3THKA

Structure of sh3 chimera with a type ii ligand linked to the chain c-terminal
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
58
structure length
58
Chain Sequence
b'KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAYVKKLDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title High-Resolution Crystal Structure of Spectrin SH3 Domain Fused with a Proline-Rich Peptide.
pubmed rcsb
source organism Rattus norvegicus
molecule tags Structural protein
total genus 12
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3thkA00
2DBMA 3VS6A 2LZ6B 4Y92A 2KT8A 3A98A 3UATA 1UUEA 1ABQA 3GBQA 2RQWA 1TUDA 5IHIA 2J06A 3VS2A 3QWYA 2F2VA 3O5ZA 1QWFA 2EKHA 2DL3A 1HD3A 4J9GA 5I22A 1GBRA 1AWJA 4F14A 2LJ0A 1PRMC 2DBKA 1QKXA 1WXUA 1WX6A 1PWTA 1M30A 1OOTA 2NUZA 4OMMA 2J6OA 2GTOA 1KFZA 1NEBA 2EYZA 3I5RA 2X3XD 1FYNA 2BZXA 2FEIA 1PRLC 3UF4A 1M3AA 2CT3A 3M0TA 1NLPC 4J9IA 2JMAA 4K11A 2AK5A 4RTXA 2KYMA 1AEYA 1SSHA 2BTTA 4CC3A 1YWPA 1SHFA 2M51A 3NPFA 1OPKA 4DEXA 2C0IA 1MV0B 1GBQA 1VYUA 3I35A 1CKBA 2HBWA 2A36A 2K79A 5EC7A 2DF6A 4HCKA 5FW9A 4IIOA 4AFSC 2LQWA 2EPDA 1YP5A 1SEMA 4Z8AA 1Y0MA 2YUPA 4RUGA 2EBPA 1M27C 2AZVA 2RQTA 1JEGA 1BB9A 2HEQA 3RBBB 2OAWA 2LCSA 2AKLA 4CC7A 1Z9ZA 3CQTA 1UHCA 2W10A 1Z9QA 3I5SA 3IQLA 2KBTA 1J3TA 1UJ0A 1KJWA 1BK2A 2L3QA 2C0OA 4HVUA 1UECA 3PVLA 1PHTA 2D8HA 1ZX6A 5ECAA 3SEMA 2FPFA 2L2PA 1W1FA 1SRMA 1A0NB 2RQRA 2RQUA 4ZNXA 4AFZC 1H3HA 2CDTA 1UTIA 2DM1A 3EG2A 1WIEA 1E6GA 4WCIA 2OI3A 1OV3A 2VVKA 2YDLA 3VS1A 4EIKA 2A08A 3TSZA 2HDAA 1K0XA 2O31A 4RTUA 3VS4A 2DVJA 1ABOA 2AKKA 3H41A 4JJCA 1WDXA 2JW4A 1ZSGA 3M0RA 2JM9A 2E5KA 5IXBA 1JO8A 2DMOA 2O9SA 2MCNA 3H0IA 5HCKA 1T3LA 2CSQA 3LH5A 2EGCA 1NEGA 2LX7A 4J9EA 1WXBA 2O2OA 1OEBA 1I07A 2CT4A 1FMKA 2MOXA 3FJ5A 1IO6A 2EYXA 2DL8A 3NMZC 1VYTA 1ZBJA 2DL7A 5GJVB 2F2XA 4F17A 4GLMA 2DILA 4DEYA 1PKTA 2IIMA 2D1XA 3UA6A 2K7AA 2J7IA 1B3QA 1GRIA 2KEAA 5IHNA 2ABLA 1SRLA 2RPNA 1S1NA 1X2KA 2NWMA 5FWCA 4J9HA 2DL5A 1AZGB 2O9VA 4OMQA 1RLPC 1BBZA 2EGAA 2YUOA 4F16A 2JXBA 2EQIA 4Z88A 4LUEA 2DLPA 1K0SA 2DA9A 2CSIA 2GTJA 4D8KA 1NG2A 2DE0X 2J6FA 3U23A 1K1ZA 1MUZA 2EGEA 4JJBA 2A28A 1AWOA 1SHGA 2ED0A 2JT4A 1X69A 1NM7A 3EHRA 1UGVA 4J9BA 3EHQA 1RI9A 2LNHB 1AOJA 2EYWA 1I1JA 2FO0A 2K2MA 2RNAA 1KSWA 2LMJA 2PTKA 1E7OA 2C0TA 3JV3A 4OMLA 1QWEA 1AWWA 1UFFA 2KXDA 3THKA 2GNCA 3H0HA 2YSQA 1JXOA 2DX1A 4LUDA 2RMOA 1NYFA 2EYYA 4R0KA 1QLYA 1NLOC 1UG1A 4Z89A 1M3BA 2KRMA 3VS3A 4ORZA 1V1CA 2LJ3A 2JTEA 2GGRA 1B07A 2LJ1A 4J9DA 4RTTA 4RTYA 1HJDA 2KT1A 2DRMA 1JXMA 1K9AA 1T3SA 2J05A 3M0QA 2ROLA 3UA7A 1E6HA 1YCSB 4LNPA 1U3OA 1X27A 2EW3A 1X6GA 2L0AA 2CREA 2HCKA 1GCPA 1GFDA 1KIKA 3EG3A 2YT6A 4RTWA 1GFCA 4X1VA 2EVRA 2KGTA 4E6RA 1ZLMA 1W6XA 3EG0A 3KFVA 1VA7A 2F2WA 1K76A 1T0HA 1YN8A 2ENMA 1BU1A 1Y57A 3VS0A 2LQNA 2RN8A 2D0NA 4HVVA 2L3PA 4JZ3A 2YUQA 2V1QA 3VS5A 2AZSA 1UE9A 3VRZA 1X6BA 2KYBA 4ESRA 4CC4B 1T0JA 2J6KA 4RTVA 4AG2C 1LCKA 2JM8A 1CSKA 1HSQA 2KRSA 4J9FA 2CH4A 1U06A 2KE9A 2RF0A 5IH2A 1MV3A 2L3SA 1QKWA 1RLQC 4FSSA 1RUWA 2K3BA 1M3CA 3REAB 1QCFA 2P4RA 1JU5C 2XMFA 2CUBA 1WYXA 2A37A 1I0CA 2ESWA 4J9CA 4KRTA 2B86A 3EGUA 4OMOA 4JPBW 4RTZA 4LN2A 2DJQA 4D8DA 2RQVA 1YWOA 3C0CA 2KXCA 1G2BA 4OMPA 2ED1A 4AFQC 2K6DA 3ULRB 1G83A 2ROTA 1VYVA 1WFWA 1UJYA 2X3WD 2DNUA 4JZ4A 2SEMA 3NHNA 2HSPA 1M8MA 2PZ1A 4AG1C 2FRWA 2M0YA 1WXTA 3REBB 3TVTA 3RNJA 1WLPB 2JS2A 2FG0A 1K4US 1W70A 3M0UA 2BZYA 1ZUKA 1PKSA 1GL5A 3M0PA 2CH4W 2MIOA 5IXFA 1AD5A 1TG0A 3VRYA 1CKAA 3M0SA 2GBQA 5FWBA 3EG1A 1YNZA 2SRCA 4CC2A 2I0NA 2VWFA 1ZUUA 1EFNA 2YUNA 3ZL7C 3NGPA 4QT7A 2JMCA 2KNBB 1PNJA 1ZUYA 5I11A 4OMNA 5GJWB 1X43A 2O88A 3R6NA 1OPLA 1WA7A 1WI7A 2CUDA 4IIMA 3H0FA 4AFUC 4LE9A 2FPDA 1N5ZA 2PNIA 1SPKA 1TUCA 3PE0A 4JJDA 1JQQA 1H92A 3SHWA 2ECZA 5IHKA 2K9GA 1AWXA 3QWXX 2D8JA 1AVZC 1ARKA 2V1RA 2FRYA 2LP5A 4M4ZA 1UHFA 2DRKA 3TSWA 2OJ2A 3VS7A 2QDLA 2KROA 2W0ZA 3I9QA 2DYBA 4GBQA 1H8KA 2DL4A 1UDLA 3PVQA 1GCQA 1X2QA 2BZ8A 1U5SA 2H8HA 1NYGA 2G6FX 2GQIA 1GCQC 2KR3A 2KRNA 4HVWA 2JS0A 4HXJA 2VKNA 1XOVA 1AZEA 4A63B 5L23A 2FPEA
chains in the Genus database with same CATH superfamily
2PUKB 2HAXA 2IVWA 1OYXA 2RQWA 2J06A 4OB3B 1U1TA 3OS0A 1QVGS 3O5ZA 4HCZA 1LOJA 2EFIA 2FZKB 4F14A 1PRMC 1ZA1B 1WX6A 1M30A 3DLLA 3JAME 3CCST 2FL7A 1FMWA 1NEBA 1OZ3A 1VQOQ 2A3LA 1Q7YC 4B9XA 3JCMW 2RHZA 3EH2A 2CP6A 1NLPC 4J9IA 2NUTA 1G3TA 1TXQA 2AK5A 4BE1A 3CPWP 4WTOB 4XTUA 4CC3A 1TS9A 2Y4XA 1YWPA 1SHFA 1H641 1OPKA 5LJ5d 2C0IA 1MV0B 2DTHA 1GBQA 5FU7C 1BYMA 5CVIA 4J7IA 1JBMA 3LX7A 2DF6A 4HCKA 4C8QE 3OYAA 4IIOA 4AFSC 4Z8AA 2EBPA 5FRNA 3FRNA 1BB9A 2JVVA 3JCMf 3JB9I 2HEQA 2CZ1B 3M53A 3RBBB 3NTKA 1EX4A 4CC7A 1YJWT 1Z9ZA 3CQTA 4A53A 2CYZB 3I5SA 2QI2A 1QVGA 4KGVB 4ZGDB 1BK2A 3G4ST 3CC2A 4IUUA 2XG8D 2C0OA 1VOMA 4HVUA 2D8HA 4ZN3A 1VQ9T 3P8HA 1MHNA 5IAYA 2VV5A 3BE3A 3G1JA 3EFOB 2EJFA 1H3HA 2O01E 1KD1R 3EG2A 1QVFP 1UB4A 2VVKA 1R0CB 1KHIA 2XIDA 1D0XA 4FT4A 1RACB 1I4K1 2DD4A 2HDAA 4BY6C 3VS4A 4C5IA 3CPWS 4M7AF 3PT9A 3S3NA 4OB0B 1PD1A 1ZSGA 2WSFE 3M0RA 4QQDA 3I55A 4OGEA 2LRQA 3LWIA 3EGXA 5D7UA 3CCMA 1OQKA 2HQHA 3H0IA 2BIVA 5LJ3h 3V8JA 1YJ9Q 5GAMf 3PMIA 1VQLQ 1MNEA 1M8VA 1OEBA 3FJ5A 2EYXA 3QYGB 4A4FA 1R0BG 1G3YA 4GLMA 1W2BP 1FXXA 5CKFA 1JJ2P 2JUFA 2OTJA 3JCMh 5LJ3e 2GF7A 1X2KA 4P5NA 3EGDA 5IN1A 2X4JA 4OMQA 4F16A 2YUOA 1MGQA 5GMKi 3P8DA 4KT0E 4L5GA 4IKFA 1K0SA 1FWZA 4HCBA 4ZTFA 4M7DD 2DA9A 1IRXA 2CSIA 1NG2A 2MWOA 1QVFS 2J6FA 1JRIA 2EQUA 4JLIA 2K4YA 3J81E 2A28A 3OYIA 1G5VA 1BIAA 3CPWA 3P8BB 1NM7A 4J9BA 1RI9A 1KC8R 3EGXB 3TCJA 5GMKh 2FO0A 2K2MA 5LJ5f 2PTKA 1IXDA 4V2SA 3JV3A 1IHVA 1K8AR 1NZ9A 3RESA 3J80E 3V7SA 3CCQQ 2K3YA 2JZ2A 2QYZA 1JXOA 3L2RA 2DX1A 1R77A 3L1AA 3FEOA 2F5TX 4KULA 2RMOA 1NYFA 4R0KA 5GMKe 1VQ4Q 4JDSA 1YFNA 4M7AG 4Z89A 3JRZA 1M3BA 2VASA 2LT4A 3SDZA 1W2BS 2LJ1A 3EGDB 1JJ2S 4BI4A 2JTFA 3QUIA 1T3SA 4BD3A 3R6OA 5FLXE 1H3ZA 1E6HA 1RAIB 4E7HA 4KGZB 1QVFA 3G6EA 1M1KR 4OB2B 1GCPA 1GFDA 1KIKA 2BE9B 4RTWA 1GFCA 1N9SA 1M90R 2KGTA 4E6RA 4N0AA 4C92D 1FX7A 2YWWA 5J39A 1N6AA 2ENMA 2YRDA 3VS0A 4HVVA 2RN8A 3CCJA 2V1QA 1MMGA 2KYBA 4ESRA 3EFRA 2EQJA 2QGGA 1S72Q 3OS5A 3CCSQ 2JOYA 4D6WA 4M77E 2JM8A 3QHSA 5CAIA 2LT1A 2RHYA 1Y07A 1QP3A 