3THRA

Crystal structure of rat native liver glycine n-methyltransferase complexed with 5-methyltetrahydrofolate monoglutamate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
286
Chain Sequence
VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differences in folate-protein interactions result in differing inhibition of native rat liver and recombinant glycine N-methyltransferase by 5-methyltetrahydrofolate.
pubmed doi rcsb
molecule tags Transferase/transferase inhibitor
molecule keywords Glycine N-methyltransferase
total genus 90
structure length 286
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 3thrA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3thrA02
1QAMA 3P2EA 5U4XA 3FUTA 3SSMA 2HNKA 4ER7A 1JG3A 3I53A 3P9IA 5E8JA 4QPNA 4HGZA 4KIFA 2FRXA 2NXJA 2GLUA 2YXEA 3BXOA 3G8BA 4E30A 3NMUF 1O54A 1TW3A 4PONA 3TFWA 5K03A 4CTJA 1WY7A 1ZG3A 3A25A 3HEMA 1OR8A 5K0FA 1QANA 2F8LA 3UFBA 2PXXA 4H0NA 3RW9A 4QQNA 4ISCA 2ZBQA 1P1CA 4R6XA 4P7KA 3VC2A 4PYJA 5GM1A 5HIKA 5KQSA 2AOXA 3MQ2A 3PLAE 1XDUA 4CKEA 1TW2A 2JHAA 2BH2A 4NECA 5ICGA 3OZRA 1VP9A 2IDJA 5EMMA 5E1OA 2PX8A 4Z2YA 2OXTA 4P58A 5EMLA 4RVDA 5EOVA 4QVKA 5P8WA 5E1BA 3LHDA 2YUIA 1RJEA 3CCFA 2R3SA 3BWBA 1X1BA 3IYLW 5MHTA 5HIJA 5CIYA 3PVCA 4IWNA 5DTQA 3EVEA 5FA5A 5FTWA 2G8NA 3DXZA 4L7VA 4PYKA 2ZIGA 5EIWA 2CWWA 5K0NA 3G5LA 1PJZA 5EEHA 3TOSA 2CMGA 4FGZA 3I9FA 2O07A 3PFGA 3R0QA 3BGVA 3GRZA 4CXMA 3ER8A 2Q41A 4RX1A 3B89A 2FCAA 3SM3A 1KPIA 3HCFA 4Y2HA 1UWVA 3P9CA 3UJ8A 4IV0A 4BLWA 3OFKA 4HH4A 4YV0A 3VSEA 1MHTA 4OA5A 4C05A 4X1OA 3KU1A 5EKXA 5FWAA 2NXCA 3TR6A 3RODA 3R24A 2AVDA 4CWAA 4HGYA 5CVVA 1G55A 3G2QA 4FT2A 5EZQA 4EMSA 5K0BA 2I6GA 3GGDA 5E8RA 5K0LA 2QRVB 2Z6AA 1G8SA 3REOA 3C6MA 4F86A 10MHA 5HOQA 1XXLA 1EIZA 2FPOA 5LQCA 1YFJA 3GRYA 2PV0A 3EVZA 4POOA 4BLVA 4C03A 4EKIA 5DT2A 2PGXA 3OU2A 5EQJB 4XUEA 2PBFA 5GWXA 2ZTHA 3T7TA 1M0EA 4KDRA 4KDCA 5DXJA 5E9WA 2P35A 2CKDA 3NVMB 3UJ7A 3LDUA 5E2BA 2ZSUA 1JG1A 4FP9A 3LCUA 4CTKA 3G7UA 5DPMA 3FPFA 1NW6A 3FZGA 1NKVA 3I5UA 2QYOA 2GPYA 3GRRA 2OB2A 1EG2A 3ERCA 4V0RA 4GUAA 5EKUA 3OCJA 4QTTB 2PX2A 2ZBRA 3UA4A 5DM0A 1HNNA 3KPVA 3OZTA 4GBED 1EAMA 1QAOA 4X41A 2ZW9A 3KQWA 2DULA 3PTAA 4YUZA 5K8VA 2AN3A 3TMAA 1FP2A 3C3YA 3R9XB 1RJFA 2AOTA 3E05A 2JJQA 1ORHA 4JXJA 3TKAA 2IP2A 3CKKA 3KQSA 4ATNA 1XJ5A 1SUIA 1PRYA 1BC5A 2AR0A 1JG2A 4XUDA 5EHIA 5GINE 3FYCA 4GQBA 1B42A 3EPPA 4OX9Y 4C08A 3GIWA 2IH4A 3TQSA 2AS0A 3MTEA 1NT2A 3PB3A 1NE2A 2ADMA 2E5WA 1AF7A 4LWPA 4R05A 3UWPA 4GOMD 2H11A 4MWZA 3TKYA 4U7TB 3UJAA 3KPWA 5LSAA 5FADA 2PSSA 4BLUA 1D2HA 3SMQA 1ZHFA 2QRVA 3M6VA 3ORHA 3KQPA 3KKZA 3DLIA 3P2KA 4AUKA 3E23A 2P8JA 3HCCA 5EVJA 2HR1A 4KW7A 3B3JA 3DR5A 5EC8A 5B1SA 3VC1A 2G70A 1UIRA 2FYTA 5E9JA 4AZWA 4BP3A 5FQOA 4UOEA 3C3PA 3R6TA 4DCMA 1XDZA 3SSNA 1R8YA 4DQ0A 5HFJA 3HVKA 1XTPA 3MERA 4E31A 1MJFA 4V0QA 3LKZA 3LL7A 3GXOA 4LG1A 4F84A 1JSZA 1VL5A 3CJQA 2OY0A 3G8AA 4PINA 3V8VA 3FRHA 1NBIA 1FJXA 2YXDA 5EMJA 5K09A 2LD4A 5KQRA 4PYMA 3TLJA 3EMBA 1SG9A 2O57A 4GOND 5FCDA 4FS8A 4KIGA 3ANXA 3MGGA 5LQJA 2OYRA 5ICCA 5DX1A 3B3GA 3LDGA 3KR0A 1P91A 3M6XA 3BGIA 3HVIA 1ORIA 3NJRA 4QDKA 4YV2A 4YMHA 3B5IA 3DMFA 2Z6UA 1FPQA 1P39A 3OU7A 1YF3A 3M70A 1WS6A 1QAQA 5ICFA 2GA9A 5FQNA 3SR4A 3P9KA 3HM2A 5C9ZA 3B7PA 1SQGA 1O9HA 5K0CA 5DTRA 2I9KA 3FTFA 1JSXA 3ER9A 1M6EX 1VBFA 3ELYA 1R18A 2OBFA 2PWYA 3HA5A 4WXHA 5KVAA 3UA3A 2EJTA 1FP1D 4DMGA 4QVGA 3QV2A 5LQAA 1ZKDA 5DLYA 3BGDA 4PYLA 4B17A 4RTPA 2VZ9A 4QTUB 4LECA 1SVUA 1R00A 3DMGA 3G89A 3JWIA 3G2MA 4C07A 4O29A 1I4WA 3KQTA 5BW4A 5DSXA 3UJ9A 5HZMA 2UYHA 1Z3CA 3FUVA 5EMKA 2A14A 2ZULA 4X63A 1P1BA 1BHJA 3D2LA 1R8XA 3GRVA 5CVDA 3BKWA 3LDFA 3NDJA 3NVKI 2IDKA 3L8DA 4DF3A 4RTQA 4YUWA 2ONZA 3KQVA 5HIIA 3DP7A 1NV9A 4YV1A 2NP7A 3PX3A 1L1EA 3CJTA 4HTFA 5JR3A 2IH5A 2HTEA 2PXCA 3HA3A 5DM2A 3TM4A 4ER3A 1Q0SA 2ORED 3BWCA 4E2WA 4M37A 1DCTA 3UJ6A 2P3QA 5DM1A 3EVGA 4GC9A 3CBGA 1AQIA 2AOVA 3GJYA 5GP1A 2NYUA 1G8AA 2B9EA 4RTNA 5C1IA 3JWJA 5CCXA 4C4AA 4K6MA 2G1PA 2R6ZA 5EG5A 4GF5A 2UYCA 1XCLA 1KPGA 1ZGJA 4KRGA 1VE3A 3HVJA 3EEOA 5F2NA 3SVZA 1N7IA 4RYLA 3LBFA 3TM5A 3MHTA 1WXWA 2I62A 3B3FA 3Q7EA 2NP6A 3NTVA 3THRA 3HCDA 2ONYA 1IXKA 3BWYA 1JR4A 4QDJA 5F2OA 5CVUA 2YVLA 3P97A 1L9KA 4XCXA 2PJDA 2CMHA 2WK1A 1R74A 3EGVA 5EIFA 4QQKA 5CD1A 2NXEA 1NW8A 3UJDA 2B3TA 3NDIA 5GIPE 1I9GA 4BP1A 1RI5A 2GS9A 3OU6A 3E7PA 2H00A 5K01A 3M6WA 4HSGA 5FWDA 2OKCA 5HILA 2B25A 3MCZA 4AX8A 3H2BA 5LQRA 2GB4A 5LQKA 4MHTA 1SQFA 1DUSA 2YQZA 1Q0TA 1X1DA 3PX2A 2WA2A 4AZSA 2XBMA 3SXJA 3FTEA 1N7JA 2N47A 2ZIFA 4PGHA 4XUCA 3VYWA 2P7HA 1R6AA 5ICEA 4KWCA 2YXLA 3EMDA 5HIMA 1WG8A 3C0KA 3HCEA 2O05A 1VQ1A 4DA4A 2ZWVA 2EG5A 4OBXA 2YR0A 3LBYA 4RVGA 4YUYA 3LECA 1INLA 3P9NA 4DZRA 1XDSA 2PXAA 4OA8A 3GWZA 3AJDA 3GO4A 1YZ3A 5G02A 3EVCA 5KYGA 2PY6A 4LWOA 2DPMA 4RTRA 1ZQ9A 4RTMA 2JHPA 3K6RA 2ZLBA 5CVJA 4F85A 1JQEA 2ZBPA 3EGEA 5DTMA 1EQAA 3IHTA 4CKBA 1TPYA 3DOUA 3P8ZA 2JH8A 3UZUA 3I64A 1YFLA 3I58A 5FHQA 3FTCA 2AOTB 1N2XA 1X1CA 3C6KA 2FK8A 3E8SA 3QOWA 2IFTA 1YUBA 4GOOD 1H1DA 4FSDA 4OBWA 1RI1A 3Q87B 2OB1A 2AZTA 4FT4A 5FHRA 3BT7A 3WSTA 3QOXA 5E1MA 3DXYA 