1HVQA 1RCXB 3CBWA 1H1NA 3N18A 3T4CA 4UFKA 3S2CA 5ABFA 2VCAA 3CASA 2DW6A 4NNCA 1QNQA 3RLHA 1FP8A 2TSYA 4OOUA 3SFKA 1VEPA 4PTWA 1Q8JA 3IUIA 2TRSA 3AS1A 2SFPA 3RO6A 2YB1A 3N25A 4EWND 3UR8A 3NZ1A 2X1UA 1FOBA 4Y2WA 1PZ1A 4YTSA 3AU6A 2Q3RA 1EX5A 1PPIA 2VFDA 1A80A 1H0GA 3FKRA 3IAQA 4MOZA 3U6WA 4ZE5A 1FWTA 2UZ9A 3GG8A 3LYEA 3RCYA 3WF2A 3GVQA 4S3GA 2CLLA 4JS3A 4AU0A 5I24A 3WY1A 1XRSA 2CLIA 3BE7A 4R53A 3IVSA 3PBMA 4ADTA 3U57A 1WKDA 2CLHA 4QJ5B 3QN3A 4JYFA 1GVSA 1VIWA 4BI7A 3KVMA 1S5WA 2ICSA 1IEIA 2FHFA 4ZQCA 4PUDA 5F2LA 1XLAA 1R3WA 1A5BA 2YA1A 3TN3A 3ALFA 4DI8A 4WOZA 1LRTA 5LNUA 2DVTA 3MQTA 1K02A 4YL2A 3B4UA 4IX0A 2PLKA 2NX1A 1EJXC 1TFVA 3IJQA 3KWSA 4MDOA 3BANA 3QW3A 3R43A 4GXPA 4AC1X 4IWWA 3W7HA 1YXDA 5CLTA 4GYJA 4IPNB 3PM6A 1GKPA 4ATLA 1Q6CA 3E1F1 1S5NA 2YDQA 5FSDC 5BNKA 5AC6A 4FK9A 3UY7A 2CLMA 2WNZA 3ZLHA 1QNOA 1QPQA 4AEOA 3ITYA 4N4QA 1TTPA 2VGIA 4MJ4A 1CXHA 1CCWB 1EF2A 5E0FA 3M0IA 1LWJA 3EX2A 5EY5A 1S1RA 4P7LA 1TO3A 2OYKA 4NJGA 4LAZA 4JHMA 6A3HA 4NILA 1X38A 1KXTA 1Q6RA 2CBIA 4EE9A 3CJPA 4CD8A 1S38A 1NOWA 4G1NA 1VBHA 4DZHA 2ISWA 4LRSA 2XG9A 5D8ZA 3IVTA 3NQVA 4B91A 5FA5A 3HV8A 3B0PA 2PD9A 1NH6A 4YN5A 3CEUA 3LV5A 2VENA 8TIMA 1SW3A 3JUGA 3K46A 1T8QA 1MUCA 5D30A 4FLOA 4IT1A 1K7FA 2VXNA 3BICA 2WMIA 1ZBKA 2ZX9A 1KWGA 1W17A 5L6UA 3W3OA 2YA0A 4Z1YA 3CUHA 2OX4A 4UR8A 3G18A 3RM4A 3T4WA 5DN1A 4DXXA 2YYTA 1SFSA 1W91A 3E0LA 5KZ6A 4REQA 3TJXA 3W25A 4JNMA 1C3FA 2AAAA 5LGZA 3GW0A 3HBLA 2QVNA 3UT0A 2J9YA 1DIDA 4UQAA 4AY1A 1LWIA 1Q7MA 4EVZA 2WYSA 3NIYA 1AUSL 2A3EA 3RCNA 4B90A 2ZIDA 2J6VA 1EO7A 2WZMA 3TQ0A 1EZ2A 4QQ3A 4TU1A 3CQHA 1JDCA 3Q4DA 3V5OA 2BFGA 2OQLA 2XIJA 1BSLA 5CKSA 3SCNA 3DYPA 2AGKA 4WJEA 4B5SA 5C8BB 1HKKA 1E5NA 1BWKA 2YR1A 2AGTA 4L9YA 4PUKA 4FIQA 1HUVA 3PUDA 4XO7A 1NFGA 5BXTA 3N14A 1K1DA 3HV9A 4JTFA 4F66A 5I78A 1CB7B 5D9MA 2IQDA 1GQKA 4K8GA 4M7SA 3QMSA 2ZC8A 4W7VA 2ZKMX 4CNUA 1SFTA 1WDRA 3TJLA 2NXHA 4S3JA 2AL1A 2BGQA 3KHDA 4E3VA 4AYSA 1KRCC 3W7KA 5I07A 4ZQNA 2QT3A 4M80A 5DMNA 2I16A 1NDVA 2PFHA 3VIOA 3R94A 2G3FA 1W9VA 2RDWA 1BYBA 4WGXA 2GWNA 3RAOA 3PBGA 1GCYA 3W86A 5DEZA 1CWYA 3ONCA 4QQUA 2FJKA 1LG2A 3ARQA 4KESA 1YEYA 3BAWA 2O7QA 5RUBA 4G7EA 4TMBA 3EKZA 3H6OA 4HNOA 1IYXA 1GTHA 1VBGA 1IE7C 3P3BA 1IIGA 1E3ZA 2O4MA 5AY7A 4N9EA 4GRSA 2DFAA 3AZRA 2IPWA 1XLBA 3ITLA 3HQ1A 3A3WA 3HA1A 3IARA 3L67A 4IPIA 5DRIA 1NM9A 1WNOA 3M0XA 1CLVA 1V3MA 4EPBC 1WXZA 3T7VA 3UCDA 2EPOA 2XH7A 3H2FA 4LJ3A 1BYCA 3VGBA 1MO0A 2CERA 4GO8A 3O8AA 1A5OC 2J8GA 4WJXA 2NVAA 3E12A 4O28A 2VR4A 2P50A 2V81A 