3THMH

Crystal structure of fas receptor extracellular domain in complex with fab ep6b_b01
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
233
structure length
228
Chain Sequence
QLQLQESGPGLVKPSETLSLTCTVSGASISANSYYGVWVRQSPGKGLEWVGSIAYRGNSNSGSTYYNPSLKSRATVSVDSSKNQVSLRLTSVTAADTALYYCARRQLLDDGTGYQWAAFDVWGQGTMVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab EP6b_B01, light chain
total genus 43
structure length 228
sequence length 233
ec nomenclature
pdb deposition date 2011-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3thmH01
2L7JA 1QVOA 2X05A 4YWGH 4U1SB 4TRPH 2Z4QB 3SE4A 4XCNB 3VRLF 1AD0A 1YQ2A 4U3CA 1OY3B 2ZJSL 5ACMA 3PWPB 4DKEL 4RMTA 3HI5L 2NY6D 1XIWC 5BXFB 4PY8J 1YYLH 3OQ3B 5BVPH 1URLA 2GUOA 1OTUD 1S7RA 2PF6A 4O02L 4Z95H 4WNQA 4WCYL 1R3LA 4EUPA 4X8JB 4F3FA 4NRZA 1V7NH 4JQIL 3MLZL 4W4NA 3VFGH 2P5EA 4JG0H 2QKIB 4GRWB 3ILQC 5A3IC 1GXEA 1TNMA 3CDGB 5J1AB 2L7UA 3UTSD 2NY6B 1RMFL 2CIKA 2PXYC 2IANB 3S96A 5J6GA 3VXUD 1F4XH 4Y2DD 1DE4A 4PJ9D 4M02A 1KPVB 2XICA 3K8LA 3TPUB 4TYUA 3UDWA 3OXRB 4LKXB 4D9RD 2F8OA 4JKPL 3MNVB 1J0ZA 1YYML 4LLVB 4FFZL 4HK0B 2LQRA 2XNAA 4XPGH 1RIVL 5SWQA 5I1HH 4HWBL 1J8HD 1MHHB 4PJDA 4GAGL 1BECA 5CZKA 1XR8B 4NCDA 4L9LA 4Z7WF 1NFDB 3C09B 1YEGH 1R5VB 4XP9H 4IRJB 2BOBB 3QEUB 5IEHA 2IC2A 4RZCB 4O58H 3QHZL 4M43H 3LDBB 3U4AA 3UROR 3O45A 4LFHG 3L3JB 4H1LH 3RUGF 1Q94B 1YEGL 4Z78A 4NQXB 3O4LA 4QRTA 3L5IA 4WUKH 1XF2B 2H2SD 4UILH 3CFKB 5FYKD 4ZUTB 2W0KA 1Q1JH 2BNRE 2ZKHH 4Q9RH 3DX6A 5KAQF 4HKJA 1DUZB 4ZPVA 2G75B 3CJJA 2IF7A 4BSVA 3MRCA 2X4UB 1ZE3C 4G42B 4X6DA 4OZHE 4BSJA 3LMJH 3WFZA 3BKMH 2CDGB 1MRFL 4ACPA 1TITA 4C57C 5IJKC 3MRQA 4ODUA 2VR9A 2DJ4A 1X4XA 4CAGA 4X6CB 5F7EL 2YC1B 5LG1A 1D5BB 1MIEL 1AXSA 1F3DJ 1LEGA 3PDDA 3X12A 4AENA 3ME0A 4PUBL 5JQ6H 3WJLA 3R4DA 3KVQA 1T66C 4ZNEE 4X5LA 3GM8A 1QO3A 3SBWC 4ENEC 2FR4A 1MFAH 5KTEH 3DMMD 4PRNA 3GSXA 3UTSB 3EJZD 5GGVH 5FYKH 4D0DB 1DBAH 4Y5XB 4Y5VA 1U8JA 3NA9L 1ZGLA 1UB6A 1IT9L 1U8MA 4P46C 3LKQB 2A6DB 4NQEE 2IGFH 3PWLA 3VXPA 2GJZA 4PS4H 3OKNA 2CSPA 1DSFH 2RBLA 1ZLUH 4QHNB 1DDHA 4M7ZB 4UUJB 3REVB 4PY7A 4LARH 2WBJC 2E5EA 5F7MC 4YO0B 2UZYB 2EIZA 1WT5C 5L9DL 3BP7A 3KPQB 2DQJH 1OLZA 2JJSA 4K23L 2E27H 1SQ2N 4NT6B 3IDUA 4URTB 1BFVL 1X4ZA 3VXTB 5I1GH 3T3PF 5DR5L 4HUWA 4O2EB 3SE3C 5F96H 3NACH 3RIAK 1D3CA 4Y1AA 2F5AH 5HHOB 3C8KB 2IFGA 2HT4D 2G9HB 2DDQH 3V5HB 3C08L 4OFYD 5IFJA 1JZ8A 1MHEB 1OQOA 3IXAB 2PW2B 2ESVB 4HWBH 1HEZA 5GSVA 5MEOA 2YA0A 1Q38A 4GAGH 1RD6A 3VDCA 2KBGA 2XQYG 4D8PB 2GJ6D 1O5DT 4CMHB 1M71B 1QSFE 4K9EC 1UC6A 3U4BH 1EEQA 5J8OA 3DRQB 1CD0A 2Z31A 5EZOL 3ZO0A 4FA8A 3FAXA 2HMID 4LEOA 2XZAH 5IF0A 1OSZB 4HWEL 1HHIB 1VB9A 1F3JB 4C56B 2IQ9L 2EXYD 5GJSH 3ARSA 3UJTH 5JQ6L 1A6TB 4HWZA 5JW4N 2BSTA 4QRSA 1PX3A 4X4ME 1MAMH 4OLYH 3SE4C 4OLVL 3OKKA 1X4YA 3TH3T 2NNAB 3LPFA 3MOAL 3MODH 4A6YH 3MGTA 4XAKE 4MCZB 3H9ZA 3MYJA 1W0WA 2ITCB 1JTOA 2CDEB 1KB5H 3O2VH 3OHXA 3CVHL 1PYWA 1RI8A 3GB7B 1YEJL 1CF8H 2AEWA 1X7QB 1ZHNB 3NZHL 2RCSL 3PWPA 3WN5A 4A2MA 5C3LD 2B2XL 3PL6A 3IU3B 5BXFA 2WV3A 2GT9B 2FD6H 4D2NA 5ISZE 4L3EE 5ELIA 3PGDB 4PJEE 2EDBA 2NTSP 1CFNB 3I6LE 4RMWA 3OGOE 2UUDK 3GBLA 3O2DL 4H20H 1FZMB 1U6AH 2NY4B 3RA7L 3BEWA 1EEZB 4I5BB 4PB0H 5T1MA 2H26A 2GITA 1UJ3B 3F6LA 5EZJA 5KOVC 4UIMA 5DJXA 1ZANL 4HX1A 1HQRB 4OLZL 4DW2L 1WC7B 4XCEB 1GGIH 1DEEB 3IFNL 3IDMB 1YNTB 2EDFA 3KPRE 2RJMA 2B0SH 1FVDB 4S10A 3BHBB 1NMAH 2YKLH 5IMMB 4OZGA 1EX0A 1MFCL 2FLBT 1INEL 1QBLL 1BZ9A 3WS3B 1P4LA 4LLVA 3LAFA 1EHLH 1MFBH 2ZSWB 2XNAB 1YECH 1I1AC 2P43B 5D8JH 2BNQD 5DJ6B 5HGHB 2A2QT 2RAMA 2HKHL 2B0SL 3LH2L 4FZ8H 4GAYA 3MV8D 3S37L 3UDWC 4RGOH 1GAFH 2ZUXA 4ODVL 1QSEB 5HGDB 1F4XL 3HLAA 5AUMA 3QEUA 1NAMA 1UKQA 2VXSL 3IGAB 3GMQB 3BQUB 4HIXL 2BJMH 2VXQH 4PFEA 5DHYB 4KJPC 2XQBH 3ARXA 4JRXA 4LSQH 2APWA 1KLFA 5F6IC 5T5FH 2R2EB 5AD0B 1OAKH 3L7FB 1GOFA 2V5TA 5F1SA 1H3GA 3K4AA 4GMSL 1F5WA 4KRPB 5ICZA 3D48R 4JGUA 3BQUC 4ZUTA 3DYPA 5KSVB 1RIVH 1P84J 4Z7UF 4DTGL 1IVLA 5HGGS 1U93B 4ZPVB 3VJ6B 3JWDH 5D5MF 4ZFOL 3EOTH 2DQUL 3OF6D 4I18A 4KWUA 3U9UB 2CDFB 3D0VA 3L1OL 2CDGA 4ISVA 2W9DH 4GBXC 3G6JA 1ZGLM 5GRUH 3O6KH 5DO2C 4PYHA 2NY1B 3ARDD 1ZEAH 4HV8A 3X12B 3BW9A 2NY0C 2D03H 2Y7QB 5INCB 2AXFB 2IQ9H 1INDH 3ARFC 1WBXA 2J88H 3PNWA 3VWKD 2RR3A 5C1MB 5FO7B 3IJSB 4I3RH 3WFHA 2D7PA 5JW4Q 1NBVL 1QO3B 3HCVA 1JHKH 4JFPB 1LNUA 4KTEL 4RIRB 3LEXB 3MV11 5EBLB 4M48L 1OAQH 3GGWB 1BWWA 3LVEA 4QOKA 2Z8VC 3VFRA 5A2JH 4JM4H 2DM3A 3GEWB 2YWYA 4J8RB 4NQSA 2A38A 4F58H 1CN4A 2VZSA 5HJ3A 3EYOA 4YHIB 1S7QA 1AIFB 2R0KH 2F53A 4QXGH 4PJBE 5J89A 5DEZA 5JUEH 3FN3A 3JVGA 1DQJA 4JB9H 4U49A 4P2OB 3CFBB 1NQBA 4WI5A 4JRYE 2ARWA 4PY7B 4U6VL 1SYVB 1X44A 4CVZB 5D1QD 1ZTXL 3ARRA 2BERA 1J1XH 2ARJA 3LSOA 3B9AA 1S7TB 3D39D 1LO2L 1RK1A 4K07A 1WCQA 4P2OC 4NNYB 3OB0K 5F44A 3HMXA 4LPXA 1KIPB 4O5LL 1XR9A 3TBWB 5I8EB 3NIGF 4HLZH 4PP1D 2ZOLB 1OP3K 1G7PA 1NCWH 3BQUD 5L0QC 4PRHE 5C0AA 4IDJL 4R90L 2QSTA 2N1KA 2E9IA 3QAZB 2CMRL 1IGJA 4TPRL 5JPMB 5HHOA 5A1AA 1LD9B 1KIRB 2X4OB 4NZTH 5IHUH 1UH4A 3PP3H 4N68A 4JG1H 4PS4L 2ZZUT 5AG9A 1BBDH 1MFCH 2PW2A 1ZS8B 1QQDA 2F15A 1J8HA 3CFCH 4BUHA 