3KHKA 1D2GA 3HNRA 4OQEA 2AVNA 2VDVE 3EVFA 4X61A 4YUVA 1V39A 3FPJA 5FUBA 5BXYA 2NXNA 2HWKA 3LSTA 3KPYA 4HTFB 2GH1A 2WA1A 4E70A 4RTSA 4DM3A 1RI3A 4DCGA 2ZVJA 1M6YA 1ZGAA 2VS1A 5DX0A 1KIAA 2AOUB 3FUXA 5DM4A 1EJ0A 4EKGA 4A6EA 4GC5A 2ZWAA 5K05A 4RTOA 3CGGA 4EVIA 3BUSA 2PT9A 3S68A 5BP7A 3O31A 3O4FA 2JH9A 3LGAA 1WZNA 4AZVA 4E32A 4OQDA 2VDWA 3TPZA 1JQDA 1X19A 3M33A 2IBSA 4A6DA 4ER0A 2FK7A 2P3OA 4R8RA 5EEGA 5BW5A 4PIMA 5DWQA 4C04A 4PGGA 3T0IA 2PX5A 4M7RA 2OPBA 3KR1A 3OE5A 2AN5A 4HC4A 2ZFUA 5ERGB 4YUXA 2VP3A 1AV6A 2XVMA 1NV8A 5LR6A 4ZTBA 4IKPA 4DKJA 4E2XA 2BR5A 2ZCJA 3ELWA 2VDUE 5D1HA 3A26A 4GEKA 5E9QA 4QPPA 3HCBA 1VP3A 3EGIA 1VIDA 4R6WA 1XVAA 1G6Q1 3KPUA 1JQ3A 3G2PA 3JWGA 4HRAA 4PIPA 3KR9A 3GU3A 3FPHA 5K0JA 5K0EA 4ER6A 1F3LA 1NBHA 1QYRA 3SX0A 2V7EA 3PFHA 1XCJA 2YTZA 2P3LA 3HA7A 1O9GA 3CC8A 3JWHA 4Y30A 5FULA 4FSXA 3U81A 2Z6QA 2V74B 3FYDA 3GCZA 2HMYB 3AWIA 5H02A 3HTXA 2P1DA 3AXTA 2QY6A 5CM2Z 1IY9A 5CCBA 1WXXA 2H1RA 3PS9A 2IIPA 2AOWA 3ELDA 2BR4A 2OZVA 3ID6C 4FZVA 5GOZA 4RV9A 2KW5A 5EPEA 5JUWA 2BR3A 3A4TA 2P41A 5CVEA 1T43A 3ME5A 4E2YA 4PCLA 3CJRA 1G60A 4X60A 5LQUA 3KQYA 2UZ4A 4R8SA 3MCTA 2XYQA 3NWEA 3FUUA 3KR2A 5DX8A 4RVFA 2JHCA 2JG3A 3MAGA 5IKMA 2ZZNA 1UFKA 3RIEA 1BOOA 3DH0A 3FTDA 3O7WA 4GOLD 5E1DA 7MHTA 2HV9A 2FHPA 2PX4A 3KQQA 3HP7A 2C7QA 1U2ZA 2C7RA 4P7JA 4RSRA 5DRYA 3TRKA 5EHGA 1L3IA 2IGTA 2UYOA 2K4MA 2GAFA 2Y1WA 2YX1A 2CL5A 1F38A 1KPHA 2AOUA 5T64A 3T7SA 3LPMA 8MHTA 1Y8CA 3NWBA 3OFJA 4PYIA 2P40A 4E2ZA 2IH2A 3DLCA 3G88A 3X0DA 3HCAA 2B2CA 2ERCA 4PYQA 5DSTA 5D1NA 2EX4A 2QM3A 3KQMA 5EGSA 1NW7A 3M6UA 3DMHA 3SSOA 3OZSA 1L3BA 3A7DA 3AY0A 3R3HA 2ZIEA 3THSA 2XYRA 4PNEA 2P7IA 1EJ6A 4PWYA 3MB5A 2QE6A 3BKXA 5CUQA 2NNWB 5IH3A 3CVOA 3IV6A 1SKMA 1AQJA 5C0OE 2EFJA 3V97A 1VLMA 5LQNA 3GRUA 4P7FA 5KS2A 5K0GA 3G5TA 5E2AA 1G38A 2G71A 1JTFA 3T7RA 5FA8A 2IPXA 4EQZA 3DTNA 4ER5A 1KXZA 1BKYA 5GIOE 4IV8A 3P71T 3FRIA 1KYZA 1HMYA 1KYWA 1FBNA 3A27A 4MQ4A 1D2CA 2PT6A 1RJGA 2BZGA 3UJBA 3OE4A 1RJDA 2B78A 1NW3A 1IM8A 2ZZMA 4RTKA 2O06A 3SGLA 3DXXA 3FPEA 4RWZA 5F2KA 1VPTA 3DULA 2IBTA 9MHTA 2AN4A 5HEKA 1KR5A 5GM2A 3FPGA 5DXAA 1YB2A 4AZTA 3GNLA 5M5BA 2XVAA 3G2OA 1JG4A 2O0LA 2OO3A 3EEYA 4P7GA 2C7OA 1RI2A 3AXSA 5T67A 3GDHA 2PWPA 4RTLA 1DL5A 5EZSA 4M36A 4CKCA 1YZHA 3DUWA 4PYOA 2C7PA 1SUSA 3M4XA 4FR0A 2BM9A 4MTLA 2ZZKA 3EVAA 3PT9A 3BWMA 1JTEA 2ESRA 2I7CA 3FUWA 3OPNA 3P2IA 4RTJA 2BM8A 1KP9A 4G56A 4HG2A 3UBTA 4U7PB 4E33A 3LKDA 2PKWA 1QZZA 3EVBA 3LCCA 3NW9A 4WVLA 3KPJA 1NW5A 4M38A 1I1NA 4BY9E 1KHHA 3HVHA 4C06A 2PLWA 2G72A 3KQOA 1L3CA 2EJUA 4PCAA 2PVCA 4KVZA 4PYNA 4EK9A 4YMGA 3EVDA 5DRTA 3UJCA 2UYQA 3LX6A 5T6BA 3MTIA 3IEIA 3BZBA 3ELUA 2Y1XA 3F4KA 3K0BA 3LCVB 1RI4A 4RVHA 2XYVA 4MIKA 1X1AA 3A7EA
chains in the Genus database with same CATH superfamily
3IKMB 2VG8A 1YB5A 2PMCA 2VJLA 2BZSA 1C3OA 4TMVA 4E88A 3C2QA 1WF6A 4W7IA 4HFNA 2EGHA 1QDEA 3P9IA 1R88A 5GZ6A 3BH7A 3BJZA 4PANA 2WWYA 5DYNA 3HUEA 5H68A 1YS7A 5ITWA 2JZCA 3EIWA 4R2IA 4D8YA 2PXXA 3WHLA 3VM6A 1P61B 4JR2A 3K72B 2HYIC 1MU0A 4QU8A 1RRPA 5YASA 4CKEA 4KHZA 5ED0A 2RE8A 5CB4A 1L7DA 2HD4A 4M9QA 2YNMC 2QTCA 2O8EA 5CCDA 3SJUA 4H7JA 1ZONA 2FF5A 2G04A 3AR8A 3REGA 3ZHCA 4N3NA 5KTNA 4TLCA 1GKKA 2EDCA 1O0BA 5I9BA 3GBSA 5DMHA 5IDVA 1TMOA 3P7MA 3EBLA 5AI8A 3L7IA 4PW0A 2A1UB 3D64A 2WD7A 1GRVA 4OJMX 2Q9BA 4TXHA 1PEKE 1JJBA 3C4VA 4P3YA 3OWOA 3WGGA 3SQWA 1L5SA 4XH9B 2Y2VA 1UT5A 4MDFA 2VXCA 3DXZA 4L7VA 1G1MA 4KR0A 4YAOA 3WQBA 4P4SA 2BTEA 1Z6PA 1OKKD 3GRZA 4XFDA 2OVFA 2P27A 3AILA 3D4OA 4OO3A 2VWQA 2Z5LA 1FOEB 2CK3D 4EVSA 1ZC4A 2FKAA 1J0DA 4K3VA 1ACJA 2C2ZA 1V1RA 3KLNA 1UZAA 3PYLA 2XQIA 2QL6A 1Z4MA 3QELB 3QVXA 3RVLA 3WYGA 1BKSB 1KO8A 2I6SA 3I92A 3IVCA 5D3ZA 2M6KA 3RFFA 2PDAA 3TDMA 3W6UA 3AG5A 2F1HA 3DBOB 1E64A 4LJ7A 5L3SB 2WUWE 3FAKA 3RTAA 3QKUA 3S1AA 1MMFB 1TQ8A 5L6MB 2ATEA 4F86A 4Q7LA 3AERB 4N5DA 3M6AA 4MO2A 5E9AA 1O58A 4FYKA 1X7YB 3FOZA 2AJCA 3L1KA 4K88A 4KJXA 4QYTA 1XE3A 2QU8A 3KXDA 3L7KA 3EFBA 3WY9A 3BICA 3NUGA 2QQEA 3D0OA 1E9BA 4R4JA 2R48A 4RSHA 3VGJA 1KQNA 2Y9MB 5G4KB 1PQWA 1VMEA 2QLJA 4DLAA 3KKQA 4Z2AA 4PHFA 4OQPA 1AO0A 4C3ZA 2GUWA 3KKNA 3RTDA 1G3IA 4ZOQI 2ET6A 2YV3A 2FE1A 3FPFA 1NW6A 3QU9A 4KPEC 4O4LA 1L4BA 5BN1A 3GRRA 4CLRB 2Q6LA 2C0QA 3OX1A 1EAYA 4WACA 5A2GA 2J3LA 4M1QA 3IE1A 2D2IA 1C9KA 1QG6A 3H87A 5DM0A 3ZE9A 4R8VA 5K8IA 4Y2GA 3D0RA 3PBKA 3FYTA 4KO8A 1L5GB 2BDEA 1L8QA 1GWNA 4US0R 4CR8A 4FD2A 4R01A 5ULLA 3E05A 1MOPA 2JFUA 3ETNA 1DXYA 1E9VA 1MPXA 1ORHA 1T13A 1TM5E 3GJ3A 3MIZA 2QROA 4NULA 4IIHA 5JASA 1IZ8A 1BC5A 1JQ5A 3BS4A 3IT0A 3LVRE 5BMOA 1VCHA 4HWGA 2P2NA 5LB4A 1VFNA 3GYGA 4LI3X 2QYHA 4CKWB 1YRQA 5FV7A 1U2DA 1JBQA 4L8YA 2JLYA 1W46A 4MLCA 4Q3KA 4UVIA 3LUJA 4MV9A 4TRNA 5EAIA 1IG3A 1ADCA 2Q5JA 3FLMA 2VHEA 3TQSA 3V8MA 4DT1A 1EBBA 1QYDA 1V41E 2QLFA 3BREA 3M5DA 4FDUA 4AJ9A 5I8PA 1DBIA 3VNUA 1VLJA 4RENA 1JHYA 2FVXA 2HQRA 4OI1A 2AE2A 5DVZA 4IDEA 3AMVA 4ALIA 1G6HA 1WPQA 1MEJA 2PGLA 4ARIA 4GLLA 4ZCTA 4I19A 1S0UA 1Y8RB 2G70A 1W36D 2XJ9A 2QZJA 3PUHA 4W9NC 4DC9A 1XDZA 3AHEA 1VOTA 4RD1A 5IJXA 1N6OA 4DCMA 2ZM5A 3NATA 1H9CA 1O0SA 1OBCA 2PH7A 4KTTE 3WGVA 4OSPA 1EHIA 