3THMH

Crystal structure of fas receptor extracellular domain in complex with fab ep6b_b01
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
233
structure length
228
Chain Sequence
b'QLQLQESGPGLVKPSETLSLTCTVSGASISANSYYGVWVRQSPGKGLEWVGSIAYRGNSNSGSTYYNPSLKSRATVSVDSSKNQVSLRLTSVTAADTALYYCARRQLLDDGTGYQWAAFDVWGQGTMVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab EP6b_B01, light chain
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 228
sequence length 233
ec nomenclature
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmH01
4QRPB 5ESAA 1KT2B 5IBUG 1H3TA 3CK0H 1K4DB 3WFEL 4Z7VB 4MGXA 5CJOL 3BH9A 3WJJA 3DIFB 4LVNB 4ZFZA 1T04B 4PJXB 4Z7QE 2VLJE 2XG5A 4FFWC 4OV5A 2ZUXA 3TA3A 1NBQA 3MBXH 5E2UL 3FO2B 4HMEA 4BKLB 1T2QL 2Z8VC 2Z93B 2BNQE 4KTDL 5FUOL 2W1NA 4ZFGL 1MF2L 4CDHA 5JPNA 1FIGL 4NQUA 1TMCB 1OF2A 3MRLB 2K7PA 1AC6A 1LEGB 4PD4J 3MUY1 3EDDA 4U1SA 5I73C 1Q0XL 3HPLA 2VZSA 2PW2A 3DHMA 5AZEL 3HR5B 1KENL 3B2VH 3GNML 3TPUA 4LOUD 7FABH 2FX7H 4NWTH 2B4CH 4Q6IA 1R5WB 5E5MA 4C56E 3OWEA 3MV8A 1F4YH 5EA0L 3RNKA 3H7BA 3VI3F 4FFWD 1YEDA 4LHQB 5JW4M 3HNVH 5MEOA 5TQ2H 5C0AA 3T0ED 5E8PA 2YR3A 4OQTL 4NP4H 3KWWA 4LP5A 5ESVA 5T3ZE 1L9MA 4PJHA 4PJ5B 2XXMB 4N1EA 2DF3A 3CMOL 1ZS8A 1JRHH 4IMLB 2YBRB 3S37L 3TT3H 3RWDB 3RJQB 2VABA 5HVWA 1KTRL 4PJAE 4C59B 1MCIA 4F58L 1I8LA 1RUMH 5D96C 3Q3GB 5ADPL 5HVFB 2ICWB 4NCC2 2YA0A 4G9DA 1CGTA 3MJ9L 5DK0A 3RX8A 5L9DH 2W9EL 1T5XB 2ZJSH 4FTVA 5F9OH 5EBMA 3O8XC 2ESVB 3CSYA 4NO0D 3QRGL 3CLFL 2CDEB 2X4PA 4L3AA 1AKJB 3FB7A 2C7UB 2EDOA 1NFIA 1CGWA 3VGGA 3ABZA 2H26B 4NZTH 1ZT1A 4Z95H 5HI4C 5EU4B 1YJDL 3ARRA 3V2AR 1HHJA 5EN2A 1B2WH 3QDAA 3EYQD 4LF3B 1RZJH 3VFVB 1R3IL 3CVIL 3IU3A 4FQCL 4YJZL 2BCKA 2A6IB 3IDUA 4JR9H 1Z6JT 4M62L 4GKOA 4TUJB 1Z9LA 3WXWH 1CFQA 3RUGA 3TO4D 5IFJA 4Y16A 5E5UB 3VA6A 1K2DB 4YFLI 5D2LA 2BY1A 3BHBB 4MJ2A 2AJXH 3EZJB 1PKOA 1RUPL 5C0AE 3VFGH 4X4YA 1A7PH 2NCMA 5GSVB 1KIRA 4HQQH 4PJHE 1E4XI 1A6AA 4PLJC 5D1XB 4M00A 3BWAB 2PYFB 4MXVF 2X40A 1P1ZA 3O3AB 1DCLA 4YXKH 2ATPB 4XBPA 4PRIE 4KQ3H 2RFXB 4OV6F 5FKAA 3MOBL 4Y4KC 3W11C 2X1OA 2COQA 3SPVA 1ZA3A 3VU2A 2DTMH 1FH5H 4U1JA 4RGNC 2AXGA 3B9AA 1FG2A 4KUCD 2HVJA 3O2VH 1KJ3H 3MXWL 4RGMC 5F3HA 2CQVA 4XPBH 5FM5O 2HA1A 4YDVB 2EC9U 4OI9A 3TNNA 2ZKHH 4TNVK 2J4WL 1RHHB 1YYML 4YLQT 3V5KB 5L88H 4MJ5B 2YZ8A 2ZZUT 1NCBL 4X6EA 3GMMA 2VDRH 3IDYB 1T83C 5DJ8A 4F9PA 3U7WH 3WNLA 2KL6A 5LG1A 3MRRA 4NT6B 4Y1AB 1ONQB 4UT7H 1EFXD 4DW2H 3K2UH 4B0MM 3B6SB 1DLFL 1AIFB 3JTSA 4FXGB 4OLZH 5I1LA 1GGBL 1WWAX 2W0LA 4Y4KD 4ELME 2VDNL 2D0GA 4XMLH 5T3XE 5J89A 2PXYA 5DMYA 2CXGA 2R29L 1QBLL 2BSSA 3P3YA 3C87A 2E7BA 1UFUA 3E3QE 3UPRA 1KTLB 5MEND 1ZSDB 3KXFD 1O0VA 3EW3B 2FH6A 4BSWB 2QJDA 4ODSH 4R96B 4PY8I 2NW2A 4HDIB 2NTSP 4WUUB 2YA1A 3UDWC 1T7VA 3O11A 3F65A 2LU7A 3EFDH 5CHNA 4OT1H 1KCLA 2IAND 1I7TB 4M1GL 4P2QA 2R1YA 2XKSA 4OIIL 3X12B 4XXCC 1VADA 5J13C 2VWEE 3HCVB 3KYOB 1IC1A 4MNQB 3ZE2E 4P48A 1FO0L 3BQUC 5DVNA 4E0RB 3EFFA 5DQDH 5C6WH 3PUCA 4JGUA 5EWIH 3CFBA 5IB4B 1FV1A 5DTFB 5BRZD 1I7UA 3I2CH 4EVNB 4X6FA 2XZAH 1HZHL 4O2CA 4K8RH 1WWCA 3RTQA 2X4TA 3K0WA 1W0YT 3ILPB 1P84J 5IVOA 3SDDD 3MCLH 4TUKH 2VLLB 2X9WA 4DTGL 5DJYA 1QLRB 3VMPA 4OKVB 4U6YA 1X4ZA 2SEBA 4ZXBA 4PIRF 1DVFA 2VE6B 4M3JA 2O5ZL 1FVEA 4NKMB 1W0WA 5INDA 2PKDA 4WFFE 4HKZA 3I85A 1NEUA 4HIEA 1KBGH 4S2SB 2AKRB 4MNHB 4NN7C 3VGAC 5MP6L 5GRYA 5IROC 4PJEA 4NC1E 5F7DB 1QFHA 1Q94B 3L7FB 3QHFL 1UB6B 5I1KL 5DI8A 1ZHBB 1KJ2H 2FHFA 2Y23A 1QHOA 1R3KB 3E6HA 4CRPA 3V7MA 3FHAA 3O4OB 2AJVL 1XGRA 1LO4L 4QF1A 3S6CA 4ZFOL 1DUZA 3MGOA 4D0BA 3MA7B 3NTCL 1JZ4A 4F9LC 4YAQA 5F9WC 4YDJA 5D71L 5HHOA 1YY9C 5C0JA 3WN5A 4NKOA 5FUZH 4HT1L 2NR6D 5EU7E 1S9WB 1U8PA 5CZVH 4XAWL 4YHOH 1A14H 4RISL 1A6WH 2P45B 1MFDH 1RIHH 5IB5B 2XICA 3V4PH 4KUZH 1J0HA 5IBTH 3QCTH 3O4LB 4X6DE 1FNSL 3ZMRA 1JP5A 4I13B 4Z76B 2LU4A 3ZDZF 2ADJA 3SDXF 4O51A 4QY8B 1S9YB 1B0WA 2IFGA 1EXUB 4ACPA 4HHAB 3VA2C 2R1XA 1KCUL 5TFSH 1S9VB 3MRBB 5SWQA 5FHAH 3PL6A 1GPOL 4Z7VF 1BD2B 5DRNA 3BVNA 5CJQL 32C2A 1KGCE 2BK8A 5HYFA 2NZIA 4PJXF 2BFVL 1F45A 1JWUA 2F53B 2A6DA 4YHIB 1CZ8L 4JPWL 4TRPH 3ZKNC 4X9IA 3HE7A 5H35B 4URTB 5E99H 4Z7OE 1TJGH 3LKPA 3I3EA 2H2PC 3KPSA 3PJSB 1PLGL 5EZIH 4GKSB 4P2RD 5TE7L 4Y4FA 4ZQKB 3IVKA 2O93L 1QO3B 3WS3B 4QCIB 1XIWA 2YRZA 1EHLH 4LSQL 3GBML 4D8PA 4LPCA 1LNUA 4JZNA 2FLBT 4Z78B 3DXAB 3KJ6H 1MFAH 4LCUB 2HJKA 4WENB 4GAFB 5FGCB 5ISZA 1MJJB 4BFGA 3IYLW 4JM2C 4M6ML 4UT6H 3DUSA 3MSPA 4IRSD 3DV4B 1Z0NA 5ALBH 1HILA 1X5AA 3GKZA 3TBSB 4BELD 4XP6H 5C1MB 4I0PD 2RCSH 1Q9LB 3BXNA 1KTDB 3U0PB 1P69B 4HC1L 1MAJA 4W4NA 4BQCA 1SEQL 3IDIA 1KPVB 5CINL 5TQ0L 2FO1A 4ODXB 3U7AA 3VMNA 2ORBH 3C8KB 3L3OA 4YDKH 3ZLQC 5H2BA 4XZUB 5JHDB 4U6HA 4XC3L 3S88H 2X09A 1WTGT 3X3FL 1VERA 1E4KC 5EU3B 5GS1A 1DQTA 1BGXL 2VDML 4KAQH 4PJ7E 2X4QB 1IARB 1HYSD 4XVSL 3GIZH 3RX5A 2DQHL 1N8ZA 1U0QA 4HF5L 4XHQA 2E6PA 3S96A 2VIRA 3BWUC 5E4EB 4HPYH 4YHYB 1H3PL 2XNAA 2YD2A 4DGIH 4G42A 1NDGA 1EGJA 1OARH 4M1DL 2VLKB 4MA8H 4ONFH 4U05A 2VN7A 3FONA 3CVHL 2MJWA 4NNXA 3NACL 2BVQA 1K3IA 3U9UB 3P0YL 1QRNA 3RIFK 1L4IA 2VNCA 4KJYB 1F6FB 4EJ1C 2VOTA 2FSEB 