3THRA

Crystal structure of rat native liver glycine n-methyltransferase complexed with 5-methyltetrahydrofolate monoglutamate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
286
Chain Sequence
VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differences in folate-protein interactions result in differing inhibition of native rat liver and recombinant glycine N-methyltransferase by 5-methyltetrahydrofolate.
pubmed doi rcsb
molecule tags Transferase/transferase inhibitor
molecule keywords Glycine N-methyltransferase
total genus 90
structure length 286
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 3thrA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3thrA02
3GJYA 2VP3A 4OQDA 3MCTA 3X0DA 2ONYA 3C6MA 5F2NA 5LSAA 2F8LA 1L3IA 1NKVA 3ME5A 5GWXA 4DQ0A 3IYLW 3GDHA 5BW5A 5HIKA 4R8SA 4YUYA 3G2MA 3G2QA 3HCAA 4HG2A 2ZFUA 1QYRA 2Q41A 2QRVB 1NW6A 1UFKA 5FHQA 1ZGJA 4HGZA 3CC8A 4DZRA 5HIMA 5T64A 3AWIA 3LCUA 4GOLD 1JTFA 1O9HA 3E05A 5CVEA 2NYUA 2P40A 4ZTBA 1EIZA 5D1NA 5DRTA 2G72A 4E31A 5EEHA 2QY6A 3DUWA 3OE5A 1WY7A 3AXSA 3S68A 5LQAA 5E2AA 2IDKA 3FPJA 2EX4A 3UJAA 2FCAA 3FRHA 4R05A 2KW5A 2IPXA 1XTPA 2P3LA 3MQ2A 4FS8A 5EQJB 4DF3A 5IKMA 3UJDA 4E2ZA 1L3CA 3LBYA 5CVUA 4EKGA 1ORIA 1F3LA 3EGIA 1G8SA 2JJQA 3A7DA 2OO3A 3FTDA 1H1DA 4GEKA 3SSMA 4C06A 1AQJA 2QE6A 1JQ3A 3KQPA 2C7OA 1I1NA 2VDVE 3M4XA 2P7IA 4PYKA 1NT2A 5E2BA 1ZQ9A 1VBFA 1RI2A 2OYRA 4M38A 5HILA 1JR4A 5FQOA 4RVGA 4F84A 3GNLA 5GM2A 3BWYA 4PYJA 4LECA 5GP1A 3I58A 4RTMA 8MHTA 3CVOA 1XJ5A 1YZ3A 3G89A 4PWYA 1FPQA 2PWYA 4FR0A 1JG1A 4RTJA 5HZMA 1YFJA 3BXOA 3WSTA 4QVGA 3AXTA 3LPMA 2FRXA 3PT9A 5DRYA 4DCMA 3B3GA 3EEOA 2E5WA 3LCVB 4KWCA 4P7KA 1TW2A 4HC4A 5EMLA 3HCDA 5KS2A 4G56A 3B3FA 3HVIA 3KQYA 1YF3A 1ZHFA 3EVGA 3JWJA 4L7VA 1EJ6A 4QPPA 4YV0A 2AVNA 1NW5A 4V0QA 2ZCJA 4RVDA 1KP9A 1HNNA 2NNWB 2PLWA 1G60A 3TQSA 2YXEA 5K03A 1DUSA 4FGZA 2IGTA 1VPTA 3GO4A 3BWCA 5E9QA 5ICCA 2GLUA 4FP9A 3BWMA 5ICGA 1BHJA 2XYQA 5B1SA 1R8XA 3UJ6A 4RTRA 5CUQA 3CBGA 3EVZA 3LKZA 3PTAA 3EMDA 5U4XA 2CMGA 2H11A 3PFGA 4GC5A 3DP7A 2QYOA 4PCLA 3KQMA 4P7FA 5FA8A 4CKCA 2YR0A 5GIPE 1XCJA 1M0EA 4IV0A 3T7TA 3KPVA 1KHHA 3FUTA 3LBFA 5E9WA 5CCBA 4AUKA 2FPOA 1DCTA 1YB2A 5EC8A 4YV2A 2IIPA 2AN4A 2OY0A 3UA3A 1JG4A 2AOTA 1N2XA 4PYIA 3UA4A 4Z2YA 4RYLA 1TW3A 1VP3A 5DTQA 3MCZA 1D2GA 5E8RA 3FPHA 5K0CA 1IM8A 4PYNA 5DM2A 5F2KA 4XUCA 1RI3A 1EJ0A 1XDZA 2O07A 3OU2A 5IH3A 3DMFA 1UIRA 1WS6A 2YXDA 3HA3A 4C04A 4E70A 1R8YA 2OB2A 3TM4A 3FZGA 2AOUB 5DSXA 3BWBA 2PXXA 3C0KA 4EMSA 5CVDA 4GOOD 1KPHA 2CWWA 5FADA 1IY9A 3RIEA 3LDGA 4P7GA 4WXHA 3KR9A 1D2HA 2YUIA 1QZZA 4KDRA 3SXJA 3HCEA 1FBNA 3I53A 3FUUA 3ELWA 1Y8CA 3BT7A 2N47A 3KU1A 4QTUB 5GOZA 3AJDA 3MGGA 5DWQA 3OCJA 3KQOA 2JHAA 1WG8A 4BLVA 4YUWA 5DLYA 2FK8A 5F2OA 2NP7A 5EMJA 2V7EA 3G8BA 1M6YA 4KRGA 3CGGA 1VQ1A 2PVCA 2V74B 3FYDA 2ZW9A 5GINE 5T67A 3TRKA 5C1IA 5CVJA 2PXCA 2AZTA 5HOQA 4AZSA 3A4TA 3HA7A 1NBHA 3GRUA 1Z3CA 1KYWA 2GA9A 2K4MA 2P8JA 3GCZA 4GUAA 2Y1WA 5JR3A 3I64A 1X1BA 2NXJA 1P91A 3GU3A 1MJFA 2DULA 2EJUA 3R9XB 1X19A 2B25A 5DPMA 1UWVA 4PYLA 1X1DA 2HWKA 3HVHA 4HRAA 3TLJA 3MHTA 3UJ8A 2ZWAA 2JH9A 3NWBA 3OU6A 3BGIA 4BLUA 4XCXA 3VYWA 2QRVA 2AOWA 4DCGA 5E1OA 2B78A 4RTKA 3P9IA 3HTXA 3G8AA 5EZQA 1SKMA 2VS1A 3FYCA 4ER6A 1RJGA 2G1PA 1SVUA 2ZZNA 1KXZA 2AOVA 3HVKA 4R6XA 4M36A 4DKJA 3KPJA 4QQKA 3LECA 3FTFA 4YUZA 4CTJA 5LQKA 5EG5A 2ZTHA 1VLMA 5FUBA 3M6XA 3FTCA 