2V6FA 3OQPA 1WJGA 3CJQA 1C30A 2P2ZA 5MDHA 1DTSA 1ZY2A 4C7OA 2Q6VA 4PSKA 4Q3CA 3W9SA 4C29A 2WYWA 4GOND 2RBEA 3I76A 2QX6A 3SBOA 4LHZA 3S4YA 3T6KA 1XK6A 3L1JA 4DMKA 3RS0A 2W6JD 1QR2A 2RHDA 4M9ZA 4LRQA 1ZRSA 3S28A 4NICA 4FOOA 2X2FA 4TMTA 1YZNA 3ETCA 4GPD1 2DECA 3O8OA 3CEMA 4OX9B 4OL0A 4L0MA 4NJEB 1O4WA 4LNAA 2V5VA 3RVPA 3NHFA 1Q57A 1P39A 1M2GA 1NJ2A 2DT8A 2BZ0A 3HYLA 1SXJE 3O3MB 4RK5A 3GQBB 3INNA 2JA2A 4RF4A 5DTRA 5C9ZA 4AKIA 5LQSA 1FNCA 1PGNA 3VPDA 5DGTA 4KIUA 4LJKA 3PQDA 3TAXA 1NYRA 4JJGA 4LQDA 3FCSB 5FO1A 3CGWA 3RAPR 1C50A 3UA3A 4B6QA 4EL5A 3TNYA 1QYCA 1VA5A 4KODA 5LA6F 2HHJA 2BZ1A 4TLDA 4CT0A 1WLYA 3RT9A 1E6WA 4ERXA 3QU5A 2H06A 3BMOA 4BMOB 1AGNA 1GZ5A 4IO0A 2Y1OA 5FJIA 3DVQX 3HY3A 4N3CA 2GAAA 2OHXA 3U4QB 1XP5A 3HJAA 1RRKA 1B1AA 4Y0VA 1BO6A 2RKWA 1NJ8A 4RXMA 2Y1KA 4WLEA 4Y6RA 3E3NA 4CDGA 2PLAA 4INOA 4ZT4A 5I9SA 1SVOA 2RH4A 2RHLA 5CVDA 1Y6ZA 3BKWA 3LDFA 3R7BA 1ONOA 3CY6A 1BS9A 1Q11A 4BZQA 2YYSA 4INPA 1BGWA 2X1LA 1SBHA 4YV1A 1XA0A 5E7MA 3PX3A 3T9BA 4Q9LA 4EB3A 5JCPA 1EIWA 3NIFB 2FX5A 2I1QA 4WXEA 3M6MD 3NAGA 4M37A 3TIXB 1PAUA 2P3QA 3ZKAA 3EX7C 3AZQA 2MCFA 1QIHA 2QX4A 3EWAA 2VTBA 3UW3A 3N7TA 4LOJA 3DOIA 5G1NA 3TXXA 2AFIE 4YI3A 4RTNA 4O2RA 1KAOA 1XNJA 3P0EA 4QAJA 2EERA 4DA9A 4EITA 1OY1A 1IAVA 3Q85A 3A1SA 3HG7A 2HHHB 4G26A 2VJQA 3R0ZA 2I62A 4KNWA 2P77A 1I3NA 3FCCA 2J0UB 4Q21A 4GS5A 2EKQA 2ZE8A 3DWFA 3IX7A 3BWYA 2IVZA 4BJ1A 3V7UA 1EFUA 1SXHA 2AFVA 3AF1A 1FCJA 2Q2NA 3VUEA 3CKMA 2EC5A 4UUNA 2JDIA 4LC1A 2JLUA 3IEVA 5GPBA 4JELA 4W82A 1NL3A 1Z5ZA 2IV3A 1NUAA 4KQIA 4XD2A 4BMDA 2EFDB 1T0PA 2NXEA 1CDDA 1XZ8A 3CF4A 1ECLA 1YMQA 2F9MA 2VEOA 2ECKA 3OU6A 1WF3A 4HN2A 4QD3A 5HMLA 3EIOA 4OG2A 3T1QA 3THOA 1QZUA 4B3MB 1ILEA 3GRKA 1GUAA 1TO2E 2CLSA 2WT4A 4KJZA 1E0SA 5EQDA 4HO1X 5FP0A 3DAYA 1E1QD 4AZSA 4BRZA 2IY9A 4CIVA 1IRIA 4FFNA 4DJFC 2BGRA 2NYVA 4Y2XA 3DFUA 1U0FA 3L49A 4MRPA 3OP1A 3HVUA 5ICEA 1L7NA 2IHVA 2XX3A 1LVHA 4ESOA 5CM9C 5FL7A 3PUVA 5SY6A 5IH7A 2JVIA 3THWB 1MV5A 3I2GA 2NVBA 1GRRA 2Q2VA 2YR0A 5CMLA 1ACLA 3UGQA 3PUYA 4XTRA 3SK0A 2YFYA 1Y5MA 3V1UA 1EE9A 4YRTA 1WXFA 4HFMA 1X92A 3IALA 5AUQA 4EUKA 2FWRA 2WD7B 3QMPA 5BSWA 5KQGA 2QTVB 5I4BA 4XJSA 3FOBA 4WESA 2R79A 3L06A 2OZKA 4LOLA 5DGIA 1X2EA 2Z4TA 5F9FA 1C7QA 5AIBA 3WWPA 3AQIA 1NNI1 3IO5A 5LQMA 3ENKA 5KOIA 4M2LA 1NMYA 2GILA 3CR3C 3T8YA 2H8KA 1N2XA 3GUCA 5IT5A 2VTVA 1KH2A 4MULA 4QHTA 1DAHA 1WLSA 4OBWA 4TROA 1H1DA 3NMUF 4CMIB 2P1ZA 3FMGA 2O7VA 5TEVA 3DVLA 1OU0A 3DE0X 5B6JA 1OPXA 2P79A 4NZPA 3ZR4B 4BXOA 3ZEAA 4X8HA 1M1YE 3UPTA 2WZQA 3CVJA 1OXKB 4XCVA 2D0PB 1AM4D 1M1UA 3BIOA 1C9YA 1COWD 4QXMA 5FWXA 5CXQA 2B61A 1ZIOA 2VSOA 3KELA 4WNIA 2VQEB 2J9RA 4QJ5A 1CNEA 1FFCA 3DW3X 1P9RA 4ALNA 5LZ9A 4ND7A 4LA4A 1DUVG 3EPLA 2XUFA 3R2JA 3QY0A 1JR3E 1F9EA 4M6WB 3C3DA 4YJ2F 3RUAA 3E2IA 1FRZA 5F52A 4BNMA 2VPIA 4N8EA 5BR7A 2ILVA 2JLQA 4C0SA 2N1BA 4OXRA 3OE7D 4TLEA 3GEBA 3VOSA 1PJRA 1QGUA 5B6IA 3I5XA 4LXQA 1HY3A 2RHBA 4WE3A 3FVQA 1O89A 5DYIA 3TRIA 2IL1A 2WKQA 1AUOA 3GMSA 3KM0A 1K7XB 2R6HA 3BJMA 3W5AA 2MOKA 5JNSA 4A27A 3SJ7A 5BSKA 1Z12A 3NHZA 4XLTA 4IYRA 2E55A 2ONKA 1GXSB 3RUCA 3EZ6A 4HFRA 1MQSA 2Q3MA 2XR1A 1JMYA 2BR5A 2MINB 2O8EB 5LLDA 2X15A 5KWEA 3ROQA 1Z0DA 5CTAA 1SVIA 3BXEA 3GPCA 3O95A 2P2CA 1KMMA 3WMRA 2IXFA 3KWMA 2O14A 2AXEA 2HV8A 5EJ4A 4A7PA 1C3JA 1D4AA 1WCV1 3TS1A 3GU3A 4DLUA 3ZIUA 3GLSA 1NPDA 4IGIA 1FMLA 1IU9A 3TAUA 3ESZA 3F6CA 1MJNA 5A3QA 1E0KA 2M6LA 1HFWA 5KWIA 2G1KA 1KYTA 2V6MA 4NCJA 4HNTA 3EISA 4YQYA 4IDAA 3RYIA 5CX4A 1OVGA 4RFSB 1PR5A 4GBMA 4OQXA 3I9KA 2P1DA 3NTXA 1IRXA 1CUFA 4B83A 4ZD6A 4F11A 4FQ7A 2H1RA 3HV0A 3ELDA 4IUYA 1DDIA 3ZD6A 1SCBA 4KQCA 2BFMA 2NG1A 5TVKA 2V59A 3IVXA 5AOAA 4LW8A 1G60A 3OZGA 3ZHZA 2D8MA 2Q8NA 1QHSA 1J8FA 2YJ4A 3BK7A 3E0XA 4X60A 5F35A 3U1BA 2IEDA 2E4XA 2VJYA 2XYQA 3NWEA 4OP1A 4Q7MB 4YIHA 3KR2A 5LYJF 2PANA 1CE8A 1VLZA 1OLUA 1X7YA 4Y9UA 3FOEC 4YDHB 2ERYA 3SAJA 2CDAA 4Z4IA 1CP3A 1DJPA 3SR3A 3C7DB 3TPFA 4JJAA 3L18A 1EP2B 1MOQA 3CUTA 5F5LA 4CIYA 1RKUA 4MWTA 5EHZA 2A6PA 3HB9A 3I0NA 1KYVA 1T2FA 1D2AA 5IP5A 3T38A 1WO8A 1SBTA 4HMOA 4B33A 4E3ZA 1JPUA 1Z37A 2VF5X 3AJEA 1QH0A 3JR7A 2HIGA 1FSSA 4E2ZA 4KMOA 3ZIDA 3ZTWA 3WO1A 2EQBA 2H1FA 3PRHA 1GTG1 4PAGA 4DA0A 4ZQIA 5D1NA 3HXLA 3IPRA 1ML3A 3ZHXA 2F9FA 3OZSA 4IVRA 5J23A 1Q74A 5CVTA 5EJMA 2A8YA 3TTWA 5ADWA 1IN4A 3PZRA 3GLGA 1VIMA 2JBAA 1DBSA 1GZHB 2IZ1A 4KWTA 4PWYA 3BKXA 3LVFO 3ORFA 3V97A 1CU1A 1PU2A 2A4MA 3MRTA 3S2FA 5CA1A 3R9IA 4BQRA 2OUIA 4XIJA 3AP3A 3T35A 4R2KA 1XZNA 4E11A 3BM5A 3AH8A 3VNQA 1LQ2A 1LDBA 2GHTA 3CUUA 3EF0A 1MB3A 3C4QA 4GMXA 4KQFA 5ALXA 1P4SA 2WM3A 5I9NA 4ZK2A 1MOZA 2MYPA 3WQSB 3KEQA 1HDCA 3EGCA 4L02A 1RJGA 1V37A 3C3WA 2GNOA 5BO5A 2VXYA 3RUHA 2QQ0A 3PUKA 2M1XA 3GJ5A 2O06A 2VJBA 3NX4A 1DPFA 4MLDA 4NXMB 3PQ5A 2AN4A 3OLCX 4MW4A 3AUFA 5BQ3A 4K2AA 4U3JB 4AP9A 4IQGA 4RE5A 3VKHA 3D7KA 2I2BA 3G2OA 2GAIA 2OO3A 3EEYA 1TTPB 4PG7A 1ESZA 4IVPA 4JT9A 2XXAB 2PL5A 2V8BA 1WY5A 4GYJA 3U37A 1Z7WA 5FNZA 1LWNA 2J6HA 1I5RA 3OOWA 4JB2A 2PO5A 3QKRA 4HDAA 1CZKA 3N6XA 2QF7A 3F1LA 2WE8A 2P78A 4RS4A 2X9VA 1C7JA 1EK6A 2GBPA 1ETHA 2KB0A 3S1LA 4URXR 4BC1A 2FVYA 3KQOA 2J9GA 4RLHA 2A7QA 