1DLHA 4P23D 4ZAKA 5LCVL 1C7TA 1SY6L 2C4FU 1CICC 1P7KA 4W81A 4HIXH 4LVEA 4LIQE 3H7LA 4U2ZA 4Y2DA 5JO5A 2B5IB 5DRXB 2CDGB 2HFGL 4PB9L 3MACL 4I2XE 5ISZE 1FPTL 1DEEB 4F33A 5DJDB 3AAZA 1U9KA 3H3BC 3HRPA 3QO0B 1RUKH 3VXSA 5F7HA 1U36A 4KI5E 3MLYH 5H94A 2YHGA 4IMKA 4OB5L 1Q1JL 3D87B 1UM5L 4JAMA 4PB0H 1ZA6A 1FZMA 1ZLWK 1IAOA 3KYMA 3OKMA 3TZVD 2X41A 4PJFA 3AU1B 5HSFA 4HWBA 4NQCA 4LNVA 2D7NA 3C9NB 3RWHB 1D9KA 4JRXB 4KRPC 2A1WH 3O9WB 5E08H 4PRPA 4QEGA 4MXQC 4MVBC 2XXCB 3WKML 3HAEH 1O5DT 5MEPA 3FRUB 4PY7A 3MRNB 3RWGA 2ED9A 2XQBH 1HH6B 3D25B 4R3SA 3R1GH 1R3LA 4TUOB 1ND0A 3BUYA 2F54B 4G80A 4WTZG 2JE8A 4J4PC 5CBAA 1J8KA 2P5EE 4OGXL 5AYQA 4LSSH 5KSAA 1HHGB 1NC4A 3PXJA 2QV2A 1GXEA 3NN8A 4MNGB 1CD0A 3V7AG 1KJVA 1FORH 1BZ9B 4PRID 3KNBB 5TE6H 2OK0H 3C60C 2MQCA 4M9OA 1LK3H 4KRPD 2YS4A 2ZCHL 4OJFH 4JB9L 1CT8A 3G6JE 1LO5A 2HLAB 4C55A 1A9EB 1OWWA 5BVPL 1AGCB 4NNYA 5D70L 4IS6B 1BQSA 1CTOA 5AWNH 1CFNB 4HWZA 4A2LA 4X7FC 1KXVC 4J4PD 4OZIB 1ZEAH 4NQVB 2P8PA 3SCMD 2HKFL 5E03A 3ET9F 1CLCA 1U3JA 3D0LB 3L5XL 5INCA 2EXWC 4AEEA 3C5SB 5E2WL 4ISVA 5LGHH 3U36B 5IW3A 2YUWA 5C0BA 4HKXB 3NIGE 4L9LC 5EG6C 3C5JB 1XZ0A 2EH7L 5FO7B 4R7DA 5GGVY 5IESL 2FBJL 4YNYA 1G84A 2AK4E 1C7SA 1UWEH 1QSZA 2Z31B 2C5DC 3PV6A 3KPPA 3P11H 2DLEA 3QP3A 2MCG1 2LE9A 5JR1H 1LO0L 1YNLH 2JK5B 3LRSA 4MCZB 2GTZB 4HUXA 4CVWA 3P73B 3PE9A 2IBZY 2QQKH 5T1DL 3V6ZA 4CN6A 1F11B 5EBLB 1CGYA 5JXEA 1JK8A 3HZMB 5TGBB 1MIEH 4NJ9H 1E6JL 1OAXL 2R0LL 1QSEA 1X5IA 1YMMA 4F7PA 3NIDE 1CF8H 4LPWA 1JHLH 2D7OA 2R56H 2X42A 3I50H 1KJMA 4M6NL 3G04B 4C54A 3VFRB 1ZVHA 4AIOA 3VXQB 3B9KA 1DBJL 1IGIH 4MMZC 3DX7A 5ID0B 5T3ZH 2A73B 2XZCL 4YH6A 5C0CA 5AZ2H 3T1FA 1G9EA 4U33A 4NQTA 2IPKA 12E8L 2OL3B 3STLB 2OJZH 2V5SA 1A6PA 3C6SA 1G6RH 4OFDA 3BX7C 5DFVD 2H45A 2R23A 2CDFA 3VRJA 4AH2A 2AV7A 1U8OB 1Z5LA 4NGHH 3LQMA 3TGXA 3CGTA 2VDLH 4UQ2A 2XY1A 2HKHH 2IADB 2XWTB 1EMTL 3P2TA 3U9PL 3QG7L 4JO1L 5C0BE 4UILL 3S3PA 5B39A 2YPLB 1EPFA 2LAAA 5A16B 3GHEH 1YEIH 1BEYH 2Q7YB 3PGFH 4WFFD 5MEQA 4RMWA 4JVWA 4R0LA 1G7HA 5F6HI 1MCHA 1B0GB 2YK1H 4YXLH 5FV2A 1LP9E 1UJ3A 5HGHA 1J0YA 1DFBH 4UI2A 2IAMA 3D5OF 2ENYA 3L5HA 2IC2A 3CLEH 2G5RA 1WGOA 3GSNB 4Y4HA 5CP3A 4I18C 4JFED 3VWKC 1TTGA 3VI3E 4D3CL 2ZOLA 1QSEE 4MXWH 1D7FA 2IFFL 1A22B 1WEJH 1L7IH 5C6TL 3GUTA 5IB2B 1HINL 1H0DA 2Z92A 5CJBA 3V52H 1U8MA 4PJIE 4JPIA 1J8HA 4ODTL 4FNLH 2E7LC 1EIBA 4NO3B 4QOKD 1KLGB 1XF3B 3MYJA 5AUMA 1N6QL 3G5YB 1IKFH 2IALB 4EIGB 4HUMB 4DZ8B 4XNZB 3VXNB 4DGVH 2A38A 4RWHA 1TQCC 5IQ9A 4LHUD 1YNKH 2LFGA 3NVQA 2A6KB 4Z8FL 1H5BA 2P8MA 2OS7A 1G1YA 4M1CC 2OZ4H 3DVFA 4CU8A 2DICA 1IC4L 4U1LB 1OSPL 4PR5B 2PYEE 1VFMA 4ORGA 5EC2B 5GS2H 4CVXB 2F9BT 3QDGE 5T33L 2V2XA 4RAUA 1F02I 3O6FC 4JG1L 1HYRC 3KAAA 3V8CA 3FO0H 4BA8A 3RPKA 3FHQA 3N1GC 4FMFA 5FUCE 2AJSH 1G0XA 4MHHG 4PRHB 3TVMB 1U93A 1XR8B 3FMGL 2DYPA 3PDDA 3F7QA 3MPCA 4JVPA 3FFCD 1EV2E 2R2HB 2BY0A 1NLDL 5D6DA 2C1PA 1ITCA 1BOGB 5IHLB 3SJVD 1FFPB 3JBG7 4L29B 4JANA 5T3XH 1MCQA 1Y6NR 2IH3A 4XP9L 1F90L 4G8GD 4MAUH 2X70A 5GRZA 4LSRL 4YHMH 1J1OL 3O0RL 4OI8A 4HPOL 4P5MA 4XPTL 2VITB 5IOPB 5CMAA 1KXTB 4UUJB 1T7ZA 2NX5B 1JPTL 5DK3A 1OP3H 5GJSL 3RDTA 1KN2L 5D8JH 2OM5A 1EAJA 3MV7B 4ETYA 4PGDA 3WLWC 4YBHA 2ZG3A 4FG6D 4JY5H 5EOQL 4TOYL 3CSGA 1NCDH 4AT6A 3ULVF 4DUVA 5SWZB 2OTWB 2GK0B 5FO8B 5I76A 1AXTH 2CKBA 1G6VK 4OD2A 2HFFB 3HNTL 1J9CT 5C08E 2V5RA 1SMOA 4GG6B 4FXKA 1MCRA 3REWA 3BZFA 3O6LH 4NFDA 4FQIH 5TDNA 1EO8L 2VDKL 4U7KA 5IMMB 4LEOB 1T03H 5CS7A 3H3KA 3EYVA 1I1FB 5BXFB 4PV9B 3BO8A 4X0KB 3PHOA 5M94B 1SEBB 3OTTA 1B4JH 1U8HB 3QUXC 4PJDB 5EH1A 4JFYB 4GKZA 4XCNA 4XNQB 1XGQA 2BJMH 2BSTB 5DS8B 3IAGC 3T4AB 2EE3A 1G7LA 2PNDA 4HX1B 3VG0H 4RFEA 4X6CE 1AGFB 3VFSA 1RJYA 4UAOC 2HT4C 4J1UA 4PRDA 1FRGL 2ID5A 4HMCA 5DQJB 5LJYH 1AD9B 5A2JH 4WWKD 2AJYL 4TSCH 4OGAD 4RFOH 5FF6B 4ONGL 4I5BA 3BSZH 3ME0A 2NY2C 3EDEA 3N9GL 3GSRA 2B4CC 3KS0J 4JRYD 2CKNA 1GIGH 1K8DB 1FYTE 4XNUH 2VXVL 1R0AH 1L6XA 2ZPKH 2R0WL 3GGWB 5DD1L 4XP1L 1GZPB 1QHPA 3G08A 1VESA 1OGTB 3PF2A 3BP7A 1IZKA 3O3BB 1I9EA 2BRRL 1S7TB 4G6AC 1C5DA 5I1DB 1TJHL 4KTYA 4D2NA 4UQ3A 5I1HL 3ULUF 1OCWH 3PHQB 4LCCB 2N7AA 3VW3L 3QUMB 4K23H 1ZWIB 2I9TB 1FFOA 3QR2A 3HE6A 5JHLL 2CLZB 5CEZD 1MCWW 1NC2D 2A9MH 4FP8H 3QJHB 4APQB 1VFUA 1T66D 3MV9D 2R9HC 2YPVH 2FNBA 2W0PA 3O2DL 3HI6H 1FAIH 4QRRA 3CZFA 4XNMA 1J0ZA 1DBBH 3OR7B 2W9LA 1ZLSL 4HS6B 4ZO7A 1MLBB 5EZLA 3SOBL 1NFDB 4UTBL 3HI5H 2XN9A 4OZIF 4LCWB 3FQTB 2VZOA 2HRPL 3UCRA 2X89A 3RGVA 1JNHB 1C16A 5TE4H 3UP1A 1RZJC 2AGJL 1WK0A 2I60H 3HB3C 3MLWL 3GSOB 3MUZ1 5SWSE 2MCPL 3QDMD 4PJBB 1M05A 1U58A 2FO4B 2FH8A 3DX9B 4OGYL 3ARQA 4XCEB 4M48L 4BKLA 5KSBF 2BNRD 2GFBB 3C5ZD 5DVLA 1ZGLP 4UB0H 3V6OC 4DGYH 3L1OH 4AL8L 2ZSVB 1R24B 2GSIB 1Y6MR 4CJ0A 4ODVL 2E7CA 5TJWK 5B8CB 1IM9D 5CIPH 1JI2A 1TZHA 5LQBH 4I9WD 3W39B 5DJAA 1JNLH 1YEHL 2DQCH 3GKWH 4JKLA 2EH8L 5CILH 4JZOA 2UY7A 1TQBB 1DBMH 3BGFC 1VEOA 3WSQL 2DWEB 4C4KO 1ZK9A 5FIEA 2X4SA 3KYNA 2YOCA 5IIEA 3FZUD 4LLWA 4JM4L 3HUJA 4OCNC 1IGJA 2VQUA 1DQLH 4JFDD 1K8IA 25C8H 3MLSL 4JHAH 3SDAD 3HI1B 2EE6A 1CR9L 5DUMH 2DOCA 5DWUL 5DYOB 1G9MH 2CRMA 3L3KB 4ZUSB 3ZDZE 7CGTA 