1E0UA 4MB1A 1CXIA 4FNTA 4ZR8A 3HGRA 1OFAA 2Y62A 4IXXA 2GYIA 2PA6A 5D2VA 2A85A 2QUVA 2VM8A 3KW3A 4HHMA 1JNEA 4Q33A 2YA2A 3SCWA 1XYCA 2HBVA 3Q58A 3QY8A 3OZMA 1IIHA 4DO6A 3TKFA 4JOMA 2PI6A 3I4KA 1Q2RA 1ZGDA 3GG0A 3LCGA 1FWDC 2GGIA 1QUMA 2ZRVA 2BY1A 1EEXA 3S1XA 1QOQA 2YB4A 1OD8A 3B03A 1ZPTA 3DHFA 3QPYA 3H2NA 3GNRA 3LK6A 3SCQA 1ADSA 3VDBA 3O6DA 2DVUA 4QROA 2VWTA 5ENLA 3TR2A 1GYLA 4O18A 3AIVA 2QIIA 2GVYA 1XLJA 1XM3A 4MWAE 3VOHA 2VZUA 4GQGA 3USZA 2GVEA 5I23A 2XIQA 3H22A 1OYCA 4IPLA 4DJFD 1QXLA 1DBTA 4S3BA 5AHNA 1J0HA 3RMJA 3R5EA 1TZZA 1LUCA 4WKFA 3M5XA 1SQ7A 4QAWA 2XPKA 1H4PA 2J7DA 1RBAA 3AYTA 1OIFA 2A3HA 4JQAA 2REQA 1VRDA 1V4YA 5JQ9A 3CZJA 4O1CA 3FV9A 3QQ1A 3MI6A 3G24A 4LQ1A 4JBRA 2QAPA 1HL9A 4DWSA 2DGAA 2WK2A 4RZ5A 4S39A 2E77A 4E2BA 2ISSA 4JTUA 2O9OA 5AC4A 3QZAA 1FH8A 1FX6A 3FGCA 3N19B 1B3XA 3CUZA 3V7PA 1B30A 4CNTA 3L68A 3GU9A 1H62A 2G4FA 3TTEA 5DO8A 3MJMA 1F9CA 3EWZA 1CGYA 1Y5VA 5EU9A 5LIWX 3S5YA 4IGMA 1O7AA 4JX5A 1GOQA 3EPOA 3KBSA 3BJSA 2Z4GA 3ISIX 3AMCA 3QVQA 1R46A 4Z2HA 3FXYA 7PTDA 2UBPC 4JIRA 3T0AA 5LXEA 1KLZA 2CETA 1Y8BA 3IANA 3OG3A 5I5RA 2BX7A 3AYRA 1ZLPA 1UR2A 4O12A 1KA9F 3QOKA 1FP9A 3TYDA 1KGXA 6CGTA 4XZ9A 4QIUA 4O1BA 3GKFA 2OEMA 2V0TA 2XVKA 2V82A 2G8ZA 3C52A 5AHIA 2PWDA 3BZGA 2J13A 4UMBA 4Z08A 4JDBA 5XINA 3IIXA 5AC7A 5HNUA 1XW8A 2DIEA 3N11A 4MWAD 4P8XA 1JGMA 3RHGA 4LSBA 1A5LC 1XDMA 3VIKA 2V5JA 1XISA 3VC6A 1SZGA 4IFKB 3WLQA 5FOOA 1ENUA 1A5UA 1MW3A 2HROA 3SCPA 4UOZA 1YRRA 4F0HA 2WKLA 4YTUA 2OB3A 3L4XA 5I79A 3BAKA 2FHBA 2A7PA 4JX4A 3GS6A 3NURA 1VPYA 3MTWA 1XCWA 2PU0A 2VFFA 1S2AA 4ML9A 3AS2A 4Z1CA 4GOAA 1TWIA 3RXZA 3W28A 3WBWA 2PRLA 4NZ1A 3NGFA 3ZZ1A 1XGZA 4HSHA 2D73A 2QCGA 2GFTA 3VX1A 5JH1A 1JPKA 3MSYA 2D2JA 3RCMA 1K70A 4G8TA 3W73A 5BCAA 1VFHA 5B80A 3WQWA 3TAKA 1XD1A 8A3HA 3SIMA 1Q6FA 4LYRA 2BNJA 2IS7A 4P5UA 3BAJA 3DGRA 3PBWA 1TUFA 4F0MA 2GJPA 4DM1A 3WL1A 1EOMA 5F4XA 4L5ZA 2PD5A 2PDNA 3AJ7A 3MSDA 1FKWA 1I2PA 3IJ8A 1V6WA 2GUUA 3KLLA 1ZFJA 2R14A 2NSXA 3U2OA 3LV6A 3WK3A 2YFOA 1CNVA 2C13A 2P3EA 3MHFA 3H2AA 3ARTA 4QM1A 3ES8A 3VNJA 5H8PA 1S1PA 1V3HA 4UMCA 3URBA 3S3GA 2NQJA 2X16A 3QV7A 3FHQA 2PDMA 5HK4A 1XBYA 3P0WA 1QI3A 3VCRA 2GGGA 3KBMA 3ARZA 1L2UA 2WMFA 3MV11 3S1GA 4N42A 3VIPA 2C6QA 1IT0A 4NJKA 3O15A 2W63A 1PO9A 1BQCA 1TPEA 5FF2A 3L4ZA 4FOUA 5ABEA 2OKOA 4LYKA 1VYRA 1ONWA 3WJSA 2PDPA 2FZ8A 2ACUA 3UNTA 3N6QA 3H54A 5IRPA 2GGEA 4UFLA 1RV8A 4E5TA 5HPOA 5FKYA 3AU2A 3R25A 2HDJA 2Y8VA 3UWUA 3ITOA 3TSMA 2EGZA 4OHQA 3WUBA 1BG4A 4WDTA 3W23A 2R1LA 3SURA 4O50A 1MFVA 