1LLUA 5DHFA 2WIKA 3OF3A 4R2JA 5A5GA 4TVOA 4G1FA 4L27A 4CG3A 1AHNA 4WZAB 1B6SA 4FHFA 3UENA 2VAVA 5CB6A 4XCXA 1KI2A 1V45E 2XYVA 4CVNA 5T41A 4BWYA 1X1AA 3A7EA 2WWIA 5BN3B 1TAUA 2CNWD 1GQQA 2EBUA 3WZ2A 5H3CA 2AQIA 3LKVA 2WVHA 1O7JA 1G20B 4TXLA 3T9DA 3C5CA 1AS0A 1C3XA 4UMFA 1IXZA 5JVDA 1PEAA 2Q6TA 3KVYA 3H3FA 1E2UA 4MW7A 3Q98A 4X94A 5K03A 3OQOA 3MPUA 3N76A 4MAAA 2XD4A 2ZBQA 1IVYA 1NGSA 1P1CA 3BIJA 4NMMA 1U9IA 3CSUA 2Q3LA 4P7KA 4OLHA 4EJSC 1WB9A 1EBUA 1NBME 1OXTA 2PS1A 1FDWA 2IDJA 3UMGA 4ASUD 1CUGA 4FNOA 2Q21A 4BNHA 1NX9A 1AQ6A 1QX4A 5JCJD 3COVA 3N1UA 4GWLA 1BVHA 1GT6A 3AEQA 1E4EB 3OPYA 1XTJA 1BDIA 1XJCA 1JG7A 1Y5LA 3DL0A 3MJVA 4GKBA 1SVLA 1E1KA 3G5AA 4PR3A 3ZV6A 4DQUA 4Q9KA 3ZU3A 1A8IA 1MVOA 3O0TA 5FNVB 1QQAA 2CJPA 2GF9A 2A0FA 4M7WA 4NBLA 1VSQA 2VPYA 2G8NA 3AEQB 2G5PA 3PCRB 5U4QA 3TQOA 3UWDA 1E0AA 1LBHA 1KY5A 1JQJC 2FEAA 4W99A 2I1WA 4FGZA 4OHKA 4ZT5A 3WR5A 4F8JA 2FDCA 2LIVA 3IJRA 2GWHA 3B89A 3SLRA 4I1YA 1LUAA 5SZKB 4IV0A 1Y1LA 4HH4A 3WLJA 2AJDA 2OORA 2ZYHA 3JVUA 3I2FA 3NTQA 4PG4A 2BF4A 5NULA 1G5RA 4ZYYA 2PUTA 2RI6A 2X8JA 4OIFA 1JHMA 1FDIA 1Q5PA 3HB1A 4ARZB 4BECA 2I4LA 4D57A 4TXNA 4BO2A 1CDOA 4ZZ1A 4JI0B 1D4ZA 4UM7A 5DP1A 1UWLA 2HXGA 5HOQA 1CQPA 1D6SA 4M0EA 4M1KA 4YLGA 4B3CA 5JMTA 2V7WA 1FNDA 2FW1A 3B70A 2RAPA 3IR5A 3CEPB 2JIRA 3AG6A 5FEMA 4PBTA 2Y0PA 1VSVA 4NNJA 4F92B 3B13B 2F4VB 1X9IA 3VTAA 1YV9A 1G6OA 1LTKA 1R10A 2PQMA 2JC3A 2WF5A 4QNMA 3WGJA 2TYSB 5ILOA 4P0QB 2HMSA 4E0BA 3RJ5A 4H9GA 1ODTC 1VJTA 3G7UA 1IY8A 4GL2A 4IMIB 2BHSA 1ZCBA 3KD2A 3EGDA 4KO3S 2HLHA 4PLCA 1E94E 1WP4A 1YONA 2NZ2A 1HOTA 1PYDA 1WCWA 3Q2IA 2IYNA 4CQNA 4GYKA 2WYUA 4Y1FA 1Z8DA 2DULA 2I76A 3I73A 4CLHA 1ID8A 3NH9A 5JQWA 3JXEA 1GIAA 1J8MF 3K5IA 1EP9A 1ZX1A 1P8AA 4KYVA 3TKAA 2AWNA 4KWHA 1IUOA 1JH8A 1BH6A 1KI8A 2Z95A 5AQEA 5AXBA 1U1FA 5KIAA 3C6ZA 4PFKA 2OR3A 2FSGA 3OT4A 4Q3LA 3JRNA 3UAXA 1B42A 3LSYA 4KNYA 4XGKA 1GYQA 5EHQA 3UKOA 4ZI7A 4AWXA 3K15A 3ZVKA 1SZJG 4FZRA 1L7BA 4HEA1 3J7TA 4R54A 1A8QA 1I4LD 2XUJA 3BIWA 4MWZA 1T3SA 1S7GA 5FFFA 4I1VA 1GPDG 1D2HA 1QVRA 2UYGA 3M6VA 4LX8A 5CB8A 4E03A 4X1IA 2EW1A 4E5YA 1E61A 2IPMA 3GJ4A 1S2IA 3RB8A 1V5FA 2PD4A 4H4CA 1U2PA 3QUCA 3K9HA 4F60A 4JB3A 1J2RA 1Z22A 2D62A 1FU7A 1KMHB 1LB1B 2ZVDA 1FTWA 4IW3B 4J9UE 4V0QA 2B4QA 4O5AA 3HABA 4QL3A 4E31A 1JSZA 4F84A 3AF5A 3NJ8A 3UT6A 3U7IA 5MF6A 3FRHA 3I9MA 4NX2A 1FJXA 1XEWX 2FPPB 1QOQB 4DXDA 4YP1A 5KQRA 4O3MA 2FOLA 2PIAA 3OZ7A 1Z62A 2F1IA 3R0XA 4IIXA 5JSZB 2O57A 4WIAA 1OI7A 4FS8A 3TN7A 3QX8A 3IMCA 2EOAA 4ENWA 2FQWA 3WOVA 1G21E 1G5QA 5IK2D 1NF9A 1EFVA 2FSIA 2ZVPX 3AY7A 4NFHA 2I7TA 2XQJA 1BFUA 3VR1A 2WW8A 2Q5CA 4RY8A 2AQ8A 4QDKA 1EX1A 3O8BA 2O2CA 1WSWA 3ESCA 3CA8A 1N2CE 2NOAA 3R3ZA 1LU9A 5CIQA 1U5CA 3ZLUA 1DEHA 1UBMS 2GA9A 2QVCA 3SR4A 2WKWA 3AYZB 4GZ6A 3ZWMA 4AS2A 3B7PA 3H1AA 4JEHA 3ZW7A 1QKIA 5AK5A 1SKYE 3PFCA 3ELYA 2HA2A 4JBIA 1QCZA 5FIUA 5KHAA 3UOGA 2XHZA 3ZY6A 4M0LA 4AJ2A 4D6XA 4C0BA 3L3BA 4PC3A 5DLYA 2FR8A 3JARA 1JTVA 4N40A 1T1JA 4G0WA 1PWZA 4IKEA 2P6UA 1PO7A 1T2UA 4PGAA 1YA8A 2CB9A 3DMGA 1NNLA 2GETA 2HPVA 1CUDA 2ZTVA 1G41A 3BMNA 3SICE 3UN1A 5HZMA 4D79A 3DB1A 2XT6A 1R5JA 2A14A 4AJNA 1P1BA 2XEXA 4ZDKA 4YJ2A 1QWSA 1E7YA 4NZ9A 1N7GA 3QNWA 3ZNOA 4AYXA 4JCCA 3O2JA 3ZGXA 3EN0A 2R1VB 4MB6A 2B2XA 3KQVA 1FA9A 5EIBC 5TGZA 1RVDA 1W4RA 5KU7A 2JAXA 3AU8A 2PD6A 1J56A 2PXCA 3ECAA 2BDTA 1BDJA 3OZVA 2R5FA 4FSHA 4JQZA 4E2WA 4UBIA 1G7SA 1ICIA 4AZ3B 1RWBA 2CMKA 2I6QA 3SQLA 3QEAZ 2V0GA 1WULS 4WBSA 1ZW6A 1ZK4A 3D6MA 3ZWKA 2IHNA 1G8AA 3DAOA 1E4VA 1BXRB 1FXUA 2VBCA 4LGYA 1QONA 2AUTA 1EUDB 1LBIA 1KPGA 5KNBA 1VE3A 2EWWA 5F2NA 1XPOA 2P6NA 3P0HA 1BWSA 1WAMA 2YXNA 5HJ7A 3RVKA 4NRDA 4JN6B 4QFMA 1D9ZA 2BYTA 3FKSA 3HCDA 2H9YA 3OJXA 3W2FA 3WWCA 4LMAA 2GN0A 3E1SA 4I9FA 4LGMA 1DO2A 4MP3A 5BOVA 2NO5A 2YVLA 3IPLA 4MO9A 3OSZA 5EZYA 3UATA 1U0LA 5IAEA 1SC9A 5JSFA 1K66A 3QPDA 1TZMA 2G1JA 3A4IA 1NXSA 2H2WA 3T12A 3V1MA 4AIIA 1JVSA 5GJBA 5TEWA 3VOAA 2IU3A 3CHYA 2PMWB 4F72A 3BCSA 1Y6QA 2XYHA 1XD8A 3FYHA 4JQOA 1ZUNA 1PQPA 3A6KA 3C8UA 1GKIA 3F9IA 1M34B 3EFOB 2H1LA 4CM5A 2GZSA 1L7EA 2OHHA 3ED5A 1F0NA 2P9CA 1GPYA 3CMMA 3IV9A 3G8YA 5BSFA 1JYSA 3ZI4A 4L15A 1Z2NX 4KVGA 2NO4A 1JBEA 2JFVA 4PGHA 2M2IA 4XGIA 1ZJ5A 1M1NB 2OZEA 4DLNA 5JADA 4NYJQ 3GPLA 3MQFA 2OUKA 2YXLA 3H17A 4ZP1A 4LF4B 3QU4A 3ZZUA 3HCEA 3L79A 3PHCA 2N1MA 4DA4A 4OBXA 1R12A 4YPOA 4WBNA 5JH7B 4LXGA 5COAA 3SQNA 3TW8B 3H83A 1AMNA 2AHOA 5H16A 1OFHA 2ZB3A 3EWSA 3PIRA 4RF3A 3WWEA 2HC9A 3HBJA 3PVZA 3QP9A 1YOVA 2GK3A 3K2QA 1ZQ9A 3JYNA 3OWHA 3UOAB 4QC2A 3X1WA 2ZLBA 2NUAA 5CW1A 1UJ5A 4X8MA 4IWXA 1RKBA 3QNMA 4ZA2A 4ZVKA 2Z9BA 1GQRA 3OTGA 4GQAA 1KK3A 4CM6A 4MYCA 2JH8A 1Y7IA 4F4DA 5BRAA 2EFYA 1XQVA 1SUEA 3BL8A 3C6KA 3OIGA 3W3AD 2O8FA 4W9MC 4MI1A 1BW9A 1EXWA 5C1BA 1GD1O 1RI1A 4TSRA 5TQ2A 4WBXC 4LPSA 4MI3A 3JQ9C 3V1TC 3I9NA 2GZ3A 3H2SA 4YV0A 3M1LA 2IS4A 2W0SA 2W48A 1OGJA 3KUDA 5EP1A 4CU5A 1T0IA 4W6QA 5JJKA 1UAYA 3NHMA 4BUZA 4EF6A 2IK8A 4KN9S 1Q7EA 1YZTA 5CBPA 5INTA 5EI5A 3OICA 5HQ3B 3OFSA 2C57A 2FSPA 1W0KA 1ZGAA 1VKZA 3O1JC 1AZLA 4I3GA 5G53C 5CLJA 3FWZA 2J09A 2ZG6A 3FYUC 2VDQB 3BMCA 4Q3BA 3EEFA 5AKLA 2GZ1A 4F3KA 