5JNYB 5IF0B 3BPNB 3LEYH 3SDXE 3IJHB 3TBYB 2NZ9C 4YIQB 2P7TA 3UTPD 1HH9B 4J3XA 3HMXA 2QLVB 3KPQB 2YZ1A 1P7HL 1IGMH 3INUH 5A40E 2FGZA 2K3TA 1I1AA 1T1YA 4L4VD 1U91B 4ZTPL 4Z7VE 1NLBH 1T5XA 3P0VL 1NKRA 3SGEI 4XCYA 3MLVL 3QUYA 3DMMC 1KB5L 4PRNB 3EYSL 4V1DD 3VWJA 1URLA 1IGTB 3BD4A 4PJXE 1D5ZB 5B39G 2CDEA 5GRUH 3NABH 4ODHH 1KN4L 5L7XL 5E6YA 4CVUA 1ZLUH 5D5MF 4GFTB 1S5IL 3CFEA 1WAAA 1RJLA 5FKPA 1T1ZA 1E4WL 5F1KC 4L3EB 3RI5F 5HBBA 3TBTA 3N85H 2VXUL 4Y8AA 1MREH 2D0FA 2B1AL 2HYMA 1KB9K 4LGSB 4ZFFB 2X44D 2CPCA 4LF3A 4D9LL 4F2MB 4ALAH 4X5WA 1FNLA 1N6UA 5GRVL 5EZJA 5JDSA 4JQIL 4IRJB 4LIQH 1J86A 3G6AA 3QEQD 3RX7A 2VAJA 1WBXB 3O6ML 3S5LB 3SGJC 3WS6A 2WBJB 3LEVL 3SKNA 1MNUH 3D39D 3JTTA 4K3GA 1ZANH 3TBWB 4CU7A 1AXIB 3DPBA 2BVOA 4GMTH 5JW5B 2HLFC 4MD4B 5L2JB 1E28A 1QSVA 3OKEB 1UKTA 3S35X 3IDXL 1KCKA 1YQVL 1YEKL 3E0GA 3B8YA 3RY5A 4PJ5E 2HP4A 4LLVB 1MFEH 3BN9C 5D1XA 4XWOD 3U30B 5K9QI 1SBSL 3P9MA 3G9VA 4NQDA 5GS3A 2FL5B 4TNWF 2YMXL 1KEMH 3FCTB 1PEZA 4Y5YC 4JKMA 1NH6A 4YHZH 4D9QE 2AI0H 4P2OA 3D0VA 4P5TC 4K8RC 1I1YA 1TCMA 3MRDB 1HDMA 1OTUD 4XAKD 1WVZA 3EYFB 4TVPD 4HIJB 1BQLL 5IM7B 1A6ZA 3BAEH 2EDLA 4J6RL 1ACZA 5K9JL 2C3XA 1T1WB 5DT1L 3V5KA 2CIKB 3ARGB 3DX8A 2DQFB 1HHHA 1FO0A 2D7TH 1EGJH 5KVDH 1NCTA 3BN9D 3QBTB 1FZKA 3OAYH 4O4YL 1Q72L 3H9SB 3TJHC 3FFDA 1FNHA 1A7OL 3P30L 4NT6A 4L5FL 2FJGB 3OJMB 4QHNB 2R0KL 4Q58C 3EHBC 4U1IA 4JPVH 3A6OA 3LDBB 1AFVH 3U0TA 3N0PB 4WO4A 1D5IL 1ZVSB 4K8RD 3MREA 4PREB 4S1DC 4XWGL 1FC2D 1AD0B 2R8SL 3DO7B 4KKNA 3T4YB 2PTTB 1S7UB 1KTLA 1Z3GL 1W0VA 4GKNB 5C09A 3X14B 4PRAB 2KH2B 1JTPA 1HOCB 1FAKT 4ENED 3LY6A 3CK0L 4BSWA 1SJEA 1F5WA 4LMQE 1HK6A 5E0QA 1OTSC 1B0RA 1IJ9A 3QO1A 2UVFA 1VB9A 1N64H 3GHBH 1T21B 4HWBH 2Q76A 3MJ7A 4NKQB 3MBXL 4NN5C 2XFXB 1NFKA 4WW2C 1FNAA 2AK1H 4NN6C 1T3FA 1PZ5B 2LAGB 5F1NA 3X11B 4Z7UB 2CK2A 3QULB 5GGTH 3MRIA 3S3SA 4OZGB 4M8VA 1LMKA 3PP3K 4PJ9B 4ZOBA 2NLJB 4BUHA 5ANMB 3B2VL 7FABL 2FX7L 4NWTL 5GGRA 2B4CL 4Z0XA 1INEH 3IS0X 1F4YL 1AHWC 4PJDF 4X7DC 4DN3H 3VFNB 5KTEH 2ICCA 3HNVL 4XCCH 4WGWB 4G8IB 2VLLA 4R2GC 5TQ2L 1QLRA 1VPOH 1U8IA 1U2CA 4MAYB 4U0QB 3LS5H 4NP4L 1OB1B 1OQOA 1U8JB 3ROOB 1GZQB 1K5NB 1JRHL 4NDMA 3TT3L 4IOFC 1C5BH 1WZMA 3IS1X 4YPGA 5DHVB 3QZWA 4I3RH 2MFNA 4Z5RB 1QLEH 2IEPA 2OJEB 3QEUA 1RUML 4MX7B 4O00A 4PJ8D 2Q8AH 4MWFB 5K59F 2H1PH 4YGVA 4EI5D 3HZKA 5L9DL 4LLAA 5FM5M 2BC4B 2FIRT 3CX2A 4MYWB 1V05A 2ZJSL 5I8KH 5F9OL 4E41B 3D69A 4Y19B 5C0EA 4EN3A 1LO3H 1S7RB 4WUUE 1S78C 1D3CA 1WLHA 4H26B 2IQAA 3BZEB 1MEXL 5EIQA 1NMBH 1FVCA 2BHZA 3BKMH 3IFLH 2GJ6D 4NZTL 5E9DB 4J8RB 3MRJB 4Z95L 3QG6B 4IOFD 1G7IB 1YDPA 1V5JA 1PYWA 4QHMA 1B2WL 1P4IH 5HGAA 4E5XB 5L2KD 4UDTB 3O4LA 1RZJL 1N5AB 4JREC 4JFFB 3ARWA 3MA9H 3DVGA 1PKQB 3MNWA 4JR9L 3WXWL 4GG8A 1EXUA 2EIDA 3OJVC 2WLYA 3MRBA 3BP4B 4XB7A 3SDCC 5CSZA 1JGLH 1R6VA 5FOBA 4LSPH 1PZUB 2AJXL 5IK3B 2XG4A 2VSCA 2V7NB 2YWZA 4N90D 8FABA 3KLHC 2RHEA 2N7BA 3QUZA 3VFGL 1A7PL 4LLQB 3DGGB 1MVUB 4FFVC 4UNVA 4YHIA 5CZXD 4HQQL 1X7QB 5EBWB 2X1WL 4ZFOB 5CCKH 1EO5A 5E2VH 1ZMYA 3MR9B 4YXKL 5F97E 4E42B 1YEEH 4GKSA 5CAYB 4KQ3L 4U3HA 2VQ1B 4NSKB 1MHCA 4HH9B 3TO2B 3KPNB 4N9GB 4MB4A 4QO1A 1QO3A 1I8MA 4ZUTA 4UTAH 2A6JB 1M7XA 3CVHA 2XQYG 2DTML 3ARFC 4JG0H 1FH5L 3QIBD 5D7LD 3P4NA 2UYLB 4HS3A 3VH8A 2APFA 1MJJA 4G6MH 1LEKB 5I66A 2EKJA 3O2VL 1HHKB 1KJ3L 3KLHD 4XPBL 4KJPD 4QLRA 4BQ8A 2UY6A 1BFOB 1VEPA 3BUTA 2ZKHL 4FFVD 5HGBA 4U1MA 5L88L 4ODWB 3NFPB 5IB1A 3ARTA 2VDRL 4GW1A 2JB5H 3U7WL 4W6WB 5BJTA 3C8KA 4EUPB 3HC0A 4DW2L 5I73B 3K2UL 4M5ZH 3FB8B 3O4LE 4KK8C 4OLZL 4DKFH 3GRWA 2H3NB 4GRWF 4N8PA 4XMLL 1VGKA 1A2YA 5CP3H 3L95A 4YFEA 1F4AA 3GSVA 1HSAB 1UB5B 1G7MB 2X4QA 3ROLB 2AJZB 4JFOA 2NY3D 1BD2E 4YQXH 4GS7B 5JOFB 1IZJA 4ODSL 3BFOA 1A64A 1T83A 4HUVB 2F53E 1EVTC 1C1EH 2FX8H 2HVKB 3MRFB 4G6JH 3EFDL 5FYKE 4N0UA 4OT1L 5D96B 4QRPD 3UJIH 2CSPA 3MBEC 3QIUA 2DQJH 4FQHA 4M7KH 1NSNH 1T0MB 1SYVB 3P9LA 1P6FA 3N1FC 5FA4B 3SE4C 5D6CA 4W70A 3TO4B 1JZ3A 1LE9A 1CXEA 3PGDB 5I8CA 2R1WB 1I85C 4JCLA 1WZKA 4X6BB 1KPUB 5DQDL 6CGTA 4N8VB 5DRXA 3DXAE 3QIWD 5FGCE 2CDGA 2XKUA 4RFNC 5EWIL 5J3HD 2QSVA 3H42H 2IPUK 4ZOEA 1F6AA 5GRJH 4UNTA 1ES0A 3CPLA 2O5XH 3I2CL 1V3LA 1TPXC 2XZAL 3GSXA 4BH8B 4K8RL 3UDWA 3CFIC 3WFHB 2UWEB 1VACA 3O6KH 2UVEA 1RZKH 3MCLL 4TUKL 2X6MA 5CEYB 3RL1B 3C9NA 3RWHA 3BGMB 3RWEB 1KIQB 1UXSA 3VXTB 5JHDE 5J6GB 1X5GA 2VLMD 1F4XH 4LVOC 4PP2A 4Y5VC 3BQUA 4G9FA 2HMID 4G3YH 1KBGL 5DMKA 5JXAH 3VXUA 1MAMH 4FQXD 1BM3H 3ULVE 4PJ5D 5LGKA 2DWDB 3W2DH 3OGCA 1KJ2L 3T3PF 1UJTA 5F6HJ 2VLKE 1BZ9A 5SX5K 5SV4A 4ZDHB 4LHJB 4MJID 2CKBH 1EFXB 4JFPB 1JYWA 3B3IA 1T22A 5FUZL 3F7VA 2CLVB 4XH2A 2N1KA 4Y4KB 1DANT 5CZVL 2P5WB 4L8DA 4YHOL 1A14L 1A6WL 3U6RA 3OKDB 3WJJC 3RZCD 3VXMD 1MFDL 2ESVD 1S9KC 1RIHL 3EJZC 3HFMH 3V4PL 1FJ1A 4KUZL 4PGBA 5IBTL 4OCMC 3BPCB 3QCTL 3VFPB 1FLTX 5M7QA 5MENB 3VXRA 3OKNA 1OLZA 1K4CA 3DX6B 3KXFB 4QRQB 3TA3C 1TFHA 4UOJA 3ES6A 1YPZF 3DLQR 4LPYA 1XGTB 5GJTH 5TFSL 5EULV 1MRDH 4HK3J 5FHAL 3TM6A 2AXJA 3HMWH 4U6XA 5DURB 4GQ9H 4F9LA 2ARWA 5KSBA 2IG2H 4PJCF 2IANB 3QDJA 4PRBB 2DQIH 3WFEH 4X5XA 3CAFA 1WCBB 4BK4A 4JRXE 3OPZH 2DJ4A 1I8IA 1M6OA 