3SWNA 3LWHA 3HHTB 3C94A 1XJWB 2L3SA 1RAGB 2XI9A 1RLQC 2Y90A 4PLLA 1RUWA 1M3CA 4A54A 3OYBA 3I55T 2P4RA 2X35A 1OZ2A 2EJ9A 4JS5A 2PU9B 4XQ3A 2ATCB 4J9CA 1FMVA 5FRMA 1YJWQ 2VUBA 1TTHB 2XHCA 3X28B 3JB9D 1YITQ 1BIBA 1G3WA 2EQMA 2QQAA 2F69A 4KH0B 3G4SQ 4OMPA 4AFQC 2CZ7B 2E1HA 2E3IA 3ULRB 1VQ9Q 3BFMA 2L5QA 2CZ6B 5CO7A 3QYHB 5GAMj 3OB9A 1YJNA 2SEMA 3NHNA 1ZHIA 3GIBA 3SWNB 3VUBA 3LGFA 2VXFA 2M0YA 4PJOD 1NBEB 2Y4YA 3REBB 4M75E 3OYLA 1SKUB 1IB8A 3CCEQ 3FB9A 4C8QA 2CH4W 1KQ2A 2MIOA 5KH6A 4RMOA 1VIEA 3AT1B 2DVEA 3MP6A 3PGGA 5FU6C 3FIFA 1IGQA 3MJXA 5D6XA 2DXBA 2YUNA 1OU8A 3NGPA 4QT7A 2JMCA 1ZUYA 2DJZA 4OMNA 3C95A 2RJCA 1X43A 3H6ZA 1NJIR 4IIMA 4AFUC 3F70A 5GANg 4NOYA 4JJDA 5LJ5j 1QMCA 2ECZA 1AWXA 1AVZC 5A0DA 3L42A 2V8KA 2LP5A 5HK3A 4M4ZA 2DRKA 5FROA 3M55A 5KCHA 3TQ7P 1VQMA 1RAFB 4C0ZA 2MAMA 2AHJB 5KYNA 3QG1A 3SB2A 3PVQA 1X2QA 1BI2A 2E64A 5D6WA 1VQ6A 2GQIA 2KR3A 4C8QB 4HXJA 3VJPA 3QPHA 3A98A 2RHIA 4F7UF 3WVEB 1QWFA 4F7UE 2DL3A 4J9GA 3S3OA 1BCMA 1GBRA 1AWJA 5GAOq 2LJ0A 2ZGWA 2DBKA 4FL6A 4XTXA 1Q95G 1PWTA 2IPOB 2NUZA 2EYQA 3M4GA 1ZSZA 2QQBA 4PJOB 1KFZA 4M78D 3I5RA 2P0QA 1FYNA 2BZXA 1IREB 2CT3A 3M0TA 5LJ3d 2JMAA 6AT1B 2E5QA 2BTTA 3AHUA 3VUZA 3A8HB 4XAXB 4DEXA 5CQXA 2M16A 2HKQB 1RL2A 3RKYA 2EJGA 1CKBA 1I5LA 2ZZDA 4IUQA 2EPDA 1Y0MA 2YUPA 3CCRA 1VQPA 2JN0A 4M7DF 4IUPA 4EMKC 2K5FA 2AKLA 3CC2Q 1Q81R 7AT1B 1YIJA 5GAOm 2COYA 4DOWA 2EIFA 4IUVA 1J3TA 1UJ0A 4RG8A 5GAN5 1U8RA 3MKDA 1LJOA 3LLRA 4XTYA 5KYWB 1ZX6A 1I8FA 2DIGA 1ZSZB 3OYFA 1OI1A 4EMHA 1W1FA 1WHLA 1A0NB 4MMKA 3CC7A 5GAN4 4E7IA 3INZA 2DM1A 3VYHB 2LCCA 2OI3A 4F7UG 3VS1A 4EIKA 3I55Q 4LDVA 3HRUA 2O31A 2DVJA 3EAEA 3CCMQ 1ABOA 5J26A 4JJCA 1ZBXA 5GAN7 4RCBA 2H3EB 2JM9A 2E5KA 3KUFA 4BI3A 4ZN1A 2QQSA 4L59A 1HK9A 1KD1C 2DMOA 2O9SA 1T3LA 4ATOA 1X6OA 2QEXA 2EGCA 2LX7A 3ASKA 5HY6A 2OTJQ 1I07A 4M78B 1IO6A 1ZBJA 5GJVB 2VXEA 4DOVA 4C92F 5GAN8 1PKTA 1G8XA 1WQWA 2MK5A 3V8KA 4M77A 2D1XA 3GLXA 1B3QA 2FZGB 4B6MA 3PMTA 4C5HA 1S1NA 1VQMT 4CI0C 1Y7XA 2COWA 1KD1U 1IGUA 4J9HA 4M7DG 1ZQ1A 1RLPC 4QW2A 3TREA 2EGAA 1S72T 2JXBA 3X20B 1MMAA 1VQ6T 4PJMA 4RCCA 4XK8E 1U1SA 1MMDA 1EZZB 1G3SA 2DE0X 5GAOl 3U23A 5D6YA 3NTHA 2EAYA 5LJ3f 3JCMJ 2V8JA 3BDUA 3QDRB 2MYSA 2D0QB 3EHRA 4MZMA 1XQHA 2LNHB 1AOJA 4BB7A 4QKUA 1KSWA 1Q82R 5AYFA 5KYUA 4FYYB 1QWEA 2KXDA 2JJ9A 2DERA 2CP3A 5LL6S 2EYYA 2E12A 1KC8C 2QTVA 1NLOC 1YITT 2KSSA 1EIFA 2RI2A 4L6V5 2KRMA 1V1CA 4XU2A 2DZCA 2JTEA 2YXYA 1B07A 1K8AC 3GP8A 4RTTA 3QZ9B 4RTYA 1NE8A 4MZPA 1HJDA 2RI5A 3L2VA 4YTLA 1JXMA 4M7DC 3A1PA 4Z02A 3M0QA 2CP5A 4M75A 3X26B 3G6EQ 2HD0A 2M9UA 2XK0A 1BKBA 1YCSB 4LNPA 4LXCA 3CCRT 4CRIA 2NUTB 2E6ZA 4EDUA 1M4ZA 4C92G 2RK1A 1KC8U 2NYSA 3CCJQ 1YIJT 2ZPIB 1K8AU 1K73R 5I2MA 1W6XA 1VA7A 3OYGA 1K76A 3CCET 2QA4A 5KYUB 5HKCA 3QZ5B 4M7AE 3CCUA 1QVPA 1RADB 2LQNA 2D9TA 3QDFA 4JZ3A 4X34A 2KAFA 2YUQA 1O9SA 2HBPA 1BI3A 3OBWA 2MMPA 2A0FB 1UGQB 1WQ7A 1M1KC 4DBHA 1M90C 1CSKA 1HSQA 4XTVA 3M4YA 2KE9A 1VQ7A 3RERA 3H8ZA 2RF0A 1WJSA 3OSSC 1LNXA 3HFOA 1M2VA 3E2UA 2B8AA 1MV3A 4M75B 4JS4A 4II1A 2CUBA 1M1KU 5A0LA 3C4SA 1WYXA 2A37A 1M90U 4C92C 1TU0B 3X24B 3QIIA 3ZBDA 2OTLA 4HKEA 4C5EA 4KH1B 3EGUA 2GQVA 4JPBW 2MPXC 3MEWA 4LN2A 2DJQA 4D8DA 1HYOA 2RQVA 3C12A 5C6SA 2E41A 3ER0A 4JRPA 1BCOA 2K6DA 3OYJA 1YJNQ 4KUDK 1WFWA 4QQ6A 2X3WD 2VC8A 2HSPA 4AG1C 5GAOp 1M1GA 1X01A 4N4IA 1I5OB 1M2VB 4M78F 3CMAA 1WLPB 1BI1A 2FG0A 2HL5C 1K4US 3N5BB 2BZYA 1ZUKA 2E10A 5IXFA 4FYVB 2Z0WA 3H9NA 3M0SA 2QQ9A 1RAAB 2GBQA 1OX9A 4DQ2A 2X51A 3EG1A 3A8GB 3CD6A 4GY5A 1ZUUA 2AIRB 2RJDA 1N8RR 2FVUA 5LJ3j 1WI7A 4IUTA 3X25B 1QP2A 1MNDA 4LE9A 1N5ZA 1PSEA 1TUCA 3MCAB 1DJ7B 3CC2T 3SHWA 1LVKA 1VQMQ 2D8JA 3WVDB 5GAOr 2RK2A 5FU7B 4PJOC 4J6YA 2FZCB 2OJ2A 2CZ0B 2FB7A 2HNIA 1VQ6Q 1NJIC 2DYBA 2LNVA 2RD1A 4HT9A 2RJFA 3JCMg 5DM7R 3J7AF 3HL8A 1VQNA 4PJNA 2DO3A 3PNWC 1VIFA 4QVZA 2DETA 5I21A 2VKNA 3RUXA 2X4XA 8AT1B 5L23A 3LH0A 2LC4A 2DBMA 3VS6A 3CCUT 2KT8A 3UATA 1UUEA 3GBQA 4MDWA 3OYKA 3E1SA 3CCMT 1TUDA 3QWYA 5GMKj 3L2UA 1NJIU 2XU8A 1TSFA 3OYYA 5GANe 1D1AA 1HD3A 5I22A 4C0DC 5EG2A 1C6VX 1PD0A 2RHUA 2YLCA 4C8QD 4J6XA 3DKMA 4OMMA 5AT1B 5LJ5e 3JB9J 3JCMb 1VQ7T 2OTJT 3E9FA 1C0MA 5HK0A 4C0GA 4KUIA 1M3AA 4K11A 3OMCA 1AEYA 1PCXA 2M51A 3G7ZA 4ELYC 3CCRQ 1IZ6A 1M9SA 1VQPQ 2BKDN 3I35A 3JSCA 2QQRA 1TWBA 5EC7A 4BDYA 4MDXA 5GAMg 3CC4A 5FW9A 3BY7A 3E9GA 1N27A 1YP5A 1K9MU 2F5KA 1YIJQ 3CCVQ 4RUGA 2AZVA 2RQTA 1JEGA 4E7JA 4AMCA 1YI2A 1M2OA 3QO3A 1NPRA 2OAWA 2LCSA 3OYMA 4PLIA 4ZGJB 1UHCA 2DTOA 3JCMc 2W10A 3IQLA 2KBTA 2M0OA 1KJWA 4J8OA 3CC7Q 2P0PA 4M78C 3A5ZB 2L3QA 2DXTA 3I56A 3E19A 4FCYA 4XTWA 1UECA 3PVLA 4M7AD 4XTZA 2HQXA 4C0FA 1SRMA 1Q81C 2G3RA 2RQRA 2L89A 4ZNXA 3CMAT 3QKJA 4AFZC 1N9RA 1UTIA 3A8MB 1WIEA 2ZCFB 4LD6A 4JJNK 1WJRA 2XKOC 5LJ5g 2HMAA 1P92A 4DA4A 1RAEB 2AKKA 3H41A 3CD6T 2QEXQ 5A2QE 4J7FA 3JCMX 5IXBA 3GF5A 3G6ET 1NPPA 1Q81U 1Y71A 3LH5A 2COZA 5I2SA 4M7AA 4J9EA 1D1CA 1K9MR 4LDXA 3OBYA 3PFSA 3CCJT 1XNIA 2NUPA 3NMZC 2DL7A 2KK4A 2O4XA 2DEUA 4DEYA 1BI0A 2IIMA 1YHQA 3UA6A 2K7AA 2KEAA 1GRIA 2V8IA 2ABLA 2RPNA 2DXCA 5KCOA 3PIPA 2NWMA 4MZTA 4PFZA 5FWCA 2DKGA 1AZGB 2O9VA 2KI7A 1BBZA 2EQIA 4Z88A 1M1FA 1VQNT 4LUEA 1YBYA 3HKSA 3A8OB 3UDCA 1RABB 2M1HA 3CCLA 2X4WA 3OYNA 4ELZC 2GFAA 1MUZA 4JJBA 2JT4A 1Y96A 3DB4A 2EYWA 1I1JA 2E6NA 2LMJA 3DLMA 1E7OA 2C0TA 2VGNA 4OMLA 4PFOA 1UFFA 4M7AB 2ZAEA 3CPFA 3THKA 3S3MA 3H0HA 2NUPB 2CS7A 4LUDA 4M7DE 2KVQG 2K5LA 2O4XB 3QXEB 1D1BA 3CCVA 3QJYA 3RKXA 1UG1A 1VQ8A 1Q82C 2FYKA 4O6JA 3LYIA 2LJ3A 2GGRA 1V76A 1WNLA 2KT1A 1YJNT 2E3HA 3MEUA 1KQSA 2J05A 2OAUA 3UA7A 2PVDB 5GAOn 2MI6A 4M77D 1YI2T 3ME9A 2QA4Q 2MF2A 3G71A 3CCUQ 5CK9A 1Q82U 3HRSA 2YT6A 2RJEA 2EVRA 3M56A 1ZLMA 3M59A 4FT2A 3EG0A 3D7SB 1T0HA 1Y57A 1WGSA 3I56T 2AZSA 1UE9A 3FJPA 4X9CA 2L8DA 2QG9B 4RTVA 1VQ7Q 4XU3A 4AG2C 3OYCA 2K57A 1K73C 2VGMA 4J9FA 5CKHA 3JB9H 2YRVA 2X4YA 2PUOB 2I2LA 2EWNA 2DFUA 4KBMB 2DPPB 4C92E 3CXCA 3OW2P 5IH2A 3MEAA 1QKWA 2K3BA 3META 2OTLQ 1YCYA 1QCFA 1JU5C 2E4HA 4BUGA 5KYXA 3RMSA 1I0CA 1K73U 3M9QA 4WF2A 3HTRA 4MMLA 4PJLA 1VUBA 4AT1B 3CMEA 2RB6A 2PVOB 4EMGA 4M75D 3ZEHA 2RM4A 3C0CA 2KXCA 4Q5WA 1YHQT 3WXMB 1G2BA 5GANd 3O8VA 3EFOA 3T9NA 1M5Q1 2ROTA 2F1LA 1UJYA 