3C6KA 2B3TA 3EVAA 4KW7A 5K0NA 5KVAA 3EVDA 2UYQA 5DM0A 3Q7EA 2P35A 4A6EA 3PLAE 1L3BA 3NJRA 4HGYA 3UZUA 1SQGA 3DXXA 2OKCA 2WA2A 1PJZA 3A27A 1JSXA 3HM2A 4HTFB 3KQTA 3V8VA 1JQEA 1XDSA 3P9CA 2JG3A 2WK1A 3SVZA 5DM1A 5FWDA 1AF7A 5HFJA 1G6Q1 3TMAA 3RW9A 2GS9A 3BZBA 5FWAA 3Q87B 3OU7A 2ZLBA 4B17A 1AV6A 2ZWVA 3SX0A 4A6DA 3M6WA 1I4WA 3OZTA 1ZGAA 3EGVA 3VC1A 4QTTB 1B42A 3P9NA 3TR6A 2ORED 2FK7A 2HTEA 2PT9A 3BKXA 3EMBA 4ER5A 3ANXA 3DULA 2OZVA 2BZGA 2VDUE 1NV8A 3H2BA 2H00A 2G8NA 2EJTA 2GH1A 1ZG3A 3HCBA 4BP1A 1RJEA 2BR3A 4LWOA 4C4AA 2IBTA 3HVJA 3OZSA 2ZSUA 5K0GA 3THSA 3SMQA 4IKPA 1NW7A 2VDWA 3KPUA 3CKKA 4R6WA 2PGXA 2PV0A 3G2PA 2O05A 2YXLA 3C3PA 4LG1A 2O57A 4GOMD 4PCAA 3R3HA 4HH4A 3B3JA 4PINA 4RV9A 4C08A 2HV9A 3BUSA 4DM3A 4MWZA 3DXZA 4KVZA 5DSTA 2PJDA 4EQZA 3GRVA 4YMHA 5G02A 5DTRA 2AOTB 1KYZA 4E30A 4R8RA 3THRA 2ZBRA 3FPFA 3ELYA 2GPYA 5ERGB 3M6UA 1N7IA 2HMYB 5BXYA 2UYCA 1JSZA 3B89A 4X41A 2BR4A 2XYVA 3UBTA 5KQRA 1DL5A 2JHCA 3M70A 1F38A 1FJXA 3SR4A 1R6AA 5EEGA 5C0OE 5MHTA 2H1RA 2NXCA 2P41A 9MHTA 4AZVA 1SG9A 4XUDA 5DTMA 3T7RA 5FQNA 3B7PA 3PB3A 1O54A 3EVEA 1Q0SA 2BM9A 5DM4A 1G55A 2OB1A 4RTPA 3DLIA 3CJTA 2GB4A 1G8AA 2ESRA 3BGDA 3G5TA 1L1EA 4RVFA 2C7PA 2IBSA 3HEMA 1NW3A 1VIDA 3D2LA 3QOXA 4BLWA 4UOEA 2R6ZA 5T6BA 3NVMB 5LQCA 2Z6UA 1NE2A 2DPMA 2QM3A 3KQSA 3P9KA 3FTEA 4JXJA 4CWAA 4CKBA 2NP6A 3AY0A 2CKDA 1R00A 5H02A 1ZKDA 4ISCA 4IV8A 5DX8A 5HIIA 3U81A 5DXJA 2NXEA 2PX2A 3T7SA 3EVCA 3ELDA 2Z6AA 1T43A 3K0BA 2AVDA 4QDJA 3I5UA 4CKEA 4NECA 2ZIFA 2G71A 2XVAA 1X1AA 5CM2Z 5D1HA 1KIAA 5P8WA 5FTWA 3ORHA 5E8JA 4PYOA 3VSEA 2CL5A 3DTNA 1XXLA 3UJ7A 1RJFA 3P8ZA 3UJCA 3G7UA 4K6MA 2PSSA 3OFJA 5EGSA 3TPZA 3A7EA 4FSXA 5EOVA 5EZSA 5E1BA 5JUWA 3JWGA 3E8SA 1D2CA 3DLCA 5ICFA 3E7PA 3ER9A 1U2ZA 5K0BA 5EHIA 5ICEA 5LR6A 4PGGA 4MHTA 2JHPA 2NXNA 2PXAA 3MAGA 3OE4A 7MHTA 4KIFA 3NTVA 1V39A 4RWZA 2P3QA 4RVHA 5EKUA 5LQJA 2BH2A 2EFJA 2PT6A 3C3YA 1BKYA 3G88A 4PIMA 2UZ4A 1R74A 1YUBA 3A26A 3OFKA 5EMMA 2XVMA 3V97A 1JQDA 3GGDA 4GQBA 3GRRA 4X1OA 4X63A 3TOSA 3KR2A 4MTLA 4QDKA 4ER7A 1QAOA 4OA8A 5LQNA 2ZZKA 4KDCA 5HEKA 1SUIA 4EVIA 3MTEA 3P2IA 4PNEA 4C07A 3R6TA 3K6RA 2OXTA 3G2OA 3TM5A 3QOWA 5EMKA 3TKAA 4WVLA 5CD1A 4RTOA 3NDJA 3RODA 1WXWA 3PX3A 1BOOA 4O29A 4BP3A 4ER0A 4RTQA 1HMYA 2AR0A 2IH5A 3LX6A 4GF5A 3MTIA 3ER8A 3VC2A 1XCLA 4MIKA 1XVAA 3CCFA 3A25A 3HA5A 5HIJA 3T0IA 4CXMA 3LHDA 1IXKA 3IHTA 3UWPA 5K05A 1QANA 1L9KA 5E1DA 4FT2A 4OA5A 1WZNA 2CMHA 1RI4A 2ZVJA 5GM1A 5K09A 3LGAA 2C7RA 4YUXA 2Y1XA 2AOXA 4ER3A 1EQAA 5EKXA 5FA5A 1I9GA 2BR5A 2P1DA 5K0LA 5BW4A 2P3OA 4QQNA 5DXAA 1OR8A 4LWPA 1AQIA 3MERA 2B9EA 3OPNA 2PX8A 3FPGA 4PYQA 3EVFA 1R18A 2YX1A 2VZ9A 4YV1A 4MQ4A 4HSGA 3PX2A 4XUEA 3LDFA 3KR1A 4GC9A 2ADMA 4YMGA 5CCXA 4ATNA 1SUSA 3SM3A 2YQZA 5FULA 3O7WA 4C03A 3NVKI 2ZIEA 1M6EX 3SSNA 4DA4A 4KIGA 4PYMA 4BY9E 5K8VA 3FUXA 2AS0A 2PX4A 1PRYA 1P39A 1NBIA 2FYTA 5EVJA 2YTZA 2ONZA 1P1BA 4IWNA 3M6VA 2AN5A 5K01A 3P97A 3DH0A 3NMUF 2P7HA 3BKWA 2PKWA 4RTSA 4FZVA 3GIWA 4C05A 5EIFA 1RJDA 3EPPA 5CIYA 3SSOA 1VL5A 4X60A 1RI5A 1KR5A 4HTFA 2IH2A 1YFLA 2O06A 3REOA 3O31A 4AZWA 1JG3A 3HNRA 4RSRA 3P71T 4YUVA 3SGLA 4GBED 4Y2HA 3IEIA 3NWEA 2WA1A 4GOND 4E2YA 5K0JA 1VP9A 4U7TB 3LSTA 3UJBA 2R3SA 4EKIA 3P2KA 3OZRA 1NW8A 2PBFA 3JWHA 4E32A 3FUVA 5LQUA 4DMGA 5FHRA 4F85A 3E23A 3B5IA 3BGVA 3ID6C 2IDJA 2ZIGA 3KQQA 3KQWA 1QAQA 3LDUA 5FCDA 3FPEA 3FUWA 5DX0A 2PWPA 2YVLA 5EHGA 2BM8A 2OBFA 3HP7A 