4P5KA 4TRPL 4ONHB 1S7VA 4YHNA 5E99L 4L1DA 1TJGL 4MCZA 4QWWC 3EO9H 1JWSB 3G5ZA 5EZIL 3BKJH 1AXSA 2F54E 5EC1B 2WIIA 4L3CA 3FOMA 1EHNA 3HZMA 3BP5A 4JHBA 1IGYA 5BRZB 2L7UA 1EHLL 4OLEA 4OZGF 3ULUE 3KJ6L 1MFAL 3MFFA 4NIKB 4MNGE 1F13A 3SDDB 4ZYKB 5J7CC 4UT6L 1I8LC 2X4RB 5ALBL 4XP6L 4XP5H 2RCSL 2NW3A 3QNZA 4P3WA 4ZUUA 2OL3A 4YZFF 3MV8D 2GCYA 2ORBL 4XMKH 3QZWG 4YDKL 3B83A 4ELKA 5MHSD 4GAGH 3S88L 1WQVT 4WRLA 5E1AA 5I8OH 4KKLC 4OZIE 3CH8A 3RY4A 2NXYC 4HIIA 5TF1H 5F1IB 1JTTA 1XF4A 2P8LA 4KAQL 4NBZB 2GT9B 1H8OA 3EJYC 1VENA 1FGNH 1FL3B 2C9AA 1JUFB 2IADA 4N1CA 4Y1AD 5D5MA 5DRZB 3GIZL 2ZP0T 1FGVH 3MLTA 1N0LA 4HPYL 3QXDA 3T08A 4CL7A 4DGIL 1N2RA 2Q7YA 1QQDB 4F57H 1OARL 3PNWB 5DDHA 3OQ3B 4MA8L 5DC9B 4ONFL 3K1DA 3ZHKA 4JQVC 1BVLB 1JWMA 2F8XC 5GS2D 1GVIA 1I7RB 1HHIB 4OCWH 2R69H 1TTFA 1E4KA 5DJXB 3SKMB 3VGAB 3S9DB 3L7EB 2EDHA 1CIUA 4LFHG 3S35H 1YC8A 4HZLA 3EJYD 4HIXL 4OCLC 3IETA 6FABH 2ADIA 2QBWA 2O5YH 5I1AB 1L7TH 3E8UH 3TN0A 1A21A 4KJQD 5F9WB 4NQSA 3AC0A 2AXFA 1RIUH 3AREA 3SQBA 1RUKL 1EEUA 1QSFA 5FYJH 3MLYL 3MMEB 4WI5A 5FB8A 2OSLA 1A4JB 4MNQD 1TZGH 4Y16D 4NQEB 3QT2A 2MMXA 3QXWA 4XMPH 5D7IA 2LABA 1MI5A 2VISA 3T2NH 3F7RA 2VZUA 3L3GB 3D18A 5CUSH 4P2RB 5E08L 2A1WL 5ERWB 3HMXH 3TV3H 3VRIB 1ACYH 4N9OB 4PJGB 5I74C 1NMCB 2EKSB 2Q20A 3GK8H 5EDXA 5ID1A 1QFUH 2XQBL 3U83A 4F9PC 2EEAA 4PR5A 3VH8G 4BQBA 3R1GL 2Z91A 4JFHD 2ERJC 1JRHI 2EDBA 2OR9H 4IRSB 3P77A 4LSSL 2YPLE 3QXAA 4LKXA 4YBLC 3FQNB 5FO9A 1CFBA 3VGDA 4XC1H 2PXYC 2XYCA 2Q1EA 4PRHA 1AI1H 4OKDA 4F7MB 5D1ZA 1FORL 4HK0B 2BNUA 4JHWH 5JPMA 1CU4H 3AFLA 5TE6L 2OK0L 1LK3L 2N56A 1MHEA 5I15H 4NC1C 1RHFA 3S4SA 4N0FA 4OJFL 5A2LH 3FOLA 4Z77B 5C3TA 4BQ9A 4NO5B 2XT1B 5DHYB 3KDMA 4G8EA 4HGWA 4MQXD 1QR1A 3OF6A 1IFHH 5AWNL 3ZYZA 3CDYA 2XTJE 1FBIH 1JPFA 3ZTNH 3E6FB 4ZUVA 3VD9A 3MODH 4YEEA 4RZCB 4JM2B 4YC2C 1ZEAL 2R2CA 1QA9A 1WWBX 3UEZA 1LEIB 5IG7B 5EU7C 5EBGA 5CKGA 3ULSB 1K3ZA 5JW3H 4LPUA 4YR6A 3GIVB 5LGHL 1CGSH 2ZUUA 1J0IA 3GBNH 4LNRA 1QP1A 1G1CA 3C60A 5EOTB 1XF2B 4F8QA 2R2BB 1HKLH 2DD8H 4KXZI 4OUOA 1B4RA 2A77H 2WLZA 4OF8A 1ZHLA 4P23B 5TDPB 4KHTH 3GB7A 2D9CA 4H5SB 4WW1B 5DJ6A 1WFTA 3P11L 1T7XA 4LLDB 5JR1L 1YNLL 5IMMA 2FJFB 4LEOA 3AGVA 3FL7A 5DO2D 5DRWB 4YWGH 5BXFA 2QQKL 4XBEH 4P2QD 4POZC 4J3OC 4PJDA 5AEAA 4ZXBC 1DVFC 1MIEL 4NUJB 4NJ9L 4XNQA 4F7TA 1Z9MA 5F6IC 1RURH 5DS8A 3T4AA 3BEWA 4AY0A 3OXRA 4QHLB 1CF8L 1JHLL 3O2DA 4PRHE 4L9LA 3W5MA 2R56L 1OTTC 5FK9A 1DJSA 3I50L 1UXWB 3R4DA 5DQJA 4JY6B 2BVUA 5EU5B 3FN3A 1IGIL 2UWEF 4U1GB 5FF6A 5T3ZL 1QBBA 1RZ8B 5AZ2L 3TCLB 3RFZC 1C12A 1CICB 1OW0A 5F70A 2OJZL 1NCNA 1MCJA 2X4UA 3TWCH 4U1NA 3RTQD 4BZ1H 3R0NA 4OF0A 2EYRA 4PTTB 3UPAA 1G6RL 1ORQA 2E5EA 2NX5E 1PDKA 3FJTA 3AM8C 3DSNA 1W72B 2VL5B 3MV7E 1U3YA 1A6UH 4NGHL 4R4BA 3O3BA 2VDLL 2JJSA 3LMJH 3CMGA 2FJHB 2HKHL 3O3EB 1G9MC 5SWZE 4DWHA 3QA3B 2Y7QA 3O2WH 2QADC 3PHQA 2G9HB 5F9JA 4KRPB 3GHEL 1YEIL 4LLMB 1BEYL 4FQ1H 2IBZX 2JJUA 3PGFL 4DUWA 4PG2A 1AP2B 2EDRA 4GG6E 1IT9H 2YK1L 3LS4H 4TN9A 4YXLL 3UZEA 2P1YA 4OQ1A 1DFBL 2YEZA 3BKCH 3QH3A 1EUTA 4MB3A 1NQBA 3HG1A 5C0FA 3HPJB 3CLEL 1MCCA 3D85A 4ZODA 4RRPG 4PJDE 2VLRA 3CUPA 1RVFH 1MHPH 3FQTA 3PGCB 3KHQA 4MXWL 1E6OH 2GY7B 1JF1B 1WEJL 3GI9H 1L7IL 5J9PA 1OP9A 5I71C 3V52L 1EK3A 4XCEA 3DX9A 3EO0B 3IXAA 1RK1B 4PTUB 3QEGH 1XIWC 4FNLL 2PCPB 4UINH 4O2EB 4QT5A 4KJWC 1KB5A 3PL6D 1IKFL 3CFCH 5T1KD 3DETD 2Z8WC 4DGVL 5HHNB 3BH8B 3DO3A 3MRCB 1I3RB 1PVHA 4M6OH 4K7PY 1ETZB 2Z8RA 3VWKA 4KI5C 1YNKL 5GGUB 5IV2A 4HJGA 1F3DH 2GUOA 2JLLA 3LKSA 3DRTB 3RNQB 1AQDA 5DEFB 4D0CA 5HPOA 1CD9B 2OZ4L 1MFCH 3HE7D 4RWYH 1A1MA 3VGEA 1DTUA 1FL5B 1CE6A 1TNNA 3PWPB 2BSRA 4JRXD 5HGGS 1RMFH 1S7XA 3FO0L 4Y4FD 5JZ7C 4H25A 2E7LA 2AJSL 3UTTA 3RVXC 1BP3B 1MJ8H 2F54D 4FA8A 4KPHH 1MHHB 4J3VA 5HYQB 1U8LB 1HH9A 3IJSB 4PGCB 1ZLVK 5T3XL 4LARH 4R4NC 4ZMAT 43C9B 4A6YA 1C08A 4AM0B 3CC5A 4X7TB 4MAUL 5J1AB 3F8UB 5E8OA 3CZJA 4UBDC 4YHML 1AR2A 3A6BH 2DQDH 1NFDE 1YYLH 2WM0A 3JV6A 4LCWE 3GZKA 3QJFA 1KLUA 4P4KD 5D8JL 5JTWA 4TNWK 3M17B 3DOSA 4X5LA 1BOYA 1NCDL 3BPLB 2NTFA 4PJBE 3RVXD 3BGAA 3VFTA 4CMHB 2O61B 4L4TA 1AXTL 5FYKH 4KH2A 4Y2DC 1HEZB 4W4OA 5EOCH 1J05B 4G5ZH 4DZBB 2IF7A 1N6VA 4O2FB 1NGXA 2P24A 2YSSA 2EDXA 1K85A 1T0NB 4B7LA 4JFEB 4K55A 3VJ6B 3LKQA 4IMKC 1LILA 3O6LL 1S8DB 4FQIL 4PG9B 3FT2B 3MJ8A 4U6TA 4ZPVB 1T03L 3ARZA 3OKKB 1IM3A 1QRND 1AE6H 1U8NB 3T09A 3QWOB 3FB6B 1B4JL 3UJJH 1D9KC 3AS0A 4ZAKD 5DUPH 2BJML 1JV5A 4QOKB 4WU5A 2EEDA 1CDUA 4OFPA 2FEDC 4TPRH 3VG0L 2V2WA 4JKWA 4PP1C 1FDLH 4D94A 4NM4H 3V4UH 3MACH 4DKDC 4LP4A 2UZIH 4IIQC 5KG9A 2AEWA 1G7QB 3ARBD 4TSCL 3V6BR 1I8KB 4RFOL 3FO9B 2DL2A 3VXSD 3RVUD 4LHUB 4I18B 3KLAB 3GRWH 3BSZL 4NO2B 4MD0B 3BP6A 5J12C 3NGBB 1GIGL 3FQUA 2GAZB 3FT3A 1IQDB 3L5WB 4XNUL 4XCFH 1UWGH 4OZHB 1R0AL 2ZPKL 3VG9C 4PJGF 2J8UF 4NQCD 2DI8A 1HI6A 3FQWB 3QUXA 1HXMB 1D9KD 3DSFH 3ULVH 1FN4B 3D3VA 3LSOB 3MC0A 1A7NH 1HCFX 1TVBB 4PRPD 2ICES 5EORH 3QNXA 3TIDA 1T1WA 2CIKA 3NA9H 5HD8D 1K6QH 5GZOD 5F88A 2AQ2A 2CH8A 5KVEH 4L3EE 3FFCB 2JJWA 1D5MB 1OCWL 1FNEB 2FJGA 4K23L 3PV7A 3S4SG 5KSAD 2G5BB 2A9ML 1NC4D 1NAMB 4FP8L 4G8GB 1MFBH 5A2KH 4K7FA 4ZNEA 