2CW6A 4IIFA 2QAFA 5FEWA 5KEZA 4E6MA 4XG1A 3INPA 4RPQA 5J5DA 5I09A 3B0YA 3ZSSA 4L1WA 3S9YA 4MAZA 4LX4A 1UJPA 5G2WA 1OFOA 4HGXA 3FCPA 2Q71A 2H90A 3TWAA 2QR6A 4QTGA 1LL6A 5GJMA 2FMNA 1RUSA 2PTDA 4U28A 4ZOBA 1GVRA 1A49A 5D33A 4DJFC 4O15A 4EAYA 4Z0SA 5TBOA 1REQA 1E6NA 1BTMA 4QSFA 1JPHA 3WUGA 3C0SA 1ZBVA 3M0KA 3AXMA 5AYXA 3O6CA 4PCPA 1VS1A 4RNJA 5HULA 4LH8A 1QW9A 3HG2A 3AXIA 9XIAA 3WDRA 5LA1A 4HSNA 3VD5A 4NJHA 1W5QA 3VZXA 2PBOA 4JIEA 1EEPA 2YDAA 3DG6A 4EF8A 1I2OA 1CLKA 3SUTA 4NASA 2F9RA 2VNCA 2WKJA 2NUYA 4C6MA 2D0HA 4HOXA 1YIXA 1H50A 5BWFA 4J5NA 5E93A 3CLMA 1TE6A 2QMJA 1LQ2A 1TZ7A 5F2IA 1W1B1 3MPGA 1VFFA 2IQ0A 1LG1A 3QRHA 3IJLA 4XISA 4GNKB 4OQVA 1HKMA 2XUCA 4BQ2A 2W91A 2ABAA 3LNMA 2PPGA 2KZHA 4XVDA 2VEGA 1UROA 3TN5A 4A4AA 1MZHA 3C2OA 4C7FA 1YADA 3TA9A 1QVBA 3TYBA 1W31A 4BKNA 3VO0A 4Z2GA 3HPSA 4ACZB 1XHGA 1VF8A 1GJUA 4J3WA 5BRPA 1KLYA 1GQJA 3QFWA 3N2MA 3KOXA 5C9RA 3E0VA 4R9OA 4MPQA 4S38A 4NT0A 3V18A 1XYLA 3UWQA 3S1UA 1TV4A 2JF7A 1FWAC 3KM8A 3IGHX 4MWAC 3URQA 2AQWA 2WPGA 1LCOA 1KB3A 1EUNA 4MUPA 3WF4A 3VA8A 2J47A 1TRDA 1C90A 3H2CA 3WQ8A 4IHCA 1V02A 1Z6KA 2Y8KA 1FWEC 4L6OA 4J28A 2Q09A 1GUVA 3TVAA 2ZTKA 1ZBCA 1Q2SA 4W8BA 1XYAA 1VZWA 3QGKC 4L80A 4PCNA 2PZNA 7XIMA 5LA0A 4UQBA 2VC7A 5A6AA 4HQVA 4D6HA 5IBXA 4LCQA 4D8AA 3UZWA 4Z2IA 2BVTA 2QCLA 1D3GA 3DXIA 2J75A 4WZHA 3C8FA 4DAFA 1XUUA 4JYEA 4YTQA 1SJDA 4DELA 4XD4A 1Q4WA 1P7TB 1VLWA 4H04A 1TE1A 1JQXA 4QLKA 1PKMA 4BF5A 2HVNA 4GC4A 4XB3A 3WBAA 4AAJA 4PBGA 4GIYA 1PKLA 2E68A 1NWSA 4C90A 1KNWA 1EXBA 1TTQA 1H49A 3UWEA 3T0DA 4BWLA 4CN1A 4G5DA 3ABQA 2J7BA 2PB1A 1IGWA 3APTA 2FH8A 1XH1A 1FWFC 2HRWA 4Q8OA 4B3ZA 1UG6A 1W32A 3TW6A 4PYSA 4Q4OA 3NJ3A 1CZ1A 3VNDA 1WZKA 3PF3A 5EMMA 1BSIA 4I7WA 3RDKA 3AXXA 4LUIA 1PTGA 1IEXA 2DORA 2GDQA 5HJYA 3QY7A 3R8RA 1PTAA 2JKPA 3W9ZA 2DH2A 1YTDA 1YDOA 3BOXA 1O1ZA 2XM2A 2QW5A 2I5GA 1KGWA 5DY3A 4R85A 1K6AA 1V3JA 2DQXA 2XN0A 1HVXA 4A3HA 1V8EA 2PDCA 3QXBA 5K2ZA 3O2LA 3GW3A 4L6DA 2QF8A 1VYSX 3VDGA 4Q8QA 3VOCA 3RG6A 3R2GA 1GHRA 2Y61A 1RHCA 4H83A 2BWGA 3W7EA 2TODA 2PZ0A 1E9LA 2WKGA 4EACA 4M0XA 2VKZG 1EC8A 1GW1A 1W5MA 1VENA 2CXEA 4NZ5A 5DXXA 4GHRA 1XP3A 2WM1A 2BHZA 1GZ1A 1CW2A 1V0MA 2XFWA 4UXDA 1VBUA 3K4AA 2AMGA 3LPOA 4ZOCA 1S46A 4MNKA 1P0KA 3M0JA 3W1NA 2RGLA 3JZUA 4ERAA 1AQFA 3WF1A 1JZ3A 3DDMA 1H0IA 1VQTA 4G2DA 4IQDA 1V6VA 2P53A 2ZC1A 3FVMA 2AL2B 1DQXA 3CPUA 3MA8A 3EX4A 1JCNA 3AZTA 4RUBA 1I2NA 4EP8C 4PMOA 3DN5A 1FDYA 1B3YA 2ISFA 5REQB 1SZFA 1VB9A 2BODX 3UA3A 1P6CA 3V3WA 1S3TC 5U7SA 3MW7A 3UF9A 4PCTA 2R94A 