1G38A 2ZZMA 3R0QA 1VE3A 4E2WA 3NW9A 5BP7A 1Q0TA 2ZBPA 1RI1A 4PONA 5KQSA 1BC5A 5E1MA 3CJQA 4AZTA 1EG2A 4RX1A 3GXOA 1N7JA 3CJRA 3KR0A 4X61A 2O0LA 3DXYA 3KQVA 2I6GA 2I7CA 4H0NA 1XDUA 3JWIA 4FT4A 4P58A 3GWZA 2FHPA 2GAFA 3EVBA 4QPNA 5DX1A 4RTLA 3FRIA 3DR5A 3GRZA 1FP2A 1QAMA 2IP2A 1KPIA 4E2XA 4OX9Y 2ZBQA 3PS9A 3PVCA 3L8DA 4EK9A 2G70A 2XYRA 2HNKA 2JH8A 4OBWA 5CVVA 3ERCA 3F4KA 3IV6A 4RTNA 1MHTA 4CTKA 3KHKA 3KPWA 3EGEA 5C9ZA 10MHA 3HCCA 3P2EA 3TFWA 3UJ9A 2ZULA 1SQFA 2Z6QA 3M33A 2AN3A 4AX8A 3UFBA 1P1CA 1FP1D 4F86A 5EPEA 2UYOA 2UYHA 2AOUA 2HR1A 3DMGA 3G5LA 5DT2A 3DOUA 3PFHA 4Y30A 5KYGA 5M5BA 1KPGA 2LD4A 3QV2A 1YZHA 3NDIA 5EIWA 2C7QA 3I9FA 4QVKA 3DMHA 5K0EA 3ELUA 4POOA 3EEYA 2A14A 2B2CA 2XBMA 1O9GA 3LL7A 1TPYA 5K0FA 1ORHA 2ERCA 2IH4A 4OQEA 3O4FA 3TKYA 5LQRA 3GRYA 1JG2A 2PY6A 4OBXA 3LKDA 4P7JA 1INLA 2EG5A 3KPYA 3MB5A 2I62A 1EAMA 3HCFA 1X1CA 3R24A 4PIPA 1JTEA 5GIOE 4M37A 4M7RA 1NV9A 4U7PB 2I9KA 4E33A 2OPBA 2IFTA 4PGHA 1WXXA 3LCCA 4V0RA 2PX5A 5E9JA 3KKZA 4FSDA
chains in the Genus database with same CATH superfamily
1HK7A 3FE2A 1DZIA 1QF9A 1TUBA 2J4FA 4QBFA 3RH0A 3M6FA 2ONYA 5LSAA 2XV1A 1PQWA 4FFVA 4JJ7A 5AKHA 5A9SB 1Z74A 3KJGA 3NPAA 3WNCA 3AB8A 1VHJA 2QB5A 4Z0TA 3ZZMA 3LX8A 4Q4HB 3I01M 4CV3A 1LSOA 3IUNA 5FTMA 2VQ6A 4ZZ1A 5J63A 2IXBA 3WMGA 4UUQA 3UMYA 1K63A 2HGZA 4FLMA 2DTXA 1R0ZA 3ASZA 2IC5A 3CX8A 4OI2A 4HKTA 1U4SA 4WXPA 5D1NA 4E1BA 4H77A 2C2KA 1A76A 3HJNA 5EJ5A 1W5BA 5LQAA 3L4SO 4BNLA 2X0FA 2JGEA 3RUDA 5CK4A 3BCSA 1AKWA 4EEXA 1HX7A 1SBTA 3EVNA 2R8YA 3L2OB 3RVPA 4TTIA 1GNQA 1VZ3A 3CGWA 1D4OA 4JBNA 1XTPA 4E4TA 4E5YA 2CFOA 1DFHA 4A8HA 1P18A 3C3XA 2QLFA 3DV0A 4IFIA 4ZOLF 2NNLD 4CKZA 1L3CA 1IWPB 3R4VA 3A2LA 1UZLA 4MV6A 1ZAKA 3EGIA 4LHZA 1XP8A 2ATVA 2XE7A 3JQCA 4Q9AA 5FBZA 3SSMA 1X8XA 2VAWA 2OQRA 3RUCA 1JMVA 1U3FA 1YS4A 4FYJA 2ZR7A 4JC4A 1YDGA 1Z4LA 2CHQA 2VDVE 4RD6A 4TWIA 1ONSA 1GTG1 2HLDA 4Y1FA 1E7YA 3U6KA 4Z4GA 1FJGB 2J3EA 3GRPA 3OTOB 3K70C 2Z3VA 1NUQA 3BX1A 1JMKC 4V3BA 5JFOA 1DAGA 4I4LA 8MHTA 3HKBA 3G0BA 4DLRA 4Z4HA 1GRNA 3CVOA 3IBFA 4XD7D 4OMUA 1FNCA 5CFZA 3L0BA 1S8AA 3SBEA 1IOZA 2WF7A 1CUSA 1OV6A 5CAEA 3FCEA 3GN2A 1M73E 2A0KA 4RLHA 2HF8A 3AXTA 2H1IA 5FUWA 5BSTA 2XHZA 1SUDA 1ZH2A 3B3GA 3U31A 5BURA 3A3YA 4BMZA 2SBTA 1ZN8A 4YMSA 4D5EA 4O5OA 4BYMA 3PGA1 5LVAA 3COYA 1OLXB 4B6PA 2ZE6A 3OE1A 5BSVA 1KAGA 3JQFC 5GTDA 1U3GA 1PFWA 3F98A 2ZJ7A 4O4JB 3EQ8A 2X3FA 1SVNA 3IESA 3GGOA 3QLVA 4LHXA 3T9CA 5E4JA 4EI8A 3GJ0A 3QITA 4FGZA 4ITVA 5JXIA 2QUHA 3U5ZB 1CUZA 2LIVA 1P4HA 5H8WA 1T1GA 5LLSA 3F46A 3MWYW 2AFIE 4ITUA 4B87A 5IJ0A 1F6DA 2C92A 4NZ9A 3VX3A 3AEKA 3AUJB 1T3HA 3PWSA 3P9SA 1RQ2A 2NVUA 2A67A 2WDZA 3JQRA 1G9XA 5ALJA 2OCKA 1B23P 2HHCA 4RCVA 3RVJA 5ARBA 4AUKA 3AX6A 1L5MA 5FJJA 4DR3B 1OGYA 3G0HA 1YMVA 3EHEA 5KSYA 1CXZA 2QTNA 1XCGB 1QRDA 2AK3A 2JFVA 1OW3B 2C5AA 4I46A 3UXHA 4ABTA 2JD1A 5D2CA 4CBVA 2C58A 4FYKA 1NJ1A 4D6XA 1YA6A 1X0XA 3OU2A 5J5CA 4FJ2A 2ZG6A 2Z5LA 1AJEA 1Y1QA 4HQOA 1YRLA 1KWGA 3K53A 1MR3F 5KOHA 3PFWO 2VA8A 3GH1A 4WZAA 2IODA 3BWBA 2GXSA 2JDIA 1VYTA 3C5EA 5EYPB 3ISVA 1R64A 3B9BA 1NXOA 3W5AA 2HUNA 1JR3E 4NJEB 3NATA 5BT8A 7ABPA 2WR8A 3BBPA 4ZAXA 3VO9A 1RHRA 5BSHA 5K0ZA 4R9VA 3M4ZA 1KNXA 4KDRA 2OBXA 1PJ2A 2QRUA 3CG4A 2K87A 5JQGA 4FB5A 1B0AA 4YASA 4PN7A 4OU5A 2QX6A 3W05A 2H63A 5KNBD 4DV1B 4HF7A 2HCFA 4PLYA 2V9CA 3CRQA 3PICA 5DLYA 4B4DA 2Q5OA 3B70A 3JV7A 5F52A 3PKIA 1DJNA 1LTKA 1RZRA 2V96A 2FSVC 