1YN7B 3QNYA 3NAAH 5K33A 4KV5F 5JLZB 1AD0A 2YPVL 1JHTB 4BSJA 4MA3A 3DO7A 3T4YA 3HI6L 1FAIL 3QFDB 1YPZA 1Q9OB 3O6FB 2PUQT 1DBBL 2Z4QA 4H0GA 3F5WB 1MPAH 4WI9A 5IR1B 1CYGA 3ZL4H 3HI5L 4M6AA 4M93B 1KXQE 4OAWA 4PJCA 2AW2A 3AY4A 3DTXB 2LTQC 3S37X 5CGTA 5HPMA 5KSVB 5TE4L 3T8XA 4F3FA 3QQ3B 3ILQC 2I60L 1D5XB 1YUHB 4PJAF 3OV6A 2XFXA 3N1MC 5D93B 3REVB 5C9JB 3PWNB 4UB0L 2OTPA 1JGDA 4F7CB 2NY0C 4DGYL 4Z6AT 1I7ZB 3L1OL 1JVKA 4P4RB 4CVZB 1PW3A 4OZGA 4B53A 5LQBL 2K9UA 1T6WA 5J4MA 2BMKB 3NMEA 3OL2A 1RIVH 1JNLL 2BXYA 3B9KC 2DQCL 3GKWL 4O9HH 5CILL 4BJLA 4XTRC 3D3VE 4Q0XH 1H3WM 2HJFB 1DBML 1EVUA 5IBLD 3ULUH 2E27H 5CEXB 4GRLC 3VFNA 2R4RH 3ILQD 5HYJB 3H9SE 2EC9T 4YK4C 1UZ6F 5JXED 2NY6C 1ZGLA 1DQLL 1J1PH 3MRMB 3PQYA 25C8L 4JHAL 4JGMA 4ZS6D 5IEKA 1S7QB 1K5NA 1NANH 1YMMD 3L3IB 5DUML 4PGEA 4JRYB 1EJ6A 4ZNEE 1G9ML 1T89C 1AR1C 4ZUWB 5DHVA 3EO1B 3LEYL 1F8TH 5D1QC 3IFPB 1UVQB 3EOAB 1QBAA 3ZT7A 4HEME 3B9KD 5IEHB 5DUBB 5FUCC 3PG2A 5C0CD 1IGML 3INUL 4UIMB 3RPIA 3HZYB 3JVGC 5DR5H 3IXTA 1NLBL 1SJHB 1EEQA 2OX5A 4XPFH 2E8YA 4GAYB 5EU6B 4AEHH 1MCBA 5CLTA 1S7RA 3UTQA 5DVKA 3NABL 4ODHL 5GRUL 3VFUB 1R3HA 2NY6D 2PW1B 3UTSA 5DJZA 2ICEB 1NC2B 1BJ1H 1OAYH 2VZTA 1OLLA 3MV9B 1MREL 3VXOA 4EQ3A 5JORA 4Z7UE 1IQWH 4UDTA 3TH4T 5IJVB 4BSVA 5FA3B 4ALAL 3CFJA 5B4MD 4OZGE 2Q6WB 4N0CC 2B20A 3BISA 1BWMA 1RD6A 3L3HB 3T3MF 4GLRH 3U4BH 3KHOA 4R97B 3AS1A 3DMMA 2KBGA 4LIQL 5ANME 4F15C 1NBYA 1CGXA 5FFLA 3V5HB 5IVXB 3EGSA 2FYYB 4L8CB 2DQTH 2IAMD 1OY3B 4KROC 5E6IC 3C8DA 5IK3A 1MNUL 2Y07H 4MDJB 1YECH 1ZANL 4GMTL 3QDMB 4Y4HD 3BI9X 3T0AA 2BY2A 2GYSA 4QXUH 2BNRB 3C5ZB 3PDOB 2WMPA 4LCYA 4ELMF 4NYLA 4WJ5B 4WY7H 1T80A 2J1KA 2OL3H 4I48B 1MFEL 5DJ2A 1U3HD 2H8PB 1GAFH 1BJ8A 1KPRA 1I4FA 1YEFH 2DBLH 5DGQA 1SHMA 3CDGB 1IM9B 4MJ4A 1KEML 5I16B 4N0CD 4NSKA 4YHZL 3KPNA 2UZYB 1J8HD 4LLYB 4YUEH 3QFJA 2AI0L 4NRZA 1L6ZA 4WHCA 3LEXB 4UDUA 3LPGA 4GH7B 3SGJA 4OZFB 2UYLA 1RZKC 4KROD 5BV7B 5D6DC 4E41E 4KI1A 4R8WH 4Y19E 3OG4B 4F37F 1P2CB 5C07D 3T0EA 2VZ1A 5FYLE 3BAEL 1BFOA 1BBDH 2F5AH 1BLNB 1AGBB 3ARDD 3SDAB 3STZB 2D7TL 5KVDL 1EGJL 5C0GA 5E9DE 1TVHB 3MUGA 4KMQA 5E4IA 3U4EA 3LV3A 3RIFF 1HXYA 2PETA 2H32A 3RDTC 2HG5B 4JPVL 1PGRB 2VXTH 1FFNA 1GGUA 1AFVL 4JFFE 3SY0B 3RWIB 1PKQE 1RPQA 3GSNH 4HUUA 3FAXA 2C3VA 2DYPD 4L4VB 2KZWA 2PO6C 4ORZC 2VKXA 3OKLB 4EDXB 4Z7NE 3RVTC 4V1DB 1ZLVH 3F6LA 4NO0A 1Q9KB 1CVRA 2V17H 5ITFA 1EHXA 3HRZB 2NY1C 5I2IA 1T2JA 4NRXA 5C0DB 4LEXH 4RA0C 4YE4H 5K9OB 1J1OH 4HBCH 5TH2B 5GQBA 3BD3A 1I9JH 3V0AC 1M7DB 3RKPA 3S36X 3I9GH 2QQLH 4X7SH 3MRPA 1N64L 5IGXH 3SGDH 3GHBL 4RNRB 5TDOB 4FABH 4HWBL 5ICYB 1A6TB 3GI8H 2ZUSA 4MD5B 1T0MA 1G9NH 2DJSA 4QTIH 5FA4A 2AK1L 1MUJB 2FLRT 1DDHA 3Q48A 2VUOA 3PGDA 3RVTD 3QEQB 3DYPA 4CADA 5GGTL 1FZOA 1NUDA 2VR5A 3D39B 2NY1D 1D5BB 1DEDA 3DROB 5DJ0A 5HJ3B 4X99B 3IDMA 1INEL 3NCEB 5HHQB 4Z7WB 1BECA 4DN3L 4HIHB 3TNMB 3FAWA 4OUUA 5KTEL 4XCCL 1XGUA 1VPOL 3UPCA 4AQOA 1E27A 2OI9C 3LS5L 1KIQA 5JUEH 5J6GA 1U42A 3K1KC 4N1HB 2BVTA 1A4KB 3LN4A 5GGVH 2CRYA 3JUYA 3LD8B 5ICZA 3DJ9A 2YKLH 1G7PA 1JZ8A 1C5BL 3KJ4C 3LKOB 3LAFA 1AO7A 4I3RL 1QLEL 3KVQA 5F7KC 1Y18A 1CLZH 3UBXB 1ZXQA 4JJ5A 2Q8AL 3MX0A 3SKOA 2ZCKH 4OZHF 3VE0B 2DM7A 5HDLA 1BQHB 4H0IA 4QGYA 5I8KL 4JLRA 3GSQB 1PQZA 5EUOA 2DM4A 4L8SC 1LO3L 2NYYD 4Z7OF 4RDQF 2DIBA 1NMBL 4JFPA 2QQNH 2YC1B 3BKML 1J12A 3MLZH 4Y5YB 3IFLL 5T1MA 2NXZD 3TBVB 4KKAC 1PSKH 2WINB 1FVDB 4ETQA 3CH1B 1YN6B 1DUYA 1SJVA 3OKDA 4LVNC 1S7SA 3VDBA 2QSQA 1P4IL 5I9QC 4U0RB 3BPCA 3VFPA 3U4AA 3HA0A 3MA9L 3HE6D 3J7HA 4XB8A 3MNVB 4WFED 3OKYA 2KPNA 2FEEL 1XGTA 2FR4A 3ZO0A 1J10A 1JGLL 1XAUA 4LSPL 2UWEE 1CDYA 3FQXB 1HN1A 4JEGB 4QRRD 1XT5A 3FO1B 2ATKB 2FX9H 2W65A 5IBUB 5EIIB 4KKAD 3WEXA 5A3ID 4JN1H 3MTRA 1KJ2B 3EOTH 4MQ7B 5HXMA 4KY1H 1P5VA 5FECA 4YBQD 1LK2A 5D9SB 5CCKL 2X89D 3RGVD 4DCQB 5E2VL 3D6GA 3U2SA 1A9BA 1MCNA 1YEEL 3GBLA 2G2RA 3L6FA 5E6ZA 2C1OB 5KVGH 4OSUH 4UTAL 5BRZA 2R39A 4KTEH 3WL9A 3IGAA 2NY4D 3C09B 4M3KB 4JG0L 3SDCA 43CAA 4MS8D 5I17B 4JQXA 4JO4H 3KYAA 4G6ML 2EYTB 1TCRB 2I9LB 1ZGLM 1AJ7H 2V7HB 3QRFM 5F1OB 3QI9D 5IHZA 4NN6B 2UUDK 5FCUH 1H3GA 3D9AH 3VCLA 2OR7A 3F7YB 4LQ1A 1IMHC 2P5WE 2JB5L 3QUYC 2E9IA 4YO0B 4P99A 2CIIB 3RWFA 5BS0B 5BZWB 3VWJC 5IW6A 5GS0H 3T65B 1NDMB 4M5ZL 4OTXH 4DKFL 2XZQH 2BVPB 5MENE 1EEYB 3KXFE 3ARGD 2ZG2A 3WYRA 4U49A 3ARFA 3LPFA 1AHWB 1N59B 5KSUA 1REIA 3EKCA 3EZ8A 3MRHB 1S5HB 3BZDA 4R2GB 5A2IH 2FZ3B 4ZTOH 4XRCA 1FNGA 5FM4A 2XACC 3RVWC 4YQXL 1U41A 4CMMB 2IANE 3HAEA 2GJ6B 4QXTB 5KS9B 1I1AD 1EAPA 1QQDA 2X4OB 4QRSB 5K9KA 1C1EL 1FNFA 2FX8L 3QUYD 2ZCLH 1CG9A 4G6JL 1AGDA 1NL0H 1EEZB 1EFQA 3WS6C 5L2KB 1WBYB 3UJIL 5EO1A 3QPQC 2DQJL 3CDFA 2Y25A 2NY5H 2R2EB 2QSTA 4M7KL 1NSNL 1J1XH 1CFTA 1QLFB 4JN2A 5C0ND 4TULH 4I0KA 5IKCA 1IC5L 1TENA 5DSCB 9CGTA 3TESA 1F3JA 1NGWB 5BRZE 4CBPA 2NNAA 5ESQA 5D1XC 1KIPB 4LDEB 3H0TB 2W0FA 3OSKA 3RVWD 1A47A 5CGMA 3ETBF 3H42L 3OX8A 1MLCA 1P4LB 5IVXF 5GRJL 4HG4J 3L3JA 3RWJB 1DQJB 3KPRD 2YXMA 3TT1H 1H8SA 2O5XL 2B7DT 5CFHA 4LAQH 4CNIA 2DI7A 2EO9A 3LN9A 3O6KL 1R3JB 5IW1B 1RZKL 1WBZA 3RL2A 4GRWH 2JB6B 2LVEA 2PTVA 3DUUA 4KHXH 4MDIB 2Y6SC 1P7QA 2Y5TA 1FCGA 