1H09A 3UPMA 1YXYA 4LC6A 3WQDA 2XGZA 5IHRA 1LTDA 2Z6IA 3BVJA 1XFBA 2PF0A 5G1MA 4JIQA 3VINA 1J10A 2OVLA 5A6LA 2QJJA 4MYXA 1EJUC 4JHOA 2DUZA 3W4RA 3URAA 1GK8A 4XBKA 4GKTA 4YXGA 3NQAA 3F7JA 5T9CE 3PUEA 2INEA 2GGJA 2X0HA 1PVNA 5I0DA 4NHVA 3QR1A 1E4NA 1GQIA 1Q5MA 2FPTA 2VDHA 2ISVA 2XISA 3GU1A 3T05A 2G41A 4U3CA 1UD4A 4TX6A 4ILSA 3UU0A 4Q22A 3VM5A 2V67A 4LALA 3TWBA 1LRNA 1P4CA 3GH7A 3WQCA 2WSKA 1JYXA 3MUCA 3JU2A 2NQHA 5CSUA 3FSUA 3VGFA 2HK0A 4CU6A 1J6PA 3LBCA 1EHAA 2IQTA 4KGLA 4GJ1A 4WUIA 1NP0A 2XSAA 4FIRA 1RBOB 2PCQA 4KCUA 2GQ8A 1W2VA 4IIBA 1NAL1 4CNNA 1RZMA 3TYAA 4HPGA 2RAGA 2JKEA 3RJYA 2OWWA 3PTDA 2FKPA 2VD9A 5CZTA 1MQQA 3UJSA 3GDTA 3NPUA 3LENA 3WDQA 2VFHA 4NZ3A 4M1RA 3EWWA 4IISA 1MVYA 3GXDA 3PBYA 2NXGA 1P1XA 1VFMA 5E5CA 1CGXA 2PDQA 1JR1A 3B9EA 4H8VA 1H41A 4OIFA 3E2VA 2VI0A 3HGOA 4J2MA 3XISA 4PMQA 3BOLA 1PIGA 3PNZA 5HWMA 4K37A 3DFNA 4GMEA 4M5PA 1JCTA 1AJ2A 1M3UA 4CD7A 3KCJA 4DBUA 4UTHA 3WLSA 5CC3A 4EPEC 1XH0A 1SU5A 3RPTA 4MUZA 3WQFA 2BVWA 2A3LA 1ZU8A 1JDFA 1FCVA 1BAGA 4FALA 4FNQA 3GTIA 1X97A 2X05A 5HA7A 3W7OA 1UR1A 2PUZA 1UHVA 3OGVA 4QJ3B 3MI2A 2ODOA 1A5CA 2WVSA 1BD0A 5HJXA 3TSBA 3SUUA 4B4HA 4O53A 3W1AA 4PTVA 4U4MA 3WX7A 4MLJA 1OT2A 1EP3A 2X8RA 3QKEA 3T6CA 3I10A 3C0LA 2XN2A 2YCJA 1G1YA 3SN4A 2Q02A 3W7IA 3W0KA 4CD6A 3LRLA 3JS3A 1P6WA 4AF0A 3CHCA 5G2HA 2JF6A 2WCSA 3LNPA 4GFSA 4YCPA 3QPEA 3N4EA 4FF7A 3WLKX 4J9JA 3UG4A 3SSZA 2JGYA 3BSHA 3PWIA 1EDTA 1XRTA 2E67A 4B5UA 1BVWA 4HB7A 4GUJA 3DHPA 3W2NA 2VZOA 3RX2A 2Z7KA 3UVIA 2FMOA 1G67A 4V2XA 1KKOA 1BPLB 4JTCA 3F4NA 2E5BA 4NNBA 4GQQA 1BF6A 1JDDA 3O9NA 4YU1A 4XQ6A 3B9AA 3FNDA 4IUOA 3MJYA 1E6QM 2X1TA 3OODA 4QNEA 2YXOA 1ZP3A 2E9LA 4GJIA 2ZYFA 3BUVA 1W9XA 1ZL1A 2BY2A 1VCFA 1TSIA 4UTTA 2OCZA 1EOKA 3QZEA 4IICA 1EUAA 4AZCB 3FYOA 2WVTA 2Z29A 4ZO7A 1JNDA 3P14A 2X2GA 2J7GA 4U2ZA 1IEWA 4GUFA 3UWWA 4PTMA 4XD5A 2VZTA 3VCCA 4R27A 2RGMA 1HJXA 2GQ9A 4H9YA 3WELA 4B9YA 3KOYA 2HNEA 3IGSA 4ZMGA 3OYXA 4AISA 2WWDA 5E6ZA 4O4VA 3VFCA 4PEKA 1DIEA 5CJMA 4I6VA 4H01A 5I3FA 1MQRA 2OGYA 3EX1A 2NQLA 3WUFA 4EPDC 1P0DA 4ZFCA 3E38A 3W7GA 4QE4A 1JUKA 3NSMA 3WQOA 2FTYA 5CAKA 4JIHA 4XIMA 4QS5A 3KS6A 3OEXA 3MVIA 3UPBA 1P7TA 3S1VA 3NPWA 4FNUA 4O1DA 4QCEA 4NY2A 4JIIX 2YW3A 3S5NA 1TZ9A 1FFRA 4NSBA 3WK0A 1RALA 1MQPA 1GPFA 4O1AA 4C5ZA 1ME7A 1X98A 3ARUA 3HG5A 2NXIA 3VIGA 3GHSA 4JKMA 4XZMX 3EOUA 3O7UA 4W5ZA 1WDWA 2WSYA 2E7FA 4MPKA 3GKAA 1WZMA 1C7SA 1N8WA 1EF3A 1PX8A 4S2CA 4HJWA 2XFFA 3E02A 1EJRC 3WLNA 1W3LA 4PUMA 1QT1A 5FJIA 1PZ3A 1MEIA 3QV8A 4CVWA 4HCLA 