4FQXD 2JCCB 2EDDA 5SX4H 4J6RH 3BT2L 5DD5H 1JYNA 3LQAL 4RAUA 5EC1B 5CJXA 1OPGL 3UPRA 1YPZF 4YWGL 2BSRB 4HSQA 1AQKL 5I8OH 5EPMB 1Q72L 3EW3B 2J5LB 2UY7A 4PRDA 2FJFA 3QDMA 1MWAL 4KAQL 3OJVC 1JGDA 2CLVB 4F7CB 3SE8L 1UM5L 3V5DB 1FL3B 1ZEAL 4LP5A 5CILL 5LBSL 3PHOA 5ESVB 2VLLA 3KHOA 4L4VD 1ZHBA 3QUYA 3HS0B 3LKSB 3MLRH 3QFDB 1U8KA 1B0RB 3G6DL 5I8KL 2D4DA 2DOCA 5DVMA 4XH2A 1MI5E 1BQHA 5GGRA 3MGTB 5IW1A 3FB8B 4F37K 3I75A 4MMXC 4HC1A 2OXGA 3Q48A 3DXAE 3JWDL 4DZBA 4CDHA 1IKNC 3Q3GA 5DZLA 5FF6B 1BGXL 5FDWA 3KXFB 3O2DA 3VGDA 3MRMA 1ZVYA 2AXHA 1P2CA 4JFOB 5BS0D 3PHQA 4L3CB 4OCXH 3OAZH 5BOZG 2AJ3A 2ZSVA 2YXFA 2IADB 3L3GB 4I0PB 5E8NB 1HYSD 5DMKA 5E2TH 1U0QA 4MD4A 2PXYD 5KVFH 1UJTA 4Y5YA 1S3KL 1GGIL 4DQOL 4FTVB 5L7XL 4WV1A 4Y2DC 1XF5A 4LRNL 3P4MB 4PJ9C 4YC2B 3ZSSA 1RIUH 3GI8L 1P69B 3GMPB 4DK3A 2JJUA 4WV1C 5I71B 5HD8C 5K9KB 1D9KA 3IKCA 1OOAA 3MV9E 5I8CB 5HDQL 5J13C 2YPKB 4WWKD 5C6PB 5L6YL 3EOYG 1JGEA 2J8HA 4YC2C 1FVCA 4LHUD 1T4KA 3FAWA 3P11H 2QKIA 4ZSOE 4BFIB 5D8JL 3D2UD 4KKNA 2DQEH 3QDJB 3H6JA 4QRRB 5SX4I 4LCIL 4HAGA 1W0VA 4GRWF 2P47B 5E2UL 4RA3A 2NY5C 2X40A 4LLDA 3JWOC 1KPVA 4S1RH 1QP1A 5MP6H 2D7QA 1R3HB 4ODXB 5ID1B 2X4RA 3GIZH 1RPQA 4UIKL 3FO0H 5IT2H 4LCWB 1TJIH 2J2ZA 3ZE1E 5BZDB 1AC6A 3IETB 5HYSG 3HPJA 1KELH 1BLNA 3DHMA 4KKLD 1MI5D 3MLXH 3U30B 1UWXK 2O5XL 1FLTX 4HD9A 4XP4H 3NPSB 1QSFA 3E6HB 4Y5YC 5C9KA 2IPUK 2WAHA 1KBGL 5C7XL 2JJVA 3QFJE 4NWUL 5GGTL 3HE6A 4AL8H 4ZFGH 2OZ4L 2HT4C 4PYGA 2ORBL 1T1WA 1Y0LA 3CC5A 1WQVT 4TQEL 4CADA 5BW7A 1Y6KR 2A9MH 3QNZA 4ZXBC 3HI5H 1N5YL 4JLRB 1CK0L 3QPQD 1A4KB 4NQXA 2UVFA 1HOCB 1WFNA 1NSNH 4FP8L 4AG4H 3WUWG 1A3RL 4L5FL 4PR5A 1OAZH 4P46B 1JZ7A 3MFFB 5H35B 5B38B 2DL2A 3RU8H 2HJLA 2AW2A 2ZPKL 4U05A 1IFHH 3SOBL 1A7PH 1H15A 5LKNA 1IQDB 1C1EH 5GSRA 2RB8A 4ZUWA 3HG1E 5I1LB 1AP2B 2HTLC 1GHFH 4HV8B 3ARBC 4KZEH 3U7YH 4KAQH 3FQXB 3BPOC 3MOBH 4DVRL 4D9QE 4WWKC 3VFPB 4TVPH 4YHOL 4MGXA 4NZJA 4P4KA 4HIHB 4LSVL 1NFDF 4EJ1C 1OAUL 1QVOB 5KW9H 2P8PA 5GRYA 4FHBD 4WO4D 3T3ME 1VADA 4JY6B 1TJHH 4G6JL 1VCAA 4Y4HD 4NNXA 4MNQB 2OI9B 3HN3A 4GLRI 4X5XA 1PBYA 4XPHL 3DGCR 3IS0X 4PV9B 4M7JH 2UWEE 3OPZL 4LLUA 4P2QD 4I3SL 4Z7UE 3UJIL 1T22B 2ZUVA 3GSXB 1SY6L 3UEZA 4XPAH 4YHKL 4ZUSB 1C08B 4ZO9A 1RQ5A 2DQIL 4PJGE 4KMLB 1MQKH 3JV0A 3I6GB 2HT2D 4ZUVB 5M7QA 1MHPH 3EFFB 1UM4H 3S88H 5FYKE 4GO6B 4S11A 2HYMA 4LRNH 4JQXA 1MAKA 3REVA 1B4RA 1SY6H 3TBWA 3NVQA 3OXSA 3DI2B 3O9WA 4RCAA 2HFGL 4YO0A 3ZHLA 4JFZH 2EIZB 4X4YA 1UWXH 3B9KA 4MJID 3RWJB 2QQKL 1CL7L 3QXAA 4WI4A 1A02N 3FRPA 1ZGLP 3LQMA 1I9RH 5AZ2H 1F3RB 1H3UA 3VD3A 2G2RA 3GSOB 4LEXL 2VDKL 5D1ZC 1KULA 1I8KA 1HHGA 3L5HA 4AMKL 3UPCA 3JUYA 3TCXA 1JPSL 3MROA 1JPGB 3BKCL 4M5YH 4IRSA 3O4LE 4ZD3H 1YPZE 3HMXH 4CVWA 3KLAA 2CKBL 4OFPA 3V5HA 4D3CL 5T1LA 3SDYL 3RY5A 2BSRA 3IDIA 1FAIH 2CO6B 5C0IA 1CD9B 1DVFC 2ZUYA 3ARGD 1KB9J 3V6FB 2W1NA 5DJZB 4Y8DC 25C8H 3GMRA 2X70A 2R1XA 2DBJA 5CS7A 1QSED 4R8WH 1ZHBB 4HBCL 5L2KA 1NFIB 3RI5F 2Q8BH 2C5DC 1PQZB 4RGOL 4X6DB 5GGSB 1UCBH 2AEIT 4EUPG 2IPKA 5IVNA 5EU6E 5DWUH 3P9WB 1QSEE 1HN1A 3BPCB 1JRHH 3DX9B 4Z0XA 4Y16D 4NHUB 5HYFA 4NJAH 2KL6A 4TNVK 5LCVH 1YNKL 4ONFH 1LP9E 3MXVH 4K55A 5HHQA 4GMSH 4TVPE 1J0YA 1NEZA 4IRZH 5CP7A 1UXWA 1SEQH 5D5MB 1FCCA 5F72S 5ETUA 1S9VB 3G9AB 4ZOBA 3FO0L 5HVFB 5GRWA 4Z7UB 2X7LB 4K7FA 1KJ2B 1U8IA 4MD4B 4DOHE 1CDBA 2EDKA 3QDJD 2WINA 3KLHC 2AK1L 3GIVB 4O00A 3VD5A 2GT9A 3BKYL 2BNQA 1IKFH 1RVFH 3QQ3B 1CFNA 3FQTA 3QEQE 5FHBH 3ROOB 5TQ2L 3RZCD 3DHJA 2E6QA 1LO5A 5DJ0B 4CJ1A 4K3JL 2OJZL 5F9OL 1UJ3A 2R4SH 4WHTA 3DSNA 3WV0A 4NZRL 1WC7A 2A6KB 3JSSA 1IKFL 3P3YA 1NMBL 5D96B 4Z77B 2MQCA 3UBXA 3DRTA 3CX2A 5AYUH 4P5KA 1DBML 3O8XD 4D94A 3N1MC 4PJCB 3ARGC 1BEYL 2Z8RA 2ICWB 3RBSA 4FQCH 4M1CD 3UYPA 3CFDB 1L9MA 4MJ2A 1N2RA 1XGUB 4I2XB 4TUJB 3SDDB 2W60A 3ARFA 3LN4B 5E8DL 3DVGB 1BLNB 4ZTPH 4APQC 5E8OA 4YFLI 3MACL 3MSPA 2DKUA 3UTZA 5ICYB 2WBKA 5LXGH 2Z0BA 3RWEA 2QTEA 5D7KE 1CDYA 4QNPE 3EYQC 3ROLA 3WJLC 3SJVE 3KDMB 3E3QE 2OX5A 5C08D 4HF5H 5D1ZA 3ULSA 5JDSB 3MLUH 1JPSH 2H1PH 4DEPB 2ZUQC 3QI9C 2F54E 1AHWB 1W72L 4PRPA 5ICZB 4LEOB 4ODWB 4YFLF 4CJ0A 2ID5A 4QHMA 2H9GB 1OSZA 1A9EA 3CGTA 4JY5L 4LP4A 2OSLB 5T3ZH 3Q5TA 1NBZA 3CMOH 3NZ8B 4YX2H 1AHWC 3PE9A 1VFUA 2XXMB 2NXZB 4EI6B 2PR4H 1A6AA 3WIHA 32C2A 1N5AB 2OK0L 2B4CH 3TIDA 4NC2B 3G6JB 2VUOA 4NM8L 4Z76B 1QNZL 2FB4L 5LGHL 3IJYA 3MRIB 3SGDH 2I5YL 4LCIH 4FQ1L 4PGBA 3LY6A 5EB9A 5IHLB 3S97C 4ODTH 1YEHL 5E2UH 5F7HA 3O11A 3EDEA 4U1KB 1FZKB 2HAZA 4LARL 4K3GA 4G8FA 4EXPX 2VL5A 3GK8L 5IEKB 2HFFB 3VGBA 3N50A 2MPAL 3WFHB 2FB4H 2P7TB 5LGHH 3HCVB 4NN5C 1PG7H 1AFVL 1ZA3B 2ITDB 4RISH 5E5MB 4FQ1H 3UP1A 1LILA 1LK2B 2EO9A 1ADQA 1ZLVH 1U8HA 1F11A 3T4YA 5KW9L 1C08A 3FQRB 3EDKA 1J7VR 1HQRA 4QWWC 1A6PA 3V0AC 4OTXL 3ARYA 5HJ3B 3EFFA 2DI7A 3BN3B 3LS5H 4YQXL 1IEBA 5FYJH 4OUUA 4GG6E 1IZJA 3HR5A 2JK5A 1V7NL 2D4FA 4OZGB 4PJCE 1T0PB 2GSGB 4RBPH 1I9JH 4KROC 3BMVA 3VWJB 3M1BB 1FO0L 1Q0XH 4G8GA 3RWJA 4KI5F 1UZ8A 2WQRA 4HWUA 4QEGA 3ZE2F 4LAJH 4F7TA 2RCSH 4PLJD 3TBYB 1KIPA 1MQ8A 1MCKA 4LCWE 1I3GL 4Y4FC 5FECA 1NMBH 3F12B 2XWTB 4NZRH 2KZWA 2IAND 3CFIC 4UQ3A 5JPMA 5DRNA 3T0EC 2BVPB 