1QW1A 5KE3A 1PM3A 1WHGA 3CMAQ 3UT1A 1D0ZA 2DNUA 4JZ4A 4C8QF 3JB9F 2PZ1A 4HT8A 4UC4A 2CP7A 4M77B 4BE2A 1WXTA 3CCLT 2DD5A 2KDSA 2R58A 4IURA 4KGXB 3TVTA 1VQ5A 1Q86R 4EMKA 1Q7YU 2GFUA 2JS2A 2HQEA 3CD6Q 3M0UA 3OW2S 3SD4A 1TUGB 1PKSA 4E7ZA 3GPLA 5KYXB 1TG0A 1QQJA 3VKIA 1D09B 2FHDA 3TEEA 1GXIE 1KG1A 5FWBA 3V8LA 2R57A 2QK0A 4LDYA 1YNZA 2SRCA 3M57A 5KE2A 4FSXA 1VQPT 2I0NA 2QGFB 2VWFA 1EFNA 3OYEA 4PJOF 2R5MA 1PNJA 3V7CA 1UGSB 3EFSA 4NL3A 4PJOE 2O88A 3R6NA 3CCVT 2CUDA 3H0FA 2QAZA 1TOVA 2FPDA 2V26A 1VQ8T 1SPKA 1D3BA 3PE0A 4XU0A 1JQQA 2WACA 3QBYA 4HA8A 4N0AC 1WHJA 2K9GA 5CIUA 2CP2A 1N8RC 1UHFA 3TSWA 3FC3A 3JCMV 2X9HA 4J83A 2ZPEB 3CC7T 1VQNQ 4TVRA 3I9QA 5M9OA 4FYXB 4GBQA 2DEQA 5CKEA 1VQKA 1C1AA 4DBFA 1GCQA 2RI3A 4EMKB 3G71T 1NYGA 2G6FX 2GCXA 3SWNC 4HVWA 2JS0A 4JUVA 5C0MA 4ZGEB 4A63B 3OW2A 1HXDA 5CR2A 2FPEA 3PTAA 1N8RU 2LZ6B 4Y92A 4A4GA 3L2QA 4E2FB 3MO8A 1ABQA 3OS2A 2XDPA 3VU3C 1Q7YR 3S6WA 5IHIA 3VS2A 4C8QG 2NLUA 1KK7A 3JB9G 2K2VA 1QCOA 1SSFA 1W4SA 2F2VA 4EPCA 2EKHA 1QCNA 4OMFB 2QEXT 1F1BB 3VV0A 1QKXA 2BE7D 1WXUA 1AHJB 1D3BB 1AT1B 4E7KA 1PSFA 1OOTA 3HRTA 4FM4B 4F7UA 2J6OA 2GTOA 4R55A 2EYZA 3OYHA 2X3XD 2FEIA 1PRLC 3MP8A 3UF4A 5IT9E 4J5YA 3JCMe 4RTXA 3CC4Q 5GANf 2KYMA 1SSHA 4PJOG 1VQOA 2LCLA 3NPFA 2K5IA 1JB0E 2HSEB 3FDRA 1VYUA 2HBWA 2A36A 2K79A 1YI2Q 3NTIA 3V7RA 2LQWA 1PC0A 1SEMA 2YRCA 4PJJA 1M27C 1XTDA 2XD0A 3CBPA 3Q1JA 3CMET 4M78E 3MEVA 1SF9A 8ATCB 4B9WA 3I56Q 4C8QC 3OY9A 4BDZA 1OX8A 1Z9QA 2DAQA 4R56A 4M7DA 4DBQA 5CKBA 4JLGA 5GAMh 1PHTA 5ECAA 3RKWA 5CCAA 3SEMA 4F7UB 2FPFA 2L2PA 2DYIA 3RDVA 5CKDA 2XICA 4HCCA 2RQUA 2K3XA 4FIBA 5LJ3g 1VQ5T 2CDTA 4E47A 1B7TA 1E6GA 2MWPA 4WCIA 1OV3A 2YDLA 2A08A 4LDWA 5GAMe 2XDDA 4NL2A 1OULA 4PNOA 2P0KA 3TSZA 2LTOA 1K0XA 2QTXA 1I81A 4RTUA 4NS5A 1WDXA 3HSBA 2JW4A 2RH2A 1UGPB 1JO8A 3RIRA 3UWNA 2MCNA 3VYGA 5GANh 4M77F 5HCKA 2QASA 2CSQA 3A8LB 1WHKA 5DY9A 1NEGA 3GNFB 2QA4T 3KXTA 1YHQQ 1WXBA 2O2OA 2CT4A 1FMKA 2MOXA 4M7AC 2DL8A 1VYTA 5LJ5h 2F2XA 4F04B 4F17A 4M7DB 1ACMB 2DILA 2DK3A 3OA6A 1YJ9A 2CKKA 1VQLA 1W2BA 2WSCE 3MP1A 2J7IA 5IHNA 1SRLA 3EG9A 1JJ2A 4M78G 1UGRB 1D0YA 4OVAA 3L2WA 2DL5A 4ANJA 3CCLQ 1VQKT 3UPUA 5GMKm 1K9MC 4C92A 2CGHA 2DTIA 3OQ5A 2DLPA 3FLGA 4JRIA 4BY6B 1ZSZC 4LDUA 4JRQA 2GTJA 4D8KA 3CBMA 1SG5A 1K1ZA 2KMTA 2EGEA 3BW1A 3SFMA 1AWOA 1SHGA 2ED0A 1X69A 1UGVA 3EHQA 3LGLA 3OS1A 2JTMA 3QJ6A 2AT1B 2RNAA 2OTLT 2HZYA 2VYTA 5DLOA 5L8RE 3M5AA 4Y91A 1AWWA 2DIQA 2HL3A 2GNCA 3HP9A 4VUBA 1VQ8Q 2YSQA 1WZOA 4BI8B 4A4KA 3L2ZA 1QLYA 5KYYA 4M75F 2QXFA 3CCQA 2P4TA 3VS3A 4ORZA 3EG9B 3HPWA 4J9DA 1VQOT 4E7SA 5GAN6 1VQ4A 2DRMA 1KQSP 3EH1A 4M77G 4C92B 1K9AA 2ROLA 3G71Q 1U3OA 4ZTJA 4N4HA 1X27A 2EW3A 1X6GA 4OGCA 2L0AA 2CREA 2HCKA 5GANj 1IHWA 3EG3A 4FW1A 1WJQA 2ZPFB 4X1VA 5DLQE 4PFPA 1V29B 2L3RA 3KFVA 2F2WA 2DXUA 2LQ8A 2LQKA 1YN8A 1BU1A 3RMQA 2QDYB 2D0NA 3NFCA 4RG2A 4PJOA 2L3PA 2RA2A 3VS5A 5GMKl 1R8OB 3VRZA 1WPYA 1X6BA 1KHCA 2C06A 4CC4B 1T0JA 2J6KA 4N4GA 3OYDA 5CQYA 1LCKA 5KYYB 1WHMA 2R5AA 1B34A 2KRSA 4QQGA 1MMNA 2CH4A 2E70A 1S72A 1U06A 3CCSA 3CXCP 1LPLA 2XDBA 4QVDA 2CP0A 2IG0A 4M77C 4XU1A 3QSUA 2LVMA 1UEBA 4FSSA 1PG5B 5J3BA 3REAB 1TH7A 2P84A 1KQSS 2XMFA 4PKCC 1RAHB 2VB6A 4FYWB 5GAN3 3CMEQ 2ESWA 3HFNA 1KQ1A 4KRTA 2B86A 4M75G 2D6FA 2PVGB 4OMOA 4Y28E 4OP0A 1ZA2B 2ZPBB 4RTZA 2YLBA 2LX9A 3MPUB 2KQWA 5KYWA 4FW2A 4A4EA 1YWOA 1YJ9T 4J6WA 1YJWA 3PIOA 1VQLT 2ED1A 1WHHA 3OSVA 2YHTA 4LD9K 4OB1B 1YITA 1G83A 1VYVA 2ZPGB 3M58A 4O5VA 3G4SA 4JRKA 3OMGA 1B34B 2H3JA 1VQ5Q 1M8MA 1VQ9A 3M54A 2FRWA 3TU4K 2RHXA 3JCMd 2KY9A 4GLKA 4PK4A 2EQKA 4OF1A 3RNJA 3CXCS 1O75A 2LDMA 1W70A 4BE0A 3CBOA 1GL5A 3ZFJA 3M0PA 1OU9A 1RI0A 4RKUE 1AD5A 3CC4T 3CEYA 3VRYA 1CKAA 4PL6A 4X9DA 3JCMQ 5GAN2 4C0DB 4A4HA 2PQWA 1QVGP 4QVCA 4M78A 4CC2A 4M75C 3CCEA 2JNGA 3ZL7C 3JCMP 2KNBB 5I11A 1Q86C 1Y96B 5GJWB 3RR6A 3GNGA 1OPLA 1WA7A 3KBGA 9ATCB 2M02A 3CCQT 2PNIA 4DBRA 1H92A 5IHKA 2WSEE 1X75C 3QWXX 1VQ4T 1ARKA 2V1RA 2FRYA 2RO0A 4FU6A 1VQKQ 2OX7A 2DZ9A 3URGA 3VS7A 2QDLA 2KROA 2W0ZA 4ME7A 3BDLA 1H8KA 1Q86U 2E65A 2EKOA 2DL4A 1UDLA 3DB3A 4E7LA 3MHXA 2BZ8A 4C5GA 1U5SA 2A7YA 2H8HA 5GAMd 1GCQC 2KRNA 2ZPHB 2HKNA 5FU6B 1XOVA 3GOXA 2BUDA 1AZEA 3LW5E 4BACA 5A0GA
chains in the Genus database with same CATH topology
2DBMA 3VS6A 2LZ6B 4Y92A 2KT8A 3A98A 3UATA 1UUEA 1ABQA 3GBQA 2RQWA 1TUDA 5IHIA 2J06A 3VS2A 3QWYA 2F2VA 3O5ZA 1QWFA 2EKHA 2DL3A 1HD3A 4J9GA 5I22A 1GBRA 1AWJA 4F14A 2LJ0A 1PRMC 2DBKA 1QKXA 1WXUA 1WX6A 1PWTA 1M30A 1OOTA 2NUZA 4OMMA 2J6OA 2GTOA 1KFZA 1NEBA 2EYZA 3I5RA 2X3XD 1FYNA 2BZXA 2FEIA 1PRLC 3UF4A 1M3AA 2CT3A 3M0TA 1NLPC 4J9IA 2JMAA 4K11A 2AK5A 4RTXA 2KYMA 1AEYA 1SSHA 2BTTA 4CC3A 1YWPA 1SHFA 2M51A 3NPFA 1OPKA 4DEXA 2C0IA 1MV0B 1GBQA 1VYUA 3I35A 1CKBA 2HBWA 2A36A 2K79A 5EC7A 2DF6A 4HCKA 5FW9A 4IIOA 4AFSC 2LQWA 2EPDA 1YP5A 1SEMA 4Z8AA 1Y0MA 2YUPA 4RUGA 2EBPA 1M27C 2AZVA 2RQTA 1JEGA 1BB9A 2HEQA 3RBBB 2OAWA 2LCSA 2AKLA 4CC7A 1Z9ZA 3CQTA 1UHCA 2W10A 1Z9QA 3I5SA 3IQLA 2KBTA 1J3TA 1UJ0A 1KJWA 1BK2A 2L3QA 2C0OA 4HVUA 1UECA 3PVLA 1PHTA 2D8HA 1ZX6A 5ECAA 3SEMA 2FPFA 2L2PA 1W1FA 1SRMA 1A0NB 2RQRA 2RQUA 4ZNXA 4AFZC 1H3HA 2CDTA 1UTIA 2DM1A 3EG2A 1WIEA 1E6GA 4WCIA 2OI3A 1OV3A 2VVKA 2YDLA 3VS1A 4EIKA 2A08A 3TSZA 2HDAA 1K0XA 2O31A 4RTUA 3VS4A 2DVJA 1ABOA 2AKKA 3H41A 4JJCA 1WDXA 2JW4A 1ZSGA 3M0RA 2JM9A 2E5KA 5IXBA 1JO8A 2DMOA 2O9SA 2MCNA 3H0IA 5HCKA 1T3LA 2CSQA 3LH5A 2EGCA 1NEGA 2LX7A 4J9EA 1WXBA 2O2OA 1OEBA 1I07A 2CT4A 1FMKA 2MOXA 3FJ5A 1IO6A 2EYXA 2DL8A 3NMZC 1VYTA 1ZBJA 2DL7A 5GJVB 2F2XA 4F17A 4GLMA 2DILA 4DEYA 1PKTA 2IIMA 2D1XA 3UA6A 2K7AA 2J7IA 1B3QA 1GRIA 2KEAA 5IHNA 2ABLA 1SRLA 2RPNA 1S1NA 1X2KA 2NWMA 5FWCA 4J9HA 2DL5A 1AZGB 2O9VA 4OMQA 1RLPC 1BBZA 2EGAA 2YUOA 4F16A 2JXBA 2EQIA 4Z88A 4LUEA 2DLPA 1K0SA 2DA9A 2CSIA 2GTJA 4D8KA 1NG2A 2DE0X 2J6FA 3U23A 1K1ZA 1MUZA 2EGEA 4JJBA 2A28A 1AWOA 1SHGA 2ED0A 2JT4A 1X69A 1NM7A 3EHRA 1UGVA 4J9BA 3EHQA 1RI9A 2LNHB 1AOJA 2EYWA 1I1JA 2FO0A 2K2MA 2RNAA 1KSWA 2LMJA 2PTKA 1E7OA 2C0TA 3JV3A 4OMLA 1QWEA 1AWWA 1UFFA 2KXDA 3THKA 2GNCA 3H0HA 2YSQA 1JXOA 2DX1A 4LUDA 2RMOA 1NYFA 2EYYA 4R0KA 1QLYA 1NLOC 1UG1A 4Z89A 1M3BA 2KRMA 3VS3A 4ORZA 1V1CA 2LJ3A 2JTEA 2GGRA 