4BR1A 1K9DA 4JYDA 5K9DA 4X63A 3GSMA 4O54A 2GJRA 3O63A 3CL6A 4YMZA 3G6LA 3WLJA 5D32A 3STFA 4Q8WA 4UNLA 1W3JA 2MNRA 3S9ZA 1E9YB 3LBOA 3P8JA 1K8YA 1Y65A 3KZPA 5A8MA 2QCDA 3AHTA 4KWUA 5DT5A 2HXTA 1V3IA 1TREA 2YOCA 1DTNA 4I7VA 3S4TA 4RNHA 1H1ZA 3UXDA 4OTKA 1X1OA 3T8QA 3MMWA 4GQ0A 2NUXA 4MDPA 4LB3A 1M7JA 4PZVA 4UC5A 1JYVA 3I6TA 4UFHA 3NL2A 3GG1A 2A3AA 3M7WA 3VZYA 1OC6A 4NUWA 3OHIA 4CD5A 3VIFA 3W7LA 3CZKA 4AD4A 2GSJA 4L9ZA 3UXKA 4GGBA 4V27A 1RR2A 3EOSA 1PCWA 1R8LA 1T40A 1E55A 5HINA 1FRBA 1EZWA 3GRIA 5LNSA 2OSYA 2O9RA 3KL5A 2OEJA 2PCEA 3ZJ8A 4UFJA 1ELSA 3STEA 2PGEA 1OGGA 4FLSA 5CXPA 1R3RA 3CQIA 3WEMA 4F79A 1HG3A 1XJBA 2WB5A 4M19A 2MANA 4JZ5A 3ZVHA 3QR0A 2WLYA 3A6OA 1UKPA 3WJYA 2G0WA 4WOQA 3WH6A 2E25A 2OOFA 5LNWA 1JZ8A 4NRSA 5A2AA 1CIUA 5DQPA 2A2IA 4FXFA 3RYSA 1UWRA 3EBVA 1TG7A 4HA0A 3M0YA 3WEOA 1TV8A 4X2RA 1MRQA 5C6MA 3APYA 3MUZ1 4QLLA 2E4TA 3DERA 3W1MA 3ARSA 3PZMA 3VNYA 3MSRA 5EBAA 3NFUA 1QR7A 3QPZA 5BROA 4OGZA 2ZXAA 3MY9A 1KRMA 2EJ1A 4C1LA 3STCA 1O5RA 2Z2BA 1DXFA 3VMNA 1NP2A 4LBRA 1L6GA 3BLIA 3T07A 1JIBA 4YTTA 2WXDM 5U4NA 4ERIA 4LEQA 3W24A 3AXHA 2DIKA 5MF5A 1SYTA 1KO0A 1WUFA 3PK7A 4ZB2A 3TJIA 1NF0A 1VFSA 3L23A 3BWWA 3MCMA 3FS2A 3VIJA 4GCXA 5JBEA 2YL6A 4NVTA 3PZOA 3AIEA 1XCXA 3MB9A 3E0WA 1R3VA 1A5AA 4ZSTA 3LPPA 4N6FA 1X8CA 4XAGA 5C9WA 1K9EA 4BF9A 3S42A 3N3TA 2VQUA 4R7WA 1S2TA 2PP0A 1UKTA 3VYLA 4XZNX 1KTNA 4QFUA 4K8EA 4KF1A 2EQDA 1DL3A 3V5CA 4DVOA 3H55A 1PBGA 3DFQA 5JMUA 5XIMA 2CYGA 4C1NA 4ZO9A 4H6KA 1PV8A 4KEMA 1VBRA 1KTBA 3AXKA 6ENLA 3SCVA 2ZZ6A 1MEWA 2D3NA 3SY5A 2E5CA 2WPBA 2AKMA 3ABOA 4S3EA 5TNVA 5D37A 3ANUA 1GG0A 1TPC1 4ZODA 5HQMA 2OWXA 2XIBA 3ABRA 5CJ5A 2DT2A 1U5HA 1QBBA 3B8IA 2D2HA 4F9DA 3U9IA 1FBAA 4RCXA 2CZ5A 2CKSA 4X22A 5AECA 5CPOA 1HL2A 4M7TA 2FTWA 1OYAA 1TVLA 1RPKA 4S2BA 3ZT5A 3AS0A 1AH4A 4WDXA 5C5YA 3W2KA 1XL9A 5EMKA 3IGXA 4MWAB 1BXBA 1WX0A 4FHAA 2A6LA 4ALDA 4PH6A 3ABXA 1IWAA 3UP8A 3OZPA 1MW2A 1TWSA 1P6BA 1ZQ5A 3LB0A 2WWCA 1FCQA 1XBVA 4IX2A 3L12A 1GJWA 4PODA 3W37A 3GXTA 3KRUA 4CQCA 1N55A 4CUCA 1M65A 2P76A 2F38A 1ISZA 3RITA 2WBKA 3Q65A 3UGRA 5M03A 3CMFA 2I5QA 3ZJKA 2ALRA 1IQ8A 3GDKA 3EXTA 3U3HA 4HBKA 5K4XA 3UY8A 3SRHA 4AHPA 2XWEA 3WF0A 4ZB5A 2Q3OA 5HMEA 1EJ7L 1TV5A 4HYRA 1GQNA 4MKNA 3K8KA 3WZ0E 1XV8A 4F2UA 2I1OA 2XJ7A 3IWPA 4NP7A 3DIPA 4AZBA 1T41A 1IZKA 3QM3A 3M64A 4PMZA 3THAA 2V30A 3S2NA 5GJNA 4IP5A 3SM0A 1A3XA 4DYKA 1XPGA 4MB5A 1TX2A 3JVAA 3Q94A 4IJRA 4JQ2A 4YPJA 4DRSA 3W1PA 3KP0A 2DSZA 2QMKA 4I5XA 1JUEA 1E1CA 5A95A 2VQTA 3NXFA 1UR0A 1ZUAX 5A8GA 