4KXWA 1DJOA 1JHYA 2CFIA 3HKCA 2H16A 1W85B 2PFKA 2FB9A 2PGLA 1EHCA 2E55A 3A4TA 3EG9B 3JZMA 1HQDA 2QVGA 4TLCA 4BQSA 2OE2A 3V8EA 1XOIA 3KJZA 1Y3FE 3T3PB 1H2WA 4ARZB 2XUKA 3KBBA 3O94A 4HRAA 3R7AA 1ZJJA 4HDKB 3SAJA 3T3HA 2EP5A 4XCXA 2WUEA 4D46A 1CSEE 1DLJA 3C74A 3KWMA 4JBGA 1U0FA 3TNFA 4F38A 3Q7IA 4G4JA 2CLEB 1XZEA 3EE6A 1HF3A 4H3HB 5F1KA 3WBBA 4A03A 4E46A 1E5TA 2E37A 3CURA 1QVWA 1U3WA 2NQTA 4Q1DA 4MX8A 4YT8A 1JJVA 4ZYXA 1S0UA 2IY7A 4D9IA 5HVNA 1OKKA 2ZS9A 3J7AC 1A88A 1ENOA 1L5YA 3KPJA 2JKZA 1ECBA 1J06A 1OH6A 5G0SA 3B1VA 5LQKA 3I1FA 2BGLA 3N2GA 4JVNA 1JILA 5DP2A 2YYYA 4WKPA 3C6KA 4FQ5A 4D4GA 1ZW1A 2EKDA 3AIIA 3MJRA 2I4MA 5K3DA 2G7MC 3TK1A 1W47A 4F6LA 2ZB2A 1E9CA 3PI6A 3NJRA 5EXPA 4DJ5X 1SQGA 1DARA 3RAGA 5JEDA 2IYSA 4HP8A 4O08A 2HIAA 3AY3A 5BSGA 2OMKA 3GK3A 4O0LA 4R0VA 4Q24A 4BO0A 3ZZNA 5AUOB 1Z17A 1OY1A 3AOGA 3L7CA 5IJZA 2CDCA 2FSPA 3SX2A 2LCIA 2CJXA 5IM4A 1NSFA 3UJHA 4A8PA 4L4UA 1Z6XA 1JMYA 2WU0A 3VR3A 2R5FA 4ZEMA 4PR3A 1RLUA 2FQ1A 2UKDA 4HLCA 4DLXA 2K7FA 2DLDA 3PKZA 2Y6VA 3M3PA 4B5KA 3TR6A 1B42A 3RVOA 4AP6A 5LPNA 2JLWA 3UPTA 3H2BA 1NRWA 1H69A 2JJ1D 3BJEA 5ALHA 5EPOA 4F71A 3SHOA 2A94A 5IEJA 1SCKA 1C7RA 4EZEA 4F72A 1UBSB 1EJ2A 2I6FA 4TWJA 1PFYA 2QXTA 2AX4A 5JJKA 2VBFA 1B8PA 1XNQB 5F2EA 1EUDB 3COSA 4GM4A 1IMJA 3CX4A 3HWWA 5C8YA 2ZKIA 5D85A 4ESHA 2B35A 2A59A 2OR3A 4YMHA 2PJDA 3M4YA 1KK1A 1JEAA 1GARA 4H1TA 5IFLA 3JSXA 2J9ZB 3ECSA 4U7HA 4Y9UA 3PXGA 2VJMB 1NE7A 2Z0MA 3SXUA 3V2UA 2WKPA 5KHLB 2JK1A 2UYCA 3UGJA 5DBFA 3TB6A 5DNCA 1QC5A 1JU3A 2HIHA 3ODGA 5JAPA 1O9BA 5LIRA 1CKEA 4XUGB 4D41A 1EIWA 2EHJA 1U7UA 1F0KA 3QKWA 4B6FA 5JZOA 5MHTA 4LUCA 1QIMA 1TEXA 3T7RA 4AW9A 5JSFA 3PB3A 1ZPDA 2I1WA 1VSTA 4GT1A 2EIXA 3IPXA 2GZDA 4MUXA 4DV2B 2ZETA 4BS9A 1G0OA 2UUBB 1D6MA 1XNJA 4QATA 1JZTA 2ESRA 1E4EA 2O2ZA 1R4ZA 2JZNA 2Q5FA 2HMWA 5LXTA 1K88A 3VR5D 4OHOA 1ZH4A 2G36A 1QO0D 2IZZA 3WQRA 3OI7A 3ZE8A 3L8FA 4IS2A 1QTRA 1SPBS 2MWMA 4ZVOA 2A4MA 2HMSA 1PP4A 3KLMX 4C6TB 4DXAA 3RWBA 1GU7A 3U7RA 1A96A 3Q5EA 4UHKA 2NXEA 4HNRA 1FFAA 1XFDA 4WZ6A 4YI5A 4QJ5A 1ZESA 3PXEA 4D74A 2VHJA 3A37A 4QBIA 4DLYA 4LGMA 2JVJA 1NDUA 1Q16A 1OFUA 2YRFA 4NARA 2PGDA 5DNEA 1X6VA 5JSUA 1T36A 5P8WA 1BMFD 2G5TA 2F6RA 1O97C 3KV1A 1IPHA 3WZLA 5L53A 3PUZA 4PSKA 3UHJA 3JVUA 1XXLA 1BX0A 3UJ7A 2I80A 2W4MA 2FEOA 4PS0A 3T3OA 2ZJAA 1Q6ZA 1XTIA 4C4RA 1D8TA 4PNZA 1KJQA 2H4JA 4KXXA 5KIAA 1QE3A 4ZA2A 2R5NA 5DOVA 1NKTA 4WCFB 3DMYA 3NFYA 1JJFA 1OH8A 3VNRA 2P3QA 5JS8A 3LO5A 5TC4A 2EZ9A 5CW2A 3TIGA 4YH1A 3U7EB 5IJWA 1KA9H 1P3DA 3JPYA 2VEOA 3RFCA 2OUKA 5BQXA 2W2QA 1Y63A 2UZAA 1W94A 2ZIXB 3RIXA 5IANA 1WLSA 4OAPA 2JGJA 3MPOA 1QGOA 2I54A 4KTVE 4HAUA 5AKZA 3GDWA 4AAYA 5A0TA 3LYAA 3E3NA 5TNXA 3I9V1 5ERYA 1FYFA 4MKGA 1R0SA 1RP7A 2GASA 3F6SA 4ZYUA 4WNCA 4BN4A 1TLTA 1GVHA 1NF3A 2IY9A 5KMGB 3M83A 4D4HA 4ER0A 5IVPA 1P60A 5B7QA 1ZICA 1ZAYA 3ZVLA 1L4LA 1LLQA 2W4IA 2WG2A 2XJ9A 4UEJA 4D25A 1QOZA 1RXCA 3KAKA 5IDVA 3E3AA 4AJKA 1W4CA 4AZ3B 4XTRA 4P0QB 3MWDB 5IPFA 4WBNB 3OKPA 1HDIA 1Q2UA 2Q0HA 4OA5A 5AI6A 2V6MA 1XMJA 5D3KA 2JVKA 4YLYA 4BXOA 2P6OA 2W22A 4J0JA 1XRSB 4YMLA 5I4CA 1XPOA 3S8EA 3A1FA 5LP6F 2ZM6B 1WXHA 2HF9A 2ID8A 3N0XA 4P5PA 2Q21A 2WZQA 2X5NA 2I8LA 1SC1A 3URKA 1ND6A 3H3FA 2WABA 1WBDA 1H65A 1D07A 3M6AA 3SM3A 1EUCA 1ODLA 3I6QA 4XIJA 1Q3TA 5FULA 2E4ZA 3BK1A 1W4AA 3R77A 5ECGC 2QVXX 1LV8A 3HB5X 3DDZX 3SSNA 3SVTA 2I29A 4UCXA 4C3ZA 2A0XA 5K5EA 2HA3A 4P3OA 5C8YB 1FUYB 