3UZQA 1QYGH 2ADFH 1QPPA 3K74B 1F4XL 1XGPA 2J8UA 1JPGA 5LAXA 4A6YH 2VLJA 1GGTA 3IDYC 4NOFA 4G3YL 5D7LB 2BOBB 2GHWB 2FB4H 4OFVA 4NQDD 5JXAL 1M71A 3NIGF 1MAML 3UYOD 1BM3L 2BNQA 2Z35B 4JRWA 3QISA 4I0PA 4ODUB 5MERB 3W2DL 4WO4C 4P2OD 4F7MA 4MQSB 2X2YA 1JGEA 1T5WB 1MAKA 2HFTA 1TZIA 2Q86A 2AV1A 4WNQB 2CKBL 4EUPG 4GW4A 2BOCB 3UXFA 4WEMB 4Y5VA 4C56A 3UYPA 4NO5A 2XWJA 1JGVH 1MCPH 5DHYA 2DRUA 1VKXB 2J8OA 4X8XA 4H1LA 3CU7A 3HFML 3LB6D 2OQJA 5B21A 1BX2A 3F12A 4GBXD 1HQRA 3DRQB 5IJKC 1NJ9B 2NY3B 4XHJC 5E8NA 4DK6A 2VUYA 4MCYA 5E9DD 5EFIB 3BIKB 1DL7H 3R06B 4HFWB 5GJTL 3P4LA 4S1RH 4PS4H 4PJAA 1MRDL 2A83B 1G6RA 3HMWL 5BZDA 4CDGC 4GQ9L 4NQEE 5F8QC 3LKRA 1IEAB 2IG2L 5C09D 1P5UA 3EOYG 2DQIL 1CLOH 4K07A 1NPUA 2CUHA 4P2RE 4P23A 2K7QA 3OPZL 4HWUA 4AYFA 4FFYH 4PJGE 2J8UE 5CP7B 3EO9L 4MHHI 4IOIA 5DRWA 4KKCD 3QIWB 4WV1B 3BKJL 4GW5A 2BXZA 3WJLA 2AVGA 3CFKB 1X5JA 2MHAB 3RWCA 3FT4B 1NCUA 3VFMA 4X4XB 2E3VA 1JNNH 3TZVA 1QEWB 2QKIA 5DMIH 5C9KA 3HZVB 1LP9F 5F89B 4JDZA 3G5VA 2X7LA 4YDLC 5DD6A 5DXWA 2V9RA 4XP5L 4KV5E 2EDEA 3I6GB 2IH1A 3W9DB 1DSFH 3O4OC 1BBJA 4XMKL 5CWSA 4EN3C 4K3EH 4MSWB 4AZ8A 2VMFA 3UC0H 1RFDH 4GAGL 4FQQA 2FIKA 4UT9H 4FQXB 5I8OL 5JW4N 2ARJA 2GITA 2L0DA 5TF1L 3VD7A 1H15A 4PJIF 3B9EA 1S9XA 1NGYA 1FIEA 1FGNL 1KNOB 1TXKA 5IVZB 5T5FH 5BQ7A 4WHYG 4R9HA 3IDNB 4PRIA 4UZGA 1XCQB 1FGVL 5GXBB 4MJIB 3I75A 1VFAB 1UQSA 5LVEA 2JCCB 1O7VA 2OZ4A 4F57L 1PD6A 4LVOB 4D0DA 1MCOH 3L3DB 2WWMC 1AP2A 4X9FA 2DB8A 3O41A 3RZCB 3VXMB 1F58H 1BZQK 4P3CH 4EN3D 1DE4B 4RMVA 3PWLB 4FFZH 1MEXH 1DZBA 4OCWL 2R69L 1YMHA 4NKDB 2F19H 2WP3O 3OHXB 3QUZC 3SCMA 1YEJH 3S35L 6FABL 1FSKB 1VFBA 1PFCA 2O5YL 3RKDC 1CN4A 4EKXA 1UZ6E 1QVOA 1L7TL 3MRQA 3E8UL 4WU7B 4ELMA 2H9GA 1RIUL 5ESAB 4Q9BA 2HT2C 5FYJL 4LFHD 5HHXH 1TZGL 3O8XD 4JQVA 4KXZH 4MA7H 4ZFZB 2D9QB 1J18A 4XMPL 1A1OB 4HZAA 2AQ3A 5DHVH 3T2NL 3U46A 2FGWH 4OV5B 5HHNA 3IDGA 3BH8A 1OGAD 2CR6A 5CUSL 1GGCH 3TA3B 4M61A 5KW9H 2J88H 5IMLA 3HMXL 1XCTA 4JFQA 3TV3L 1ACYL 4CJ1A 5HI4D 4JFXA 3ZT5A 4UMGA 4P57A 2D0HA 3MROA 3GK8L 5D2NA 4GXVH 1QFUL 3RKDD 1Q8MA 2P42B 3BKYH 5JPNB 5CJXC 1V7MH 1OF2B 1SBBA 4L8BA 2OR9L 5FYLH 1R5VA 3X3GH 4HJ0C 2J12B 2H6PA 3UYRH 3HPLB 3OJDA 4Q2ZA 2PW2B 4XC1L 4M5YH 3TPUB 2OP4H 1AI1L 3MRGA 3K2MC 4Q6IB 1X5HA 5E5MB 3MV8B 3RNKB 1CTNA 4JHWL 1NBZA 3H7BB 5CGYC 5GGSA 4WTZA 1CU4L 1YEDB 4RBPH 5MEOB 5I15L 4P49A 3ULVC 3T3ME 2UUDH 5E8PB 5E4EC 4ZSOB 5BO1H 4YHYC 1IL1A 3KWWB 5ESVB 4LASH 4X7TA 2FDBP 3OAZK 4PLJD 4HV8A 1ZS8B 4P0DA 4IHOA 1UCBH 3S36H 5CJ8A 1IFHL 4OFIA 1FBIL 3BIAX 2VABB 3ZTNL 3MODL 3OKOA 3C6LA 4X6CF 5F3BA 4HJ0D 4AENA 1U3ZA 5JDJA 3NZ8A 3QIUC 5AYUH 4G9DB 3W11D 2P5WD 5DK0B 3HAEG 5JW3L 4LBEA 3K7UA 1EDQA 1CGSL 3CFDA 3GBNL 4RGND 4FTVB 4FN0A 2VB5A 3CSYB 3GMPA 2YPKA 1HKLL 5KS9F 2FEEI 2W9DH 2DD8L 2X4PB 2ZSWA 1YY8B 4LU5H 2A77L 1RU9H 1NFIB 4NPYA 4MJ6A 4KHTL 3JUZA 4KK5C 4XX1E 1KCRH 3R0MA 2WIMA 5DURD 4OF3A 2EICA 4PG9A 4BUGA 3DV6A 1HHJB 5D2NE 3T77A 5EN2B 4YWGL 3UO1H 3OKKA 4OCRH 2CD0A 1P9MA 1CXHA 4XBEL 3RY6A 3IU3B 2X4NA 3Q6FA 3TJEH 2BCKB 1HQ4A 5LWYH 3O9WC 3PWUB 1CFQB 1RURL 4HJJH 3RUGB 5IFJB 3VGHA 3ZKQD 1WC7A 4LSUH 4QOKA 4Y16B 3WFBH 3QUKA 1T7YA 4X6DA 4K9EH 2XI9A 4O58H 5D2LB 4QKXB 3WDJA 5H8DA 4U1HA 4EUPH 2H32H 3N1PC 1N7ML 5DMJB 4X4YB 1U8QA 3RHWK 4KK5D 1KIRB 3QHZH 3TWCL 3ULUC 3GSUA 1ZT7A 4BZ1L 1A6AB 1JZ2A 2HJLA 2GJZA 5IQ7H 4OZHA 1P1ZB 1QFOA 3H9HA 1JYNA 3GMOB 4M7JH 1TITA 4RX4D 3QWRA 1JNJA 4XBPB 3BPOB 1HCVA 5FKAB 4N68A 1A6UL 5D7JA 5GSRA 3LMJL 3CSPA 3BQUD 2Z0BA 1ZA3B 3GDBA 4G9FD 4MZ2A 3SPVB 4QHKI 4U1JB 1ORSB 3V4VH 2AXGB 1VDGA 3V0VA 1D5MA 1FG2B 5CIPA 3O2WL 3H6JA 2HVJB 5ENWA 4N0YH 2F74A 4XPGH 3BEVA 5F3HB 2I27N 1O7SA 4KC3B 3SJVA 4U4BA 4JZJA 3AB0C 3TNNB 5T1LA 4FQ1L 5I74B 3IRPX 4G8GA 5AD0A 3S3JA 3ARXA 1IT9L 4JFEE 4X6EB 3LS4L 3GMMB 4H1LG 3MRRB 3H8NA 4WDIA 3BKCL 3AM8A 3QFDA 4YEFA 1BPVA 3HC3H 1D6VH 5ITBH 3JTSB 5I1LB 4YBLB 1A7QH 4JKPH 2FRGP 3NPZB 1A1NA 3LQZA 4CKVX 1RVFL 4OD3H 3TCXA 1MHPL 4R26H 2BRQA 4QOKE 1E6OL 1BVKA 3GI9L 3UPRB 3QQ3A 3VXRD 1D5XA 4M02A 4PJ7A 4QYOA 2EDTA 1IRAY 4K3HA 3AMLA 1A5FH 3REVA 3QEGL 5GIRA 1XEDA 4QHUA 4UINL 1CDIA 2NW2B 1JIBA 1GCFA 5EB9A 2ITCA 4RCAA 3CFCL 3O11B 3P9WB 1CWVA 3HLAA 5CHNB 3WBDA 1YY9D 1CCZA 1OSZA 4OZHE 4P2QB 4M6OL 3QDJD 2R1YB 1MFNA 2BMKA 1JF6A 3WHXA 1VADB 2XA3A 1J5OH 4NOBA 4NQED 1IAKA 1MFCL 3BOVA 3I02A 1X6NA 1XF5A 4RWYL 3EFFB 4JDVA 4WHYH 3FFCE 5F44A 3HNSH 3ZE0F 3CFBB 1FZJA 1RMFL 4WWKA 1RK0B 1FV1B 1LD9A 4QTHA 4BH7A 3SJVE 1I7UB 3T0DA 4QRUA 4X6FB 2B1HH 4O2CB 4CN1A 3CIQA 1MJ8L 3TH2T 3RTQB 4G8GE 2X4TB 4J3WA 4BQ6A 5HHMD 4I2XA 4K71C 2W07A 3OBAA 5DHXB 4KPHL 4U1KA 3ECBA 3B43A 5DJYB 3LRHA 1OAKH 4U6YB 2SEBB 4BZ2H 4LARL 4ZXBB 3LVEA 1N4XH 4GXUN 1CDGA 3UTZA 3ZKND 2HWZH 1FVEB 2YD7A 1UC6A 4G6FD 2ADGA 4RGOH 1SJHA 3A6BL 2DQDL 1YYLL 5INDB 4GAYA 5K93A 4HKZB 2H2PD 4HIEB 5M95B 2VXQH 5J6HA 2AEIT 4NCDA 1EA9C 4PJEB 5JW4Q 5E56A 5DI8B 4X8JA 5GPRA 5C92A 4K7PX 4I1NB 3E6HB 2XTJC 4NC0B 4GQPH 1XGRB 4QF1B 5FYKL 4JM2D 1M7IA 2JCCF 2P5EA 3MGOB 4DAGH 3IDJA 1JMZA 1A7RH 5EOCL 4F37K 3TN0C 4G5ZL 4YAQB 5DEGB 4YDJB 3C2AH 5HHOB 3AREC 5C0JB 3WN5B 4NKOB 1J0JA 1U8PB 1JHKH 4IJ3B 3I6KA 