2P68A 4OHPA 2A88A 4K9RA 3SEZA 1DWUA 2QORA 3A4YA 3IVAA 3QYAA 4NFYA 2W8ZA 3IQHX 4R1NA 2WF6A 3K9GA 2QTHA 5EKSA 4F9EA 1P7ZA 1C0KA 1N0UA 3LGAA 2Q0QA 4WT7A 2V7QA 3OM0A 1Z88A 3DHYA 2VDWA 3HI4A 3NASA 4L0QA 4OQDA 3IKTA 4CRWB 2Q2WA 3MZ0A 4QYXA 4V1CB 2V5AA 3ABSB 3K2EA 2QTBA 3HU5A 1EB8A 3CEHA 1DEAA 1UZUA 1ZK3A 4M55A 1I36A 4LBZA 1OIXA 3AINA 4ND8A 3TWOA 5J4VA 1BFDA 2D3TA 1DMRA 1Z7GA 2X77A 3HZOA 3LNCA 4IUDS 3LZDA 4HX5A 4Y1GA 5JS7A 1PZXA 4Q15A 3ORSA 5CGZA 4ZDJA 2M9MA 3N7UA 1NKSA 2C04A 3VKFA 1M2NA 3CZMA 1MORA 2JI6A 4LHYA 2DT5A 3AY6A 3RKRA 1TD1A 4DLYA 2RH8A 1LKZA 5KJCA 5M34A 4HDNB 5G3YA 4BV3A 3W4KA 4B44A 5EXDA 5LLSA 4MP6A 4JBGA 3T3IA 2I4TA 1F3LA 1HQYE 2YJ3A 3DE3X 2RGAA 5EL0A 5AJZA 1GFSA 3SM9A 5BVGB 3FYUA 1IBLB 4GKKB 4YRFA 4EDFA 1E2KA 4PC1A 5A4KA 1O9GA 1YR8A 3GLFA 5DIFA 2FFRA 1M6HA 1TO1E 3I9V1 4W1PA 5ALRA 4BE4A 5JDIA 1X13A 1XZKA 5G0VA 3A9UA 3C8DA 3AXTA 3LA6A 5B3JC 1SXJB 1GSAA 3OX2A 3L1IA 3NEYA 3PS9A 3ZWVA 5KNDA 4GGOA 1EHYA 1YL7A 4LXTA 3FRJA 5GOZA 4HLUA 4FGWA 4J94A 3BTSA 5DMXA 1XCOA 5A06A 2OCXA 2BL4A 1SQSA 5L3ZA 1P77A 1UMDA 3QIAA 5AIAA 4EHJA 1X70A 1QVZA 4M1MA 2ATVA 3VMFA 7GPBA 2IHYA 1EG7A 1H8HD 3EDOA 2X0JA 3MSXA 5ALIA 3LBNA 2WJIA 3IUYA 5EHXA 1IXYA 4YT2A 3HYTA 1ZSYA 4QHSA 2K7ZA 5REQB 3G7NA 1KJ8A 2VHYA 2ZI5A 2I5PO 4G8DA 5A4FS 3EAQA 5JAPA 4GD3Q 2PLNA 3OIUA 5DCUA 3DGFC 2CL5A 2C4NA 1F38A 4FNMA 4P83A 3T7JA 4AC9A 2OFFA 2K5UA 4OOFA 4XM1A 3WJ1A 1EUYA 2HCJB 1BX0A 1WHTA 3KG2A 3ONVA 3QLUC 5CFOA 3FM9A 5KJEA 5KNBD 1ZN7A 2BBOA 1S3FA 3LC0A 2C31A 2OAQ1 3PYMA 4NSNA 2PUJA 5WRFA 2PNJA 2DU8A 1JAYA 1RBQA 1RYZA 3GLHE 3KQMA 4FCWA 2SCUB 4IJKA 4MYRA 4QQ8A 3ZNPA 4CLRA 3B36A 2FLWA 1PQUA 1USIA 1PFKA 2CXUA 3LLMA 4HQKA 5EYPB 1E3TA 1UJCA 4M8SA 4PNEA 1ZR4A 1UEJA 4PE5B 1Y3DE 3HY4A 1RQXA 3AIOA 3KHUA 3L7CA 3S3TA 2RGCA 1U0NA 2Y68A 4QGHA 4TTAA 4Z9FA 5H3HA 5LZ8A 1PZGA 3EH1A 2FFHA 1FSZA 1ZFNA 4OQYA 1JN0A 1U9JA 3VDXA 4G6ZA 2OCIA 2OD7A 2XNKA 1YJ8A 1MTOA 2J1LA 3LNTA 3O2QB 4TL9A 4I66A 4AJEA 4UFOA 2SICE 4WD3A 1DBPA 2PT6A 1F2TA 2Z57A 4KVAA 4LXHA 3I5AA 4MZXA 5IBRA 4TKVA 1V2HE 3CINA 5ALJA 3RABA 5JANA 4BNDB 1NW3A 3PRJA 5K0SA 1KY3A 1PJLA 2CE2X 3PF8A 4KGDA 4P54A 4AG6A 3RJZA 3CX4A 2F1JA 3K0FB 3R75A 4RABA 3K4PA 2CD7A 2NUPB 4YRKA 2DZDA 1XLTA 3DL7A 1C1HA 3OA2A 5EKTA 3I61A 4NAHA 5DHRA 1NC1A 2CY0A 2OCYC 3UHOA 4NH0A 4M0FA 3GP3A 1P9LA 1XTUA 1YS1X 4HEA6 3PT9A 4ZYVA 4B4WA 2I7CA 3HA2A 3OPNA 3U13A 1BEZA 3AR3A 5FUWA 3Q9LA 1NFQA 1T15A 1MNAA 4WCFA 3EG9B 4ZVPA 1CEYA 3D2CA 3GFBA 3ZJTA 1U28A 2YIVX 3AVVA 2F8TA 1C3OB 1CZRA 3N5CA 1R6VA 2G72A 1FTYA 2C5FA 1GADO 2J0EA 3EOAI 3PFIA 3QQ5A 4EUSA 3B6MA 4YMGA 5MFPA 1NFRA 4R83A 4TT3A 1N2EA 5CRIA 5DRTA 1O94A 4KAAA 3K0SA 1KGDA 3QHPA 4M6WA 2PUCA 3ELUA 1VLQA 4W8OA 3AM5A 4MIKA 4DLPA 4NONA 2GLXA 4B8WA 3GDWA 3BXPA 5DTEA 3WP1B 1BQ4A 3KRTA 2FEXA 1UJ2A 2ZSIA 2WJWA 2NO9A 2V7XA 1NOKA 1Z45A 3GJ6A 3QWIA 2F9LA 1HF3A 3EFOA 4EUEA 2YBDA 4RYDA 3V4ZA 3WDLA 3WNQA 3RADC 5C3UA 2R1ZA 2VN8A 2W4QA 4E5SA 4OMFG 2YWXA 4W5TA 3V2HA 4DR1B 4BV8A 1J0XO 2JRCA 2FU5C 3UFBA 1PNVA 3SBEA 5JALA 2CDCA 1EVIA 3EGXA 1H4VB 1TX4B 4NBVA 2Z4SA 1S8OA 4LC0A 1TW2A 2GCPA 3ZCVA 5L40A 1GRQA 1YMVA 4GI5A 4HV4A 3VU8A 1TOAA 1QYWA 1U4OA 1GO2A 4IDCA 4QREA 4EPRA 1WM1A 1RPAA 3PXEA 1YVDA 4OFBA 3LF1A 5M3BA 1JSRA 5AVXA 2VDMB 3ITKA 4OYRA 2QYSA 3KLPX 3A11A 4E7OA 2HI0A 1WABA 1MEEA 1XR3A 1LPBB 1U2SA 1E4OA 2DC1A 2REXB 2WVAA 4URYR 4FNGA 2A9QA 1IOLA 1FJ2A 3ZD8A 5T4BA 1YJCA 2OFPA 1NM5A 1M1YA 3LPDA 3THXA 1JJFA 2JF0A 4IFEA 1HLPA 3U19A 1G18A 3DVAB 2CJWA 4F5WA 4K6CA 2QTLA 2Q41A 1FRFS 1ZNWA 3OZEA 3NH6A 1JHZA 2GZ2A 1ZGZA 4QATA 3REQA 4JI2B 2C59A 3O84A 2B8WA 3RM3A 2BONA 2PO7A 4C7OB 2HK9A 3N8KA 3KWFA 1KK2A 1Z2PX 1HORA 2J9XB 4HAWA 4TLBA 1UEIA 1N5OX 3DMDA 1IYZA 1TFRA 2JFOA 1SQ5A 3BTVA 3L2OB 4IGKA 1QH8A 3GUHA 5CVVA 4CF5A 4QZVA 4FFBB 4FT2A 2LRHA 4LCEA 5K6AC 4EHFA 1O9BA 4OXKA 4R98A 3GN1A 4LOIA 3SSAA 2PZ8A 2FPOA 4UE2A 3WGHA 3AI1A 5B37A 3IAS1 3DEAA 4MEJA 2BGJA 1XTZA 3AVUA 3O8OB 1YR7A 4RDCA 5ALSA 1Q1AA 3L6RA 3FBGA 2DBQA 4KDRA 4D0SA 1JIUA 2J5XA 3IUMA 3M89A 3P1JA 1L5FA 1FUUA 1NVXQ 2YICA 3CKLA 5HA5A 2B1IA 2JAWA 2HUNA 5E2BA 5ALEA 2FPGB 3V7YA 2G0AA 2GEKA 4ON9A 1RM0A 2X0IA 3OC0A 5CFNA 1XOIA 3KUCA 4I1OA 3GG2A 1NKVA 3O1HB 3VJMA 3N0XA 2ALJA 5D00A 2JLVA 1AB6A 2WILA 3B7GA 4BGUA 5L7YA 8GPBA 3TTTA 1YASA 2GKSA 4D74A 2VQFB 1YVPA 4FGSA 1QAOA 1TEXA 1CVRA 2I91A 3I01A 3PXCX 3MUOA 3MWDA 3SF0A 3M4JA 5JOQA 4RU1A 1G4UR 5TT0A 1Q7RA 4MROA 4UNNA 1N2JA 4PSDA 3SQDA 4JXJA 1EP1B 5BSGA 2YY7A 4WKPA 4JLPA 4UMEA 1PRYA 4XUDA 3F71A 4DY4A 4QPZA 4C6TA 3MMNA 1DBQA 2HA0A 2HJ9A 1VE6A 2XSZA 3KTAA 4NZZA 4C08A 2JJMA 2EL9A 1OZFA 2GK7A 2EYQA 2JGIA 2O2ZA 2WSMA 3IQDB 3MWGA 2VWHA 2H0QA 5LBTA 5BOSA 1ZD4A 4BGIA 2O5VA 2VAXA 4DR5B 3WZLA 2WWTA 2H11A 1O96A 2FOXA 1TNDA 4PAWA 2FPXA 1SXJA 2XXJA 2I4IA 4Y8VA 3IHLA 3KQPA 2WE7A 3CFYA 4ZREA 2RGXA 5ELXA 1M76A 3QUAA 3QUSA 3K6KA 2PLFA 3ANMA 1YBVA 4Y6OA 4ZI3A 4EF5A 1EXDA 1SB9A 2NZ8A 1YB7A 4HEJA 1YRHA 2IU0A 1GGEA 2OPHA 4K9MA 3TZCA 2OBYA 3BVPA 2HR1A 2NU6A 4RIGA 1RZUA 4G4SP 2CV1A 1V9LA 3ZBTA 2AJ8A 3HVKA 5K8TA 3TE6A 1YI1A 4R9UC 1OI2A 1UDAA 1KI6B 4L76A 3DEYX 4NFSA 4BOYA 3LO5A 5A9SB 1E8NA 3K09C 4XIFA 4QQRA 