2PZKA 5K3FA 5BYKA 1NVWQ 3N7UA 4MQLA 4UFPA 1VPEA 4LAFA 1JT2A 3JASB 3FBGA 2GN9A 4FMCF 4JEMA 2E4WA 1HTWA 1IHUA 1JHMA 2AEJA 1QH8A 2GBIA 3EPKA 1U2QA 1Z3IX 2CBZA 4BE9A 1GG9A 5I9IA 1R8JA 1SVSA 5JNRA 3NHSA 4WDQA 3GUUA 2GERA 3DEAA 3R5TA 3SS8A 5GOTA 3QUCA 4Y2HA 4Q37A 4QSHA 3UMFA 1J22A 1Y5RA 1ZFNA 3H13A 4RJLA 3DT6A 3GEEA 4W9NA 3SG0A 421PA 4EA8A 2PBFA 1TO1E 4LRSB 2H85A 1DDIA 3R3YA 2CBGA 1DSSG 4F85A 5KJCA 1ECPA 3E23A 1IN5A 4TTRA 4Y6PA 1KEEA 4RENA 2DX7A 3K2BA 5BORA 2ODNA 3FUWA 3Q9LA 4IJVA 3NHKA 4JI7B 3H8VA 2VP5A 2MINB 3Q9NA 3JQGA 1JDVA 1O95D 4JMPA 1MENA 1DQRA 2A0FA 2FG5A 1LLUA 4JGGA 4DLTA 2GKGA 2G1KA 2WLTA 1VC2A 3GR6A 5AW8A 1UXOA 1PIWA 4RACA 1P4GA 1ZMTA 4ZU1X 4X61A 4ENRA 1T4CA 2W2LD 4HRXA 2CLDX 3G2IA 3JWIA 4LOLA 3SIPA 2P6UA 5EKSA 3GRZA 2ZT6A 4EIWA 5KAMA 2XA2A 4DARA 1N34B 1SBHA 4AJJA 3LUKA 1K5GA 2NXWA 2HNKA 3ILSA 4IGIA 2LCQA 4B85A 2OHHA 4HNUA 3IV6A 3LWBA 4NFYA 3DMTA 3V7NA 5JDCA 1TZCA 2VP4A 4GPZA 1JQAA 1DUVG 2X9LA 1ULSA 4N03A 2W6IA 5SZHB 4CQMA 3S1SA 1HH4A 1NX6A 3UFBA 3K94A 3RVNA 4MVJH 1CVLA 1XWIA 3PQ4A 3W9BA 1NFQA 5CM9C 2J46A 4E88A 1L1FA 3BS4A 1DRVA 1KBZA 4LZOA 2OCIA 1N7GA 4O2AA 5I7OA 4IDGA 3E2PA 3U4IA 2UVPA 2VTVA 3CLKA 4GVLA 3C97A 5DYWA 5HF6A 3WRXA 2JI4A 4PXAA 1EXMA 4AMUA 4BMYA 5HX7A 2DJIA 3PP8A 4KO4S 4QVKA 4XB6B 1T4BA 1M1NA 1KRHA 4Y18A 2C4VA 2DUUA 1TADA 2H5JA 2ACKA 4FEEA 3TZLA 2I55A 4YXFA 3A6DA 1U9ZA 1RXUA 1OIVA 1P2FA 4OSOA 3IUPA 3HFRA 2B4KA 5AVKA 1JG2A 3MJVA 3WGJA 4DMCA 2NZJA 5DNVA 1PDVA 3C8DA 4CKBB 4LFBB 1UPBA 4LFAB 2XXAB 4B8ZA 5EJEA 1U0SY 2I9KA 1OIWA 2QJWA 4E33A 4V0RA 4PGHA 4DSOA 3TRIA 2FFRA 4MW6A 3L1HA 1GFWA 3VKGA 2I4NA 1GUFA 2QR3A 2TS1A 3H5RA 2ILVA 4DQ0A 2EZ4A 4EUHA 2FUCA 3GDHA 3LC7O 3RK4A 2REBA 1PZGA 1EUZA 1Y89A 3ZI4A 2ZBVA 2OFWA 1WDKA 3WKEA 4NYJQ 2ZJ6A 4P32A 4N9QA 1II8A 3ZGVA 5HGXA 2QL9A 5IWAB 2R00A 4O59O 1E0SA 4TMWA 1LFAA 2TMGA 3I2IA 1Z25A 3WIUA 3GEPA 5KO2A 2P0AA 3E05A 4UXJA 3ROEA 3NC0C 1XMXA 3H8JA 4JC0A 2C57A 4FMCB 3T0FA 3IULA 4B2LA 4RYDA 4MKHA 1W35A 3G9XA 4BKOA 3JW8A 3KJEA 2B4TO 2JB9A 1C7EA 1YS9A 3DVRX 1U7ZA 4PZDA 3VJMA 4YRZA 4RWEA 3X2FA 1V37A 5GPBA 1PR9A 1SKYB 1XFAA 1IQPA 3A6HA 1QNLA 1O94A 4ALLA 2VCEA 3JQAB 4RV5A 5JLAA 5DNYB 1HE5A 4MV5A 5G1OA 3AP1A 1YKSA 2JIPA 2A92A 4PSDA 1SQ6A 4E2ZA 4I5IA 4R51A 1RRKA 2SCUB 3GNSA 5CVUA 4KSYA 4CQNA 2GPSA 2VPXA 3QKSB 1RWQA 1KZYC 4MKRA 4RY2A 3N2KA 1LDMA 2AJTA 1IEQA 4V39A 5EJ4A 1JBQA 1SHZA 2FG6C 3KQPA 4OGLA 2EEZA 2V97A 5BOSA 4PC3A 1GTL1 1NT2A 2MYNA 1UDRA 4S2UA 1NXQA 2OPHA 1KDPA 3RFXA 4AN4A 4FCWA 5AVTA 1J25A 4OYYA 1JKXA 4Z9BA 3GNLA 5ADUS 1DQPA 1UJ5A 3AF5A 4XAQA 1GQOA 1GL3A 1HA3A 2HJHA 2XVYA 4J0FA 3IELA 4LQDA 3MTJA 1VHTA 1Y5NA 2ZSDA 1L0BA 1WR8A 3IJRA 3S29A 1I7QB 3VU8A 2GHRA 1I4LD 4D96A 1A9YA 2ZRDA 2ZKLA 4OVKA 4JKYA 2HWWA 3HDHA 4CM4B 3O4RA 3SDSA 2V45A 3WJ7A 2RGRA 4RPCA 3RARA 3B3FA 3AH8A 2OWDA 4IRMA 5GV7A 3THYA 3QBTA 1ZJYA 2IDMA 3MPUA 1WMSA 5ALYA 4ZXPA 2DFTA 1FDVA 4RZ2A 1AKRA 1QFJA 1RIIA 1RKBA 2GGSA 4TKUA 4JVMA 3UQZA 4YB8A 2O7NA 4CKWA 1CJMA 3DF9A 4CMGA 3I1JA 1V4VA 4Y0AA 2V7XA 2GN2A 2XYQA 1JXQA 3QBDA 3BBLA 4KH1A 3GPLA 1QYVA 3DE6X 2FFBA 1FFEA 1UPTA 2H9AA 4MVJA 1E8MA 2EP8A 2VT7A 1Z18A 2CF5A 2QZ9A 3W1WA 4ZOLB 5BOSB 3GFVA 1LS6A 3KCNA 2YR0A 3MFYA 3FDFA 2BW0A 4LRTB 1OLOA 3Q6MA 3W4IA 1I0IA 2AKAB 3TNDA 4ND2A 2G3YA 4XH9B 4A27A 3JD2A 4N3AA 4MS3B 1W5AA 4NL4H 1MO2A 2AJBA 3H1GA 1JXAA 2WM2A 4H18A 4KFTA 1X87A 4QU8A 3SF8A 1WOMA 3ZTTA 2ZWMA 3DOFA 1XN4A 4XTCS 1O96B 