5DQ9A 3DBXB 4D9RE 1HWGB 3PHSA 2VXSH 5KVFH 3LHPH 4AIZA 3IJYB 2QADB 4XNZC 1AE6L 3Q1SH 3G6JA 3K4DA 3F6IA 4P3DA 3UJJL 5HYJE 2ADJB 3QDMA 4O51B 1G9NC 5DUPL 2DQEH 2BNRA 3C5ZA 2R1XB 3WIFA 4TPRL 1MH5A 5SWQB 3PL6B 1FDLL 1D6EA 3HC4H 4XVTH 2A74A 4Y5XA 4P2CG 4JRYE 4NM4L 5T1KB 3V4UL 3D48R 5DRNB 1C5CH 3BVNB 5CD3A 32C2B 2UZIL 1PY9A 1IM9A 3ARED 2EDNA 4Y89A 3GJFK 5HHPA 2ILLA 3V5DA 1JWUB 3FRPA 3GRWL 2A6DB 4YHPA 3IFOA 5FDYA 3TVMC 3HE7B 5D1ZC 4POYA 4OZFA 4XCFL 3W0WD 1UWGL 3LKPB 1MI5D 3CJJA 5EU6E 2AK4A 3KPSB 4HMDA 3DSFL 3ULVL 4RA3A 1A7NL 5F7EH 3KLSA 5EORL 4Y4FB 3IVKB 1T4KA 2VYRE 4JFDA 1CICD 3FN9A 3QAZC 5D72H 1V3JA 3SDAA 3NA9L 3EYUH 5CEZE 4D8PB 1K6QL 1LNUB 4O5LH 5GGTA 5KOMC 4JZNB 5J0BA 1UEYA 1QFWM 5KVEL 1Z0MA 3KPTA 4IRZH 1C8PA 2D4DA 2HJKB 4OIAA 1YNTA 4IIQA 3MV9E 1MWAA 3DUSB 1WT5A 5I30H 3GMRA 1HILB 2W60A 1UT9A 1ODAA 2J5LB 2J6EH 2G60H 3BXNB 3SY0A 3MRKA 1DR9A 1MFBL 5T5NG 4I8DA 3NAAL 2WUCH 3IDIB 2BVEA 1F4HA 3AXLA 4P4KB 3L3OB 4XXDA 5IVXE 5H2BB 4U6HB 4MA1C 4MXQD 1OQXA 3OAZH 4MVBD 3WLBA 2FECL 1N3NA 5GS1B 1MPAL 4FMKA 1KEGH 3WUWA 3ZL4L 5B38A 2XKNA 3QDME 5K9OA 1DQDH 3OF6D 2BNRE 4WFGE 1OWRM 2ZOKA 3AROA 4M4RA 1R5IA 4JVUA 1N8ZB 1U92A 4RNRA 3TFKC 5FDWB 3S96B 2VIRB 1P6AB 1T20A 2XNAB 1DQQA 3V0WH 1IE5A 1BIIA 1FLRH 4HGMA 3GJEA 4G42B 4I9WE 2V2TA 5I6XC 4LLUA 3VFOA 1NDGB 1XH3A 5IMOA 2JIXA 2X05A 4L4JA 5KN5A 3S98A 3FONB 1H3XA 3C60D 4NNXB 2EXYC 2ZUVA 2BVQB 1NGZA 3KPLA 5GRVK 1QRNB 3MGTB 3KYKH 2AJ3A 4C58B 1RIVL 4O9HL 3BIBX 1DLHB 1DN0A 4Q0XL 4ZAKB 5FAAA 5GZNC 1LP9A 3O45A 4FZ8H 3ULUL 4JFDE 1OW0C 5E00A 1P7KB 2E27L 5AAMA 2IQ9H 2ICWI 2W59A 35C8H 3V6OE 4Y2DB 2R4RL 3RUGF 3NCYS 4OCYH 4F33B 3RIAK 3AAZB 3ARBB 2EYSA 4UV4H 1RZGA 1BZ7B 5D2LF 2EXWD 1J1PL 3PWJA 3UTPE 3VXSB 1HSBB 4I4WA 1F42A 4JAMB 1ZA6B 2JJSC 1FZMB 1IAOB 5EPMA 4QXGH 3CCHA 2RBLA 3KYMB 3DURA 3OKMB 4L4VE 4C57C 4CW1A 3PWPD 4H1LH 4HGKC 4PJFB 3VRLF 4XNXH 1F8TL 5JQ6H 1QBMH 4NQCB 4PJIA 3WIHA 3I6LD 4V1DE 4S0SD 3O3DA 1D9KB 3UX9B 1UWXK 4OD1H 3DHJA 3WMSA 2D31B 4PRPB 4EBQH 5DR5L 4PG2C 4RDQG 5MEPB 4X98A 4GRLA 4XPFL 4PY7B 1I9RH 3MXVH 3RU8H 4AEHL 5C0IA 4R3SB 4HH8A 5DMGC 2XPGA 5GS0C 1R3LB 3BUYB 3QQ4A 4M7LH 4YFDB 4NHUA 5CBAB 2LVCA 3VFWA 2HH0H 1BAFH 5AG8A 5KSAB 5J11C 1NC4B 4HKJA 4KGJA 1OAYL 3NN8B 5J12B 2WUBH 2PYEA 3DYMA 5C8JA 1T89A 1KJVB 3QDGA 3IU4H 4LMQI 5D1QA 1K9TA 1WFNA 1IQWL 3QEQE 1XR9B 2XV6B 3ZKMC 5JW4R 4M03A 2HFEA 1INQA 3EDFA 4OFKA 2AEPH 3JVGA 3D39E 4FQJH 4RIRA 1MRFL 3U4BL 1LO5B 4HUWA 4OBRA 4NKIH 4GUPA 3QPXH 4NNYB 4NJAH 4WHDA 4Y7MA 1UH4A 5LBSH 4YX2H 2DQTL 5GS0D 4HWZB 3NFNB 4Z7WE 3LRGA 3MCKB 3OR6A 1G0YR 1WIPA 2K1MA 3HG1D 1T6VN 5E2JA 2Y07L 2NY5C 1T1XA 1YECL 2P8PB 4C83A 1RJCA 1NGPH 3D85D 3V9FA 4QXUL 2VLRD 5INCB 4ISVB 4WY7L 3LKNA 2FD6H 1UM4H 2CLRA 2OL3L 5C0BB 1GAFL 2OMNA 1OHQA 1YEFL 2DBLL 4XAKE 5F7LB 3SE3C 1VFOA 4R7DB 1ROWA 4TVPE 4XGZA 5LGJA 4R90H 2VDPH 1W72H 4YUEL 3PIQA 3PV6B 2OMBA 3KPPB 3TYFA 2LTQB 2VAAA 3LRSB 2RR3A 5E6IA 5EO0A 5DD0H 4HUXB 5C08A 4R8WL 4GRMB 3QXTA 3V6ZB 3TEUA 3VWKD 1IEBA 3MYZA 1BBDL 2F5AL 3RGHA 1JK8B 4FQLH 3TIEA 1KCVH 4OLWH 1QSEB 1YMMB 2X10A 1MQKH 5ETUA 4P9HH 2CUMA 2CIIA 3KPOA 1KJMB 5BZWA 3MUHL 5ACLA 3PABA 3EDKA 2VXTL 3B9KB 4PJ8A 2DQGH 3IKCB 4U3CA 3DX7B 1L9NA 5C0CB 3U0WH 2V6HA 3D2UA 3SO3C 3T1FB 3GSNL 4X6CA 1KG0A 4DJMA 4EI5A 2IPKB 5BVJA 1NEZA 2Y36H 3BZ4A 1N59A 1IGFH 3C6SB 3JV4A 2V17L 15C8H 4W4OC 3MLUH 1WCQA 2R23B 2NY6B 1JN6A 4CMMA 2CDFB 4LEXL 3VRJB 1ZHNA 4AH2B 2AV7B 4M1CD 1Z5LB 4YE4L 3WE6A 4HBCL 1FYTA 2X4OA 1I9JL 1MIMH 4UQ2B 2Q3AA 4PBWD 1LDSA 4IRJC 3I9GL 2QQLL 4X7SL 5IGXL 1F4WH 3DARA 4NNPH 2YD8A 3O6FD 4FABL 2WBJC 5B39B 3GI8L 4J7RA 2JJVA 5FHBH 1B88A 5EUKA 5HVGB 1G9NL 4QTIL 5HGDA 1MJ7H 5IB3A 2PO6A 5MEQB 5HY9A 4R0LB 1G7HB 3WNPA 5C2BH 4KDVA 5IMKA 3G5XA 4L4TD 1UJ3B 2P4AB 5HGHB 3U30C 2IAMB 2LQRA 2XWBA 2YWYA 3BW9A 3TYGH 1V7NH 4AEIH 3NFSH 2CMRH 1U8KA 4Y4HB 1FG9C 4GSDH 1YEGH 2VDQH 2WV3A 3GMLA 2ZOLB 4NQXA 3B9DA 1U3HB 1II4E 5IHUH 1QRKA 3WLWD 1QFWH 2JB6A 5BS0E 3V6FA 3W9EA 3GUTB 1ED3A 1SMAA 1H0DB 2Z92B 4UU9A 5JUEL 1U8MB 3EOBA 1N5YH 2GSGA 1ZHKA 4B7IA 4OF5A 4D9RD 4JPIB 3FRPG 1HE7A 4PUBH 1J8HB 2EE2A 3DI3B 5GGVL 3RJDA 2EECA 5AUMB 1UZ8B 3MYJB 5DD5H 4P46A 2YKLL 1U6AH 4LVHB 3QIBA 4KVCH 4OZFG 5ICXA 5HYJD 5SWSA 3SE8L 5GISH 4JY4A 4KROB 1KUMA 3FTGB 2DQUH 4HXBH 1CLZL 4P9MH 5C07B 1ZLWH 1G7JA 5DZNA 3BESR 5IQ9B 2ZCKL 3LDBC 1IC7H 5DK2B 1H5BB 5MERA 3ARDB 2F8OA 2GJ6E 5KS9E 4OCSH 1I9IH 1HIMH 3EYOA 4G8FA 4ORGB 5FV1L 1MCKA 3QUXD 4DVBA 4RAUB 2QQNL 5ACZA 4NBXB 3IF1A 3MLZL 5L2KE 4Q9RH 4NCC1 4V2CB 1PSKL 3ZE1F 4HLJA 3MNZA 1U93B 4UOW0 2DYPB 3KR3H 5EU6D 2HT4D 3AY4C 1MCDA 1U95B 4X7EC 2C1PB 2EO1A 3G6DH 2GEEA 2NY2D 4JANB 4N90E 2DIJA 4TTDC 3WUWG 2DLHA 4PV8B 2PN5A 2X70B 5B38G 2AP2A 3R06A 3SDXA 4P5MB 4L8SA 3O3UN 3WO4C 5CMAB 4EZMA 4MLSA 2ITDA 1CVSC 3DUHA 2FX9L 4QRPA 4XI5C 1KT2A 4PGDB 3MLXH 1K4DA 4Z7VA 4JN1L 1WICA 3DIFA 3EOTL 4G6AD 1T04A 2DAVA 4KY1L 4R7NB 4PJXA 4XT1C 5I76B 5D7KD 2DM2A 2CKBB 4OD2B 5D7LE 3QIWA 3FO2A 4MAYC 1LVEA 2NY1B 2UZXB 1PX4A 5KVGL 4OSUL 4WFGD 2Z93A 1SVCP 4KTEL 4FXKB 4N5EC 3Q5OA 2L7JA 3REWB 1FL6B 3BZFB 2R9HD 3UJTH 5TDNB 4JO4L 3EYVB 3MRLA 3BO8B 1LEGA 