5J0BA 1IAKB 5F9WB 3KLAB 4NNPL 3LEVH 4OLVH 5T1LB 1JPFA 5DHYA 1JF1B 3PL6C 3WE6A 5HHMB 3VXSE 5AD0A 5CKAA 1Z9LA 5IG7A 1EEYB 3UTPD 5DRXA 4GS7B 3GRWL 4PJ8C 5TQ0H 3LKNB 3QQ4B 4RAUB 2IPUG 5DLML 3CVHB 4ZFFA 4O5LH 3MLSL 4FABH 2XTJE 3CFJA 2X70B 5DC9B 1XGRB 2WUCL 3WLBB 5FUCE 5MP6L 1UM6L 3U0PB 1T2QL 2IAMC 2CDFA 3WHXB 1OTUC 4RGNB 3MUY1 2HKHH 4L4VE 4K3JH 4OZGE 5F9OH 3TP4A 2ATPB 2H32H 2UWEF 4RRPG 5L2KE 3FOLA 3UXFA 4FTVD 4QRPE 2I24N 3L95A 1G6VK 3CPLA 5ESAA 4X6CF 3QUYB 3OKDA 1TVHA 5I15H 4N8VB 5T3XL 4WI6A 4QWWD 5HTSA 4AH2A 3W2DH 1CBVH 3TH2T 1Z9MA 1M7IA 1M05B 3DXAB 1WBXB 4QHKI 1AKJD 4HS3B 2OR9H 3I75B 3V4UH 4OFVA 5HD8D 1D5XA 4R3SB 5FO7A 3W0WB 5F1NA 4F7PA 2YD3A 4S1SH 4EDWL 4Z7UA 4PRAB 2W0PA 2Q6WA 4MXWL 2QJDA 1U3HB 1LNUB 1HCFX 25C8L 1GC1H 3DV4A 4NBZB 5DK3A 2J8UB 3CXDL 4GRMA 3SCMD 3ULUF 4F15B 1Z5LA 3QJHB 5E6IA 1M7DA 3GSWA 3UX9B 1MFBL 1AIFA 4CN4A 4IHOA 2MQ3A 4NO0D 5F1KC 4YE4L 2ERJC 4MHHI 4FTVA 5FM5O 1G6RA 3TJHC 5HHOD 1A9BA 3BPNC 4XVTH 4FXKB 3K81A 4F15C 1UYWH 5DHVB 3ZDYF 1R0AH 4ZFZA 3DVIA 3HE7D 3FO2A 5GJTL 1EO8L 4G6KH 1OSPL 2PETA 1F4YL 1QSVA 1KNOA 4IIQC 4ZFOA 4G5ZL 3GMNB 3V9FA 3ARZA 1ZLSH 5F88B 3QO1A 4OZHF 3KJ4C 1KN2H 1T4KB 4BFIA 4YFEA 4J3SA 5DEFB 5I6XC 3STZB 1G7PB 1S5IL 3IU4H 1NDGA 4X9HA 1YEFH 5CIPA 1Y6NR 5HHNA 2AQ2A 2AJYL 1P4IH 4MA3B 4JE4B 1IGTB 1RZ8B 1HCVA 3G5VB 5GPRA 1QZ1A 4TSBL 1AGBA 4JDTH 4U1NB 5CD5C 3SKJL 2AEPL 3LRHA 3FB6A 1EVUA 1ZLSL 1JBJA 1QLRB 5ACZB 3LB6D 3P0YL 4S1DD 1JI1A 1JRHL 3MRHB 4LPUA 4KV5E 1T6VN 1WICA 1D6EB 2QL1A 2Y5EA 4TTDD 5HY9A 4JFYB 5DMIH 5E7BA 3PG2A 2Q86A 3GSVA 2Y23A 3TC9A 1IC5L 1DLFL 3ULSB 4P3DA 1VPOL 5B3JF 1L7TH 1YEDB 1XEDA 3VFVA 1VFBA 3ELAT 3VXQA 1UGNA 3MZTA 3RWDB 5DJAB 1T2XA 2FBOJ 1T5WA 5D9SB 1U92A 4XXCC 5E2WH 5T5FL 1NL0L 3WIHL 1YUHA 4AIOA 2LTQB 1P7KA 4UTAH 3IT8D 4FQCL 1R5WB 4R90H 3RHWF 3TYFA 5DMJB 1EJOH 1A4KA 2A83A 1RK0B 2YK1H 3FB7A 4YXKL 1AGFB 2UWEB 4YPJA 2GSIB 5DJCB 2AXJA 1CGSH 5EO1A 1MQKL 2HJLB 1GGCL 3PP4L 3HUJE 3FB8A 1NKOA 1OL0A 4MCYB 1IQDA 4G9DA 4AQ1B 3QDJE 1RUKL 3PWUA 2X5PA 4PGBB 4KMTH 4JB9L 1MLCA 1N0XH 1QFWM 1ORSB 4LLYA 2YHGA 4RMQA 3NCJH 2DKSA 1P2CB 5HVHB 4HIHA 4FQLH 1CK0H 3W82A 2P7TA 3P4NB 4K9EL 3VXNA 3IF1B 4ETQA 1CU4L 1LK2A 4NKDA 1XF5B 4KK9D 4JHBA 3MZGB 3OR6A 4OZIA 3V0VA 4CN6A 4R7NB 4ZAKC 2QSVA 1KB5B 4LAQL 4OF3A 4XNZB 3IDXH 4XNUH 43CAA 4YDVA 1FE8L 4WUUD 3U7YL 5FYLH 3IAQA 1D5IH 1NLBH 1Q0YL 5GGQL 1UKTA 4AEIL 1FGNH 1FVCB 1I3UA 3WUWB 5FK9B 3P4OA 5IBLC 1Y6MR 2EXWC 3D85B 4HZLA 3I6GA 5T1LD 4X99A 5IB4A 4OM1L 2VTFA 4XZUB 1FRGH 3ILPB 1DQLH 4NGHL 3VFNB 5ALCL 3G5ZB 1UA6L 4HBCH 4XCYA 4CNIB 5HYJE 2HG5A 4MLSA 3Q6GH 3PGCA 2YPLA 3BKJH 3DSFH 4M1DH 1KXTB 3KXFD 1NCTA 2EC9U 3QXAB 3ZKSD 2D7MA 1LGVA 3MV7D 1DCLA 1CT8A 1VFAA 2EZ0C 3DV6B 1F8TL 1BQHG 3H8NA 1WTGT 1YEEL 5HYQB 1T1XA 1FFOA 3V2AR 2AVGA 3VXRD 4P2RD 1A7QL 2P5ED 4YQXH 1LEIA 2DLFL 4MAYA 1FL6A 1TZIB 3CNKA 3X3FL 4OIIL 3IDNA 3BRGC 5C07B 2NY4C 5C09B 1CLYL 3DVNB 3VFOB 2YD4A 4JZNB 4RFEA 3IDIB 4GKOA 1EJ6A 1X3DA 1ULVA 3RZWA 2YD6A 1IGCH 4G43B 4Q97A 1WWAX 3RAJL 4PJBF 4NJ9L 5B38A 2R1XB 4LGPB 1HXMB 2FIRT 5C0DB 5FHBL 1VPOH 1XCTB 1KEML 4HUKB 1AO7B 1T83C 4G6FB 1TXKA 1JPST 4KK9C 3MREA 1CFQA 5HPMA 3GFUA 4ZAKD 3EYSH 1C5CH 5F1IA 2IFFH 2ZOKB 4LIQL 5D72L 3QXDA 5CEZE 2VDQL 1CFTA 2BVTA 1UM4L 1QFWL 1HINH 3MLRL 4PJ8A 4GT7A 4YXKH 1K9TA 1VGEH 5FM4A 4BJLA 4CRPA 3FB5B 4F7PB 1EEUA 3GMOA 2A6IA 4NQCB 3U83A 5TGBB 2HH0H 2P5WA 4HFWB 2NW3A 2J6EL 1S7WB 4X5XB 2J8UA 4GRMB 4OZ4A 1G9MC 2V5YA 3GSWB 2VJXA 4HIJB 1JMXA 2VLRB 4L5FH 2FJHA 4JJHA 3KJ6H 1T5XA 2ADFH 5SWSB 5SWSD 4O4YL 1FZOB 2NTFB 2UZXB 4PJFF 1RUQL 4PJAE 2DYPD 3QA3A 1V3KA 3V7MA 5L7XH 3PDOB 4TULH 4GG8A 3FQUA 4HHAB 4KJPD 2VAJA 3MOBL 4DVRH 1ND0B 3ZYJA 3RVXD 4FFYL 1BFTA 4NP4L 2DKMA 1AGCB 4JFED 5EN2B 1EFQA 4L8BB 3OAUH 4HIXH 5DVNA 3EYQD 3U0TA 4G6ML 4P4KD 1A3RH 3Q2CA 3CCHA 3FN9A 4JPKH 3T0VA 1NH6A 2VDMH 2APFA 4XMPH 1E6JL 1ES0A 3FHAA 1F4YH 3GBNH 1N2RB 4QOKE 1SY6A 5HY9B 1R0AL 3QUXC 4KI5C 3RKPA 3RWCA 3SDDA 5E4EB 2Q86B 4XVTL 2NYYD 1QLFA 2FJGB 4LQFL 2UZIL 3NH7L 1B3JA 2NY0D 5J57B 3RY4A 1MJUH 5FYJE 3MRJB 5KVDL 3LS4H 5B39G 4QCIB 3FO1A 3VXQB 2AJVL 4IOFD 4CU8A 2XQYK 3BP5A 3REWB 3S4SA 1OQXA 3BD3A 1VKXA 1P7KB 3PL6D 4LSVH 2WBJB 3QDGE 3X3GL 4LMQE 4LIQH 4Q74A 4HT1L 2W59A 5L2KB 3GMLB 1AGFA 2GSIA 4H1LA 4J4PA 3PQYD 4MD0A 5ADOH 2Y36L 3BPCA 3HC4L 2BNRD 3RRQA 4G9DB 5J06A 1FZJB 1FJ1B 4FQHB 1EERB 3MJ7B 1UQSB 4JQXC 4M6OL 4P2QA 5FA4B 1A4JA 4NQUA 2R1WA 4F58L 1NEZB 4K7PL 1YYMH 1UXWB 3MLUL 2EEAA 4DGVL 1E6OL 5A40E 1S9VA 3O3BB 4NRYA 5FA3B 3WXVH 1ZANH 3SKMB 3MO1B 4NBXB 3ULVC 1D6VH 3D85D 1NGQL 1MVUB 1QOKA 3SQBA 4PJEA 4U1KA 4IMLB 4KTYA 5MENA 4KRMB 2BNQB 5DT1L 1HYRC 3PWPE 1HILA 4PIRF 3ROOA 2VDNL 5D7IF 3RGVA 4LDOB 1EZVX 4EUPB 3D6GA 3G6AB 1G7HA 1I1YA 5D2NC 1JN6A 5J1AA 2CKNA 4ELKB 2DTMH 3TIEB 1KG0A 3ULUD 2ADFL 1T0NB 2GW5A 1CDGA 5ANMA 5E6ID 3V79C 3K8KA 1SYSB 4AZ8A 1MJJA 1NLBL 1Q0YH 5GGQH 4G8GB 3RX7A 3WFCH 3OZ9L 1ERNA 4QRPB 2HVJB 2LABA 2CJUL 4LSQL 3S4SG 3LN4A 2PYEE 1FNFA 4JAMA 3QHFL 4JO1L 1I9EA 2CIIB 3T08A 1HINL 1A0QH 3F12A 4WEUD 4HS6B 3RWEB 5KANI 4UQ3B 4OV6F 3ISWA 1GIGL 5EOCJ 3ROLB 5GJTH 1MNUL 2VERN 1LWRA 2EIEA 