1A0DA 2J6XA 1OC7A 4MJZA 3P60A 1XC4A 3E3HA 2X41A 1X8FA 3WLIA 1I9CB 3KOWA 4M3PA 1WQ5A 3CWHA 3GXIA 1L8PA 1BLIA 1U22A 3T44A 1CBGA 1C92A 5JXQA 1W3KA 3WNLA 4MVAA 4AZ7A 1XINA 1K03A 5H1WA 1R5YA 1LZOA 4DYJA 1F3EA 1B4EA 3RX3A 1GONA 3WH5A 4O1EA 2VR2A 2C79A 2VX6A 4M81A 5H91A 4K36A 4F0LA 5H2ZA 1NDYA 3VC5A 2ESCA 1OFDA 4HJFA 3G8EA 2ZWYA 1KXVA 3NM3A 3S6OA 3E2RA 4A3QA 4A3YA 1RP8A 1LJYA 3K8LA 4ENLA 5DMYA 3KOZA 3OLIA 4O10A 1DKWA 4PMDA 1UR3M 4ICCX 1OFRA 3PZQA 1QNRA 1UCWA 4LAUA 3SIZA 4EXQA 4L4OA 1H7WA 1QI0A 4UOJA 3MV01 2YKKA 4DXKA 3QYQA 4F9JA 4E38A 3WF3A 4RXFA 1YBQB 3W02A 3QBUA 4D6DA 2Z27A 2ZZ5A 3WMLA 2POTA 3VOIA 4UFMA 3MO4A 4HP5A 3DKJA 2W61A 4OOZA 3ABSA 4O16A 4H7CA 1ZCCA 2QCFA 3RGTA 1R2RA 1W54A 2WHLA 3K30A 4XD3A 3SEPA 1EA0A 1QWGA 1UBPC 3PJXA 3RRXA 1EXPA 1IT8A 4DYEA 2YBUA 3U4FA 2CBUA 1SR0A 1V77A 3QLLA 3BPWA 2BY3A 1OCNA 3UG5A 3VIIA 5TD4A 4UTMA 4KWWA 3QZ6A 4AY8A 1VAHA 1HX0A 4JTQA 3CV7A 5J8LA 2RJHA 4A8IA 4WXYA 5FESA 1XBXA 3H2OA 4GYKA 4ORMA 1EGVA 5I2UA 2Y63A 5G4WA 4MADA 3M6DA 2QUMA 4PTDA 4O17A 2QYGA 1TV3A 2HVMA 3FJ4A 2VYOA 3WUEA 5GQBA 1ODZA 2EKCA 1DIOA 2VRKA 5FEXA 1IR2A 1SSDA 3U2EA 4D6GA 4JTGA 4Y9NA 3BV4A 3BMXA 1WAUA 1W3IA 3NVDA 4L64A 3HOJA 1KXQA 3FHAA 2QNEA 5CPMA 5EMYA 3W84A 1RSCA 4YVVA 1VFTA 3LSCA 4QGCA 1AFSA 1EJSC 4UCGA 4HU8A 3TZFA 3DFOA 1QK0A 3NQ6A 4AH7A 2W92A 5FJTA 5AVHA 1DJNA 5JUVA 2GJXB 4GQBA 5GPRA 4JN8A 1RVKA 2VFIA 3KTCA 1MYRA 3TW7A 4DJEA 1T7LA 4ZEPA 3T9PA 2GVLA 3EOLA 4WY0B 4H19A 3CV2A 3WKZA 1JQVA 1QI5A 3R8GA 1H2JA 4UQCA 4CKQA 5I03A 3LCHA 4NI3A 4O13A 4B3LA 3BGGA 1OF6A 4LUYA 1PSCA 1Q7ZA 3DENA 2YZ5A 4HK6A 1P0EA 2OZ0A 5CPLA 3N4FA 1ME8A 3N2TA 4MGGA 2V5BA 3UXLA 4LFYA 4MB4A 3UBPC 1UPMB 2YDSA 3AWOA 5K7JA 3M1ZA 1J9YA 1OX4B 3OOQA 3HPFA 5A1AA 4YYCA 3N29A 2BHYA 2QV5A 2OKTA 3DI0A 1HO1A 4GWEA 1UOZA 4YIWA 4TV5A 2QDGA 4DJFA 2ZUMA 2YXGA 1BQGA 3LPGA 3TP4A 3AJXA 3SCSA 4LW7A 4UOQA 4JTSA 1U30A 3DUGA 1V93A 2W67A 3CUJA 4H7VA 3W1TA 4LU0A 2AOSA 3NO3A 3DYMA 5ABFB 1M7PA 3TJ4A 1JPIA 3KBVA 1U1UA 3OVGA 3PJWA 1H5VA 1JG9A 3FYYA 3GK0A 3MO7A 2XIOA 5KTLA 1M7XA 4FNSA 4UZUA 2CZDA 1Q6LA 2O4QA 4WSKA 4PTXA 3RN6A 4XAYA 1E0XA 4H41A 4JFSA 4Z1AA 4P61A 1RK6A 5D03A 1GEHA 1WOAA 4RZ4A 3S6DA 4R3UA 4E4UA 2PDYA 4X9SA 3S5ZA 4IMAA 4ECLA 5IBXC 3AI0A 4US6A 1EKOA 2FYMA 4GH1A 4QEHA 3NNTA 3ALGA 3B05A 4Q8NA 1HGYA 5A2CA 3L2LA 3EKGA 5AYIA 1E9ZB 4EKJA 1H1YA 3ABZA 3WLTA 5AFDA 1EQPA 2ZBTA 4RE2A 4M1BA 3VKJA 5BOOA 4FSAA 3MUIA 1NWUA 3L4YA 1XCFA 9RUBA 3W1RA 2FGBA 3PPGA 3VKKA 4W86A 2ZX5A 3VAVA 4JN7A 3VTRA 3SBFA 1YPXA 2VT0A 3UETA 1MW0A 