4OM0L 3T2QA 5F89A 4JPKH 4B50A 3AS2A 3PHOB 1WITA 1AJ7L 4H20H 2WP3T 4Z18A 3B5TA 3HR5A 4XCNB 4GKZB 2YD3A 1XGQB 3ISWA 5FCUL 2KQNA 3D9AL 4TQEH 1R5WA 1NAMH 4LRIC 1G7LB 4ZOAA 1B90A 4RFEB 3VFSB 1RJYB 3HB3D 4J1UB 1QUNA 5GS0L 2YN3A 4NZRH 4M7ZC 4OTXL 4KKBC 2XZQL 2DBJA 3PQYD 4PJ5A 4PJFF 3NPSC 3GSRB 4IMLA 4K7PH 2YBRA 1BQHG 3RWDA 4WCYH 1NAKH 2DJUA 4PD4K 4KZEH 2A2QT 3Q3GA 4ZTOL 3LIZH 5F21B 2ICWA 2OI9B 3EJJX 4QRPE 1W8OA 3G08B 2NXZB 3BP7B 4Y8DC 4PY8J 2FECI 1H3UA 4YFLF 2ZCLL 1C5DB 2ESVA 3W5NA 1NL0L 4UQ3B 2OYPA 1NUFA 4NKDA 1AKJA 2NY5L 2C7UA 1J1XL 1FFOB 4U2YA 3HE6B 3MQIA 4TULL 5F7MC 3UTSD 5KJRH 1AY1H 2H26A 4CUCA 5EU4A 1ADQA 4RMUA 3ZE0E 2AEQH 2NZ9D 1IILE 3VFVA 4QRRB 1LE5B 3CZFB 4XNMB 2A6IA 4BYHA 1S3KH 1GOGA 4TUJA 3TT1L 3DYOA 4FOMA 5EZLB 2XN9B 3DMMD 3T2PA 4LAQL 4LOUC 1K2DA 2VLME 5BCAA 2XRAH 4I3SH 3BHBA 3RGVB 5I9QB 1A1OA 1C16B 3BN3B 5HVHB 1FYHB 4KHXL 5I1CH 3T0EC 4JKKA 4H0HB 2QHLA 5I0ZA 5GSVA 1M05B 1U58B 1QYGL 2ADFL 4A6YL 1GL4B 3E1F1 3NZHL 2VC2H 2NY4B 4LSTH 3Q5YA 3BWAA 1MCWM 4K9EC 2PYFA 3WNKA 1VSCA 3O3AA 2D3VA 1OAQH 2FB4L 4QHKJ 1NANI 2QEJA 2ATPA 1TZHB 4RAHA 2RFXA 5DJAB 2CUIA 4MJIE 2ZUWA 4ZD3H 3QI9B 4JZOB 4UOW1 3QFJD 5CEZH 2JCCE 5I18H 3MUJA 1BVZA 1KSRA 3TF7C 3VXME 2ESVE 3SKJH 4UV7H 2X4SB 4HCRH 3F58H 3KYNB 2HLFD 4JO2H 4YDVA 5IIEB 4ZSOA 4LLWB 3HUJB 1IGJB 3OZ9H 4B5EA 4GS7C 1RHHA 1W2KT 5SX4H 1K8IB 4MJ5A 3Q5TA 1JGVL 1MCPL 5DC4B 4YPJA 1RULH 1NEZG 3GEWB 4DQOH 2EIZB 2OR8A 4Y1AA 1ONQA 2E9WA 1KB9J 2YD6A 2P7TB 3B6SA 2WQ8A 3EYQC 1AIFA 3OAUH 4FXGA 1OAUH 1ZVYA 2O26U 2GKIA 4P5TD 5GGRY 3WNOA 1RAMA 5MI0B 5I75C 1DL7L 1I1AB 2E9BA 1T1YB 4DN4H 1OPGH 4S1RL 4N5UA 1XGYH 2LU3A 4PS4L 3TO4C 5AG9A 3DI2B 4XCYB 3QUYB 4GLRI 3THMH 4AG4H 3VWJB 4Z9KB 4OLXH 2AERT 4H8WH 1ZSDA 4R4FH 3ZKSD 1YY8A 5JQHC 1CLOL 2ZUQB 3CFEB 4R96A 1RJLB 5FKPB 1J11A 1T1ZB 2EDDA 4HDIA 4WUUA 4FFYL 3TP4A 4J23A 5BOZG 3TJHD 3TBTB 5EZOH 2X1PA 3BRFA 5IJKA 2MKLC 4OZFH 3EHBD 2I5YH 1I7TA 1RSFA 3ZDXF 4DEPB 5BV7H 4M8QB 4J2XA 2QHRH 3X12A 3LH2H 1QNZH 4X5WB 1P53A 3KPRB 3PWUA 4S1DD 3Q6GH 5KVMC 2MTPA 3HCVA 3KYOA 5EZJB 5JDSB 4MNQA 1XFPA 3BDYH 3G6AB 3X17A 4E0RA 1JNNL 4GG6F 5DMIL 3GSWB 3MV8E 3SKNB 5IB4A 3JTTB 1MWAH 4KK6C 5DTFA 5MHSE 2BVOB 4ZSOE 4EVNA 1OTSD 1E28B 4TVSa 4XVJH 3A6CH 3ILPA 1DSFL 1VA9A 4K3EL 3P9MB 4OKVA 3UC0L 1RFDL 3GMOA 4Y1AE 4NQDB 1IBGH 4UT9L 1SVZA 1JJUA 1CQYA 1IAIH 2VE6A 5E7BA 4NKMA 4P2OB 3D0VB 1X5KA 1Q0YH 1I1YB 2JJTA 1N26A 1HDMB 5BS0D 5T5FL 1AO7D 1OAZH 1ORSA 4S2SA 1JFQL 4FTVE 2AKRA 2EEBA 5C70A 4KK6D 4MNHA 4JFZH 3ZKXB 4Z0BH 1A6ZB 5F7DA 1Q94A 3L7FA 1UB6A 4KK9C 1ZHBA 1ZTXH 1MCOL 1R3KA 3DX8B 1HHHB 1FO0B 3S34H 4ZS7H 1EO7A 1P84K 1F58L 2HAZA 5I1JH 1FZKB 3MA7A 4P3CL 4R2GD 3FFDB 4FFZL 4GBXB 3NH7H 2DLIA 2F19L 4JGJA 5E1HB 4U1IB 3SGDI 4NM8H 1YEJL 3U0TB 1S9WA 4WO4B 5IFHH 2QSCH 3MREB 5IB5A 3RUGE 4OM1H 1WIUA 5JMOC 3MOAH 4MNQE 4YHLH 4FQ2H 3SO5A 5D2LE 4Z76A 1W0VB 5C09B 4QY8A 3NCBB 4CGTA 1S9YA 4KK9D 4OBSA 1SJEB 3DVIA 5HHXL 1B6UA 4HHAA 1S9VA 4MA7L 2EE9A 5GHWH 3VRLE 3S8WA 5IWLA 1B0RB 1S78D 3QO1B 5C71A 1BD2A 1X5ZA 4JQXC 2GQHA 1NFDF 2FGWL 2N4IA 3SDDC 4TVPH 2Q76B 3MJ7B 1GGCL 3WIHH 2DMCA 4JFHE 5KW9L 2J88L 4RAVB 2F53A 3UAJC 3KGRA 2VDOH 1T3FB 5F96H 5H35A 1V3KA 4GXVL 4PJBF 5F1NB 3BKYL 3A67H 1EERB 1V7ML 3IAQA 4YGAB 3PJSA 3MRIB 2BHUA 5FYLL 4PLNC 3X3GL 1RK0A 4ZQKA 3UYRL 3WS3A 4QCIA 4M5YL 4N8CH 2OP4L 2VRAA 5GGRB 4Z78A 3SDCD 1UKQA 4Z0XB 3ORJA 3DXAA 4LCUA 4S11A 3V7AE 2DKMA 3WDIA 3DV4A 3TBSA 1U8IB 1WISA 5BO1L 2MWCA 4IDJH 1Q9LA 4LASL 1H3VA 1KTDA 3UAJD 3U0PA 4LL9A 3QCUH 2NR6C 1UCBL 3S36L 1KPVA 1KLFA 3AUVA 4NDMB 4ODXA 5CJXA 4YPGB 3QZWB 3CXDH 5JHDA 4XZUA 3QEUB 1DBAH 4YDLB 5EU3A 4L1HA 5AYUL 4YGVB 2FWOB 3HZKB 3ARFD 1BFVH 3RVVC 3AS3A 3D69B 5C0EB 4U31A 4RQQB 4EN3B 2W9DL 1X3DA 1CL7H 2IQAB 2OBGA 2F58H 5DEGA 1FVCB 2I25N 4LU5L 1RU9L 3KLDA 2V5MA 4P2QE 3BRGC 2DLGA 2VLKA 4WEBH 1KCRL 1OT2A 1X5YA 3BDXA 3QB7C 4G43B 2APBA 1YDPB 4EI6B 3DBXA 1PYWB 3U9UA 2ICWJ 4QHMB 5CZKA 2VR4A 3UO1L 5HGAB 5LKNA 4OCRL 2Z8SA 3IJYA 3QQNA 1JPST 4KK8D 4KJYA 3FB5B 2FSEA 3TJEL 3DVGB 3WV0A 5LWYL 1IC5H 3MNWB 3IFNH 2NY7H 3TPKA 2BHYA 4GG8B 4HJJL 3UROR 1EZVY 1NMCC 1UKSA 4LSUL 3RVVD 3WFBL 3O8XB 4K9EL 4O58L 5CSZB 2M2DA 5FOBB 5T1KA 1DEEA 5DJDA 1OGAB 8FABB 3QO0A 4IRSC 3QUZB 1GGIH 3CU1A 4I0PC 3SHSA 3QHZL 1X9QA 4PGJA 3AU1A 3MOQA 4UIKH 5IQ7L 3ZT6A 3MBED 4KDTA 4S0TD 2DIAA 4M7JL 4JRXA 3O9WA 2ZG1A 1F00I 1P7QD 1MHCB 3K8KA 1I8MB 4ZUTB 4PJEE 2BY3A 2VLJD 3CVHB 3FRUA 2DS4A 3MRNA 2WK2A 4DVRH 1HH6A 4XNYH 1MCEA 3D25A 3V4VL 3P4NB 4KVNH 4HS3B 3VH8B 4TUOA 1HYSC 2F54A 5I66B 1AQKH 4LGPB 4GXUM 4N0YL 4U7SA 1EJOH 3HS0B 3T0WA 4LRNH 4XPGL 1TETH 2BNQD 1HHGA 5HGBB 4U1MB 5HHOE 5IB1B 4MNGA 1MCLA 2IPUG 3HUJF 4GW1B 3KNBA 1NBVH 5BJTB 1ZKAA 4P4KA 4M43H 3HC3L 3HC0B 1D6VL 4HK3N 5ITBL 4X9BA 4NFCA 1OP3K 3WD5H 1A7QL 3B4NA 4JKPL 4C56D 1KV3A 2HLAA 4WI2A 1VGKB 1A2YB 4P23C 1YC7A 3L95B 1A9EA 3GSVB 1AGCA 1F2XK 4IS6A 4OD3L 5F72S 4RGNB 1CE1H 1FE8H 4R26L 1CFNA 4JFOB 4OZIA 4RGMB 3DWTA 1HNFA 5FDWA 5T3ZD 4NQVA 2CGRH 3JWDH 3WJLC 2B2XH 4RRPA 2J7LA 2NMSA 3D0LA 3H9YA 3O81A 1A5FL 1GC1H 2MKWA 5F93C 3C5SA 3U36A 2F8VA 4HKXA 3C5JA 3TZVC 1WAAF 2P49B 4N0UB 5FO7A