3THMF

Crystal structure of fas receptor extracellular domain in complex with fab ep6b_b01
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
77
Chain Sequence
LHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCGHGLEVEINCTRTQNTKCRCC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab EP6b_B01, light chain
total genus 13
structure length 77
sequence length 84
ec nomenclature
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00020 TNFR_c6 TNFR/NGFR cysteine-rich region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.50.10 Mainly Beta Ribbon Tumor Necrosis Factor Receptor, subunit A; domain 2 Tumor Necrosis Factor Receptor, subunit A, domain 2 3thmF00
4MSVB 1ZA3R 1FT4A 4M4RA 5CIRE 3THMF 3QO4A 5L36B 2H9GR 4M4PA 3TJEF 3U3TA 4BK5A 1TNRR 2HEYR 3URFZ 3WVTA 5IHLA 3BUKC 3FL7A 1EXTA 4J6GC 3U3SA 1D4VA 4MXWR 5BNQR 3X3FA 3U3PA 3ALQR 4FHQA 3K51B 3MHDD 4KGGC 4OD2S 3IJ2X 2UWIA 3ME2R 4YN0A 5DMJA 2AW2B 4E4DR 3MBWA 1JMAB 3ME4A 4BK4A 4I9XC 4N90R 3U3QA 4RSUD 3U3VA 1DU3A 1SG1X 3QBQB 1NCFA 4KGQC 2HEVR 3MI8D 4GIQR 1D0GR 2X10A 3QD6R
chains in the Genus database with same CATH superfamily
4MSVB 1ZA3R 1FT4A 4M4RA 5CIRE 3THMF 3QO4A 5L36B 2H9GR 2E4VA 2E4YA 4M4PA 3TJEF 3U3TA 4BK5A 1TNRR 2HEYR 3URFZ 3WVTA 5IHLA 3BUKC 3FL7A 1EXTA 4J6GC 2E4XA 3U3SA 1D4VA 4MXWR 5BNQR 3X3FA 3U3PA 3ALQR 4FHQA 2E4WA 3K51B 3MHDD 4KGGC 3IJ2X 2UWIA 3ME2R 4OD2S 4YN0A 2AW2B 5DMJA 3MBWA 1JMAB 4E4DR 3ME4A 4BK4A 4I9XC 2E4UA 4N90R 3U3QA 4RSUD 3U3VA 1DU3A 1SG1X 3QBQB 1NCFA 4KGQC 2HEVR 3MI8D 4GIQR 1D0GR 2X10A 3QD6R 2QR6A
chains in the Genus database with same CATH topology
4MSVB 1ZA3R 1FT4A 4M4RA 5CIRE 3THMF 3QO4A 5L36B 2H9GR 4M4PA 3TJEF 3U3TA 4BK5A 1TNRR 2HEYR 3URFZ 3WVTA 5IHLA 3BUKC 3FL7A 1EXTA 4J6GC 3U3SA 1D4VA 4MXWR 5BNQR 3X3FA 3U3PA 3ALQR 4FHQA 3K51B 3MHDD 4KGGC 4OD2S 3IJ2X 2UWIA 3ME2R 4YN0A 5DMJA 2AW2B 4E4DR 3MBWA 1JMAB 3ME4A 4BK4A 4I9XC 4N90R 3U3QA 4RSUD 3U3VA 1DU3A 1SG1X 3QBQB 1NCFA 4KGQC 2HEVR 3MI8D 4GIQR 1D0GR 2X10A 3QD6R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSV B;  1ZA3 R;  1FT4 A;  4M4R A;  5CIR E;  3THM F;  3QO4 A;  5L36 B;  2H9G R;  4M4P A;  3TJE F;  3U3T A;  4BK5 A;  1TNR R;  2HEY R;  3URF Z;  3WVT A;  5IHL A;  3BUK C;  3FL7 A;  1EXT A;  4J6G C;  3U3S A;  1D4V A;  4MXW R;  5BNQ R;  3X3F A;  3U3P A;  3ALQ R;  4FHQ A;  3K51 B;  3MHD D;  4KGG C;  4OD2 S;  3IJ2 X;  2UWI A;  3ME2 R;  4YN0 A;  5DMJ A;  2AW2 B;  4E4D R;  3MBW A;  1JMA B;  3ME4 A;  4BK4 A;  4I9X C;  4N90 R;  3U3Q A;  4RSU D;  3U3V A;  1DU3 A;  1SG1 X;  3QBQ B;  1NCF A;  4KGQ C;  2HEV R;  3MI8 D;  4GIQ R;  1D0G R;  2X10 A;  3QD6 R; 
#chains in the Genus database with same CATH topology
 4MSV B;  1ZA3 R;  1FT4 A;  4M4R A;  5CIR E;  3THM F;  3QO4 A;  5L36 B;  2H9G R;  2E4V A;  2E4Y A;  4M4P A;  3TJE F;  3U3T A;  4BK5 A;  1TNR R;  2HEY R;  3URF Z;  3WVT A;  5IHL A;  3BUK C;  3FL7 A;  1EXT A;  4J6G C;  2E4X A;  3U3S A;  1D4V A;  4MXW R;  5BNQ R;  3X3F A;  3U3P A;  3ALQ R;  4FHQ A;  2E4W A;  3K51 B;  3MHD D;  4KGG C;  3IJ2 X;  2UWI A;  3ME2 R;  4OD2 S;  4YN0 A;  2AW2 B;  5DMJ A;  3MBW A;  1JMA B;  4E4D R;  3ME4 A;  4BK4 A;  4I9X C;  2E4U A;  4N90 R;  3U3Q A;  4RSU D;  3U3V A;  1DU3 A;  1SG1 X;  3QBQ B;  1NCF A;  4KGQ C;  2HEV R;  3MI8 D;  4GIQ R;  1D0G R;  2X10 A;  3QD6 R;  2QR6 A; 
#chains in the Genus database with same CATH homology
 4MSV B;  1ZA3 R;  1FT4 A;  4M4R A;  5CIR E;  3THM F;  3QO4 A;  5L36 B;  2H9G R;  4M4P A;  3TJE F;  3U3T A;  4BK5 A;  1TNR R;  2HEY R;  3URF Z;  3WVT A;  5IHL A;  3BUK C;  3FL7 A;  1EXT A;  4J6G C;  3U3S A;  1D4V A;  4MXW R;  5BNQ R;  3X3F A;  3U3P A;  3ALQ R;  4FHQ A;  3K51 B;  3MHD D;  4KGG C;  4OD2 S;  3IJ2 X;  2UWI A;  3ME2 R;  4YN0 A;  5DMJ A;  2AW2 B;  4E4D R;  3MBW A;  1JMA B;  3ME4 A;  4BK4 A;  4I9X C;  4N90 R;  3U3Q A;  4RSU D;  3U3V A;  1DU3 A;  1SG1 X;  3QBQ B;  1NCF A;  4KGQ C;  2HEV R;  3MI8 D;  4GIQ R;  1D0G R;  2X10 A;  3QD6 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...