4KFZC 3EOTL 4Z8FL 1PLGH 4FG6D 1E4WL 4RFEB 1U8OA 2MJWA 3DXAD 4U6XA 1BBDL 2Q8AH 2R0ZH 3OAYH 1P9MC 1F42A 2DBLH 2DLEA 1NMCC 2P24B 3RUGE 3VFSB 3QQ4A 2WWMC 1FFPB 2GI7A 2JB6B 4NQED 3B3IB 3WDIA 4F37F 2R2HA 5HDOA 4UI2A 5ENWA 3ZYIA 4HIIB 3L5XH 2YD2A 1QRNE 1I1AB 3JWOL 3TWCH 3TIDB 1H0DB 1QA9A 2BFVH 2R4RL 1X5JA 5BRZA 1T21A 3OWEA 3MRQB 4ODUB 4HDIA 3T4AB 3SCMC 1A7QH 3ZE0E 1J5OH 2W07A 2BCKA 3B2UC 1ED3A 3QQ9C 1C1EL 3IJYB 5D71H 3FOMA 1ZA6B 2AV7B 2H2PD 4OIBA 2Q7YA 3K1KC 4NQEA 2E7LA 1CE1L 2PO6A 4UU9A 1QPPA 1M7IB 3K7UA 1T66D 3QDGB 1U91A 3PGFL 3QDGD 4P59H 5ESQB 3PV6A 3SE9L 5B3JE 3DTXA 1JGLL 3DX8A 1CYGA 2LU4A 3JTTA 5GIRA 2W9DL 1GGBH 5CEZD 5C0BE 1KCVH 1UT9A 1VHPA 2EDJA 5C0FB 2X4QA 5IR1B 5FKPB 5T3XD 2VDOL 4ZS7H 4GKNB 3WKML 5KVGL 3DV4B 4P5TC 4MXVE 3KYKL 1H3VA 3BXNB 3N1GC 4KI5E 3L3KA 3A6CL 1OP9A 3DIFB 4OKVB 4NPYB 4NO3B 3PWLB 3L3HA 2X89D 3BD4A 5KS9E 4PUBH 4HEPG 1RVFL 1A9BB 3TT1L 4M62H 1GZPA 4FXKA 1L9NA 5DD6A 1WJ3A 4J3TA 4EN3C 1DP0A 1AGCA 3WNNA 5DJ2A 5D7JD 3CZJA 4FG6C 4KPHL 4YUEL 4JRYB 3HMXL 3KR3H 1KNOB 3E6FA 3T8XB 3K46A 3GHBH 3VCLB 3BEVA 4X0KB 4O51B 3AREA 4IMKC 5I75C 2BY1A 4OAWA 3CD4A 4OUOA 5EU7E 1DZBA 4YDLC 1RJYB 3QCVH 2XA3A 1X5KA 1G7MB 1RZ8A 3G6JF 4G7YH 3S8WA 5F9JA 4HK3N 1I3RA 2QQKH 3O6FD 4DOHB 1I4FA 1QLRA 7CGTA 5I1AB 3IFOB 3C5JA 1EAJA 4XX1E 4ZPTA 3D3VB 3U7WH 4PJFA 4PTUB 1QNZH 1C8PA 4NN7B 3W9DB 3EJYC 1MCCA 2C4FU 5IB5A 1TTGA 2W0FB 3UTSE 5K9QG 2XTLA 4Q7DA 5FO9A 2BY2A 4YBQD 3HC3H 5E00B 3LOWA 4PB9H 2HMIC 1CGUA 2J8UF 5TDOB 3OF6A 1H8SA 3C6LD 4NKMA 2SEBA 1KENL 4MZ2A 1IAIH 1T5WB 4XC1L 5D9SA 1CTNA 4WCYH 3F5WA 1QRND 2Z92B 1TVDA 4KUZH 4Y16B 1FZJA 1A6TA 3QNXA 4FS0A 4KHXL 5IMLB 1JJUA 3MMEA 1FO0A 1KT2A 3H9HA 3SPVA 2VLKB 2Y06H 1SBBA 3AROA 3MV8A 4AH2B 4CW1B 4YHPB 5EOCH 3BP6A 4BQ8A 4UT6L 1YEKL 4FQXA 3GMMA 4OM0L 2P5EE 1BVKB 3MUHL 2XWJB 3SKOA 1JK8A 3TA3A 1X5FA 2OK0H 3VXSA 2DLHA 2DJUA 2E27L 1OHQA 5MI0B 2HT3D 3C2SA 3VFUA 2Q6WB 3L3DB 1MJ8L 1FV1B 1ORSA 1UZ6F 4PJHE 4HGWA 1S7VB 5FUOH 1JCKA 3ZT7A 1R3IH 1PZ5A 3NABH 4ELMA 5ECJE 3UC0H 3CX5K 3JV6B 3O6KL 5EUOB 4MLIA 3I50H 2GK0B 3MTRA 3VGAB 1SMAA 4YBLB 3IF1A 4ETQB 1GPOH 1UJ3C 2XWBA 4NKDB 1KIQA 1XF4B 2X09A 1OTSD 4HPOH 3MRGA 3KG5A 4TUKH 3OR6B 1G7HB 2IFFL 5DQDL 1JN6B 3R0MA 2QQQA 2J7LA 43CAB 4K7PH 1KPUA 2DMBA 3VRJB 1UWGL 4MNGE 3H7BA 2JJTA 2AAVA 1EH9A 3NCFB 3QZWG 5F88A 1TLKA 3WUWA 3V4PH 2XXCB 4YXLL 3RNQB 4KUCD 5DEFA 4G8EA 1DVFD 2MHAA 2NX5D 4K7PY 1IGCL 1OTTC 2AEQL 1IAII 4I8DA 5ALBH 5TFSL 4GG6F 5CHNA 1CD8A 1FFNB 2YXMA 3VH8A 4R0LA 1EHAA 3MX0A 4M8QA 5DJ6A 4YNYA 5LVEA 3O2WH 4D0BA 1XZ0A 3V0WH 1HHJB 3OKLB 5C08E 4L9LC 4KPHH 5JHDE 1IL1B 1JHLH 2XZQL 3TFKC 1C5CL 5B4MC 4HK0A 3H42L 4FQJL 3E2HB 1AO7D 1MHHA 4PJDB 5HGAB 3SDXA 3ZTNL 1VFAB 2FBJH 3TN0A 5JHDD 1LO4H 3P30L 2Q20A 4L9LB 3TNMB 1TTUA 1Q9OA 2EDYA 2IH3A 5GS0C 4G7YL 4JN1L 5I1DB 3MLVH 4YH6A 1OD7A 3ZMRA 4CMMA 5HI5C 3RWDA 5J13B 4Y4KD 4WY7L 5EU5B 1CE6A 1ETZA 2E7MA 1HWGB 3HZKB 5DXWA 35C8L 3B2VH 1CTOA 5AYQA 5CD3A 1X6LA 1GC1L 3S3JA 4UB0L 2HT3C 2E7BA 1GOHA 3R06B 3S6CA 5DLMH 2A83B 5FGRA 5FUZH 5EWIL 1EPFA 4ZTOH 4FNLH 4XXDA 5KTEL 2GJ6B 2P48B 1E27B 5DJCA 5C0NC 3F7RA 4GSDL 4ISVB 2FGZA 1QA9B 5F89A 3ZTJG 2HVKA 3KGRA 3SDCD 5E8EA 4AEIH 1KSRA 3QXWA 3PJSA 4RNRA 4FMKA 3VWKB 5C0EA 4NN6C 1WAAA 3L7EB 3HE6C 4LLQB 1AO7A 1ED3B 4JPWL 4OJFL 2AV7A 4KRLB 3C5SB 5F1IB 1FG2A 5EU3B 1A7PL 4FNLL 1J1PL 2OMBA 3MXWL 1LK3H 4LDEB 3VWKC 2ZP0T 3OSKA 3PNWB 3V5KA 1WSST 4JPVL 1FYTA 4QKXB 4ZO7A 1OP3H 4Y4KA 3AREC 2CUIA 3BYYA 2YC1A 2X10A 1D5BA 4P23B 3IJSA 3O8XC 2BMKB 2X4QB 3CFEA 3GMOB 4JFPA 1RUAL 3WIFB 2NW3B 3HRZA 3GGWA 4QOKD 4QOKB 5E4EC 1B90A 4XX1G 4IS6B 3OL2A 1P6AB 1D9KD 3TT1H 2BX5A 3G5YB 2YUWA 5JR1H 4FQ2L 2AK1H 3WMSA 3DARA 2QADB 2FL5A 4CVZA 4BM7A 4U7MA 1L6XA 4J2XA 3DROA 3MNZB 1J05A 3QA3B 3K1DA 3BGMB 5KVEL 3RQ3A 2A6DA 4WEBH 5IQ9A 5IB4B 3VXPB 5BV7H 1T7YA 1F4WL 2W65B 4NBYB 3IAPA 3AU1A 1NL0H 1NFKA 2ZOLA 3W11C 4PJGA 3D9AL 4AJ0A 3OG4B 5D7LE 1XH3A 3QUZC 5INDA 5EO9B 2XI9A 2F74B 4MJ6A 3WEXA 3IFOA 3VXTA 5FCUH 4PGJA 3WXWL 1ES0B 1F97A 3RIFK 1YA5A 2B1HL 2XZZA 4RMVA 2H6PA 1J8HB 4IM8A 3VGFA 3ZTJH 4C83B 4PTUA 3IFNH 3IKKA 1U8NA 3KPLB 4XBGA 4MAYB 2G9HA 1WZKA 3B9EA 2VISA 4AT6B 3MLWH 5FO9B 3VXUB 5I18L 1MPAH 4QCIA 3EIFA 4O9HH 1DUYA 2VLRE 4QXGL 4OGAC 4JZJB 3NTCL 3FT2A 1QRNA 2Z92A 3HG1A 5IFAL 1HK6A 2F19H 1P5VA 4ONGH 5HGBA 3IDJB 2EKSA 4UT6H 4DKEH 3O4OC 3MREB 2C1PB 5F1OB 5IF0B 4OLWL 5C0RL 4GMTL 1NCBH 4XH2B 4LSPL 3EO0B 1IC7H 1BQHB 3LQAC 4FTVE 3K2MC 4QRPD 1CR9L 4R2GB 1HSBA 1BVKA 4RWHA 2IQAA 4FQHA 1JK8B 3TA3B 4HWZB 4DKFH 1CG9B 4DKAA 3VFGL 1XGQB 2F5BH 2YEZB 3FQWA 1IMHC 3VFUB 3VA6A 1B9ZA 2P5WB 4PJIA 1WLHA 4HUUB 1UADC 2PTVA 4KK8D 3L3IB 4PB9L 1W0WB 4I0PC 4K3DH 4LIQE 3WO4B 5DUPL 1XT5A 3TVMB 2IADA 3O3BA 2EE2A 5FA3A 3JV6A 3W11D 4G5ZH 1X7QA 4GS7C 4LCWD 3IXTA 2D31B 4UAOC 4IMLA 4WV1B 1T5XB 4K8RL 3MCLH 1VGKA 3CFCL 2NTFA 2CRYA 3T1FA 1BQLL 3WO4C 2PN5A 3TVMC 4J6RL 4KJQD 4NSKA 5GS1C 4R4NC 6FABL 3QIBC 3QO0B 4LQFH 1I7UB 3KYNA 3AY4A 4I5BA 3T0AA 2V2WA 5D7LD 4RGNC 3AY4C 2X4SA 1QBML 1A2YB 4P3CH 1JGUH 4D9LH 5CJ5A 1E4XL 5HYSA 3HC3L 1GYAA 3LKOA 3KNBA 1NUDA 3CH8A 3IDMA 5EWIH 1T0NA 5CFHA 2C7UB 2BP3A 