1B07A 2LJ1A 4J9DA 4RTTA 4RTYA 1HJDA 2KT1A 2DRMA 1JXMA 1K9AA 1T3SA 2J05A 3M0QA 2ROLA 3UA7A 1E6HA 1YCSB 4LNPA 1U3OA 1X27A 2EW3A 1X6GA 2L0AA 2CREA 2HCKA 1GCPA 1GFDA 1KIKA 3EG3A 2YT6A 4RTWA 1GFCA 4X1VA 2EVRA 2KGTA 4E6RA 1ZLMA 1W6XA 3EG0A 3KFVA 1VA7A 2F2WA 1K76A 1T0HA 1YN8A 2ENMA 1BU1A 1Y57A 3VS0A 2LQNA 2RN8A 2D0NA 4HVVA 2L3PA 4JZ3A 2YUQA 2V1QA 3VS5A 2AZSA 1UE9A 3VRZA 1X6BA 2KYBA 4ESRA 4CC4B 1T0JA 2J6KA 4RTVA 4AG2C 1LCKA 2JM8A 1CSKA 1HSQA 2KRSA 4J9FA 2CH4A 1U06A 2KE9A 2RF0A 5IH2A 1MV3A 2L3SA 1QKWA 1RLQC 4FSSA 1RUWA 2K3BA 1M3CA 3REAB 1QCFA 2P4RA 1JU5C 2XMFA 2CUBA 1WYXA 2A37A 1I0CA 2ESWA 4J9CA 4KRTA 2B86A 3EGUA 4OMOA 4JPBW 4RTZA 4LN2A 2DJQA 4D8DA 2RQVA 1YWOA 3C0CA 2KXCA 1G2BA 4OMPA 2ED1A 4AFQC 2K6DA 3ULRB 1G83A 2ROTA 1VYVA 1WFWA 1UJYA 2X3WD 2DNUA 4JZ4A 2SEMA 3NHNA 2HSPA 1M8MA 2PZ1A 4AG1C 2FRWA 2M0YA 1WXTA 3REBB 3TVTA 3RNJA 1WLPB 2JS2A 2FG0A 1K4US 1W70A 3M0UA 2BZYA 1ZUKA 1PKSA 1GL5A 3M0PA 2CH4W 2MIOA 5IXFA 1AD5A 1TG0A 3VRYA 1CKAA 3M0SA 2GBQA 5FWBA 3EG1A 1YNZA 2SRCA 4CC2A 2I0NA 2VWFA 1ZUUA 1EFNA 2YUNA 3ZL7C 3NGPA 4QT7A 2JMCA 2KNBB 1PNJA 1ZUYA 5I11A 4OMNA 5GJWB 1X43A 2O88A 3R6NA 1OPLA 1WA7A 1WI7A 2CUDA 4IIMA 3H0FA 4AFUC 4LE9A 2FPDA 1N5ZA 2PNIA 1SPKA 1TUCA 3PE0A 4JJDA 1JQQA 1H92A 3SHWA 2ECZA 5IHKA 2K9GA 1AWXA 3QWXX 2D8JA 1AVZC 1ARKA 2V1RA 2FRYA 2LP5A 4M4ZA 1UHFA 2DRKA 3TSWA 2OJ2A 3VS7A 2QDLA 2KROA 2W0ZA 3I9QA 2DYBA 4GBQA 1H8KA 2DL4A 1UDLA 3PVQA 1GCQA 1X2QA 2BZ8A 1U5SA 2H8HA 1NYGA 2G6FX 2GQIA 1GCQC 2KR3A 2KRNA 4HVWA 2JS0A 4HXJA 2VKNA 1XOVA 1AZEA 4A63B 5L23A 2FPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBM A;  3VS6 A;  2LZ6 B;  4Y92 A;  2KT8 A;  3A98 A;  3UAT A;  1UUE A;  1ABQ A;  3GBQ A;  2RQW A;  1TUD A;  5IHI A;  2J06 A;  3VS2 A;  3QWY A;  2F2V A;  3O5Z A;  1QWF A;  2EKH A;  2DL3 A;  1HD3 A;  4J9G A;  5I22 A;  1GBR A;  1AWJ A;  4F14 A;  2LJ0 A;  1PRM C;  2DBK A;  1QKX A;  1WXU A;  1WX6 A;  1PWT A;  1M30 A;  1OOT A;  2NUZ A;  4OMM A;  2J6O A;  2GTO A;  1KFZ A;  1NEB A;  2EYZ A;  3I5R A;  2X3X D;  1FYN A;  2BZX A;  2FEI A;  1PRL C;  3UF4 A;  1M3A A;  2CT3 A;  3M0T A;  1NLP C;  4J9I A;  2JMA A;  4K11 A;  2AK5 A;  4RTX A;  2KYM A;  1AEY A;  1SSH A;  2BTT A;  4CC3 A;  1YWP A;  1SHF A;  2M51 A;  3NPF A;  1OPK A;  4DEX A;  2C0I A;  1MV0 B;  1GBQ A;  1VYU A;  3I35 A;  1CKB A;  2HBW A;  2A36 A;  2K79 A;  5EC7 A;  2DF6 A;  4HCK A;  5FW9 A;  4IIO A;  4AFS C;  2LQW A;  2EPD A;  1YP5 A;  1SEM A;  4Z8A A;  1Y0M A;  2YUP A;  4RUG A;  2EBP A;  1M27 C;  2AZV A;  2RQT A;  1JEG A;  1BB9 A;  2HEQ A;  3RBB B;  2OAW A;  2LCS A;  2AKL A;  4CC7 A;  1Z9Z A;  3CQT A;  1UHC A;  2W10 A;  1Z9Q A;  3I5S A;  3IQL A;  2KBT A;  1J3T A;  1UJ0 A;  1KJW A;  1BK2 A;  2L3Q A;  2C0O A;  4HVU A;  1UEC A;  3PVL A;  1PHT A;  2D8H A;  1ZX6 A;  5ECA A;  3SEM A;  2FPF A;  2L2P A;  1W1F A;  1SRM A;  1A0N B;  2RQR A;  2RQU A;  4ZNX A;  4AFZ C;  1H3H A;  2CDT A;  1UTI A;  2DM1 A;  3EG2 A;  1WIE A;  1E6G A;  4WCI A;  2OI3 A;  1OV3 A;  2VVK A;  2YDL A;  3VS1 A;  4EIK A;  2A08 A;  3TSZ A;  2HDA A;  1K0X A;  2O31 A;  4RTU A;  3VS4 A;  2DVJ A;  1ABO A;  2AKK A;  3H41 A;  4JJC A;  1WDX A;  2JW4 A;  1ZSG A;  3M0R A;  2JM9 A;  2E5K A;  5IXB A;  1JO8 A;  2DMO A;  2O9S A;  2MCN A;  3H0I A;  5HCK A;  1T3L A;  2CSQ A;  3LH5 A;  2EGC A;  1NEG A;  2LX7 A;  4J9E A;  1WXB A;  2O2O A;  1OEB A;  1I07 A;  2CT4 A;  1FMK A;  2MOX A;  3FJ5 A;  1IO6 A;  2EYX A;  2DL8 A;  3NMZ C;  1VYT A;  1ZBJ A;  2DL7 A;  5GJV B;  2F2X A;  4F17 A;  4GLM A;  2DIL A;  4DEY A;  1PKT A;  2IIM A;  2D1X A;  3UA6 A;  2K7A A;  2J7I A;  1B3Q A;  1GRI A;  2KEA A;  5IHN A;  2ABL A;  1SRL A;  2RPN A;  1S1N A;  1X2K A;  2NWM A;  5FWC A;  4J9H A;  2DL5 A;  1AZG B;  2O9V A;  4OMQ A;  1RLP C;  1BBZ A;  2EGA A;  2YUO A;  4F16 A;  2JXB A;  2EQI A;  4Z88 A;  4LUE A;  2DLP A;  1K0S A;  2DA9 A;  2CSI A;  2GTJ A;  4D8K A;  1NG2 A;  2DE0 X;  2J6F A;  3U23 A;  1K1Z A;  1MUZ A;  2EGE A;  4JJB A;  2A28 A;  1AWO A;  1SHG A;  2ED0 A;  2JT4 A;  1X69 A;  1NM7 A;  3EHR A;  1UGV A;  4J9B A;  3EHQ A;  1RI9 A;  2LNH B;  1AOJ A;  2EYW A;  1I1J A;  2FO0 A;  2K2M A;  2RNA A;  1KSW A;  2LMJ A;  2PTK A;  1E7O A;  2C0T A;  3JV3 A;  4OML A;  1QWE A;  1AWW A;  1UFF A;  2KXD A;  3THK A;  2GNC A;  3H0H A;  2YSQ A;  1JXO A;  2DX1 A;  4LUD A;  2RMO A;  1NYF A;  2EYY A;  4R0K A;  1QLY A;  1NLO C;  1UG1 A;  4Z89 A;  1M3B A;  2KRM A;  3VS3 A;  4ORZ A;  1V1C A;  2LJ3 A;  2JTE A;  2GGR A;  1B07 A;  2LJ1 A;  4J9D A;  4RTT A;  4RTY A;  1HJD A;  2KT1 A;  2DRM A;  1JXM A;  1K9A A;  1T3S A;  2J05 A;  3M0Q A;  2ROL A;  3UA7 A;  1E6H A;  1YCS B;  4LNP A;  1U3O A;  1X27 A;  2EW3 A;  1X6G A;  2L0A A;  2CRE A;  2HCK A;  1GCP A;  1GFD A;  1KIK A;  3EG3 A;  2YT6 A;  4RTW A;  1GFC A;  4X1V A;  2EVR A;  2KGT A;  4E6R A;  1ZLM A;  1W6X A;  3EG0 A;  3KFV A;  1VA7 A;  2F2W A;  1K76 A;  1T0H A;  1YN8 A;  2ENM A;  1BU1 A;  1Y57 A;  3VS0 A;  2LQN A;  2RN8 A;  2D0N A;  4HVV A;  2L3P A;  4JZ3 A;  2YUQ A;  2V1Q A;  3VS5 A;  2AZS A;  1UE9 A;  3VRZ A;  1X6B A;  2KYB A;  4ESR A;  4CC4 B;  1T0J A;  2J6K A;  4RTV A;  4AG2 C;  1LCK A;  2JM8 A;  1CSK A;  1HSQ A;  2KRS A;  4J9F A;  2CH4 A;  1U06 A;  2KE9 A;  2RF0 A;  5IH2 A;  1MV3 A;  2L3S A;  1QKW A;  1RLQ C;  4FSS A;  1RUW A;  2K3B A;  1M3C A;  3REA B;  1QCF A;  2P4R A;  1JU5 C;  2XMF A;  2CUB A;  1WYX A;  2A37 A;  1I0C A;  2ESW A;  4J9C A;  4KRT A;  2B86 A;  3EGU A;  4OMO A;  4JPB W;  4RTZ A;  4LN2 A;  2DJQ A;  4D8D A;  2RQV A;  1YWO A;  3C0C A;  2KXC A;  1G2B A;  4OMP A;  2ED1 A;  4AFQ C;  2K6D A;  3ULR B;  1G83 A;  2ROT A;  1VYV A;  1WFW A;  1UJY A;  2X3W D;  2DNU A;  4JZ4 A;  2SEM A;  3NHN A;  2HSP A;  1M8M A;  2PZ1 A;  4AG1 C;  2FRW A;  2M0Y A;  1WXT A;  3REB B;  3TVT A;  3RNJ A;  1WLP B;  2JS2 A;  2FG0 A;  1K4U S;  1W70 A;  3M0U A;  2BZY A;  1ZUK A;  1PKS A;  1GL5 A;  3M0P A;  2CH4 W;  2MIO A;  5IXF A;  1AD5 A;  1TG0 A;  3VRY A;  1CKA A;  3M0S A;  2GBQ A;  5FWB A;  3EG1 A;  1YNZ A;  2SRC A;  4CC2 A;  2I0N A;  2VWF A;  1ZUU A;  1EFN A;  2YUN A;  3ZL7 C;  3NGP A;  4QT7 A;  2JMC A;  2KNB B;  1PNJ A;  1ZUY A;  5I11 A;  4OMN A;  5GJW B;  1X43 A;  2O88 A;  3R6N A;  1OPL A;  1WA7 A;  1WI7 A;  2CUD A;  4IIM A;  3H0F A;  4AFU C;  4LE9 A;  2FPD A;  1N5Z A;  2PNI A;  1SPK A;  1TUC A;  3PE0 A;  4JJD A;  1JQQ A;  1H92 A;  3SHW A;  2ECZ A;  5IHK A;  2K9G A;  1AWX A;  3QWX X;  2D8J A;  1AVZ C;  1ARK A;  2V1R A;  2FRY A;  2LP5 A;  4M4Z A;  1UHF A;  2DRK A;  3TSW A;  2OJ2 A;  3VS7 A;  2QDL A;  2KRO A;  2W0Z A;  3I9Q A;  2DYB A;  4GBQ A;  1H8K A;  2DL4 A;  1UDL A;  3PVQ A;  1GCQ A;  1X2Q A;  2BZ8 A;  1U5S A;  2H8H A;  1NYG A;  2G6F X;  2GQI A;  1GCQ C;  2KR3 A;  2KRN A;  4HVW A;  2JS0 A;  4HXJ A;  2VKN A;  1XOV A;  1AZE A;  4A63 B;  5L23 A;  2FPE A; 