2ACQA 2VWSA 4MYAA 3U48A 1POJA 1XG4A 2A21A 4YVPA 4WDWA 3C8NA 1B3OA 3MDWA 4JTTA 2TAAA 4AVNA 3DCPA 1DJQA 4OECA 2FB3A 3FKKA 3BAIA 2OO0A 3H2MA 2B7OA 4OBTA 5F2GA 3QY6A 5I6SA 5CCZA 1EJTC 2WOQA 3ARYA 2CZFA 5E9AA 1SO6A 1YDYA 4H8UA 1P5BA 5IXEA 2QHAA 3S47A 2GK1A 5L9FA 4GFIA 3F5KA 4K7VA 1E3XA 4J3SA 4YNGA 1AMYA 4JX6A 1KFWA 3B0VC 2BXZA 1D9EA 2Z2AA 3GUGA 3VZZA 3IAPA 2XH2A 4FNPA 4QG9A 1AG1O 3F2CA 1KM6A 1THFD 2VD8A 4L4MA 3LLFA 1R9XA 4N02A 3POCA 1O4UA 3N17A 1GYMA 4Z17A 4GJJA 2G95A 1C93A 2IKJA 2BVDA 2HTMA 3S2MA 4RPPA 1J11A 4N6EA 5CG0A 1SFLA 2DSKA 3L0KA 4L1GA 3AIQA 1KD0A 1DE6A 1GVIA 3ECQA 2VUNA 4HOZA 3SQSA 3C2YA 5DXYA 3RR1A 3VMPA 4PB5A 1AH3A 1UYQA 2WLZA 1VFLA 2VO5A 5EYWA 5G1TA 1L0PA 5DELA 3C86A 5FAGA 3W7PA 1PHQA 4E8CA 4DUVA 2WMIB 1XIMA 2NV9A 2PTXA 2W27A 1XGDA 2HZGA 2BV9A 5AVNA 2OZ3A 2B7QA 3QLDA 4ICNA 1XIDA 1ZSXA 7ENLA 3LEPA 4FS9A 1Z89A 3G2GA 3U5YA 1LQ0A 2PLCA 5FL0A 1JFHA 3L2MA 4MY1A 1AQHA 3HGJA 2V2DA 1J18A 4D9PA 2KX9A 4MY9A 5D2WA 1KBJA 1RQBA 3UG8A 3LI0A 4DM2A 1XUZA 5LYRA 1X1ZA 4E0CA 2RDTA 4ZO6A 1IHIA 1SFJA 2YW4A 2V68A 3W76A 1VC4A 4W7WA 2Y2WA 1DJZA 2QF7A 4Z1DA 3W01A 1F8MA 2C71A 2FZNA 4Q4KA 2DZUA 4C6FA 4J1OA 4YTRA 1XYMA 2BY0A 1B1YA 2XH0A 3RNDA 4LEFA 4ROQA 1UQZA 3W7CA 1J79A 2GOUA 4XBSA 2POZA 2J8TA 3OZOA 4IG2B 3WBEA 1EFZA 4OUEA 1IXNA 1H7XA 3WNKA 1SZRA 1ME9A 4JTLA 3GB6A 3YPIA 3DG3A 1C8VA 1P0NA 1ZALA 3F4VA 3IJ7A 2HJPA 3CHVA 1PL9A 4DPQA 4D6JA 1KM3A 2CLKA 3O06A 3LSBA 2QUUA 4ZQMA 4FO4A 4HTBA 2A1YA 3GFYA 4IMDA 1YBQA 4FI4A 3WQPA 1UKOA 4QXIA 1W1TA 3DFTA 4GO9A 2WANA 3DECA 1G0CA 1X6UA 5I3GA 3V75A 4IM4A 5AC8A 1K4HA 4C6PA 2QKFA 4BEQA 3ZYZA 2FVKA 4GYPA 4IH3A 3P93A 3W1QA 4JQ3A 3IIOA 1DQWA 1VIZA 2J7EA 5D9NA 2PU1A 2IXUA 4LBSA 3OJGA 3W70A 1SR9A 3DH7A 3GNXA 1ZJIA 1ICSA 3NOEA 4HU3A 4GVIA 1LLOA 5AYZA 2NWRA 3P5YA 3DG7A 2F6KA 5A8OA 4JTRA 4GY0A 1TJ2A 2UV8G 1V7YA 3L9CA 4D1IA 1LOSA 2OFJA 2OZ8A 3HG4A 5G2IA 1I2RA 1LOQA 3VFLA 3VNKA 1PWMA 4LAKA 1F6PA 1NDZA 3I4EA 2DJLA 2NT0A 3MDUA 2CU0A 3LHYA 4HD5A 1QO2A 3E2SA 2J7FA 2ZE0A 3VD7A 4UTKA 3CUXA 2YCLB 2IUZA 3EAUA 3P81A 1L6WA 3CZ8A 2D23A 3NR0A 4GPNA 5C70A 3A5VA 1QHZA 4D8LA 2G5WA 4AMCA 3IGUA 3KAOA 3NSXA 2X1RA 4FB7A 3MCOA 2GJXA 1A4MA 4E4PA 5CBBA 1LBMA 1OIMA 2BXVA 1FDJA 4CD4A 3W6LA 4NYUA 5BU9A 4ATWA 5KZDA 1DE5A 3ATYA 4UQ9A 3ZQ9A 1E0WA 3TAOA 2FZBA 2NZLA 5CGQA 4GI4A 4W85A 2ASHA 1QPNA 3TC3A 3ZWTA 2MUCA 3IRSA 4QE5A 2Y5JA 3AUJA 1BVNP 3QW4B 1DWIM 4FLQA 4DB7A 5H8UA 1OX4A 2VX4A 3NCOA 1W6TA 3A9IA 4KKXA 3PHAA 1ISVA 1Q66A 3EDDA 3S5SA 3GQYA 4F4RA 4K7YA 4KIEA 4AVFA 3WD2A 3S5OA 