4I4WA 4XP1L 5E6YA 1JF6A 2IAMD 5TQ0L 4KK6D 4OD1L 1IL1A 1IEAB 4MDJB 2X4RB 2ERJB 1TENA 3TNNA 1G9NL 5D7JC 1DEDA 1O7SA 1SBSL 4X6BB 4YGAB 3BWAB 2R4SL 3D69A 4JREB 4PJXF 5HGHA 4X98A 1R5IB 2VC2L 4L3AA 3HKFA 1KB9K 1QACA 1KOAA 1QLFB 2FJGA 3VXMA 4JDZA 5B8CA 4U7SA 1C12A 4CKVX 1A6WL 1N4XH 3P4LA 4CMMB 5D70L 5AUMB 1JNLL 3DURA 5F97E 4YHYB 1CGSL 4S2SB 3TYGL 2GFBB 1Y0LB 3CC5B 1KN4H 3QB7C 2NY5L 5E6ZA 1P6FA 4N90D 5AG8A 1IGML 1WFTA 4W4OA 3ALWA 4P5TB 2R2EA 1P1ZB 5CEYB 3O2WL 5IBUG 1U3JA 4LCCB 1D5MB 3G04B 5I1CH 4U6HA 3U30C 3S35H 4XTRD 1MUJB 4I0PD 1A1OA 4XXDB 4JQVA 1EXUB 5IVXE 4PR5B 5LGJA 5D1XD 2OL3A 1DFBL 4UDTB 4X8XA 1YN7A 3WJJA 4N0FA 1FBIL 4D3CH 3ARBD 4RQQB 5E5UB 1K2DA 2HN7A 2OR7A 1IM3B 1I1AA 4TULL 1N59A 4BZ1L 4R4ND 2D0HA 2FHBA 4XMKH 3T4AA 4OCYH 1TCMA 3B2VL 3PABA 2P8PB 3FOMB 1I9RL 4NRYB 5FAAA 2AJXL 4NQEB 4JY6A 4BH8A 1FAKT 2Y7QA 3ORJA 1C16B 2VXVH 1NC2A 1EUUA 4DEPC 1INEH 1YMME 2ZUQB 3DX8B 3WNOA 4EDXA 2EYSB 3I6LD 4KQ3L 2ICEB 2VNCA 5CGTA 5IR1A 4KY1L 3G5XA 4WWKB 4XVUD 5EOTA 2K7QA 4NM8H 4KTDL 3EDFA 1FL5A 3MA7A 5D4QA 3TWCL 4MXWH 3H3KA 1GIGH 5DJYA 5F96L 3O6LH 4K94H 3U9PH 3IAGC 3K4DA 2JIXB 1P4BL 3CVIL 1I7ZB 1OPGH 2FZ3B 5EIIA 4POZC 5T1KA 4OZGF 1HNFA 3HR6A 3BGMA 2HLAA 1DQMH 3JBG7 3B9KC 3RWFB 2QQNL 4MNHA 3JTSB 4P2RB 4P2OA 5I1EH 1S9XA 3DBXA 4Y2OA 2DM2A 4LVHC 1JTPA 3R1GH 3U7AA 3U0WL 4JFXA 2Q76B 3OPZH 5K59E 5DI8A 3B9KB 1XH3B 4LSUL 4NO0A 4TVSa 4H1LG 3TZVA 3OX8A 2F74A 3RVVD 4F8TA 5CGYD 2XA8H 1CDCA 2CIIA 3X3GH 4OZFA 15C8L 3ARTA 1KFAL 1IGJB 4WW2C 1Z2KA 3WFBH 2BVQA 3KPLA 2QHRH 5JO5A 2NY1D 3ARDB 1KJMA 4ENED 4WHYG 4UTBL 5E8PA 2DQFB 3HZYB 3RP1A 4U6XB 5EZIL 5B4MD 3WIIH 4PJDE 4Q6YA 4V1DE 1A7RL 3RWGB 3WL9B 4P46D 1S9WB 4DGYL 4E41D 3KYAA 3TA3D 3BVNA 1S9YA 3FT2B 3WKMH 4EIGB 4EBQH 5KVGH 3MCLL 4MX7A 1D5ZB 1FN4B 4YBLC 4JKLA 3KYKH 4P2YA 4LF3A 1YEJH 1E6OH 5GS0D 3O3AA 3OJDA 5DGQA 2DM7A 3WFDL 3LEYL 1HQ4B 2EECA 5D5ME 5HI5D 1REIA 3DYOA 1RULH 4JRWA 1SM3H 2WMPA 4FABL 1BZ7A 5JW3H 3V5DA 5D2NA 5KG9B 1P7HL 1NGYB 1MCOH 1T21B 4DZ8A 2LVEA 5EU6B 5EU6D 4NZDA 1WUNT 5ICXB 2B5IC 5I16B 1J8KA 1ZA6A 3QEQA 2YEZA 4D0CB 2EXWD 1B0RA 1G7LA 3BZEA 3P9LB 1ZHKB 3MLWL 1T1ZB 1DN0B 4XP1H 3PV6B 4LASH 1KCUH 3GMMB 2Z31C 4OQTL 1LP9B 1G7IA 5F7LB 4JRXE 2YZ8A 3QQNA 3TF7C 4DZBB 1MRFH 3HE7A 3QEHA 5C0FA 2X7LA 1L7IL 4K7FB 4ZAKA 3KXFA 1FLRH 4FXGA 1BQUA 3N1QC 5KOMC 3BXNA 5IIEB 3T1FB 3RY6A 4OD2A 4W6WB 5JIIA 3BDYL 1R3KA 5HYJA 1T7WA 5GGTA 2EZ0D 5C0AE 3MV9B 5CGYC 1AE6L 2OZ4A 1F58L 5D2NE 2FBJL 3GKWL 1OGAA 4H25A 1YQVH 4WTZA 1RV6X 4GW4A 4KU1A 1T1YA 1RURH 3SDAD 5FGSA 1QRKA 4X7SL 4PJ9B 3LHPL 3IKCB 3BN9D 3VU2A 1KPUB 2NY4D 4JRYA 3E6FB 4MJIE 4I0CC 2C7UA 4JFDA 4QHLB 4HK3J 3MUGB 3DRTB 1JWUA 4FQPA 4HKBA 4LSRL 3RNQA 4I4WB 1PG7L 4JHWL 1XF3A 4K94C 3E8UH 4JR9L 5JLZB 1RU9H 4QRRA 2ADGB 5CJOL 4Y4KC 2W0LA 1GRWA 4NJAL 4MSWA 1G7QB 1ZSDA 5I0DA 2XT1B 1R5IA 2I25N 4AEHL 3HMWL 2ZUWA 5I1EL 2V7HB 1XZ0B 1IC7L 2GYSA 3Q6GL 3DETD 1W2KT 5E8OB 5D96C 4JDZB 4QRUB 3MBXH 5ISZA 4NUJA 3UZQA 3HI6H 2NPLX 4XB7A 4JDVB 1NCAH 1OAUH 1LE9B 5E2VH 3P0YH 3MRRB 4HULB 3TN0B 2VB5A 2GFBA 4KVCL 4AEHH 3MV8E 4N1EA 4ZODA 3X13B 1CFVL 4HJGA 4UT7H 5I1DA 3HUJA 1D5MA 1AQDA 3WJJC 2R0WL 3NABL 1A1MA 4XXCA 1S5HB 3HZKA 3NCCB 1MWAH 1NDMB 1CQYA 1FVEB 1K85A 2BC4A 1OWWA 2GTZB 3MBEA 3VDBA 2AGJH 2NXZC 3MA9H 3CAFA 1TFHA 3I02B 4WEMB 3STBA 1NLDH 4Z7VF 4M43L 5GS3A 5ACLA 2WIIA 4EUPH 3IJHA 2CO7B 3MJ8A 4LSDA 1JV5A 2V2TA 2GJ6A 5I30L 2AJSH 3K74B 3HG1D 3MFFA 5H35A 3CLFH 3HNTH 2NXYB 5F89B 1DLHA 3ULUL 5KS9B 5BZWA 3GO1H 3MLVL 4CU6A 3FMGL 1JGVH 3P0GB 4OLEA 4YAQB 3RVXC 3C5SA 3SY0A 3SGKC 1I3VA 5C3TA 4G8IA 3L3DA 4O9HL 2P4AB 5AEAA 4YDJB 4GG6B 3KS0J 3WDHA 5JXAH 1BBJB 1T2QH 1VENA 3OJ2C 4M7ZC 4M5ZL 1DTUA 1VSCA 4NN5B 2ED7A 3KPOB 4P23A 4WWKA 1KFAH 4UT9L 5FUZL 1J18A 3QHZH 3CVIH 4G80B 4Y1AD 1CVRA 3WIFA 2H3NB 4S1RL 1N6QH 4PJXA 3RVUD 3C2AL 4HH8A 5MEPA 2V9RA 4JKMA 4N9GB 1T80A 4MD5A 5T1KB 2AV1B 4B53A 3VRJA 2ZUUA 3MBEC 2YD5A 3JTSA 4U1HA 1M7XA 1R24B 5FIEA 3D25B 4L8SA 3V6OA 4GBXD 2Y07H 1EFXB 3DROB 3MNZA 4IBLT 5HDLA 1ONQB 2W38A 4DN3H 4LVOB 1X6NA 3SE3A 4PD4K 3BZDA 4Z6AT 3MRBA 3LN9A 2FEEL 2HJKA 3OXSB 3WDJA 1RZJL 3OKLA 1DBJH 4NKOA 5EBMB 4F33B 5KZCD 2CPCA 4X4YB 1NUGA 3UC0L 2NW2A 4LVOC 1XGTA 3BP4A 3QPXL 4P49A 4OIAA 5EO9A 3OZ9H 4JHAH 4J3VA 3ARDA 3QG6B 2A9NL 1IFHL 1KELL 4ZNEA 1DVFB 2K7PA 2NX5B 4PG9A 5GRUL 4QY8B 1KJ3H 2DD8H 1KN2L 4PJ8D 1JPGA 4LHUB 1UWGH 4MJIB 1UA6H 4EVNA 5BVPL 3RWGA 5MERB 2A74A 4M7LL 3UYRH 3F7YA 3BVNB 5GZNC 1XF1A 1UG9A 1XGYL 4UAOB 3MBXL 2JCCE 4YBHA 2XIDA 1PSKL 3TO4C 4L4VA 3U0PA 3JXAA 3MCKA 4X6DE 1DBBH 5CILH 5FUCC 5I76A 3PQYB 1EVTC 3MV01 5TF1H 5E8EB 3DOSA 1SJEB 4RNRB 5ESAB 3LS5L 3GJFK 3L7EA 1CFVH 3TO4B 1P7QA 1ZLWH 2X1QA 3LCYA 5DD3H 3P73A 5IB3A 3PWNA 2V9QA 3CXHK 4NQVB 1PW3A 5FOJA 4PJ5E 5C0AD 3NAAL 4HUVA 4XRCA 5FYKU 4Q9QH 1Q8MA 2IH1B 5F7DB 1HSBB 3WSQL 3MFGB 1NAML 3EYSL 1WVZA 3EFDL 5E6IC 3W0WA 3S3PA 1U3HC 5HHQB 4PGDB 3VD4A 1EK3A 4HCRH 2FGWH 1N64H 1EGJH 2J6EA 4PGCA 4N8CL 4Z7VA 5GRVL 1IBGL 2UYLA 3QJHA 1KUMA 1F90H 1CXEA 3RJDA 1MOEA 3H42H 4FQJH 3RWIA 3TJHD 2DMCA 3D39B 5DJDB 3IXTB 5J12C 2P8MB 4XPFL 5ANME 4XVSH 5GGSY 1YMMB 2H8PA 4JKWA 3CUPB 