4FDVA 4HB3A 4EZBA 3R41A 3W6ZA 1SVWA 3L4JA 1R9GA 3BWXA 4I4IA 1TMKA 1BVUA 4GRDA 5BY2A 1BWRA 4DEYA 4EBBA 3HJNA 1YNSA 3DBHB 3GH1A 5ARBA 5K99A 3C43A 3EBPA 4ZYTA 1WUKS 4M99A 5TV2A 5B1DA 4JAVC 3BGIA 3UK2A 1TU3A 1UMCA 3Q8LA 4Z1MD 1WEHA 3V80A 4LY6A 5HMMA 2ZK7A 4KLAA 2WY2D 2WHQA 4ITVA 1XQWA 3DR3A 1U8XX 1ZP6A 3KEOA 2G9RA 5LMZA 3LLUA 3H5TA 1EU1A 1ZM9A 1LJLA 3JAWB 2RGBA 1UBFA 3F2VA 1I2AA 1M6VB 2VPXA 1OXVA 1WNTA 2IGBA 3DO8A 3OCCA 1X7ZA 3R3SA 3DBVO 1GPWB 2OBFA 3MMZA 4HLUC 4WXHA 4ZOAA 2E37A 3GLFE 3LQ1A 1JHVA 3KTDA 3T5CA 4BLRA 1B0AA 2R8PA 2OG1A 1FE8A 2W5UA 3DQQA 4KH1A 3SYNA 4L5CA 1DQRA 1N2SA 1VLLA 1CY0A 3H3JA 4ND6A 4NKRA 3L8GA 3U44A 3OJLA 4ZU1X 4BJHB 5KSYA 3C98A 3OT5A 4WRRA 1UP6A 1P75A 2HXSA 2X19A 3FN4A 1X9HA 3JWIA 3LX4A 4O29A 1Z33A 4JLKA 3C41J 5DSXA 5I9TA 2C8VA 1R4AA 2NN3C 1F2TB 1E7SA 4RMHA 4FFOA 1CR6A 1W0JD 1ZMBA 3MGAA 4M98A 5LWQA 3ZGVA 1Z16A 3GEHA 3F97A 1KC3A 2ZJOA 4WKGA 2VTBB 4DCJA 1AUPA 2AE1A 2J3HA 3P2JA 4JOQA 1DC8A 2ACVA 4MRSA 3FA2A 5GADl 5K1ZA 3TINA 2EFHB 3WRYC 1YZUA 3EA0A 4WNAA 2W90A 4N8SA 3GT7A 3IOYA 3RC9A 2HJVA 4ER3A 3KAJA 2QSZA 4PCUA 1CY8A 3GLKA 4ZT2A 2I2WA 1GGNA 5BSTA 5AVVA 1CRPA 1T9HA 4PG5A 4IYJA 3GEIA 4X1KA 4AP5A 4L75A 2BKLA 3TB6A 2BEWA 2W6JA 2B9EA 1L5KA 4YC7A 5JWOA 4OHYA 4FMCB 3CW2A 4PQRA 1US8B 3AFGA 3MW8A 3ZTTA 3ZU6A 1KP3A 4I55A 4M46A 1Y3CE 5BSMA 4ZCRA 1CJSA 1WXWA 3B3FA 3QJGA 2W8BA 1IULA 2QTFA 3G3EA 3KOUA 2MU1A 4QU0A 2NP6A 1QOPB 4QYWA 5BV0A 2XOXA 4Q05A 1Z36A 1SWVA 2MSDB 4OP2A 4RNDB 1OOEA 4EEKA 1R74A 5BSHA 1V4VA 1XSEA 3K1ZA 3CX6A 5GIPE 3L8YA 1E7WA 2MINA 4H6VA 1NI4B 1BRTA 3WNBA 1RYNA 3KJIA 4MKGA 2A5LA 1F0YA 2XH8A 2I3ZA 1Y9EA 3EE6A 3Q1KA 4GXRA 4MPJA 4C2BA 5JZOA 1YCDA 2EIHA 1MAHA 1U81A 3AHCA 2LW7A 3INTA 4Z4HA 5BNTA 3KALA 4UHKA 5AW3A 4X8LA 3O3OB 4C4YA 3IO3A 4XUCA 4DY6A 2PRKA 4ZVSA 5C34B 4Q02A 1DLIA 1DQPA 1FVOA 4BU1A 1HZZA 1WG8A 3A2LA 5GONB 5SYMA 3TZKA 1V9CA 1TI7A 2HRZA 2O05A 4LV8B 4PLZA 1SD5A 4PSCA 4YJKA 5ALDA 3W5JA 4CV3A 2X42A 5DHUA 5LCXA 2F48A 2IE8A 3SIPA 4LFBB 2XUOA 3A9WA 4NZOA 1PW5A 2BFBB 3D7NA 4QBTA 2NTEA 4G0OA 2GJSA 3C3AA 2GM4A 5F73A 4P9NA 5LJIA 4U7GA 4HATA 2H2FA 2DTDA 4MDYA 3VA7A 1QP0A 1BAPA 4ICIA 4WW0A 2CBGA 5ADHA 1TGVA 2QT0A 4U6QA 1JQEA 3EGEA 2RAVA 2C7VA 2C96A 3MJ4A 3VHQA 2HA7A 4MA0A 5CVEA 1M3SA 5GJCA 1RZRA 4DSTA 5LIRA 2DCMA 1EM8A 1N5MA 1OLUB 1XA4A 3E8SA 2Y9PB 2XE4A 3GFPA 3KS9A 2REQB 3MS2A 3G49A 3RTCA 3CLSC 3KB2A 3VKWA 3WLSA 3CNHA 4D81A 1JG6A 3EC7A 5AW6A 4HDMA 1P5FA 1C7RA 1S2MA 4F97A 1FUKA 1E5QA 1TO6A 1WRBA 3EQZA 3HNRA 4ND2A 1QHHA 1P44A 2BI4A 1VBKA 1XZFA 3WVNA 3N39C 1OWLA 2PL9A 3C85A 4OLJA 3L7OA 1ZA1A 3M0EA 5D84A 3E1KA 3RUEA 4OGGA 1KIAA 4B4DA 1NSYA 1WBJB 2VFAA 1R0ZA 4P3KA 1Z2OX 3EUEA 2Y1GA 3E7WA 1KI4A 3FZYA 1YBHA 2LBPA 2IDZA 4MRMA 3H9GA 1G8MA 4CCYA 3A6EA 4K6OA 5DWDA 3K0AA 3R74A 3LOUA 3HYNA 3VSCA 1CG6A 1JB9A 1GDTA 4B0PA 4TS9A 1NXWA 4MWOA 5FT9A 4UMDA 3G9TA 4D41A 5IKPA 3LS2A 1UPFA 2WMDA 1P4AA 4YT4A 1XNRB 4PGGA 3WLPA 3GVIA 3VV2A 5D5HA 1J90A 3H86A 3ZC3A 4AMYA 3LKBA 1CJTC 4B8YA 4B6FA 3HRIA 3RKSA 5PGMA 3UK6A 2ICAA 3KV1A 1J8YF 4CCSA 5I3CA 4J0EA 4B7XA 4XQCA 4L8GA 5ESDA 3UFXA 3V4SA 4LYHA 4C4SA 2XA1A 3RARA 1FUEA 3OTIA 3V4OA 1RLOA 1ZOSA 3NOXA 3PDHA 1XAGA 3DDUA 5H4HA 3KUUA 3ROFA 1QPGA 1PWHA 3W4JA 3VOBA 1H1LA 1QWOA 1UMBB 5TR9A 4EJMA 1ETUA 5LMUB 5DCWA 4U2DA 2ZSHA 3IC5A 4QU5A 1WETA 3GFOA 2NSJA 5EJ9A 1H8ED 1WMEA 3MWJA 4WN9A 3K9CA 1SXGA 2F7SA 1K6IA 4YI5A 1EE2A 3JY6A 3L8EA 3ST7A 3E84A 3RASA 5A6VA 3ROKA 1XZQA 4GVXA 4S1VA 1U0OC 3MWLA 4C89A 4CT5A 1DIAA 1MFPA 2BR4A 1CE8B 3EA4A 3HB4X 2GPTA 1KP2A 1U90A 2QAGA 3ANYB 4X95A 1EWQA 3BA1A 2C8LA 1KZ1A 1W49A 1K06A 3V6LA 4DCSA 4EVRA 4G0YA 3GLUA 1E3MA 1QE0A 1Y8RA 1RQ7A 1AQNA 3C8HA 5CDHA 4TLMB 2IPLA 3I23A 4KQMA 3B82A 5B2ZA 4LJRA 5ALQA 2O1EA 2OKGA 1BCRB 3V1NA 2JHCA 1HUQA 1V7ZA 2NUTB 4B79A 4HQFA 1UFKA 3IP7A 2VHXA 3GUYA 3EXG2 1T2EA 3QVVA 2FWIA 3OX4A 3GN2A 5E1DA 1MC5A 2JFPA 1TTHA 2H7YA 2ZGVA 1JHDA 1U2ZA 1IPEA 4J03A 1HDIA 3P4XA 1NPYA 1J6UA 3HB7A 3K71B 1NDUA 1IEWA 2BLNA 2K4MA 2Y1WA 2AEEA 3DOOA 3KK0A 3OMXA 5FPKA 2H1OA 5C5CA 3ZDBA 3IB6A 2JZOA 5ALNA 4YK7A 3VVCA 1E1CB 4XGQA 5C31A 2P6RA 3A70A 1K8XB 3ZGNA 3ZIAA 5ICSA 3NHYA 5AUOB 2PJUA 1ODJA 4PHTA 4PYQA 3CO0S 4J6EA 1YDHA 4XPIA 1H2FA 1B6RA 2GBIA 5EGSA 5LZ4A 1VI6A 2QJWA 1L3BA 3IAS6 1UXJA 1H6BA 4TVKA 4ZARA 1VHJA 3PWKA 4AN0A 3ZJUA 4Q1BA 1KH3A 5HZHA 5EA2A 3UWOA 4IO1A 2C3YA 3ASYA 1GQFA 1CFJA 1N2CA 4ZVNA 3MWYW 4TMKA 2L2QA 2CJXA 3N8IA 5JMOA 4JR0A 2LV8A 4ODIA 4UW9A 2L18A 4CIXA 3ZDCA 5AYVA 3FCEA 5KPJA 1OYWA 2Q27A 3UXMA 4G81A 1HFEL 1NMQA 2Z4RA 4CV2A 2BBSA 4DDWA 3TQHA 5KKCA 3IP1A 2E4AA 1ES9A 1YKSA 1O6CA 1UQUA 2AC7A 2IZ6A 5T4FA 3SIRA 3FNBA 3G85A 4XJVA 5JY1A 2Z2KA 3OG9A 2H16A 3B9RA 2NAPA 3SYLA 1NOIA 2VH1A 1KJNA 1DPGA 2I2FA 4H60A 1SB8A 1AOXA 2WWRA 4N7MA 5C1PA 3BXXA 2I2AA 1DC3A 4IVNA 4ALMA 4KFUA 3KJGA 3W7VA 1S89A 3JATB 4MV1A 3VZSA 2ES4A 3A4LA 4P34A 3DTVA 1ZQ1A 4E1AA 1P4GA 3H9UA 1U9IC 1ZESA 1OLSA 2MHCA 1SBYA 3P26A 4XYMA 2ZI7A 3DUWA 5LP6F 2BP7B 2P11A 3ORYA 4QE3A 3KL4A 2Y0DA 3N5KA 3FGZA 5EJ5A 4HH1A 1JTEA 2JD1A 1FS5A 3ICOA 4XGNA 5H59A 1PUJA 1H3FA 3L7YA 3RFTA 1I6MA 1L4NA 4REMA 3T5TA 3RQIA 4PRZA 3GVCA 3T3PB 