#chains in the Genus database with same CATH topology
 2PUK B;  2HAX A;  2IVW A;  1OYX A;  2RQW A;  2J06 A;  4OB3 B;  1U1T A;  3OS0 A;  1QVG S;  3O5Z A;  4HCZ A;  1LOJ A;  2EFI A;  2FZK B;  4F14 A;  1PRM C;  1ZA1 B;  1WX6 A;  1M30 A;  3DLL A;  3JAM E;  3CCS T;  2FL7 A;  1FMW A;  1NEB A;  1OZ3 A;  1VQO Q;  2A3L A;  1Q7Y C;  4B9X A;  3JCM W;  2RHZ A;  3EH2 A;  2CP6 A;  1NLP C;  4J9I A;  2NUT A;  1G3T A;  1TXQ A;  2AK5 A;  4BE1 A;  3CPW P;  4WTO B;  4XTU A;  4CC3 A;  1TS9 A;  2Y4X A;  1YWP A;  1SHF A;  1H64 1;  1OPK A;  5LJ5 d;  2C0I A;  1MV0 B;  2DTH A;  1GBQ A;  5FU7 C;  1BYM A;  5CVI A;  4J7I A;  1JBM A;  3LX7 A;  2DF6 A;  4HCK A;  4C8Q E;  3OYA A;  4IIO A;  4AFS C;  4Z8A A;  2EBP A;  5FRN A;  3FRN A;  1BB9 A;  2JVV A;  3JCM f;  3JB9 I;  2HEQ A;  2CZ1 B;  3M53 A;  3RBB B;  3NTK A;  1EX4 A;  4CC7 A;  1YJW T;  1Z9Z A;  3CQT A;  4A53 A;  2CYZ B;  3I5S A;  2QI2 A;  1QVG A;  4KGV B;  4ZGD B;  1BK2 A;  3G4S T;  3CC2 A;  4IUU A;  2XG8 D;  2C0O A;  1VOM A;  4HVU A;  2D8H A;  4ZN3 A;  1VQ9 T;  3P8H A;  1MHN A;  5IAY A;  2VV5 A;  3BE3 A;  3G1J A;  3EFO B;  2EJF A;  1H3H A;  2O01 E;  1KD1 R;  3EG2 A;  1QVF P;  1UB4 A;  2VVK A;  1R0C B;  1KHI A;  2XID A;  1D0X A;  4FT4 A;  1RAC B;  1I4K 1;  2DD4 A;  2HDA A;  4BY6 C;  3VS4 A;  4C5I A;  3CPW S;  4M7A F;  3PT9 A;  3S3N A;  4OB0 B;  1PD1 A;  1ZSG A;  2WSF E;  3M0R A;  4QQD A;  3I55 A;  4OGE A;  2LRQ A;  3LWI A;  3EGX A;  5D7U A;  3CCM A;  1OQK A;  2HQH A;  3H0I A;  2BIV A;  5LJ3 h;  3V8J A;  1YJ9 Q;  5GAM f;  3PMI A;  1VQL Q;  1MNE A;  1M8V A;  1OEB A;  3FJ5 A;  2EYX A;  3QYG B;  4A4F A;  1R0B G;  1G3Y A;  4GLM A;  1W2B P;  1FXX A;  5CKF A;  1JJ2 P;  2JUF A;  2OTJ A;  3JCM h;  5LJ3 e;  2GF7 A;  1X2K A;  4P5N A;  3EGD A;  5IN1 A;  2X4J A;  4OMQ A;  4F16 A;  2YUO A;  1MGQ A;  5GMK i;  3P8D A;  4KT0 E;  4L5G A;  4IKF A;  1K0S A;  1FWZ A;  4HCB A;  4ZTF A;  4M7D D;  2DA9 A;  1IRX A;  2CSI A;  1NG2 A;  2MWO A;  1QVF S;  2J6F A;  1JRI A;  2EQU A;  4JLI A;  2K4Y A;  3J81 E;  2A28 A;  3OYI A;  1G5V A;  1BIA A;  3CPW A;  3P8B B;  1NM7 A;  4J9B A;  1RI9 A;  1KC8 R;  3EGX B;  3TCJ A;  5GMK h;  2FO0 A;  2K2M A;  5LJ5 f;  2PTK A;  1IXD A;  4V2S A;  3JV3 A;  1IHV A;  1K8A R;  1NZ9 A;  3RES A;  3J80 E;  3V7S A;  3CCQ Q;  2K3Y A;  2JZ2 A;  2QYZ A;  1JXO A;  3L2R A;  2DX1 A;  1R77 A;  3L1A A;  3FEO A;  2F5T X;  4KUL A;  2RMO A;  1NYF A;  4R0K A;  5GMK e;  1VQ4 Q;  4JDS A;  1YFN A;  4M7A G;  4Z89 A;  3JRZ A;  1M3B A;  2VAS A;  2LT4 A;  3SDZ A;  1W2B S;  2LJ1 A;  3EGD B;  1JJ2 S;  4BI4 A;  2JTF A;  3QUI A;  1T3S A;  4BD3 A;  3R6O A;  5FLX E;  1H3Z A;  1E6H A;  1RAI B;  4E7H A;  4KGZ B;  1QVF A;  3G6E A;  1M1K R;  4OB2 B;  1GCP A;  1GFD A;  1KIK A;  2BE9 B;  4RTW A;  1GFC A;  1N9S A;  1M90 R;  2KGT A;  4E6R A;  4N0A A;  4C92 D;  1FX7 A;  2YWW A;  5J39 A;  1N6A A;  2ENM A;  2YRD A;  3VS0 A;  4HVV A;  2RN8 A;  3CCJ A;  2V1Q A;  1MMG A;  2KYB A;  4ESR A;  3EFR A;  2EQJ A;  2QGG A;  1S72 Q;  3OS5 A;  3CCS Q;  2JOY A;  4D6W A;  4M77 E;  2JM8 A;  3QHS A;  5CAI A;  2LT1 A;  2RHY A;  1Y07 A;  1QP3 A;  3SWN A;  3LWH A;  3HHT B;  3C94 A;  1XJW B;  2L3S A;  1RAG B;  2XI9 A;  1RLQ C;  2Y90 A;  4PLL A;  1RUW A;  1M3C A;  4A54 A;  3OYB A;  3I55 T;  2P4R A;  2X35 A;  1OZ2 A;  2EJ9 A;  4JS5 A;  2PU9 B;  4XQ3 A;  2ATC B;  4J9C A;  1FMV A;  5FRM A;  1YJW Q;  2VUB A;  1TTH B;  2XHC A;  3X28 B;  3JB9 D;  1YIT Q;  1BIB A;  1G3W A;  2EQM A;  2QQA A;  2F69 A;  4KH0 B;  3G4S Q;  4OMP A;  4AFQ C;  2CZ7 B;  2E1H A;  2E3I A;  3ULR B;  1VQ9 Q;  3BFM A;  2L5Q A;  2CZ6 B;  5CO7 A;  3QYH B;  5GAM j;  3OB9 A;  1YJN A;  2SEM A;  3NHN A;  1ZHI A;  3GIB A;  3SWN B;  3VUB A;  3LGF A;  2VXF A;  2M0Y A;  4PJO D;  1NBE B;  2Y4Y A;  3REB B;  4M75 E;  3OYL A;  1SKU B;  1IB8 A;  3CCE Q;  3FB9 A;  4C8Q A;  2CH4 W;  1KQ2 A;  2MIO A;  5KH6 A;  4RMO A;  1VIE A;  3AT1 B;  2DVE A;  3MP6 A;  3PGG A;  5FU6 C;  3FIF A;  1IGQ A;  3MJX A;  5D6X A;  2DXB A;  2YUN A;  1OU8 A;  3NGP A;  4QT7 A;  2JMC A;  1ZUY A;  2DJZ A;  4OMN A;  3C95 A;  2RJC A;  1X43 A;  3H6Z A;  1NJI R;  4IIM A;  4AFU C;  3F70 A;  5GAN g;  4NOY A;  4JJD A;  5LJ5 j;  1QMC A;  2ECZ A;  1AWX A;  1AVZ C;  5A0D A;  3L42 A;  2V8K A;  2LP5 A;  5HK3 A;  4M4Z A;  2DRK A;  5FRO A;  3M55 A;  5KCH A;  3TQ7 P;  1VQM A;  1RAF B;  4C0Z A;  2MAM A;  2AHJ B;  5KYN A;  3QG1 A;  3SB2 A;  3PVQ A;  1X2Q A;  1BI2 A;  2E64 A;  5D6W A;  1VQ6 A;  2GQI A;  2KR3 A;  4C8Q B;  4HXJ A;  3VJP A;  3QPH A;  3A98 A;  2RHI A;  4F7U F;  3WVE B;  1QWF A;  4F7U E;  2DL3 A;  4J9G A;  3S3O A;  1BCM A;  1GBR A;  1AWJ A;  5GAO q;  2LJ0 A;  2ZGW A;  2DBK A;  4FL6 A;  4XTX A;  1Q95 G;  1PWT A;  2IPO B;  2NUZ A;  2EYQ A;  3M4G A;  1ZSZ A;  2QQB A;  4PJO B;  1KFZ A;  4M78 D;  3I5R A;  2P0Q A;  1FYN A;  2BZX A;  1IRE B;  2CT3 A;  3M0T A;  5LJ3 d;  2JMA A;  6AT1 B;  2E5Q A;  2BTT A;  3AHU A;  3VUZ A;  3A8H B;  4XAX B;  4DEX A;  5CQX A;  2M16 A;  2HKQ B;  1RL2 A;  3RKY A;  2EJG A;  1CKB A;  1I5L A;  2ZZD A;  4IUQ A;  2EPD A;  1Y0M A;  2YUP A;  3CCR A;  1VQP A;  2JN0 A;  4M7D F;  4IUP A;  4EMK C;  2K5F A;  2AKL A;  3CC2 Q;  1Q81 R;  7AT1 B;  1YIJ A;  5GAO m;  2COY A;  4DOW A;  2EIF A;  4IUV A;  1J3T A;  1UJ0 A;  4RG8 A;  5GAN 5;  1U8R A;  3MKD A;  1LJO A;  3LLR A;  4XTY A;  5KYW B;  1ZX6 A;  1I8F A;  2DIG A;  1ZSZ B;  3OYF A;  1OI1 A;  4EMH A;  1W1F A;  1WHL A;  1A0N B;  4MMK A;  3CC7 A;  5GAN 4;  4E7I A;  3INZ A;  