1B2WL 2RGSA 3GI8H 2BRRH 5TE7H 5JZ7D 4PJXE 4UV7H 5GHWL 5D7JB 5IQ9B 1ORQA 3FRUA 4JRYD 5EU7C 4NZUL 2VDNH 3VA2C 2PKDA 3LD8C 2P8LA 3GUTB 3VFWB 4QT5A 5C6TL 4GAFB 3QBTB 3STZA 2KH2B 3CDGA 2DQCL 1A3QA 1HH6B 3ULVF 4G3YL 1IM9A 1ACYL 3L5JA 2IGFL 1AQKH 1QEWA 5I8OL 3T77A 5TDNA 2YPVL 4EI5D 1CD1A 1NCAL 5CP3A 5KSAD 4X9BA 4LKXA 4M7LH 5E9DB 1F02I 4NUJB 5KS9F 5BMFH 3RX5A 3W81A 5IUSA 4XBGB 2I9TA 4PRHB 3ARFB 4XNMB 4NO2A 2BOCB 4DCQA 3B2UD 2ESVE 4JG1L 3MRRA 4TUOB 3U46B 4HMDA 3QQ9D 3OAUL 4XI5C 2IBGA 3STLA 1QFUH 3N06B 5E24E 5JXEA 1R5VA 1VEPA 3NCBB 3FJTA 4WW2F 3WNPA 4JHWH 1IC4L 5E08H 1EHXA 5IKCA 3QPXH 1OM3L 3W39A 5DUBA 3VG9C 4JZJA 1JTTA 1U3HD 3RL1B 2ICWJ 4O2CA 3TEUA 5CJ8A 1F6FB 3L3JA 1QHPA 3D18B 3C5ZA 5HSFA 3G04A 4NYLB 35C8H 5E95B 4Z78B 3QI9B 1RK0A 1G9MH 1JV5B 1ZVSB 4NO5A 3AXLB 1A8JH 4K71C 4TNWF 1CS6A 1H3PL 4B7LA 4ZQKB 5C0CB 1WIPA 5IV2B 4ORGB 2YR3A 1FC2D 1G0XA 2VDPH 1CG9A 2ZG3A 3CH1A 4YAQA 3BZ4A 2FHFA 5DRWA 4LFHD 2R29L 4OF8A 2JCCF 4PV8A 5HVGB 5KSBB 1SVCP 4Y7MA 1MY7A 4HC1H 2XFXB 2Y4SA 1EJOL 5JHLL 4XVSL 1Z0NA 3NAAH 4ZO8A 1E4JA 1NBQA 4KK5D 4J3UA 3T2PA 2DWDA 1NCUA 3IDGA 1I9IH 1BAFL 1T2JA 2B4CC 1ADQL 1AO7E 2J1KA 2XYCA 4G8FB 5DC0A 4RMSA 4RMRA 2D03L 3UTTE 2EYSA 2AEQH 4E9LA 1KB5A 1FP5A 4NSKB 1S7RB 1L7TL 4L3EB 5IJVB 1PVHA 5C70A 2AABL 3NBNA 5KZCB 4LSPH 4OZFH 1F11B 4YJZL 4FFWC 3J7HA 2UUDH 1V3LA 3ZKXC 4KTEH 2PCPA 5F70A 4MDIB 2IAMA 3KNBB 5GGVL 4OQTH 4XZUA 5ITFA 2CIKB 4RSVA 3WS6A 1PD6A 5CBAA 1WTLA 1C5DB 1WGOA 4L4TD 2E7CA 2LAGB 1CI5A 4OCNC 5T1DL 5SV3A 1CLZL 1NGWB 2EDQA 5JPNA 1KLGB 1UZ8B 4HJJL 5IB2A 1CT8B 4KRNA 4WO4C 2B5IB 4QRRE 3NGBB 4HLZG 5MEQA 3FT3B 4Y4HC 4PRIB 1OP5H 4AG4L 4UIKH 1DVFA 2NX5A 3UJJH 1MCBA 2VZUA 5F7EH 2XWTA 3MOQA 4OCYL 3EO9L 4JFDE 4LRIC 2EC9T 3BKCH 1WWBX 3GSQB 1F6AA 2VZ1A 4KVNL 3I3EA 3FONA 4W6YB 4ZMAT 5IGXH 3QCUH 1U8QA 3MRKA 4C56D 3OKOB 1I85A 1JVKA 4N8CH 1KBGH 5GSVB 1AJ7L 5CEYA 4NOBA 4RAHA 4U6HB 3O4LB 5IHUL 2OCFD 4KHTL 3P77A 3LRGA 1EO5A 5L2KD 3QNYB 1S9WA 3MCKB 4ZFFB 4V1DA 5FGCB 1F13A 1FPTH 1D5ZA 1FN4A 1ZV5A 5E2JA 5C0DA 5SX5H 4XAKD 4NIKB 4O58L 4HWNA 1X5AA 4U1IB 4ELME 2X4UA 4K94L 5FGBC 5GZOC 4NCC2 5CCKH 3LHPH 2DQJL 4X6FA 1P9MA 4OCRL 5SWZD 5ERWB 4XPAL 4OFIA 4YHKH 1NGXA 5A16B 4WFGD 2BSTB 4QRSB 2MCG1 5I71C 3BZEB 3SDXF 4YHLL 1C16A 1OTTD 3R8BB 2GEEA 1PSKH 1DN0A 3J8F7 3C5ZD 3ARGB 1WBYB 1LP9A 4Z7VB 4M61A 1CXKA 2X4TB 2ICEA 4M4RA 5FB8A 1OAXH 1PYWB 3NFSL 5EU4A 1KTLB 5CUSL 3RWIB 3TFKD 2WM0A 5SWZB 3H9SD 4G9FD 5BS0B 5D2LE 4Y5VB 5CAYB 4AY0A 4JG0L 4Y89A 5EIIB 4MNQE 1UWEL 4JCMA 4H88H 2ZG2A 1VFMA 2APBA 3AMLA 2WANA 5C92A 4Q58C 3M8OL 1EEZA 3BESR 5BQ7A 2FH6A 5IMOB 1S9XB 1F2QA 3DBXB 2H26B 3LV3A 1G6RH 1PEWA 4GQPH 1NGQH 4JFXB 5B8CC 4MVBD 1KIUA 1U95B 4L8BA 5L8KB 1KTKE 3TJEH 2VABB 1CGYA 1EBAA 3H9SB 1G9ML 1JHTA 1L7IH 3GMNA 4UDUA 5EG6C 3T77B 2CLRB 2X42A 3CCHB 3QIUD 2M2DA 3GSRB 3WS3A 5E9DA 2NCMA 2HA1A 3OB0H 3QUXD 3BO8A 4KI5D 4MA3A 3EZ8A 4U1MB 4YIQA 4EZMA 4U4BA 4DN4L 3OKMB 3N9GH 1AGBB 2FX8H 3RWCB 1W8OA 2NYYC 1MAML 4ZTPL 4U1NA 3FB6B 5DHVH 2DQCH 3QWOA 3EZJB 2CKBA 4XAWL 1JNNH 4UV7L 5GZOD 3PWVA 5T33H 4IDJH 5IOPA 4JDVA 1YNLH 4J12A 3PF2A 4PJBB 2FX7H 4GMTH 1WT5A 1CWVA 4GRLC 4EN3B 2Z35A 4F9LA 2WBJA 1SEQL 2D0GA 6CGTA 4APQA 2KDGA 1PKQB 3CK0H 3CU1A 1MFDL 1ZVSA 1NDMA 4H1LB 1A6VL 1YUHB 3MBEB 1AJ7H 3SDCB 1FIGH 4TOYL 1GOGA 4I2XE 4ZQKA 3TYFB 2W9EH 5IV2A 1OAKL 4X7FC 1MCPL 4I18B 3FB7B 3SO5A 1IGFL 3MJ7A 3UO1L 2Q7NA 1E4WH 5I16A 3BZ4B 1TVBB 5IK3B 3P9LA 2WWKO 3AGVA 1X9QA 1J0KA 3SBWA 4ZS6D 1MCWW 3T65A 5IROA 2ZCHH 5J9PA 4LKCA 2BSSB 1DBKL 2QLVB 3C9NB 3ZE1F 2HP4A 3A6OA 2VLJD 2BXYA 4FQ2H 4CVUA 3BW9B 2VLKD 3MO1A 5DMGD 4ZAKB 5CIPH 3S37X 4MVBC 2DWDB 4OSUH 4PJDF 1WEJH 3MCG1 5MENB 5SV4A 4JFDD 3QDMD 1JNHA 1PY4A 2R9HD 3FFCE 3LIZH 1R3KB 4KDTA 1CGXA 4QXTB 1N6UA 3P4NA 4RGNE 1SM3L 4OM0H 5J6HA 1AD9B 4F9LC 5EFIB 1T1YB 1KB5L 3O2VL 2NY7L 5EZJB 2DM4A 1NBVH 4R26L 3SEPA 3E1F1 3PXHA 4XCEA 4PRBB 2DI8A 3GSNB 4ZSOA 4PRID 4DFHA 3S36L 4CVXA 5LGKA 4FZEL 5ANMB 5KSUA 3CFBA 3ET9F 4Z5RB 3D25A 1I9JL 2R0WH 5C9JA 5CJXC 5DD1L 2DF3A 4H88L 1KLGA 2IANA 4X4XA 1TDQA 1W8NA 4WHDA 3P40A 4MQXD 4TSCH 2V7HA 4XNYL 1UZ6E 4GAYB 5D72H 1S7XB 3MNVA 5ISZB 4OQTA 3WO3B 4F9PC 2PYEA 4ZO6A 4BH7B 2X4PA 3QULA 3TO4D 3MGOA 4LNVA 3VGAC 1G9EA 4MWFA 3BJ91 3GMQA 3IGAA 4Z7OF 5JW5B 4JANA 4I3SH 3MRKB 1I7TA 1NPUA 4PG9B 3LQZB 5T5NG 4K8RD 2GY5A 4HJGB 4LHUA 4WUKL 4MJIA 4EVNB 5DT1H 1A1MB 3NOIA 3K0WA 1TZIA 4MQSB 5GGRY 3QNYA 1FVEA 1I9IL 2OMNA 3B3IA 2V5RA 3DVNA 3VFOA 3T1WA 5DMGC 5JMRA 4HAFA 2VR4A 3I02A 2AKRB 4I48A 4KROD 2BRQA 4P57A 4HXBH 3MJ8B 5DD5L 3TVMD 3UZVB 3IFPB 4Q0XH 4M3KB 5ID0B 1XCTA 2RHEA 3HB3C 1G9NC 4HFUH 5EZLA 1TPXB 2A0LD 4WFHE 3QRGH 1MIML 4UNVA 1TZGL 2PO6B 4UU9B 1X5YA 4K7PX 4ODHL 1I8IA 1U91B 3CSYA 5DK2A 1NCWL 3QXTA 4XMKL 4NM4H 2Y5TA 2CR3A 1YC8A 1U58B 4P5TD 1L6ZA 1RUPH 5CP3H 1MFAL 4XT1C 1FO0H 1MCSA 1S7WA 3RA7H 4PP2A 4OJFH 2XOTA 5DFTA 4PD4J 2A9NH 1KACB 3M8OH 4Z7NE 3O9WD 4JHAL 4NPYA 4Z95L 1K6QL 2A1WL 1KCSL 1OWRM 5DMKB 3AMKA 2VLRA 2NY0B 3IDXL 4XNUL 1I8LA 4XPBH 4EIZC 4Y5XA 2H8PB 5IGXL 3ESVF 1OD9A 4EEEA 3HI6L 1T7VA 1ODAA 1K4CA 2YPKA 1G7JB 4JM2B 4GG8B 5ADPH 5KSBE 7FABL 5C71A 