1Y89A 2C3UA 5CH3A 4D8TA 5EWJB 4M38A 1ZN9A 5I45A 3I6QA 3RVNA 3V4PB 4F4IA 3KD3A 3WQHA 4B3TB 3T41A 3D59A 1ULHA 3EG5A 4DUZB 3LX6A 4FYXA 3ZCPA 3JSAA 1IJFA 4H7HA 3ZD7A 1XLUA 3F4KA 1CJUC 2A9PA 4FMDB 1YR2A 2J41A 4I6GA 3GPBA 2CVZA 2FQYA 2WJGA 1QHEA 3HDTA 4HGOA 3K2IA 2W2KB 4PX3A 3EIFA 5HCUA 4FYYA 2P6OA 3L0ZA 4PSAA 4BX0A 3UG6A 4LFAB 4H6PA 3GNQA 1CZHA 3WLLA 2IEGA 1CRZA 1GNVA 3W8RA 4BNDA 3EEIA 4JX9A 4PNZA 3LRTA 3U3RA 4A23A 3RTEA 5HIKA 1AMUA 1B0PA 4LHSA 1RPJA 1DCFA 4OHRA 8ABPA 2ZR9A 3O8LA 3OZRA 1EGAA 3RE1A 1H9AA 1MDBA 2J5BA 1N6HA 1BD3A 3ZHQA 5BN4A 2PGDA 2ASEA 4RHYA 4UXHA 4ZI7B 2AW3A 2Q4RA 3IDZA 1LTQA 3VHLB 2BFAA 5E1BA 2Z8ZA 5TJ9A 1BDMA 1PFWA 2R3SA 1X1BA 2Q3FA 4L95C 4L4YA 2RG1A 3RO7A 3EVNA 5EQFA 3W78A 5MN5A 2PK3A 2V65A 3VDRA 3PVCA 1R0XA 2A84A 2QVYX 2XTAA 3HPQA 3PC6A 4PYKA 1KQGA 2PZFA 1XC7A 1XZPA 2QZPA 3OCUA 2O07A 4BNGA 1PLJA 2LGJA 3M4YA 4MS1A 1C0LA 1ZUWA 2FCAA 3PNMA 2WSLA 2OCLA 3OAAD 4XSGA 5CT5A 2GR9A 2W2XA 5DBGA 5FI5A 1A8UA 3CM0A 4BAUA 4BZXA 3D6HA 1XMOB 6AT1A 1MHTA 1ZLXA 4YRRA 1EHCA 4JI4B 2OCAA 2PCJA 1R0BA 4H0CA 3KU1A 4X1OA 3TLKA 3PWZA 5FWAA 4EUFA 4TTPA 1DZIA 2P5UA 1SU4A 2OAP1 3H2ZA 5JNUA 3WGMA 2E2WA 4IVQA 1DAGA 3UGKA 3W2HA 3KCQA 1VSBA 1U2DC 3FSEA 4PRYA 1O95D 1RIFA 4EMSA 2C0CA 2F1KA 1JR6A 3C6MA 2OILA 3LTEA 10MHA 3TNLA 4FK8A 1V9SA 1SBIA 2FZWA 4FHCA 1KDVA 3R8XA 4C03A 3KEFA 3GW8A 4EKIA 2XTZA 2A1TR 1LEHA 4MV3A 5EQJB 1XNGA 5LJLA 4FW8A 3AEYA 1OVMA 1P3Y1 3EGXB 1ANKA 1CEXA 3NWOA 5E9WA 4COOA 3AEXA 3UJ7A 3O8CA 2AR9A 4MEBA 4ZTUB 4J1NA 3VPAA 3PHGA 1N2BA 1CUWA 4FBLA 3BJRA 3OJEA 4MW0A 4UCQA 1Q22A 1JEDA 2F3TA 2WDZA 4FEGA 4Q00A 2TMYA 2PWAA 1G4HA 4C7VA 4GI1A 4ZOLA 2ZBRA 3QF4A 5B12A 2EBWA 4FZ3A 1LGYA 1M2HA 1S9HA 4A8HA 4RELA 2X8BA 3ZK7A 1PI3A 3T5MA 4DL9A 1VKJA 5AHXA 2J3JA 3KQSA 2CJWB 4HB2A 4M54A 1O6FA 1XJ5A 1ZXXA 1EVEA 2IIQA 1JU4A 4OJKA 1UBOS 1IVSA 4U8HA 3L0SA 2ZYVX 2ACEA 5D3QA 2RGRA 4Q3EA 3HCRA 4TQUS 5F78A 4J0QA 5ITSA 121PA 4AJ1A 3T99A 3VXKA 2V03A 4M8IA 4LWPA 4EY7A 3NHKA 4G1BA 1Q0UA 2VUIB 2QV7A 1ZJ6A 3LIPA 4NXNB 3KPWA 3VTKA 3HV2A 1KFJB 1RWVA 1UBGA 2XAUA 2VJAA 4DSAA 1U7DA 3KKZA 5A3RA 2AG1A 2OO5A 2Z08A 3QX9A 5B1YA 3WA7A 4AB1A 2ZYGA 4FHZA 4MGKR 2VUHB 4DMLA 2DJ5A 3UOWA 2IRWA 3VYUB 4N7RA 3PQ8A 3GEEA 2QRNA 2DKNA 2WHRA 3B3JA 3DR5A 3H11A 1X7XA 4YJHB 5ERXA 2WEKA 5F4ZA 3ZZNA 3DMPA 5CA1F 1HZZC 2C9BA 3CCBA 5GMOA 1IHOA 2JGLA 1VLVA 1N2GA 3ZWDA 3ZWPA 1KAGA 2XMPA 4OXQA 4FYJA 1KVUA 1VIVA 3RRXA 3TVDA 3U4DA 4BB0A 4NNOA 1PV4A 3AI7A 4YAGA 2I1LA 3HS3A 4ZAWA 2I8LA 3DTVD 4IQ8A 5K09A 3H84A 4LIPD 5H9VA 1E9CA 5DNYB 2YOFA 1T6XA 1U5BB 2O1SA 5FCDA 4D9CA 1F4VA 1T9CA 1ZJZA 4YAIA 3UJNA 1JLHA 3TYXA 1W6UA 3QLVA 5HJ2A 4TYMA 3UUFA 3V48A 3WHPA 4A92A 4BX2A 2R6DA 1R0LA 3RSCA 4ALKA 1Z8NA 1C0EA 5LP6C 2JL1A 4JLAA 3HLYA 1WV1A 3NNDA 2A9RA 2C9CA 4QYIB 2ZRQA 1UJNA 5E6UA 2UU9B 3R23A 4IFBA 5CDFA 2O8CB 3FLEA 3HN7A 2RONA 5IDYA 5IJ0B 1TYDE 4WBNB 5JH7A 2JFHA 1QZXA 1KETA 3O8QA 1QG4A 3MWEA 4MR7B 5K3SA 3RU9A 5JAMA 5FBWB 5EJAA 2ZS8A 4L4XA 5IC5A 3U40A 1QIJA 1WHSA 2V3VA 4PYLA 4BMVA 4LF8B 1SEPA 3NPMA 4CG0A 2VO1A 2XITA 2HHCA 3W34A 1WXIA 2NV2B 1G5HA 3CB2A 3G6WA 4O1MA 1PG2A 2FE4A 4LRUA 3QKSB 1EXNA 3OECA 4BKPA 5KBYA 3HJTA 4DSZA 5JAZA 3PD0A 3INRA 4Q01A 4JI7B 3D2LA 4NBWA 4EH1A 2AJLI 3KZNA 3JVDA 5D3MA 2BI7A 3C5WP 1V3VA 2VPPA 4J9VA 4IIUA 3PL1A 4U7HA 4XEHA 3HRKA 4BASA 3IULA 1NV9A 1PR4A 3QWHA 5DNWA 4UBJA 4KRFA 4KVFA 2X4IA 1QQBA 1L1EA 2XWPA 5GQSA 2PBLA 1TEVA 2QDXA 2FZVA 1BS2A 1SOVA 4IJVA 3BWCA 1NATA 3RK4A 3TM4A 4Y3UA 2OBNA 1OH5A 2ZAIA 1XTRA 2UYYA 1U2EA 3LOPA 4GM0A 2FPKA 2FQ1A 1O87A 4RSMA 5LUBA 2DYKA 5ERYA 1E2MA 1QDUA 2HFJA 5JXHA 2FGJA 1P0MA 4EG8A 4WV3A 5CCXA 1XZDA 3FNEA 3AR6A 4MVJH 4RSGA 4QECA 1AGXA 5JS8A 2PTHA 3PSAA 1IZ9A 3WLQA 2FEMA 1M2KA 2UZIR 4N3BA 4RNCA 4F21A 2HSDA 1E5TA 1SEVA 1YUNA 3E4CA 1ENPA 2P0EA 3DEFA 3HZHA 3NHRA 1P7YA 3Q10A 2XCLA 4MVJF 3PFBA 4QWWA 1X1SA 5A4AA 1G98A 2EJVA 1YI0A 2I22A 2V6JA 5JVDF 1AS2A 2IYQA 2VF7A 2W43A 4BQQA 4H1VA 4Z0PA 5FV4A 3GVHA 2JGMA 2JFFA 3BCRA 1E1YA 1NR5A 1Z6YA 2B3TA 2CVQA 4V0KA 3WISA 4TWRA 2FZ4A 4R9RA 2E1RA 2WZDA 2JANA 4D2IA 4D9BA 4CGZA 3GL9A 5K01A 1W5BA 5I5GA 1Q0LA 2RK6A 2J6CA 1WMBA 2VUSA 3CZ9A 4N5NA 4PGMA 4QGAA 5A4MS 2RBGA 4DYDA 1ZGGA 5M29A 2F4NA 2H0RA 4CPDA 4CW7A 1Q0TA 1A71A 1J0CA 3LQ2A 3PCTA 5AKXA 1N7JA 3UTDA 1E9DA 3E8XA 4OPMA 2VP4A 3A0UA 2B7LA 2Y6UA 1P0FA 3U80A 3KEGA 4YRDA 1J22A 1J2UA 4I9UA 3UMFA 3WZMA 4EG7A 2ENWA 1D2RA 2EG5A 1UKVY 1T5SA 4WBNF 3ZE2B 1U2QA 2KMLA 2IHJA 3ETLA 3NIWA 4WNAB 5HE8A 4F4JA 1DGQA 4K81B 5AKHA 4FCVA 4H7PA 2XZPA 5K8CA 1PJ3A 1FEZA 2WU1A 821PA 3AOEA 4FHGA 1K97A 3U0BA 2VPTA 1E32A 2DPMA 2A67A 2PRIA 4GZ5A 1IUNA 4V3BA 5HJ5A 1S8AA 2Y67A 3UJPA 3V5NA 1PGJA 1WKBA 2WKSA 3HQ4O 4WCDA 4BO5A 1AA9A 4KC0A 1FP4A 3Q5DA 3R3XA 4MR9B 5A0FA 1BD4A 3P8ZA 1YQQA 2P9BA 4IL5A 1O96B 4BWFB 1RP7A 3PSHA 4RV5A 3UUEA 4YCNA 4TRRA 4PX9A 2Q28A 3W1EA 1Q6ZA 4ECEA 3EPKA 5KNLA 3WSTA 3QOXA 2V58A 2Q5FA 2BEVA 3AFHA 2NM0A 3OY7A 3LIIA 4NABA 2PN1A 2B0CA 4YROA 4FNAA 3KPYA 4MCJA 3VU3A 4AJ4A 4G0XA 2IUFA 4RTSA 3AKZA 4X84A 2ZJYA 1R2QA 4DCGA 4ZQHA 1M6YA 4ZYWA 2HWUA 4DKXA 5FR1A 2V45A 2AOUB 2R8YA 5EP3A 3CPHA 3I6ZA 3R0VA 3WHIA 3WE7A 4EKGA 