1SQSA 5E7QA 1RI3A 1U0TA 2C96A 3O3NB 3OX4A 4YP1A 1GKUB 2H18A 5A1JA 4DQDA 1P33A 1XTBA 4FYWA 5B1EA 3M1LA 4BQPA 2BN4A 5BMOA 1AIPA 1NVUQ 4KHZA 1DC8A 2G8LA 3FZGA 3UMBA 3G9TA 4X94A 3VDQA 4EMSA 2CXTA 1OX4B 3FPAA 4WK6A 1G9SA 3Q11A 1V43A 4TKVB 4GS5A 5CVDA 2UZ3A 3C3DA 5AJZA 3HB9A 4QYTA 1P5HA 3ZBPA 4C9BA 4YRKA 4P7GA 1NXVA 3L3BA 2I71A 3U9LA 1Q0QA 2JJMA 4U6SA 1YA8A 2AWNA 3W5UA 1Z0ZA 4BFTA 1UPXA 5G0VA 1XZBA 4M1YA 1JL3A 4UNQA 1CP2A 1Q83A 1FBNA 4JX8A 1Q3HA 1CJBA 2GJ9A 3FSEA 3RUAA 3SFVA 3FAKA 5GOZA 4QTUB 2WWVD 1I80A 4MWTA 4UBIA 4ZU6X 4CDGA 1TYBE 2IYLD 2OGUA 4FDMA 4NY1A 4WOKA 1QTNA 2PMBA 1EDDA 1EM8A 4II3A 4KV7A 2VJAA 1DC6A 1L5OA 2PVCA 3FYDA 4H7EA 4NYIR 4EM6A 3K70B 3MINB 3V1YA 5GINE 3PG5A 5L4LA 1X80B 3BWVA 2FMFA 2BHRA 1KIMA 2FNAA 2FX2A 1FXWF 3Q8LA 3LVBA 4XX1A 5WRFA 2GA9A 2P8JA 5A9SA 3EZ9A 1KTIA 3ICEA 2O5EA 3Q3HA 2FPPB 4L85A 3UAVA 2QSZA 4L2IA 1O6CA 3GU3A 4HK4A 3CCCA 1I6WA 4IEIA 4B43A 4Z4CA 2VOJA 5DPMA 1X1DA 4I19A 1XYYA 2ABWA 1I9CA 3KZKA 3KUCA 4BKPA 1JGTA 1K8XB 1O5IA 1IDN1 1P0PA 2YFHA 1CW2B 1R8SA 1P2VA 1UPAA 2VSOA 5FWNA 3IKJA 2Q8NA 2ZZNA 1T24A 1FNMA 3A28A 4D9JA 4EUKA 2BE9A 3RU2A 2SHKA 3D8TA 1ZD1A 3OZVA 4ZEXA 4M7WA 1XMIA 1K9VF 4AIIA 3GAFA 4MO2A 3IEKA 4QQKA 3STWA 2DC1A 3WLTA 4UQLA 1XI2A 3IEPA 1ETUA 4IGKA 2IUYA 1BEUB 3IERA 1BS9A 4TLLB 2W2MA 2YKGA 1UKCA 1VYVA 4ZQEA 3M6XA 2AR9A 1A8HA 1P77A 1YL7A 2WY2D 5LZ2A 1LBHA 3BB3A 1HQYE 5AKGA 2GETA 1AKQA 1Y33E 2PTGA 2UZ1A 2XUFA 4QQ8A 4ENUA 1ZN7A 3LVQE 4LYFA 1GUYA 4CI0B 3HM2A 3AFMA 1WIWA 2JAHA 2WZBA 3VTAA 4CYMA 2H4WA 3KQTA 5CFNA 1KRXA 3UXEA 1XU4A 3LBAA 5J43A 5K0TA 3LW8A 1OD6A 2Z4RA 1C3VA 1I32A 3C8ZA 3DEIA 4NE9A 3WWEA 1JJAA 3I92A 4GKKB 1UKZA 4D3ZA 5BT9A 4QU9A 1NONA 3K5IA 4I66A 4YDQA 4HOYA 1U2DC 1YZKA 3FYTA 3NWJA 1SN7A 3OKFA 3NHBA 1AS3A 2JIMA 1I3CA 5CT9A 3ZCRA 3DBRA 3NGXA 3CUYA 5FR1A 1ZGAA 1UBFA 3EJWA 1D4AA 3VC1A 3L43A 3WJ1A 5B7NA 3WNBA 5JCPA 5F4ZA 4P2GA 1GSAA 4M3NA 3ZV5A 2C4KA 1GUDA 3AUKA 3TZ6A 4EJFA 5KHOC 1MC5A 1BGVA 2OP0A 1IM2A 2ZUWA 3G82C 5BN4A 4UDOA 3J7TA 1I30A 3VPXA 3BHJA 3IAFA 3L8CA 1IRIA 4N5HX 5HF8A 5TT0A 1R7RA 5LMCA 3WYGA 1M1YB 4GOMD 1ZHOA 4V03A 5DLEA 3LT4A 4L5YA 1QB8A 3QMPA 4MW1A 2J3HA 1O95A 1KDOA 2P4EA 1KJ9A 2PKRA 2H4YA 3PHHA 4YDRA 1VI6A 5HQJA 2UVDA 4IUCS 5A02A 4JI0B 4EHAA 3VHXB 3KZCA 2WTMA 2XQVA 4TS4A 1APBA 3THRA 3RFUA 1RHJA 3AUAA 3GMIA 3VKUA 2WQ7A 3HHPA 4OQXA 3W8FA 5ALUA 1YC5A 4KJXA 5C1BA 2P11A 2QL7A 3C3KA 4L5CA 2BR4A 4I50F 3H1PA 5AH0A 3SJAA 4TS9A 3WE7A 4Q3DA 4I4IA 4I08A 1FXSA 3M70A 4P4LA 3SBOA 1XRNA 1MG0A 1QE0A 3O1IC 2NT4A 4CF3A 1HZZA 3C14C 2PWZA 5H9WA 1VLJA 2RHWA 1GO2A 3RS3A 4BAGA 1USGA 1TZKA 5DHAA 5DM4A 4MRSA 5FBQB 5AXBA 3VR5H 2PZEA 2B1RA 1DXYA 1MZVA 2X1VA 1OVMA 1JEQB 1L4NA 3RVKA 4CIDA 2B4RO 4HTAA 1G8AA 2C7PA 2YZMA 1L1EA 1W73A 3G8CA 3EGWA 1BVYF 5JCXA 4UOEA 2WDPA 2O23A 1E79D 1T13A 2POQX 3Q2KA 2HJ9A 3KQSA 1BS2A 3FTEA 3DAOA 2BWJA 3EF0A 2IEGA 3SHWA 2Q2OA 4BNGA 2HRCA 3DFIA 5H02A 1UBGA 2ZGVA 4GH5A 1ABFA 1FU4A 4BJ5A 3IP6A 1T9GS 3KLPX 3EASA 4GM0A 4LJ4A 3UFXB 1WP9A 3ANTA 2FN8A 4MR9B 2R97A 2BDEA 3EGDB 2X8AA 4QULA 4AXBA 1A9TA 4LGYA 1B41A 2P2GA 1N8KA 2Q46A 4URUR 1X1AA 3NXKA 3BMOA 3E9CA 1T0UA 3JQBC 1P2SA 1J2EA 1S1MA 5I7WA 1Z36A 3LIIA 1YBMA 3OD5A 3CNBA 4JUAA 4ZDWA 4DPKA 3P52A 3V34A 1O8CA 3VPAA 1NVAA 4RFLA 4Y7DA 3WLQA 1KI1A 2CW5A 2AQ8A 3BCRA 4TWAA 1YI8A 2BEWA 4BB0A 1QPGA 1YCGA 3JCZA 1E3TA 2I6XA 3DLCA 4EFKA 4EGAA 4CEIB 3M5CA 4I4CA 2VH2A 3RAEC 5A0FA 5K0BA 3N07A 