1WZMA 3I2CL 2IEPA 4X0KA 5EOQH 5BW7C 2HJKB 5I8EA 3KPNA 3ZKMD 4MXVF 4TNWK 2I9LA 1KGCD 3U0WH 2CXGA 2ED8A 1OVZA 4TSBH 3BRDA 1Q9LB 4BZ2H 3CDCA 4NCC1 3RZCA 4JVWA 2B8OT 5TDNB 4FZEH 5J1TC 3K3QA 2VXSH 5T3ZE 2ZCHL 4HUWB 5CZVL 4QY8A 1QQDB 2A77L 4WI3A 2R23B 2R2CA 3ARBA 1C7TA 3W9DA 5HHXH 1AGDB 5FCUL 1CICD 5EC1A 2X1OA 4M03A 5D7IA 3R8QA 3KYOB 2B1HH 3U79A 1MHEA 1N4XL 4LEXH 3QSKB 2V2XA 2QADC 3BH9B 4LSSL 5JXAL 3MRJA 5E00A 3C6LC 2OJEB 2FJFB 5K93A 4NZTL 1CFBA 2SEBB 2JB5H 1EGJL 1MJ7H 5CINL 2O5ZH 1VERA 4XVUC 4Y16C 5FO8A 3C2AH 2VLLB 4XCFL 3TO4A 3HS0A 4Z7WA 2GY7B 5A2FA 3GMLA 1RZFL 2YUZA 2X1WL 2YK1L 2GK2A 5B22A 5E5RB 4LOUC 3KS0H 4P46A 1NLDL 4CW1A 3QR2A 2CXKA 3DO7B 5I73C 4I77H 4ESKA 1H15B 1UH2A 2IH1A 2QHLA 2J88L 3C9NA 5T3XH 3MGAA 3Q3GB 1RZJC 5FDWB 5C0BD 4PGDA 3KLHD 2O93L 1OLLA 2YPLD 3SGEI 4XBPB 3V52L 2LAAA 5I0ZA 1LEKA 4ZTOL 5GGUA 4ZYKA 1HH9B 1XGYH 5JXEC 3P0VL 3ZDYE 4OGYL 1PY9A 4OKDA 1VADB 2BSED 2GK0A 1ZHNA 4HF5L 1DBAL 3TZVD 2XWBB 1RZIA 3MRPB 3PL6B 4ZFGL 4N8VG 3MRGB 5GS1A 1B6UA 3T0EE 1QKZH 4MQTB 3EYVA 1HILB 2R56L 1IJ9A 5JMOC 2VL4A 4BFBD 5C7XH 1ORQB 3FRUB 4HGKC 1JGEB 2I27N 5TPWL 4LSTH 3ULVH 3UCRA 1D5IL 2CK0H 1HZHL 5EUOF 4UIMB 3NN8A 5DJXB 1PGRB 2IAMB 3TA3C 4N9OB 1BIIB 3PWPD 2APVA 3L9RA 1W0VB 5TH2B 4X4XB 2Z8SA 4WFEE 3IVKA 4Y2DB 5F8RC 5EZOH 1Q9WA 4YXHL 2NZ9D 4C56E 5C07E 3L5WB 4TRPL 3H3PH 4FZ8L 4N5UA 5L88L 3M07A 3WLWC 5F7UA 2PXYB 3HC0B 3MXWH 4BYHA 3ECBA 1RSFA 5IM7B 4PJ7A 2NR6C 4OCMC 3HPJB 3Q5OA 1DQDH 4M7LT 4WGWB 3ZHKA 4LVNB 1NMCB 5DDHB 3PP4H 1G1YA 1Q9OB 2AI0L 2IH3B 5DC4B 5CZXD 4WVRA 2E8ZA 2D7TH 4Z0BL 3VRIB 3DI3B 1X5GA 1CE6B 1ETZB 2H45A 4FXLA 3QUYC 3BQUA 5FM5M 1T1WB 3MUJA 4Q9QL 1OW0C 3X3FH 4ORZC 5H37H 1AR1D 2XKUA 2X9YA 2PO6D 3C5ZB 3RNKA 2KUTA 1K5NB 1S78D 4FN0A 5EH1A 3U4EA 1V7ML 2P24A 2AK4E 2EH8H 3TT3H 4R7DA 3LZFH 1A3LL 2JB6A 4FQQB 4R4FL 3NFNB 3AXLA 1ZK9A 4C4KT 3IFPA 4NN6B 3CZFB 3C5ZC 2Q1EA 5C0CA 2VITA 4LCUB 5I1LA 1S7UB 5FGCE 1YJDL 5J3HD 1KXVC 3BPLB 2QEJA 4JO2L 5D6CA 3Q1SL 2DJSA 3GHBL 4U0RC 1JIBA 1NGZA 2YSSA 4R8WL 2XRAH 1C5BH 5C0GB 2ICWI 1J0IA 5E1HB 3V0WL 4PJCF 1SHMA 4X9GA 1U36A 3ZDXE 4GOSA 5LXGL 2V7NA 4OD3H 5JQHC 3MACH 1CLZH 1KCSH 5ESQA 5CJQH 4ALAL 2Y72A 1WBYA 3MV7A 1MHCB 2X4TA 3N9GL 3SO3C 3O81A 4QGYA 2DWEA 3F6IA 4RIRA 3RWHA 4OB5L 3TCLA 3GIVA 2CKBH 3O8XB 4NFDA 4ODVH 4P3WA 4ZUSA 3KJ6L 1YEKH 4L8DA 4LU5H 2VIRA 3HZVB 4C59B 3WD5H 4JPVH 4ERSH 4ZUVA 4YZFE 3NPZB 1KF9B 3DWTA 5FV2A 1LO5B 5GGTH 4DFIA 4U2ZA 5BQ7B 4HPYL 5CINH 1JFQH 3O6FA 3I3BA 4Y4FD 3KLDA 4XC3H 2I9LB 2H41A 1U95A 3I3DA 3T0ED 1BFOB 4LPTA 3RTQA 2CMRH 1JHTB 4UDUB 5D93B 4NNYA 3BEVB 1GGTA 1NJ9A 1FNEB 3ARWA 1IILE 2CLRA 5FYJD 1KCKA 1XR9B 1S78C 2OS7A 3WEXB 4HT1H 3GSOA 3WNMA 4OAWB 1AXIB 5DSCA 4PPTA 1HHGB 4WU7A 4YDLB 2IPTH 5BRZE 2COQA 3KPMA 5C0CE 1QBMH 1M6OB 2XG5A 4B7IA 1YMHB 2GTWB 5DZOA 2X4OA 4CMHC 3BFOA 5TF1L 2R8SH 2HLFD 3QUZB 4OV5B 3LS4L 3SN6N 5GXBB 4JFQB 1CZ8L 3Q5YA 4DAGL 1J0HA 1NC4B 1DSFL 5D1QC 3GJEB 3P77B 3BGFC 1MCIA 1TJHL 1MVFA 2EYTA 5EA0H 3V6FA 1CF8L 3KDMA 4JPIB 2CK2A 4KQ4L 5D1ZB 4ZS6C 4NQDA 4EN3A 4L4JA 5DMIL 2DIBA 3V95A 5JNYB 4HPOL 4TUKL 3OG6B 1J9CT 4PP1C 5TDOA 2XPGA 3BGFB 4ODWA 2VLME 4QO1A 1ITCA 4M5ZH 2WZPD 4N5ED 4XNXL 1A9EB 4KZEL 4H20L 2HRPL 4D9LL 4YGVB 1JYXA 2BVUA 1CDHA 3NMEA 5ESVA 2ATKA 3BH8B 2APXA 1N0LA 2OP4H 1J5OL 4PJIE 5IMLA 2EIBA 1B6DA 1G0YR 1ZVHA 2Z93A 2NMSA 4KK8C 3T3MF 4C55A 2NLJA 5CWSA 1EMTH 2VMFA 3QIWD 4GXUN 2BSSA 4GJTB 5HHME 3VXSB 4XWOC 3MRIA 1CDIA 2VZOA 4U1SA 3TVMA 1HXYA 3D5OF 4NRXA 3WCYA 4KKBD 5EUOE 1I7RA 5EU4B 3S98A 2CRIA 4KJQC 3JWDC 5GS1B 2D7NA 4KMTL 1JNHB 4OF5A 5DS8B 5T1KD 3EYVB 4I0PA 2CK0L 5DZNA 5E7FA 3JUZA 3M45A 2ITDA 1IGYB 4KV5F 1RU9L 2IBBA 4HWEH 2C3VB 4I77L 4MQXC 1UACL 1U8HB 1U9KA 3EOBA 3QWRD 1V5JA 3NIDE 4PRHD 3NN8B 4Q9CA 2A6KA 4JCLA 4M3JA 1PZUB 1SJHA 2E9WA 4JJ5A 1AFVH 5F7NC 1TQBB 1AKJA 4PJ7E 2O5ZL 1Q9WB 2ZUSA 2AJVH 2YN5A 4HEME 1KJ2H 3ZZ1A 2YD7A 4JFEB 8FABA 2H2SC 2IBZX 4K8RC 3LIZL 1FIGL 4TOYH 3TNNB 3Q0HA 3TBVA 2RFXB 4I9WD 5BJTA 5GRZA 4L3ED 4I2XA 2GIYA 4QYOB 4E5XA 1FNSH 1TPXC 3TBYA 2VWEE 1HYSC 2FX9L 4D0BB 1XR8A 4JKPH 1HHJA 3VXMB 1ZT4A 3U2SB 2FLRT 3UTZB 3GBNL 1R3HA 3KYMA 4N5EC 1C12B 4EDWH 3PWVB 5IOPB 4G8GE 1YMMD 3D87B 4QF1B 2JIXD 1ZOXA 2MMXA 1U2CA 1YEIH 1YC7A 2CGRL 3B5GA 5LAXA 4BELD 1II4E 4KDVA 3EAKA 1OARH 3VFMA 4XBEH 5J12B 1ZXQA 1JZ2A 2HJFA 3F58L 1ACZA 1NUFA 2VN4A 4B50A 3HB3D 4WI7A 2EDRA 4R96B 1AHWA 1KC5H 2BDNH 4TSAH 4ONOA 4AIZA 1FH5L 4QHMB 4M8VA 3GO1L 3MRNB 5D7IE 2OSLA 2N56A 1O0VA 1OAZL 1MCFA 1JRHI 1NBZB 3NZ8A 1FYTD 4AK1A 2N7BA 3R06A 3RVTC 2B39A 3WD5L 2F8XC 2J4WH 1MCWM 2EH7H 3WUZA 4NGHH 4BKLB 2YN3A 4YDKH 4L29A 5D7SH 5EC2B 5LQBH 5IK3A 5SX5K 3VWJD 1N59B 5IW6B 2AXGB 5JZ7C 3ZT6A 4YHOH 1QSFD 5K9OA 5I66B 3FOLB 3PJSB 3B43A 5C0EB 3L95B 2AEPH 4Z76A 4X6CA 5T33L 2F54D 4G6FD 1AP2A 3M17B 4POUB 4AENB 1IAOA 3TBSA 4BH8B 1N6VA 5D1XB 4JGJA 4Z7QE 4U0QB 2FECI 5I75B 3GM0A 4HS3A 3B9VA 2D7OA 5F9DC 4PJGF 1RHHB 3CIQA 3WXVL 3SGEH 4EI5C 4ZXBD 1D6VL 2LU7A 5HI3D 4DVBB 4DGVH 3U4BL 2BVOB 2QSCL 4OI8A 4H26A 3BIKB 1MSPA 5I74C 3HRZB 5IBLD 5EFIA 1YJDH 3UZEA 4DN3L 1Z9OA 1EMTL 5D70H 5K33A 4OLUH 4P4RA 4EI5B 1M7DB 3B9KD 5DA4A 