1II0A 4TWJA 1FYDA 4OLBA 3HHEA 1CJBA 1SIWA 5AVJA 3ZW9A 4R2XA 1QGED 2C2BA 4X3PA 2X14A 5EYPA 1H4TA 4YCLA 1T2AA 1P17A 3Q4GA 3P2YA 1L8LA 4K9KA 4X85A 2IYLD 4EGAA 2IEIA 4OAQA 1JQDA 3NHPA 3EOZA 3ZV4A 4RGYA 1EZ4A 2P6MA 3OIVA 2X0EA 2WNHA 2XD9A 3CH4B 4WEOA 7ABPA 5E4JA 3SZOA 1JXOA 3H9EO 4UM5A 4QYMA 1TCCA 5DOZA 4DJTA 1NUQA 2DQKA 3SYKA 3RYFB 4O0MA 3A4NA 1AV6A 1OFGA 4R84A 3NNNA 4G5GA 4QDOA 3WQRA 3B6IA 4DRXB 2WF9A 2EW2A 4OU5A 1N32B 1SUCA 2FUCA 5KEIA 3Q6NA 2QUAA 2D8AA 1G6KA 1QF9A 3EYWA 4D8UA 3U48A 4C1BA 3KSZO 2CLLB 4KIJA 3KR9A 1Z3IX 1XCPA 4QM7A 1CF4A 5D5PA 4MA5A 3C45A 5KX5F 1HOXA 1Z39A 3R1IA 4V2UA 1TJPB 5KHLB 4B3SB 2FUKA 3DGEC 1QGDA 2CK3A 3KAKA 3L77A 5KI6A 5IZCC 1LK5A 2BFBA 4ZEMA 4L3WA 4RO0A 4WY2A 3DBRA 4YRMA 3VZDA 4IIDA 3KZCA 4I50F 3DVAA 5IX8A 1R1DA 4UU8A 3GLIE 1PEDA 2HLDD 2W4IA 3SWWA 1GL6A 4YBRA 1OA0A 4JGBA 1ONSA 5KTRA 1U04A 5LYJA 4E6EA 4QXAA 4XSVA 4YJHA 1EUCB 1A8SA 1QV7A 2ZIXB 4DJAA 3E9YA 4IRMA 1QS0A 3MCTA 1G8KA 4KN6A 4K6GA 4Q1AA 4R8SA 4WINA 4UZSA 2IVFA 3FUUA 4TMYA 4YNBA 1EFTA 4GL4A 3WTBA 3BSYA 3T3OA 2XTJA 3A2MA 3ROZA 5HGXA 2EZ9A 2FLVA 1FYEA 3FETA 3FTDA 5CLGA 3TDKA 5FL7D 3HKDA 4AY3A 3JQRA 4ED9A 1ZVJA 1Y6RA 2FTKE 2PZKA 2W6QA 2IGTA 4J7CA 5FEUA 4JVOA 2B7CA 2XVZA 4KDFA 1XTBA 2VQDA 4O2BA 5EMNA 1X0VA 4FZJA 3RAGA 4O8CA 4KQ2A 2XQKA 3O6VA 4KMRA 4BCCA 2QA5A 4PYIA 1K88A 4TL6A 4WXRA 5JYBA 2ZTLA 3L7MA 1DBRA 4F71A 3UKDA 2ERCA 4EHAA 3A9TA 3MF4A 5AW1A 2AEFA 2YRFA 1LDNA 2YWBA 1KAQA 3BF8A 4KXUA 4LF7B 3R5JA 3DMHA 3DV0A 2QN3A 2ZKLA 4X71A 1JA0A 4X1YA 4OKNA 2AFHA 3B1ZA 4XLZA 4F1WA 4MXDA 1LVUA 1A04A 2CLIB 2W6IA 3D3KA 3L41A 4URUR 1UP7A 1B14A 1UPBA 2G07A 1VE1A 3E7XA 1RM5A 1YVEI 5K3AA 4B84A 1GY8A 4QEKA 2G71A 1V35A 4AULA 1N7HA 3HCNA 5BW6B 1CD5A 1YZKA 5CLLA 4FOTA 1COWA 3M5PA 5BV7A 2J3EA 2Q6IA 1ZW1A 4EY3A 1U9ZA 4L74A 3USCS 3CWZA 2H4FA 3NDRA 3F9CA 4DIBA 1U2TA 4Y6GB 4YP9A 4EPXA 4JJ7A 1WUYA 5D3MB 1NUHA 1PG5A 3DXXA 5B53A 2G9NA 4TZ6A 4DR2B 3BTUA 2WWWA 3EF1A 4FS3A 4L4UA 1E7RA 4HFJA 1QHGA 5IBPA 4LZOA 1KGSA 5IM4F 1X7XB 3UV3A 4HDSA 4KDEA 4I9HA 1G9TA 1LLCA 2D5LA 5I8ZA 3VYSB 3F5DA 4BO1A 1PWEA 1R0WA 4Y67A 4MYDA 1IZZA 3DYBA 1OWPA 3N0TA 2IE0A 3QFFA 3H16A 2ZXUA 1SUSA 1TTQB 3HXOA 4CNQA 4DWOA 5HPYB 3VDQA 3OZDA 2AFIB 1RE0A 2ZZKA 3QEJA 1JAXA 3E5RA 1XV5A 2EGUA 4BFUA 2FWNA 2A58A 4N0DA 1ECBA 1FPMA 3OZCA 1UKCA 3UBTA 1SBZA 2NU8B 3VJRA 3ZU2A 1GRNA 1N8KA 4NPAA 4NYIR 3RPEA 2JASA 4MV0A 5EJFA 1PP4A 1KHHA 1RXCA 2IYZA 2YQ5A 4Z4EA 1JKJB 1R4MB 2PVCA 4HN4B 1PD1A 3K9BA 1EDDA 4FUTA 4KN5A 4BMSA 4PZUA 4JGIA 1E62A 1VG0B 3A1UA 4A73A 3ZDYB 1GGVA 2BFFB 1GSOA 3DCYA 5IAAA 2CWDA 4YHHB 5A0VA 2NSDA 2J33A 1RYHA 1RYBA 3TTSA 3GNTA 3ZDZB 3SSMA 1PBTA 2ZU0C 4Z0NA 1W73A 1Z0AA 5TS2A 4D4GA 2DRIA 3OURA 3ZXYA 1K6MA 1ORDA 2LIPA 4I9NA 4YP6A 1ADFA 4XPIB 3EB9A 4FPXA 4R0VA 3E18A 4I4TB 4PONA 4JZYA 4GU5A 1RWWA 3LPAA 3WDMA 5DYGA 1NRIA 3IAHA 3O4IA 3QVMA 3OX3A 1CDZA 1NFFA 1JE0A 3F7TA 4N6NA 4CBVA 5A05A 3PLAE 3PG5A 4X7BA 1BE8A 1S4QA 1V8OA 1FDUA 3FZEA 5FKJA 1ATZA 1FF9A 1XEWY 1AB5A 4WLUA 9LDTA 2QL9A 4G0VA 1I01A 1Q17A 3SI7A 3QVGB 1T36B 1J1IA 4P4TA 2GYVA 3WIEA 3IMFA 5D7BA 5KAMA 3CYFA 5IU6A 4S04A 5LQAA 1XRLA 1GN9A 3MG9A 2ZS9A 2I8AA 3QHQA 3RVBA 3DPSA 5CIYA 3OPXA 4BNZA 3HCOA 5JDIC 3G8CA 5DTQA 3WSWA 2R6CA 2O8BB 4U9IS 3X44A 5EIWA 3RVQA 3PPVA 2QZ9A 2C2HA 2CWWA 2NSHA 4M9UA 2CMGA 2GNPA 1RBMA 3IJPA 3PE3A 3I9LA 4RDXA 1ZMRA 1ZM4A 3E9ZA 4QFCA 4E12A 2X9QA 3IP6A 2HT1A 4DEVA 4DRZA 1A9TA 3HCFA 5KYNA 3P9CA 2K2QB 2R8XA 1AC5A 4P81A 4EM6A 2R8EA 3CEJA 4DM7A 1E6UA 4NCNA 3R7WB 2QR5A 3CEAA 1Z0FA 4WERA 1Z17A 1T5BA 2R7LA 2AVDA 3RODA 4CF6A 3GEGA 3QG5A 2YWCA 4RZXA 2W8BB 3UEOA 4CEIA 3K09A 4KQJA 2AC2A 2CYAA 2ETXA 2GZDA 3EHEA 2QMOA 4HF7A 1UBNA 3PRKE 4EW1A 5J2UB 2DVMA 1DVRA 1P80A 5IVDA 4NEHB 1S3IA 3WWOA 3D4BA 4ZU6X 4CL2A 5ES4B 4CF3A 3JQ9A 1XQYA 5ITZB 2G9UA 4UM9D 1AMOA 1B8NA 5GV7A 4PHCA 3GJSA 3EGDB 3AJRA 1WXEA 5I7WA 4C0QC 4GNKA 4EYEA 2JIZA 1N4AA 4KUEA 4UTXA 3ADKA 4J0DA 1UIMA 1Y1QA 4FXPA 3OZXA 2WWGA 4EY8A 1KFCB 1CNMA 2PAAA 4BN4A 4F2WA 4R1QA 1Z8FA 1LNZA 3DDZX 4GZMA 3RC3A 2GHQA 1OE0A 5IXJA 4JC4A 3AX6A 5TT1A 2E6KA 3CWCA 1T6BY 3GZNB 4B35A 4DPLA 3SLKA 5HW0A 1ZN8A 3OZTA 1FTQA 1ZS9A 1T5LA 1ZI6A 1OFUA 2YZGA 3KQWA 2NPIA 3GFSA 2B1QA 2GUGA 2H3HA 1NAIA 5DB4A 4AKGA 3EPHA 3B9PA 4V24A 4OSEA 1PGOA 4AJOA 4I4TF 4KUHA 2IP2A 1W2WB 2Q0XA 3IS3A 4KKVA 4PG8A 2G1UA 4GP9A 2QT1A 3MTAA 4OOEA 1JG2A 4TKUB 4M60A 3IP3A 4KMSA 4MKZA 3EPPA 1Z5GA 1V5EA 1PKXA 1TAGA 5LLTA 4AL4A 4UUPA 5CDSA 1I1QB 2R1TA 1C7FA 2DHQA 1Z25A 1V6SA 3F6BX 3B1KA 3KJFA 4R51A 4WLNA 4WWHA 3ZWYA 1AS3A 3I2JA 4ENVA 1H4SA 3TKYA 5A04A 1Y9JA 1T3GA 3FIJA 4FI3F 2VRNA 3PC4A 3RJMA 1YU9A 2WICA 3WBFA 1XZAA 3ORHA 1BE0A 4A03A 1M8PA 1RU3A 2VJKA 2YS6A 4K7JA 1YH3A 3JQFC 1OA1A 5JXWA 3D1VA 1JQBA 2A57A 2LVBA 3WLOA 2X1VA 3V1KA 4EDHA 3TUZC 3AV0B 5AKZA 5JATA 3CIOA 3GP5A 3ON5A 4XVQA 5TMPA 1Y34E 1AXGA 1JR3D 5M7EA 1KY4A 2QBYA 2CFIA 3EDRA 3EK2A 3MM4A 3RLIA 3NS7A 1XTPA 4Z4GA 4TS1A 2PMKA 2FP3A 2A78A 4ZPXA 2J4CA 3IR6A 4KFTA 4EJ0A 2J6BA 1V5IA 3G8AA 1QP8A 3WJ2A 4ZEWA 1MRZA 2C5SA 3N86A 4MWDA 4RJTA 4HDOB 4RETA 2PYIA 3M7IA 3Q0TA 4NF2A 3STWA 1PE0A 1EDEA 1QTQA 1XDBA 4WY5A 4N48A 4EMUA 1W34A 2FOIA