3KZXA 3FVVA 5EE0A 5BVGA 1Y1RA 5L95A 4FYPA 4PPFA 1QDEA 1M0WA 1EBBA 1CRLA 4QGBA 1BDBA 1ZXBA 2C5SA 1QX3A 3BRWD 1Q0ZA 4DVGA 5KJEA 1GZUA 1ACJA 1C3JA 1TE2A 1ZLXA 2GX6A 2YV5A 3INTA 3PE6A 2JFBA 1PL0A 5FRDA 3U62A 4E5DA 4F2PA 1L7AA 6ABPA 3GGDA 4X6LA 2JNWA 4M1ZA 2BHTA 5C37A 1KEKA 5LU9A 1N1DA 3HWX1 4OA8A 5H9VA 4B82A 3G9QA 1LY1A 1NM5A 1GQ2A 3M6LA 2W2XA 4LKOA 2QVLA 4BB9A 5F9FA 3H1TA 3T9AA 1E3WB 4EG1A 2NU8B 3L0PA 5KWVA 1FZQA 4U7FA 4X5OA 3UK7A 1E9RA 4ILEA 1CIVA 4DLKA 1DIGA 3OMXA 3PX3A 3ETGA 4E11A 3AR7A 2OEPA 2WYHA 8OHMA 1I4EB 4OQFA 2WVHA 4Q1EA 4LVCA 4ZCIA 2GJ8A 1LPMA 4G0OA 2XH8A 2GNOA 3E9MA 4I99A 2VRNA 1JHRA 2HNAA 4GF5A 2R2GA 4OXIA 4HZUA 4URHA 2EJWA 1NRJB 2GYWA 5CDFA 5JOQA 1FTNA 1NGSA 1PG2A 2BHNA 3K5PA 1RLMA 3VMFA 3L6CA 1VJ1A 2I65A 4CXMA 4ZI7B 2AJDA 2JIDA 3WG9A 3NJ8A 2GVDC 3V1NA 2YJ6A 4UASA 3ZCXA 1FRQA 1E4EB 2BGMA 4TSFD 1NXWA 4DLUA 3ROGA 3OPYA 4X65B 4EHFA 1ZNQO 3JATA 4V0KA 2WUFA 4V0ME 1W48A 1SOMA 3WGYA 3QHAA 5BW4A 2P75A 3PIRA 4PFKA 1GGNA 1OR8A 1Z8DA 3WDSA 3WLFA 3OT1B 1FNNA 4QUGA 2PKCA 4HSGA 4TRNA 5CCXA 2CVHA 4EMTA 5AW7A 4RAOA 3COPA 2HCTA 4ATNA 1N5MA 1G7RA 2X2EA 5CBPB 1FOEB 1SD1A 3ACBA 3IBTA 1Q1EA 3STUA 3LAWA 3K9FC 5DU2A 4IDPA 5CXUA 2DLCX 4CM8B 2BUAA 3DMTC 2A0YA 5TY0A 5L4NA 1GV1A 2I7DA 1K8ZB 3MQFA 4QHSA 5T3UA 1X1RA 5SZKB 2WWXA 1MRZA 1YQ9A 1KY3A 1TYCA 4J2TA 3CXUA 4GE3A 3DE2X 3MS2A 1U2GC 1B3RA 1R5NA 2C2BA 2XCQA 2OAEA 3H97A 3I6YA 3PQ2A 2VTBB 4UTPA 3UJ3X 1UFRA 5EIFA 1WPGA 1PNQA 1SIOA 3SSOA 1GITA 1UK6A 5J40A 4AK9A 2C61A 2RJNA 5FH9A 1KR5A 2QVCA 2CHGA 2JZOA 3HR7A 4KAFA 2OORC 2GXAA 1YVPA 4LZJA 1XAHA 3AL3A 2EQ5A 1K8YB 3HNRA 4OQQA 3FUCA 3P71T 1FF9A 2GN8A 2OT3B 3BTOA 4LF5B 5E3IA 2P4UA 1WE2A 1MPTA 3HFJA 3VNBA 5BSEA 2IS2A 5KDOA 1IJBA 2BI8A 2E87A 1QCDA 5DNAA 3UUGA 3L1IA 4MHSA 1YRBA 5KNCD 4GPTA 4OHXA 3PQEA 3RRNA 4JFAA 4MUFA 2EX0A 2E1PA 5THKA 3N70A 3BGVA 4O2BA 1W75A 2GCEA 3TLZA 4CF7A 3SXPA 3PEVA 4W9MC 3FPEA 2YJGA 4JQZA 5DX0A 1FLVA 3STYA 3Q5DA 1FW8A 2Q50A 2PUFA 1Y7IA 5GONA 4NH4A 2BP7B 3R0QA 5ALXA 4ARVA 5CLIA 4NULA 1YVUA 1RWKA 1RI1A 3GLIB 1GRRA 5TQVA 1WD5A 2IYYA 3LTEA 4CLOA 1OA1A 4MCJA 3K0CA 3MT7A 4PG8A 3GXOA 3CJRA 4QDZA 5EPEA 3IP7A 4FW9A 3NEJA 1DP4A 1SVOA 3PHLA 1JSLA 2UUOA 1DXQA 2FHPA 1XTZA 1Z15A 3MXTA 4BCCA 4Q3LA 1UWKA 1FP2A 4JP5A 3PDHA 2D0DA 1DKQA 1KPIA 1W8IA 2X0JA 1JFVA 3IV9A 3ZCSA 2XYRA 3HO8A 3EDOA 5BR7A 4J1QA 1N92A 1RC0A 2GSDA 4KU4A 3TYXA 3NUZA 4DPLA 3DL7A 1JAYA 3KPWA 2HQSA 5DLPA 2JFYA 10MHA 6REQA 1DJQA 2DWUA 4MITA 3ZX4A 2HSZA 1XK7A 3HLKA 1SQFA 3UXYA 3RSFA 4LZZA 3ZHVA 1XMSA 1EK6A 3LL4A 2YY5A 3IFSA 1C8VB 1VGVA 1UMDA 3TEFA 3VPBA 3H5NA 2XI4A 1Q1GA 3NWOA 4F60A 1S7CA 3SOZA 4PQGA 2AMVA 2GN6A 2CJWA 3PNKA 1N4AA 3ZI0A 3DE7X 4HAZA 4M0LA 5DGXA 2XWBF 5K0SA 3H3JA 4N7MA 1M54A 4WNIA 5L3ZA 4FFRA 1X7GA 5IF9A 4ZAWA 1RZRD 3UUFA 1UPCA 5TPWA 4YPOA 2NZWA 4XIYA 3KOYA 1V95A 3IAXA 4BUCA 1AC5A 4E3WA 1VBNA 1B00A 5J4YA 1AK2A 1SC4A 1NQOA 1DC4A 2DKNA 4KNVA 1L7RA 2AG5A 1P6QA 5SYMA 3WWPA 4GE0A 4A82A 4WERA 1EVLA 4D3YA 1KOGA 1DBRA 4HDKA 1X9GA 1P61B 3G0DA 1NUPA 4QZVA 3D6UA 5GZ1A 5LB4A 2GCOB 6Q21A 4I7EA 1E3MA 3I37X 3OJWA 2X9VA 3R6GA 2QZPA 4GKJB 4QD3A 4YRBA 4X20A 5TGZA 2CVZA 4GBGA 1Z6GA 4UEQA 1Y6JA 3K6JA 4EX7A 2JFXA 3E1SA 1TM4E 1X14A 4PLCA 2C7BA 1NSTA 3W9UA 5DDIP 1OPRA 3NHRA 3AWIA 3SC2A 2D6FA 5ITVA 1O9HA 1EFKA 2ZRMA 1AQUA 3F9CA 3QXJA 4KFUA 5KNDH 1B15A 4ZTBA 2IZ0A 4AZ0B 3HO6A 1TVKB 4FYXA 4URYR 4HDMB 4YY3B 2JKVA 5KOHB 3I9LA 1FNBA 1IHYA 