2DM1 A;  3VYH B;  2LCC A;  2OI3 A;  4F7U G;  3VS1 A;  4EIK A;  3I55 Q;  4LDV A;  3HRU A;  2O31 A;  2DVJ A;  3EAE A;  3CCM Q;  1ABO A;  5J26 A;  4JJC A;  1ZBX A;  5GAN 7;  4RCB A;  2H3E B;  2JM9 A;  2E5K A;  3KUF A;  4BI3 A;  4ZN1 A;  2QQS A;  4L59 A;  1HK9 A;  1KD1 C;  2DMO A;  2O9S A;  1T3L A;  4ATO A;  1X6O A;  2QEX A;  2EGC A;  2LX7 A;  3ASK A;  5HY6 A;  2OTJ Q;  1I07 A;  4M78 B;  1IO6 A;  1ZBJ A;  5GJV B;  2VXE A;  4DOV A;  4C92 F;  5GAN 8;  1PKT A;  1G8X A;  1WQW A;  2MK5 A;  3V8K A;  4M77 A;  2D1X A;  3GLX A;  1B3Q A;  2FZG B;  4B6M A;  3PMT A;  4C5H A;  1S1N A;  1VQM T;  4CI0 C;  1Y7X A;  2COW A;  1KD1 U;  1IGU A;  4J9H A;  4M7D G;  1ZQ1 A;  1RLP C;  4QW2 A;  3TRE A;  2EGA A;  1S72 T;  2JXB A;  3X20 B;  1MMA A;  1VQ6 T;  4PJM A;  4RCC A;  4XK8 E;  1U1S A;  1MMD A;  1EZZ B;  1G3S A;  2DE0 X;  5GAO l;  3U23 A;  5D6Y A;  3NTH A;  2EAY A;  5LJ3 f;  3JCM J;  2V8J A;  3BDU A;  3QDR B;  2MYS A;  2D0Q B;  3EHR A;  4MZM A;  1XQH A;  2LNH B;  1AOJ A;  4BB7 A;  4QKU A;  1KSW A;  1Q82 R;  5AYF A;  5KYU A;  4FYY B;  1QWE A;  2KXD A;  2JJ9 A;  2DER A;  2CP3 A;  5LL6 S;  2EYY A;  2E12 A;  1KC8 C;  2QTV A;  1NLO C;  1YIT T;  2KSS A;  1EIF A;  2RI2 A;  4L6V 5;  2KRM A;  1V1C A;  4XU2 A;  2DZC A;  2JTE A;  2YXY A;  1B07 A;  1K8A C;  3GP8 A;  4RTT A;  3QZ9 B;  4RTY A;  1NE8 A;  4MZP A;  1HJD A;  2RI5 A;  3L2V A;  4YTL A;  1JXM A;  4M7D C;  3A1P A;  4Z02 A;  3M0Q A;  2CP5 A;  4M75 A;  3X26 B;  3G6E Q;  2HD0 A;  2M9U A;  2XK0 A;  1BKB A;  1YCS B;  4LNP A;  4LXC A;  3CCR T;  4CRI A;  2NUT B;  2E6Z A;  4EDU A;  1M4Z A;  4C92 G;  2RK1 A;  1KC8 U;  2NYS A;  3CCJ Q;  1YIJ T;  2ZPI B;  1K8A U;  1K73 R;  5I2M A;  1W6X A;  1VA7 A;  3OYG A;  1K76 A;  3CCE T;  2QA4 A;  5KYU B;  5HKC A;  3QZ5 B;  4M7A E;  3CCU A;  1QVP A;  1RAD B;  2LQN A;  2D9T A;  3QDF A;  4JZ3 A;  4X34 A;  2KAF A;  2YUQ A;  1O9S A;  2HBP A;  1BI3 A;  3OBW A;  2MMP A;  2A0F B;  1UGQ B;  1WQ7 A;  1M1K C;  4DBH A;  1M90 C;  1CSK A;  1HSQ A;  4XTV A;  3M4Y A;  2KE9 A;  1VQ7 A;  3RER A;  3H8Z A;  2RF0 A;  1WJS A;  3OSS C;  1LNX A;  3HFO A;  1M2V A;  3E2U A;  2B8A A;  1MV3 A;  4M75 B;  4JS4 A;  4II1 A;  2CUB A;  1M1K U;  5A0L A;  3C4S A;  1WYX A;  2A37 A;  1M90 U;  4C92 C;  1TU0 B;  3X24 B;  3QII A;  3ZBD A;  2OTL A;  4HKE A;  4C5E A;  4KH1 B;  3EGU A;  2GQV A;  4JPB W;  2MPX C;  3MEW A;  4LN2 A;  2DJQ A;  4D8D A;  1HYO A;  2RQV A;  3C12 A;  5C6S A;  2E41 A;  3ER0 A;  4JRP A;  1BCO A;  2K6D A;  3OYJ A;  1YJN Q;  4KUD K;  1WFW A;  4QQ6 A;  2X3W D;  2VC8 A;  2HSP A;  4AG1 C;  5GAO p;  1M1G A;  1X01 A;  4N4I A;  1I5O B;  1M2V B;  4M78 F;  3CMA A;  1WLP B;  1BI1 A;  2FG0 A;  2HL5 C;  1K4U S;  3N5B B;  2BZY A;  1ZUK A;  2E10 A;  5IXF A;  4FYV B;  2Z0W A;  3H9N A;  3M0S A;  2QQ9 A;  1RAA B;  2GBQ A;  1OX9 A;  4DQ2 A;  2X51 A;  3EG1 A;  3A8G B;  3CD6 A;  4GY5 A;  1ZUU A;  2AIR B;  2RJD A;  1N8R R;  2FVU A;  5LJ3 j;  1WI7 A;  4IUT A;  3X25 B;  1QP2 A;  1MND A;  4LE9 A;  1N5Z A;  1PSE A;  1TUC A;  3MCA B;  1DJ7 B;  3CC2 T;  3SHW A;  1LVK A;  1VQM Q;  2D8J A;  3WVD B;  5GAO r;  2RK2 A;  5FU7 B;  4PJO C;  4J6Y A;  2FZC B;  2OJ2 A;  2CZ0 B;  2FB7 A;  2HNI A;  1VQ6 Q;  1NJI C;  2DYB A;  2LNV A;  2RD1 A;  4HT9 A;  2RJF A;  3JCM g;  5DM7 R;  3J7A F;  3HL8 A;  1VQN A;  4PJN A;  2DO3 A;  3PNW C;  1VIF A;  4QVZ A;  2DET A;  5I21 A;  2VKN A;  3RUX A;  2X4X A;  8AT1 B;  5L23 A;  3LH0 A;  2LC4 A;  2DBM A;  3VS6 A;  3CCU T;  2KT8 A;  3UAT A;  1UUE A;  3GBQ A;  4MDW A;  3OYK A;  3E1S A;  3CCM T;  1TUD A;  3QWY A;  5GMK j;  3L2U A;  1NJI U;  2XU8 A;  1TSF A;  3OYY A;  5GAN e;  1D1A A;  1HD3 A;  5I22 A;  4C0D C;  5EG2 A;  1C6V X;  1PD0 A;  2RHU A;  2YLC A;  4C8Q D;  4J6X A;  3DKM A;  4OMM A;  5AT1 B;  5LJ5 e;  3JB9 J;  3JCM b;  1VQ7 T;  2OTJ T;  3E9F A;  1C0M A;  5HK0 A;  4C0G A;  4KUI A;  1M3A A;  4K11 A;  3OMC A;  1AEY A;  1PCX A;  2M51 A;  3G7Z A;  4ELY C;  3CCR Q;  1IZ6 A;  1M9S A;  1VQP Q;  2BKD N;  3I35 A;  3JSC A;  2QQR A;  1TWB A;  5EC7 A;  4BDY A;  4MDX A;  5GAM g;  3CC4 A;  5FW9 A;  3BY7 A;  3E9G A;  1N27 A;  1YP5 A;  1K9M U;  2F5K A;  1YIJ Q;  3CCV Q;  4RUG A;  2AZV A;  2RQT A;  1JEG A;  4E7J A;  4AMC A;  1YI2 A;  1M2O A;  3QO3 A;  1NPR A;  2OAW A;  2LCS A;  3OYM A;  4PLI A;  4ZGJ B;  1UHC A;  2DTO A;  3JCM c;  2W10 A;  3IQL A;  2KBT A;  2M0O A;  1KJW A;  4J8O A;  3CC7 Q;  2P0P A;  4M78 C;  3A5Z B;  2L3Q A;  2DXT A;  3I56 A;  3E19 A;  4FCY A;  4XTW A;  1UEC A;  3PVL A;  4M7A D;  4XTZ A;  2HQX A;  4C0F A;  1SRM A;  1Q81 C;  2G3R A;  2RQR A;  2L89 A;  4ZNX A;  3CMA T;  3QKJ A;  4AFZ C;  1N9R A;  1UTI A;  3A8M B;  1WIE A;  2ZCF B;  4LD6 A;  4JJN K;  1WJR A;  2XKO C;  5LJ5 g;  2HMA A;  1P92 A;  4DA4 A;  1RAE B;  2AKK A;  3H41 A;  3CD6 T;  2QEX Q;  5A2Q E;  4J7F A;  3JCM X;  5IXB A;  3GF5 A;  3G6E T;  1NPP A;  1Q81 U;  1Y71 A;  3LH5 A;  2COZ A;  5I2S A;  4M7A A;  4J9E A;  1D1C A;  1K9M R;  4LDX A;  3OBY A;  3PFS A;  3CCJ T;  1XNI A;  2NUP A;  3NMZ C;  2DL7 A;  2KK4 A;  2O4X A;  2DEU A;  4DEY A;  1BI0 A;  2IIM A;  1YHQ A;  3UA6 A;  2K7A A;  2KEA A;  1GRI A;  2V8I A;  2ABL A;  2RPN A;  2DXC A;  5KCO A;  3PIP A;  2NWM A;  4MZT A;  4PFZ A;  5FWC A;  2DKG A;  1AZG B;  2O9V A;  2KI7 A;  1BBZ A;  2EQI A;  4Z88 A;  1M1F A;  1VQN T;  4LUE A;  1YBY A;  3HKS A;  3A8O B;  3UDC A;  1RAB B;  2M1H A;  3CCL A;  2X4W A;  3OYN A;  4ELZ C;  2GFA A;  1MUZ A;  4JJB A;  2JT4 A;  1Y96 A;  3DB4 A;  2EYW A;  1I1J A;  2E6N A;  2LMJ A;  3DLM A;  1E7O A;  2C0T A;  2VGN A;  4OML A;  4PFO A;  1UFF A;  4M7A B;  2ZAE A;  3CPF A;  3THK A;  3S3M A;  3H0H A;  2NUP B;  2CS7 A;  4LUD A;  4M7D E;  2KVQ G;  2K5L A;  2O4X B;  3QXE B;  1D1B A;  3CCV A;  3QJY A;  3RKX A;  1UG1 A;  1VQ8 A;  1Q82 C;  2FYK A;  4O6J A;  3LYI A;  2LJ3 A;  2GGR A;  1V76 A;  1WNL A;  2KT1 A;  1YJN T;  2E3H A;  3MEU A;  1KQS A;  2J05 A;  2OAU A;  3UA7 A;  2PVD B;  5GAO n;  2MI6 A;  4M77 D;  1YI2 T;  3ME9 A;  2QA4 Q;  2MF2 A;  3G71 A;  3CCU Q;  5CK9 A;  1Q82 U;  3HRS A;  2YT6 A;  2RJE A;  2EVR A;  3M56 A;  1ZLM A;  3M59 A;  4FT2 A;  3EG0 A;  3D7S B;  1T0H