3G1YA 1D2KA 3R13A 3XINA 3IK4A 2GUYA 2E6FA 4TTGA 2XTKA 1OGBA 1AVAA 2REQB 1E6ZA 4QG6A 4RV3A 1R87A 4UTTC 1UWAA 3REQA 1H61A 2J79A 2X0SA 1RAKA 3F5LA 3HPAA 2XFRA 3ZT7A 3TOPA 5FF0A 1AL8A 3K8MA 4TR9A 1TPH1 1QK2A 3LXBA 1B90A 1I2QA 3AAMA 5JU6A 1J8VA 4U33A 4DWSB 5A6JA 1E40A 1CT5A 3EB3A 3UZ5A 1G4EA 2E8ZA 2PF8A 3LM7A 5C71A 4LOCA 2OYMA 1KM1A 3N6JA 4R34A 1YDVA 5EA9A 1UD3A 4IMGA 1EHNA 3BLPX 4JTAA 3CEPA 3OA5A 3R79A 2A4AA 3FGCB 3EKLA 2AAMA 2ZICA 1FWHC 4MZ1A 4GGHA 5A8PA 1ITXA 2NW0A 1TV2A 1GVFA 4Q7NA 3UZJA 4U31A 5LKYA 1UZ1A 3SJ3A 2VC5A 3QOMA 4GY1A 4AX6A 4NXSA 1A3WA 3L4UA 3QQ0A 2RDXA 2FDSA 4UBPC 5AZ1A 4H1ZA 1N8IA 2VMFA 3BMWA 4JXCA 5BRQA 3OVQA 4ASTA 3T81A 2ADAA 2GDVA 1V08A 1T99A 4G9PA 3G1AA 1DP0A 3LY0A 2G37A 1BRLB 3NQFA 1QHPA 2G3NA 4RE3A 4MB3A 1PXGA 2BP1A 2FGLA 1JYNA 4MG4A 5T26A 3NEVA 3CMJA 1XIEA 4CQ9A 5GNZA 3FEQA 4LCSA 1KRBC 3AICA 1LRQA 3T2PA 3GBDA 5D38A 4M6QA 3DBPA 3G0XA 3M44A 4LVDA 3WN6A 3SB0A 4IMEA 1V0KA 4A2SA 1TCDA 3KDNA 3LHUA 1B9ZA 4N2YA 3BW2A 3CU2A 1XWYA 4PCSA 3QFEA 4XBJA 3CQJA 3LU2A 1VJIA 2CLFA 4W4QA 3OW1A 5CSSA 4KQNA 3S46A 3WNOA 1QBAA 3T08A 3W83A 4HA3A 5C2GA 3TEVA 3KFTA 4KRUA 1QNVA 4JTJA 5J5RA 1SVDA 3EEZA 3WD4A 4C7DA 3TTYA 1BYAA 1IZCA 2NX9A 2Y89A 4DJDD 3D5HA 3MU7A 2CHNA 1XS2A 5TQLA 1XSKA 3AC0A 3QMTA 3RJXA 1R3SA 2ZDSA 3OGSA 3SZ8A 3CUFA 3W2LA 5JIPA 1GOOA 2ZX8A 4GNVA 3WQ5A 3CQKA 1XI3A 2AQOA 2OT1A 1SJBA 3MUY1 3LERA 3VNIA 4OJYA 1EYWA 2PE4A 4IL2A 3LZ3A 3RF9A 5FACA 3GDMA 3EWBX 4HPXA 1EA9C 2G3JA 1EP1A 3AIRA 1HKIA 4LY4A 3CHFA 3NAVA 4NKCA 5IDIA 4W8AA 3GTFA 1C8QA 1QNSA 3AZSA 4Y96A 4S1FA 3OQ8A 3V1HA 1AD1A 3O07A 4TVDA 1JCMP 4WEVX 2ZXQA 4WRHA 1IR1A 1Z32X 1ZJHA 3W7NA 3M9YA 3RILA 3TLLA 4GZEA 1TMLA 4O4WA 1K8CA 1HN1A 1HKWA 2YPIA 1JF6A 3N2CA 3C2EA 3C4UA 1L6SA 4NXKA 1B31A 1H51A 4GKLA 1W9BM 2C1GA 2OG9A 2ZRZA 1XDLA 4RXGA 1TUXA 1NWRA 1J01A 3EDKA 1UZDA 7REQB 4DLMA 2C0HA 4HIBA 3GH5A 1PX3A 3M0MA 2YIHA 1F05A 1WDSA 3P8IA 3NQMA 3RLGA 1RA5A 2Y5SA 4XKMA 1Y5XA 2GLKA 3USBA 3RMEA 3SQLA 4GIRA 3KVJA 4WKAA 2HWGA 2WJZA 4XZLX 4KEUA 1HKJA 1HNYA 2IPFA 2J78A 4C91A 3L4WA 3RM8A 1LL7A 1EBGA 3MBFA 3WJZA 4IG2A 5FF4A 3WBYA 3D6NA 2B4GA 5EMLA 3OO2A 1ITCA 2DP3A 1HKVA 4IXHA 3PC0A 3I68A 1FY6A 3KZSA 1H63A 3G1XA 3MKVA 3QHMA 4JR5A 5LIYX 1AH0A 3V36A 4B3KA 1REQB 3MCNA 4UCFA 4PMVA 5C2CA 3LGEA 1RXOB 2HISA 3SUVA 2A3CA 2O9TA 1E0VA 4PMRA 1W56A 4E3TA 1O5XA 1HF6A 3CPGA 2F61A 4KRZA 4LVAA 2OLHA 1I8JA 3L65A 2ISDA 3DFHA 3M5YA 2HS6A 3COTA 3U5UA 2ZZ1A 4UFIA 4MZ8A 2J4GA 1H60A 3GHUA 1Z42A 3PZTA 3DFYA 3KVLA 4BZYA 3EWYA 4QNWA 3LGDA 5H6HA