12E8L 2E3VA 4NJ9H 1PX4A 2O26U 3GJFA 3TZVC 5KSUB 3K2UH 1FNAA 1RZGA 5JOFB 1FLRL 2QQLH 5F6HI 2EEBA 1QFHA 3RVVC 3TZVB 1W72B 1LDSA 2R0LL 4JHZA 3QO1B 4O2FA 5EIQA 3PDGA 1U8PB 3BDXA 4U1LA 5L9DH 1S7XA 4MA8H 2X4NA 1HKFA 2FO4A 2PYEB 4BH7A 4OT1H 5I15L 1X5HA 4OZIF 1ZKAA 1SEBB 2C1OA 1J10A 3JVGC 3NCJL 4QTIH 3HI1A 1YECL 4DAGH 5KN5B 2G2RB 4XPTH 3D2UB 2VXVL 4XHJD 3HPLB 3VWJC 4BSWA 2H6PB 1EEYA 5DRXB 5BMFL 4JFYA 5JTWA 3DGGB 1HIMH 5DTFA 1WF5A 2FNBA 4ZG1A 1HWHB 1TZHB 1M71A 1UEYA 5D7IB 4IMKA 1WFOA 4G7VH 1T6WA 4NQDB 4KK5C 3VXUA 2PW1B 3KPRA 5M94B 1HHHA 4KTDH 4F2MA 3KPSE 5H94B 5DJAA 3N1FC 4P57B 1ZHLB 4FFYH 4X7CC 1R3IL 2D0FA 3PWJB 4JFEE 1KCRL 3F7PC 5D2NB 3QFJB 3UAJC 5KG9A 2P5WD 3GMRB 1NANH 5HI3C 4A6YB 3FZUD 1PEZA 2J5LC 1AR1C 1R5WA 3HA0A 5JXED 2DQGH 3UMTA 3S3SA 2DI9A 5JIHA 5I1JL 4Z9KB 3QEQB 3BDBA 1PQZA 3VXME 3GSUB 5ALCH 1CFSA 4M7KL 3DO7A 2VH5L 2V6HA 4M4PA 5EOCL 2OR8A 4NHUA 5HPOA 1CXFA 4WI8A 5TE4H 4PLKC 2LE9A 2J4WL 2YPLE 3OHXB 1IAMA 1XGQA 1I7RB 1NAKH 1BJ1H 5L8LB 1DR9A 1MJ7L 2X6MA 5DURD 4B0MM 4XBPA 3WN5B 5E4IA 4JFZL 3O4LD 4P9MH 4G8GD 1RUKH 4R4FH 4X4MA 2Z4QA 5CLWA 1TQCB 1G9NH 1I1FA 3F7VB 4XCNA 4H5SB 5J7CC 3R0NA 4H25B 3SDAC 5KVMC 2XZQH 4W4OC 3PHSA 5HVWA 2GITB 4HQQL 4PY8I 3RVWD 4MJ4A 2BHUA 4M5YL 5DHVA 5KVFL 2CH8A 3FO2B 3T09A 3FQTB 1N8ZA 5KANG 1B4JH 1FGVL 1K4CB 4JM2A 4IRJD 5C0JA 3BGAA 2DQEL 4JFHD 2JB5L 2D9CA 3ARPA 3WHE1 5JLZA 3VXOB 3D85A 1NCCH 8FABB 4OQ1A 4MZ3A 5DUMH 1BIIA 1UXSB 3LZFL 4X99B 4KKAC 1DL7H 1BOGB 3QCUL 3L9RB 3S96B 5J6GB 4Z77A 5JIPA 4Y5VC 1G7QA 1K3ZA 3ILPA 1HSAA 4JFFD 1ZSDB 4MHHG 2VSCA 3RPIA 5CBEB 2ICWA 1DN2A 1MAJA 3KYMB 2YPLB 5T5NF 2R23A 4K23H 5GGVY 4TUJA 3ECBB 4PBWD 1BD2E 1GHFL 1IGIL 1H8NA 1AGDA 3DVGA 4N0CD 4GRLA 4LSTL 1RY7B 3C60D 4J4PD 2HFTA 4NQDE 1P4IL 5CLTA 1A14L 4JO4H 1HHKB 4OD3L 4HWBA 4R96A 5JUEL 4R4BA 4DKFL 1LEIB 2BOBA 3DNKA 4O02H 3SCMB 1FL6B 4KJYB 4AIZB 5CSZB 3FRPG 4PLKD 2BC4B 1G84A 4LPYA 3B5HA 5D7SL 3TN0C 3RNKB 3VJ6A 4X6EA 1E0OB 2OQJB 2YRZA 1RMFH 2UWEA 2H9GA 4XP6L 4OBRA 1CXHA 4H8WH 1H3XA 3IDYB 1GSMA 4UTBH 4WDIB 4YK4C 1HZHH 4N0FB 5HDBF 2VITB 4JPWH 3E3QC 5E56A 3DECA 1CFQB 2DL9A 1IM3A 3RVWC 3PWUB 4G42A 3F58H 4Z7QF 2ZOKA 4JFHE 1UWEH 3AS3A 4LLYB 4V1DD 2LTQC 4RFOL 1KCLA 4WW2A 2NXYC 3KPOA 5IBUB 3S5LG 5DEGA 3BPOB 3FCTB 5IVXA 4P2QE 4OCWH 4LSUH 4G80A 4OZHB 5TGBA 1AD0B 4LL9A 2PTUA 2XN9A 2EDWA 4RISL 3BIKA 1FZKA 3MRPA 5AZ2L 3BE1H 3V0VB 1MHCA 2JE8A 1AY1L 3C87A 3ZYOA 1N0XL 3GNML 3ULUC 3MV7E 2J6EH 2FJHB 3ALXA 4PRNB 4MAUH 3GJFB 2Z8WC 3MJGX 5SWSA 3T4YB 3SKNB 5HYIA 1OAQL 3FQRA 3RL2A 4L8DB 2Q3ZA 1RIUL 4NHCL 2WK2A 3W0WE 3SDCC 1BFVH 1EGJA 3C60C 4WFHD 3LKQA 4M93B 1NKRA 1ONQA 3RWFA 3OKNB 4I0KA 3RTQC 4LQ1A 4U6YB 4EXKA 1B0GB 2MWCA 3TV3H 4O2FB 5M95B 3G5ZA 1T03L 5EBMA 5DQJB 1OGAD 3CMOL 4YX2L 3UTTD 1AE6H 5KSBF 3V4PL 5MEND 1ZLWK 3RTQB 2MKLC 3O6MH 3VFTA 2M1KA 4NNPH 4PJ7B 1JGVL 3O41A 1LD9A 1QBLH 1KPRB 3X17A 2I60H 3OAZK 3VH8G 5B3NA 1JP5A 3RBGA 1ZT1A 5DSCB 5HYQA 4HH9A 1T1XB 1TJGH 3LKPA 2JCCA 1DQLL 1GVIA 1WAAE 1MFEL 1RJCA 2CRMA 4NFCA 3AS1A 5MERA 5GS2H 4RZCA 3PIQA 5JO5B 3G08B 1TZHA 3MLSH 1ZT7B 4KI1A 3SJVD 4M1GL 2EDHA 3UJJL 3W9EA 2DTSA 4PBXA 4AYFA 1RZ7L 2G5BA 1NC4A 3GHEH 4PRDB 4XP4L 1EV2E 3WL9A 5LJYH 1OGAE 1LVEA 2EYTB 3S35L 2CUMA 4NQCD 3GI9H 3NFNA 2NXYD 2RQ8A 5I76B 4HKXA 3SGJC 2X1PA 5DK0B 1VA9A 5GHWH 5EORL 3QIWC 3OJDB 1Q72H 3W5NA 1LQSR 2AP2A 4GXUM 4G7VL 4ZNCD 3WHXA 1BREA 2JELL 3CX5J 3OGCA 4WO4B 5JA8B 4LLAA 1Z6JT 3H9YA 4TNVF 3A67L 1OT2A 1FJ1A 4RBPK 2Y9RT 4L8CB 1EZVY 1V3JA 3FB5A 3V6OE 4Y19D 2A6IB 4NQCA 5ADOL 4XPGL 5CJOH 1KJ2L 3GJFH 2NNAA 5KJRL 3DXAA 2XQBL 5CMAB 5BO1L 4L3CA 1U3YA 2CDEA 2AJ3B 2UYLB 1CICA 1DBKH 2Z91A 4ZOCA 5E8NA 1I1FB 3QZWB 4P2CG 2PYFB 4WJ5B 1U3HA 2W91A 5FYJU 3T2NL 1TQBC 2N4IA 5ABDE 1FZOA 1NEUA 2VAAB 3V6ZA 4OGAD 3V4VH 3HZVA 1D9KB 3CLEH 5KVDH 1N8ZB 4J3XA 4DUWA 2CD0A 1OGAB 1H5BC 2NY2B 2GJZB 1NCCL 2HRLA 2C3VA 3DUSB 4RAVB 1ND0A 2GAZA 2PTTB 1DQDL 3O6FB 4GW4B 2XTJB 3EOBB 4Z18A 4HS8L 4JN2A 1AY1H 3PQYE 1GJIA 1NAKL 3BE1L 4M00A 4NFBA 3WKNA 4KJWC 1PDKA 4GRWE 4ELKA 2HKFL 2OTPA 2JKXA 1V8HA 2F8VA 3O6FC 4QHLA 2FHCA 1QSZA 1YJDC 4MYWB 4BQ6A 4GQ9H 4JFEA 4XHQA 5CBEA 1NDGB 1QFWI 4WUUA 4Z7WE 1P4LB 5ID1A 1IM9D 5F7WC 2GQHA 2OBGA 4WU7B 2ADGA 4KGLA 5IESH 5AZEH 5GS0L 3EJYD 3G5VA 2OP4L 4PRHA 4XNMA 4OLXL 1YMHA 2GTWA 2BOCA 4DCQB 2DQTH 4LVEA 2EKJA 2A0LC 1G0DA 1MCOL 2FD6L 5T3ZD 3H3BC 2E9BA 1FDLL 2BZDA 1T20B 4JFQA 5MEOB 3RVTD 3FO1B 4R4BB 3BMWA 3GIZL 4BQ9A 2JTDA 1UFUA 3KPPB 4D8PA 3VG9B 3HE6B 2C9AA 3B5TA 1T83A 3W39B 5CSZA 3QIUA 1MF2H 1QYGH 4JPIA 4PRPE 4FFVD 1LDPL 1WITA 4OCSH 4P9HH 3B9DA 3DRQA 5JNYA 2DAVA 2OQJA 4LDLB 2ORBH 3NTCH 1U92B 4NO5B 3O9WC 3THML 4X6CE 4MMZC 1CIDA 4W81A 4QTIL 3WNLA 2ZG1A 4ZUWB 2XKSA 2F58H 2X44D 5HHVL 4S1DC 3IJHB 1UQSA 1IGIH 1N7ML 3FQXA 1P4BH 1BIHA 2CGRH 3K8MA 5K9OB 1QFPA 1EO8H 4G6KL 5KSBA 4HDIB 1NC2D 3RX8A 5BZWB 4P4KB 4E41B 4PG2A 1E4XH 1DL7L 5DEGB 2DQDL 3ZKMC 5D6DC 4P3CL 4UNTA 4G8IB 1P53A 2MPAH 1OTSC 4NNXB 3MXVL 4YDJA 1BBJA 3FQNB 4GXVH 3UTPE 3IU3A 4YEFA 3RFZC 3QDHA 3JV5A 4ODTL 1W72H 4PV9A 4RX4D 3QUMB 5FCSH 5E0QA 4OF7A 3MNWA 5EOQL 3RKDD 5HHPA 1PKOA 1IGYA 2PYED 5K9JH 2BJML 5DVLA