A;  1Y57 A;  1WGS A;  3I56 T;  2AZS A;  1UE9 A;  3FJP A;  4X9C A;  2L8D A;  2QG9 B;  4RTV A;  1VQ7 Q;  4XU3 A;  4AG2 C;  3OYC A;  2K57 A;  1K73 C;  2VGM A;  4J9F A;  5CKH A;  3JB9 H;  2YRV A;  2X4Y A;  2PUO B;  2I2L A;  2EWN A;  2DFU A;  4KBM B;  2DPP B;  4C92 E;  3CXC A;  3OW2 P;  5IH2 A;  3MEA A;  1QKW A;  2K3B A;  3MET A;  2OTL Q;  1YCY A;  1QCF A;  1JU5 C;  2E4H A;  4BUG A;  5KYX A;  3RMS A;  1I0C A;  1K73 U;  3M9Q A;  4WF2 A;  3HTR A;  4MML A;  4PJL A;  1VUB A;  4AT1 B;  3CME A;  2RB6 A;  2PVO B;  4EMG A;  4M75 D;  3ZEH A;  2RM4 A;  3C0C A;  2KXC A;  4Q5W A;  1YHQ T;  3WXM B;  1G2B A;  5GAN d;  3O8V A;  3EFO A;  3T9N A;  1M5Q 1;  2ROT A;  2F1L A;  1UJY A;  1QW1 A;  5KE3 A;  1PM3 A;  1WHG A;  3CMA Q;  3UT1 A;  1D0Z A;  2DNU A;  4JZ4 A;  4C8Q F;  3JB9 F;  2PZ1 A;  4HT8 A;  4UC4 A;  2CP7 A;  4M77 B;  4BE2 A;  1WXT A;  3CCL T;  2DD5 A;  2KDS A;  2R58 A;  4IUR A;  4KGX B;  3TVT A;  1VQ5 A;  1Q86 R;  4EMK A;  1Q7Y U;  2GFU A;  2JS2 A;  2HQE A;  3CD6 Q;  3M0U A;  3OW2 S;  3SD4 A;  1TUG B;  1PKS A;  4E7Z A;  3GPL A;  5KYX B;  1TG0 A;  1QQJ A;  3VKI A;  1D09 B;  2FHD A;  3TEE A;  1GXI E;  1KG1 A;  5FWB A;  3V8L A;  2R57 A;  2QK0 A;  4LDY A;  1YNZ A;  2SRC A;  3M57 A;  5KE2 A;  4FSX A;  1VQP T;  2I0N A;  2QGF B;  2VWF A;  1EFN A;  3OYE A;  4PJO F;  2R5M A;  1PNJ A;  3V7C A;  1UGS B;  3EFS A;  4NL3 A;  4PJO E;  2O88 A;  3R6N A;  3CCV T;  2CUD A;  3H0F A;  2QAZ A;  1TOV A;  2FPD A;  2V26 A;  1VQ8 T;  1SPK A;  1D3B A;  3PE0 A;  4XU0 A;  1JQQ A;  2WAC A;  3QBY A;  4HA8 A;  4N0A C;  1WHJ A;  2K9G A;  5CIU A;  2CP2 A;  1N8R C;  1UHF A;  3TSW A;  3FC3 A;  3JCM V;  2X9H A;  4J83 A;  2ZPE B;  3CC7 T;  1VQN Q;  4TVR A;  3I9Q A;  5M9O A;  4FYX B;  4GBQ A;  2DEQ A;  5CKE A;  1VQK A;  1C1A A;  4DBF A;  1GCQ A;  2RI3 A;  4EMK B;  3G71 T;  1NYG A;  2G6F X;  2GCX A;  3SWN C;  4HVW A;  2JS0 A;  4JUV A;  5C0M A;  4ZGE B;  4A63 B;  3OW2 A;  1HXD A;  5CR2 A;  2FPE A;  3PTA A;  1N8R U;  2LZ6 B;  4Y92 A;  4A4G A;  3L2Q A;  4E2F B;  3MO8 A;  1ABQ A;  3OS2 A;  2XDP A;  3VU3 C;  1Q7Y R;  3S6W A;  5IHI A;  3VS2 A;  4C8Q G;  2NLU A;  1KK7 A;  3JB9 G;  2K2V A;  1QCO A;  1SSF A;  1W4S A;  2F2V A;  4EPC A;  2EKH A;  1QCN A;  4OMF B;  2QEX T;  1F1B B;  3VV0 A;  1QKX A;  2BE7 D;  1WXU A;  1AHJ B;  1D3B B;  1AT1 B;  4E7K A;  1PSF A;  1OOT A;  3HRT A;  4FM4 B;  4F7U A;  2J6O A;  2GTO A;  4R55 A;  2EYZ A;  3OYH A;  2X3X D;  2FEI A;  1PRL C;  3MP8 A;  3UF4 A;  5IT9 E;  4J5Y A;  3JCM e;  4RTX A;  3CC4 Q;  5GAN f;  2KYM A;  1SSH A;  4PJO G;  1VQO A;  2LCL A;  3NPF A;  2K5I A;  1JB0 E;  2HSE B;  3FDR A;  1VYU A;  2HBW A;  2A36 A;  2K79 A;  1YI2 Q;  3NTI A;  3V7R A;  2LQW A;  1PC0 A;  1SEM A;  2YRC A;  4PJJ A;  1M27 C;  1XTD A;  2XD0 A;  3CBP A;  3Q1J A;  3CME T;  4M78 E;  3MEV A;  1SF9 A;  8ATC B;  4B9W A;  3I56 Q;  4C8Q C;  3OY9 A;  4BDZ A;  1OX8 A;  1Z9Q A;  2DAQ A;  4R56 A;  4M7D A;  4DBQ A;  5CKB A;  4JLG A;  5GAM h;  1PHT A;  5ECA A;  3RKW A;  5CCA A;  3SEM A;  4F7U B;  2FPF A;  2L2P A;  2DYI A;  3RDV A;  5CKD A;  2XIC A;  4HCC A;  2RQU A;  2K3X A;  4FIB A;  5LJ3 g;  1VQ5 T;  2CDT A;  4E47 A;  1B7T A;  1E6G A;  2MWP A;  4WCI A;  1OV3 A;  2YDL A;  2A08 A;  4LDW A;  5GAM e;  2XDD A;  4NL2 A;  1OUL A;  4PNO A;  2P0K A;  3TSZ A;  2LTO A;  1K0X A;  2QTX A;  1I81 A;  4RTU A;  4NS5 A;  1WDX A;  3HSB A;  2JW4 A;  2RH2 A;  1UGP B;  1JO8 A;  3RIR A;  3UWN A;  2MCN A;  3VYG A;  5GAN h;  4M77 F;  5HCK A;  2QAS A;  2CSQ A;  3A8L B;  1WHK A;  5DY9 A;  1NEG A;  3GNF B;  2QA4 T;  3KXT A;  1YHQ Q;  1WXB A;  2O2O A;  2CT4 A;  1FMK A;  2MOX A;  4M7A C;  2DL8 A;  1VYT A;  5LJ5 h;  2F2X A;  4F04 B;  4F17 A;  4M7D B;  1ACM B;  2DIL A;  2DK3 A;  3OA6 A;  1YJ9 A;  2CKK A;  1VQL A;  1W2B A;  2WSC E;  3MP1 A;  2J7I A;  5IHN A;  1SRL A;  3EG9 A;  1JJ2 A;  4M78 G;  1UGR B;  1D0Y A;  4OVA A;  3L2W A;  2DL5 A;  4ANJ A;  3CCL Q;  1VQK T;  3UPU A;  5GMK m;  1K9M C;  4C92 A;  2CGH A;  2DTI A;  3OQ5 A;  2DLP A;  3FLG A;  4JRI A;  4BY6 B;  1ZSZ C;  4LDU A;  4JRQ A;  2GTJ A;  4D8K A;  3CBM A;  1SG5 A;  1K1Z A;  2KMT A;  2EGE A;  3BW1 A;  3SFM A;  1AWO A;  1SHG A;  2ED0 A;  1X69 A;  1UGV A;  3EHQ A;  3LGL A;  3OS1 A;  2JTM A;  3QJ6 A;  2AT1 B;  2RNA A;  2OTL T;  2HZY A;  2VYT A;  5DLO A;  5L8R E;  3M5A A;  4Y91 A;  1AWW A;  2DIQ A;  2HL3 A;  2GNC A;  3HP9 A;  4VUB A;  1VQ8 Q;  2YSQ A;  1WZO A;  4BI8 B;  4A4K A;  3L2Z A;  1QLY A;  5KYY A;  4M75 F;  2QXF A;  3CCQ A;  2P4T A;  3VS3 A;  4ORZ A;  3EG9 B;  3HPW A;  4J9D A;  1VQO T;  4E7S A;  5GAN 6;  1VQ4 A;  2DRM A;  1KQS P;  3EH1 A;  4M77 G;  4C92 B;  1K9A A;  2ROL A;  3G71 Q;  1U3O A;  4ZTJ A;  4N4H A;  1X27 A;  2EW3 A;  1X6G A;  4OGC A;  2L0A A;  2CRE A;  2HCK A;  5GAN j;  1IHW A;  3EG3 A;  4FW1 A;  1WJQ A;  2ZPF B;  4X1V A;  5DLQ E;  4PFP A;  1V29 B;  2L3R A;  3KFV A;  2F2W A;  2DXU A;  2LQ8 A;  2LQK A;  1YN8 A;  1BU1 A;  3RMQ A;  2QDY B;  2D0N A;  3NFC A;  4RG2 A;  4PJO A;  2L3P A;  2RA2 A;  3VS5 A;  5GMK l;  1R8O B;  3VRZ A;  1WPY A;  1X6B A;  1KHC A;  2C06 A;  4CC4 B;  1T0J A;  2J6K A;  4N4G A;  3OYD A;  5CQY A;  1LCK A;  5KYY B;  1WHM A;  2R5A A;  1B34 A;  2KRS A;  4QQG A;  1MMN A;  2CH4 A;  2E70 A;  1S72 A;  1U06 A;  3CCS A;  3CXC P;  1LPL A;  2XDB A;  4QVD A;  2CP0 A;  2IG0 A;  4M77 C;  4XU1 A;  3QSU A;  2LVM A;  1UEB A;  4FSS A;  1PG5 B;  5J3B A;  3REA B;  1TH7 A;  2P84 A;  1KQS S;  2XMF A;  4PKC C;  1RAH B;  2VB6 A;  4FYW B;  5GAN 3;  3CME Q;  2ESW A;  3HFN A;  1KQ1 A;  4KRT A;  2B86 A;  4M75 G;  2D6F A;  2PVG B;  4OMO A;  4Y28 E;  4OP0 A;  1ZA2 B;  2ZPB B;  4RTZ A;  2YLB A;  2LX9 A;  3MPU B;  2KQW A;  5KYW A;  4FW2 A;  4A4E A;  1YWO A;  1YJ9 T;  4J6W A;  1YJW A;  3PIO A;  1VQL T;  2ED1 A;  1WHH A;  3OSV A;  2YHT A;  4LD9 K;  4OB1 B;  1YIT A;  1G83 A;  1VYV A;  2ZPG B;  3M58 A;  4O5V A;  3G4S A;  4JRK A;  3OMG A;  1B34 B;  2H3J A;  1VQ5 Q;  1M8M A;  1VQ9 A;  3M54 A;  2FRW A;  3TU4 K;  2RHX A;  3JCM d;  2KY9 A;  4GLK A;  4PK4 A;  2EQK A;  4OF1 A;  3RNJ A;  3CXC S;  1O75 A;  2LDM A;  1W70 A;  4BE0 A;  3CBO A;  1GL5 A;  3ZFJ A;  3M0P A;  1OU9 A;  1RI0 A;  4RKU E;  1AD5 A;  3CC4 T;  3CEY A;  3VRY A;  1CKA A;  4PL6 A;  4X9D A;  3JCM Q;  5GAN 2;  4C0D B;  4A4H A;  2PQW A;  1QVG P;  4QVC A;  4M78 A;  4CC2 A;  4M75 C;  3CCE A;  2JNG A;  3ZL7 C;  3JCM P;  2KNB B;  5I11 A;  1Q86 C;  1Y96 B;  5GJW B;  3RR6 A;  3GNG A;  1OPL A;  1WA7 A;  3KBG A;  9ATC B;  2M02 A;  3CCQ T;  2PNI A;  4DBR A;  1H92 A;  5IHK A;  2WSE E;  1X75 C;  3QWX X;  1VQ4 T;  1ARK A;  2V1R A;  2FRY A;  2RO0 A;  4FU6 A;  1VQK Q;  2OX7 A;  2DZ9 A;  3URG A;  3VS7 A;  2QDL A;  2KRO A;  2W0Z A;  4ME7 A;  3BDL A;  1H8K A;  1Q86 U;  2E65 A;  2EKO A;  2DL4 A;  1UDL A;  3DB3 A;  4E7L A;  3MHX A;  2BZ8 A;  4C5G A;  1U5S A;  2A7Y A;  2H8H A;  5GAM d;  1GCQ C;  2KRN A;  2ZPH B;  2HKN A;  5FU6 B;  1XOV A;  3GOX A;  2BUD A;  1AZE A;  3LW5 E;  4BAC A;  5A0G A; 
#chains in the Genus database with same CATH homology
 2DBM A;  3VS6 A;  2LZ6 B;  4Y92 A;  2KT8 A;  3A98 A;  3UAT A;  1UUE A;  1ABQ A;  3GBQ A;  2RQW A;  1TUD A;  5IHI A;  2J06 A;  3VS2 A;  3QWY A;  2F2V A;  3O5Z A;  1QWF A;  2EKH A;  2DL3 A;  1HD3 A;  4J9G A;  5I22 A;  1GBR A;  1AWJ A;  4F14 A;  2LJ0 A;  1PRM C;  2DBK A;  1QKX A;  1WXU A;  1WX6 A;  1PWT A;  1M30 A;  1OOT A;  2NUZ A;  4OMM A;  2J6O A;  2GTO A;  1KFZ A;  1NEB A;  2EYZ A;  3I5R A;  2X3X D;  1FYN A;  2BZX A;  2FEI A;  1PRL C;  3UF4 A;  1M3A A;  2CT3 A;  3M0T A;  1NLP C;  4J9I A;  2JMA A;  4K11 A;  2AK5 A;  4RTX A;  2KYM A;  1AEY A;  1SSH A;  2BTT A;  4CC3 A;  1YWP A;  1SHF A;  2M51 A;  3NPF A;  1OPK A;  4DEX A;  2C0I A;  1MV0 B;  1GBQ A;  1VYU A;  3I35 A;  1CKB A;  2HBW A;  2A36 A;  2K79 A;  5EC7 A;  2DF6 A;  4HCK A;  5FW9 A;  4IIO A;  4AFS C;  2LQW A;  2EPD A;  1YP5 A;  1SEM A;  4Z8A A;  1Y0M A;  2YUP A;  4RUG A;  2EBP A;  1M27 C;  2AZV A;  2RQT A;  1JEG A;  1BB9 A;  2HEQ A;  3RBB B;  2OAW A;  2LCS A;  2AKL A;  4CC7 A;  1Z9Z A;  3CQT A;  1UHC A;  2W10 A;  1Z9Q A;  3I5S A;  3IQL A;  2KBT A;  1J3T A;  1UJ0 A;  1KJW A;  1BK2 A;  2L3Q A;  2C0O A;  4HVU A;  1UEC A;  3PVL A;  1PHT A;  2D8H A;  1ZX6 A;  5ECA A;  3SEM A;  2FPF A;  2L2P A;  1W1F A;  1SRM A;  1A0N B;  2RQR A;  2RQU A;  4ZNX A;  4AFZ C;  1H3H A;  2CDT A;  1UTI A;  2DM1 A;  3EG2 A;  1WIE A;  1E6G A;  4WCI A;  2OI3 A;  1OV3 A;  2VVK A;  2YDL A;  3VS1 A;  4EIK A;  2A08 A;  3TSZ A;  2HDA A;  1K0X A;  2O31 A;  4RTU A;  3VS4 A;  2DVJ A;  1ABO A;  2AKK A;  3H41 A;  4JJC A;  1WDX A;  2JW4 A;  1ZSG A;  3M0R A;  2JM9 A;  2E5K A;  5IXB A;  1JO8 A;  2DMO A;  2O9S A;  2MCN A;  3H0I A;  5HCK A;  1T3L A;  2CSQ A;  3LH5 A;  2EGC A;  1NEG A;  2LX7 A;  4J9E A;  1WXB A;  2O2O A;  1OEB A;  1I07 A;  2CT4 A;  1FMK A;  2MOX A;  3FJ5 A;  1IO6 A;  2EYX A;  2DL8 A;  3NMZ C;  1VYT A;  1ZBJ A;  2DL7 A;  5GJV B;  2F2X A;  4F17 A;  4GLM A;  2DIL A;  4DEY A;  1PKT A;  2IIM A;  2D1X A;  3UA6 A;  2K7A A;  2J7I A;  1B3Q A;  1GRI A;  2KEA A;  5IHN A;  2ABL A;  1SRL A;  2RPN A;  1S1N A;  1X2K A;  2NWM A;  5FWC A;  4J9H A;  2DL5 A;  1AZG B;  2O9V A;  4OMQ A;  1RLP C;  1BBZ A;  2EGA A;  2YUO A;  4F16 A;  2JXB A;  2EQI A;  4Z88 A;  4LUE A;  2DLP A;  1K0S A;  2DA9 A;  2CSI A;  2GTJ A;  4D8K A;  1NG2 A;  2DE0 X;  2J6F A;  3U23 A;  1K1Z A;  1MUZ A;  2EGE A;  4JJB A;  2A28 A;  1AWO A;  1SHG A;  2ED0 A;  2JT4 A;  1X69 A;  1NM7 A;  3EHR A;  1UGV A;  4J9B A;  3EHQ A;  1RI9 A;  2LNH B;  1AOJ A;  2EYW A;  1I1J A;  2FO0 A;  2K2M A;  2RNA A;  1KSW A;  2LMJ A;  2PTK A;  1E7O A;  2C0T A;  3JV3 A;  4OML A;  1QWE A;  1AWW A;  1UFF A;  2KXD A;  3THK A;  2GNC A;  3H0H A;  2YSQ A;  1JXO A;  2DX1 A;  4LUD A;  2RMO A;  1NYF A;  2EYY A;  4R0K A;  1QLY A;  1NLO C;  1UG1 A;  4Z89 A;  1M3B A;  2KRM A;  3VS3 A;  4ORZ A;  1V1C A;  2LJ3 A;  2JTE A;  2GGR A;  1B07 A;  2LJ1 A;  4J9D A;  4RTT A;  4RTY A;  1HJD A;  2KT1 A;  2DRM A;  1JXM A;  1K9A A;  1T3S A;  2J05 A;  3M0Q A;  2ROL A;  3UA7 A;  1E6H A;  1YCS B;  4LNP A;  1U3O A;  1X27 A;  2EW3 A;  1X6G A;  2L0A A;  2CRE A;  2HCK A;  1GCP A;  1GFD A;  1KIK A;  3EG3 A;  2YT6 A;  4RTW A;  1GFC A;  4X1V A;  2EVR A;  2KGT A;  4E6R A;  1ZLM A;  1W6X A;  3EG0 A;  3KFV A;  1VA7 A;  2F2W A;  1K76 A;  1T0H A;  1YN8 A;  2ENM A;  1BU1 A;  1Y57 A;  3VS0 A;  2LQN A;  2RN8 A;  2D0N A;  4HVV A;  2L3P A;  4JZ3 A;  2YUQ A;  2V1Q A;  3VS5 A;  2AZS A;  1UE9 A;  3VRZ A;  1X6B A;  2KYB A;  4ESR A;  4CC4 B;  1T0J A;  2J6K A;  4RTV A;  4AG2 C;  1LCK A;  2JM8 A;  1CSK A;  1HSQ A;  2KRS A;  4J9F A;  2CH4 A;  1U06 A;  2KE9 A;  2RF0 A;  5IH2 A;  1MV3 A;  2L3S A;  1QKW A;  1RLQ C;  4FSS A;  1RUW A;  2K3B A;  1M3C A;  3REA B;  1QCF A;  2P4R A;  1JU5 C;  2XMF A;  2CUB A;  1WYX A;  2A37 A;  1I0C A;  2ESW A;  4J9C A;  4KRT A;  2B86 A;  3EGU A;  4OMO A;  4JPB W;  4RTZ A;  4LN2 A;  2DJQ A;  4D8D A;  2RQV A;  1YWO A;  3C0C A;  2KXC A;  1G2B A;  4OMP A;  2ED1 A;  4AFQ C;  2K6D A;  3ULR B;  1G83 A;  2ROT A;  1VYV A;  1WFW A;  1UJY A;  2X3W D;  2DNU A;  4JZ4 A;  2SEM A;  3NHN A;  2HSP A;  1M8M A;  2PZ1 A;  4AG1 C;  2FRW A;  2M0Y A;  1WXT A;  3REB B;  3TVT A;  3RNJ A;  1WLP B;  2JS2 A;  2FG0 A;  1K4U S;  1W70 A;  3M0U A;  2BZY A;  1ZUK A;  1PKS A;  1GL5 A;  3M0P A;  2CH4 W;  2MIO A;  5IXF A;  1AD5 A;  1TG0 A;  3VRY A;  1CKA A;  3M0S A;  2GBQ A;  5FWB A;  3EG1 A;  1YNZ A;  2SRC A;  4CC2 A;  2I0N A;  2VWF A;  1ZUU A;  1EFN A;  2YUN A;  3ZL7 C;  3NGP A;  4QT7 A;  2JMC A;  2KNB B;  1PNJ A;  1ZUY A;  5I11 A;  4OMN A;  5GJW B;  1X43 A;  2O88 A;  3R6N A;  1OPL A;  1WA7 A;  1WI7 A;  2CUD A;  4IIM A;  3H0F A;  4AFU C;  4LE9 A;  2FPD A;  1N5Z A;  2PNI A;  1SPK A;  1TUC A;  3PE0 A;  4JJD A;  1JQQ A;  1H92 A;  3SHW A;  2ECZ A;  5IHK A;  2K9G A;  1AWX A;  3QWX X;  2D8J A;  1AVZ C;  1ARK A;  2V1R A;  2FRY A;  2LP5 A;  4M4Z A;  1UHF A;  2DRK A;  3TSW A;  2OJ2 A;  3VS7 A;  2QDL A;  2KRO A;  2W0Z A;  3I9Q A;  2DYB A;  4GBQ A;  1H8K A;  2DL4 A;  1UDL A;  3PVQ A;  1GCQ A;  1X2Q A;  2BZ8 A;  1U5S A;  2H8H A;  1NYG A;  2G6F X;  2GQI A;  1GCQ C;  2KR3 A;  2KRN A;  4HVW A;  2JS0 A;  4HXJ A;  2VKN A;  1XOV A;  1AZE A;  4A63 B;  5L23 A;  2FPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...