1U02A 2AF3C 3DWGA 4EFLA 2PMKA 2IHTA 3UCXA 5IXYA 1JB9A 5B6IA 1K66A 1PHPA 3FRHA 3GLGE 1KJIA 1TYEB 3ABZA 2IPXA 2JGDA 4RGVA 4WBSA 4YWHA 3FNEA 1U3DA 3KJIA 4UTVA 3A6PC 3PKJA 2Q0QA 3IPYA 1K3TA 5K3FB 2BI4A 2PRKA 2QG6A 4YRFA 1P62B 3EQ2A 4MPDA 1F3LA 5J5AA 5KWJA 3FTDA 1G2PA 4XDGA 4LE2A 3Q4GA 1JKJA 4GMDA 2NVUB 2HPAA 5L40A 2UUAB 3FMGA 3AETA 4X24A 4ZQCB 5I01A 3PC7A 4UKDA 4BKQA 821PA 1KQFA 4MMXB 1URPA 2MMGA 4UAVA 4H6WA 3E5NA 4LECA 1SO8A 2QWXA 2ZYUX 2X2PA 3I32A 3F0TA 2HEGA 3WKDA 5DP1A 3OZGA 5J2TF 1RAGA 2Q3HA 5HZMA 5IDXA 4BQEA 2ZITA 4G65A 4ZT6A 2E5WA 2A88A 3KJNA 1HLPA 3KO8A 5KAPA 5L45A 1B43A 1OX6A 2HJVA 2ZT5A 3KNZA 4G56A 1V35A 2GAIA 3F78A 3HVIA 3KQYA 4TV8A 2F4VB 3R7WB 1TZ2A 4DV4B 1JFTA 1X0VA 3RVBA 3G6WA 1ZW6A 1YDWA 4BNYA 3EQ7A 3R3SA 5B7PA 2ECFA 1DUSA 3WJAA 1G8JA 1A95A 3K4QA 3RSCA 3HN2A 4L4RA 3CE6A 1WWKA 2GLUA 4JQSA 5IT0A 1SCQA 1A8UA 3K5WA 1JIXA 1GPWB 5U4XA 3ZCTA 5HKKD 2IV2X 4P7FA 1E64A 1QZ3A 3AYXB 2YHAA 4JN6B 3LLMA 1X1QA 2PL5A 2VRBA 4WOBA 1PX2A 2HO4A 3UB2A 3RC8A 2RHHA 3OQVA 1E6CA 2IIPA 1T1RA 2OY0A 4OF4A 1UP7A 3ZOKA 2CXSA 5CK5A 3BMQA 5IULC 2L2QA 1MB0A 3D3JA 1I7NA 3KFVA 3KYDA 2C97A 3QVOA 1Y6ZA 3EC2A 4R54A 1KYVA 3P0HA 3AFGA 1SXJE 4MMZB 1DKPA 1XZPA 4HH0A 5LDDC 1XYVA 3ZD7A 1VLLA 4YAWA 4GMHA 3T7AA 3M82A 3LUAA 4R1QA 4CF6A 2PEZA 3JQ6A 4Y67A 4BPRA 2I2XB 3SYMA 3B6IA 2DH6A 2IVZA 4NBVA 2RC5A 3FPBA 3IDQA 4MWSA 3ZTWA 4HAYA 5AJUA 4DXHA 4E15A 2XOXA 2IT1A 4AJEA 1NRIA 2NPOA 4JLBA 5HWSA 3CW8X 3O8DA 1WW3A 2ZT7A 3ELWA 3FUUA 3LPNA 3PNPA 2P2LA 4NMMA 4TVOA 1P5JA 2JS7A 1V8OA 3K16A 4RMGA 5ALIA 5JECA 4BLVA 1THZA 1T0PA 4M9UA 3IMFA 1EVQA 2FK8A 4XLZA 1TQ4A 2IOFK 1H4TA 8ADHA 2OBNA 1I7PA 2FW9A 1RCUA 4JY7A 1R15A 4NAUA 5FBLB 2VHTA 3KT8A 3WB2A 3T1OA 1F9AA 3VZPA 4TROA 3HVRA 5EE1A 1Q84A 1U1FA 2VZEA 4OUDB 2JI7A 1JI0A 2O8VA 4IFEA 1IZYA 1V16A 4O4IB 4RMNA 4BNHA 4A6PA 4CMHA 3D0RA 3M2TA 1X1BA 3PSHA 4WCFA 2EJUA 5DJ5A 1GA6A 1ODCA 2MSKA 4G4IA 5HE8A 4KREA 2DPXA 2F00A 2AUMA 3NDBB 2QQ5A 2AOWA 1IONA 2FGKA 4ZFNA 2B78A 6REQB 2NZUG 1WY5A 4M1EA 3GZNB 4XA8A 5GJCA 1DIAA 2F3TA 3DZKA 2F1JA 4EKDA 1T26A 2Q3FA 4K2HA 5FWXB 1MIOB 1TF2A 2C3MA 1Y1PA 2G9QA 1QHYA 1PE0A 3H5TA 4JASB 1PJBA 1D3AA 1DDOA 1UBLS 4FYYA 1CS0B 4P33A 4I1RA 2D7DA 4J6EA 4OFZA 4X1IA 2PUAA 3EVDA 3BMQB 3LLUA 3O4JA 2HA6A 4YJ2F 4R98A 3SBXA 1BYUA 2HSGA 3FDXA 4IXDA 4OUDA 3COJA 2O54A 3X44A 1G20B 4YRQA 1MUUA 4Q39A 3TLBA 4WFQA 2ZPTX 4QVIA 5ESWA 1NBME 2WWGA 3H9EO 4YACA 3VHQA 3LOUA 4UBLA 3UWMA 2HXSA 2DR3A 3HPRA 1C3LA 1HEUA 1QDLB 3ML1A 4EJSA 1EVJA 1SAYA 1TU3A 3O21A 1M2NA 3QFCA 1H1TA 1L7XA 5AQ1A 4X7RA 3HI6A 3OU7A 4RETA 1PS8A 4AG6A 4N0PA 3NBFA 4MJLA 2RGUA 4WA8A 3TTXA 1UBUS 3UAGA 2QMOA 1NVDA 4A0QA 1OWMA 1IUPA 3K1TA 4Q6BA 1RBMA 3W78A 5A7FA 4AL4A 2QPAA 3STTA 1GD1O 4AICA 5IXJA 1C2TA 3TAHA 4QEKA 5KNBH 3TUZC 4AQ7A 2IXTA 2XT9A 1I33A 2C5GA 1ZIPA 4JLOA 4IOJA 2QMHA 1SCAA 1XBTA 4QDOA 1NV8A 5DGHA 3NM4A 3EB9A 3I2HA 3RUHA 3DZBA 2HDOA 3V4RA 2HA4A 1S6YA 1P2UA 2V54A 1G9TA 3NHWA 4ZO8A 1GAXA 5FUMA 3FDZB 1OB5A 1ORDA 5IDWA 2VWPA 4H35A 4IZIA 5AW5A 3JQBA 2O05A 5LA6F 4R9UC 3U0BA 5A4AA 4TQGA 2JZCA 1VKOA 1W2GA 3NH9A 1C14A 1VCMA 2X4DA 5A5EA 5ADWA 5DHTA 5BUZA 4KQGA 3FJ1A 4PZPA 1YIDA 2DTDA 2QN1A 4W7IA 2J5RA 4GI2A 2O3SA 3M5WA 4R8VA 5CYGA 1FMCA 2F1HA 1JFSA 4KDEA 1WSBA 3G2HA 4X8MA 1ATIA 3DBHB 2Q8QA 4BBZA 4FDTA 4M0FA 3IOEA 5KTRA 2PJUA 5IMBA 3JARA 2VAVA 5JH7F 4MIOA 1OXBB 1Y7HA 1OFIA 2GUGA 5BSUA 4BV3A 4HDSB 2W6MA 4C0WA 4EATA 2Y05A 1J49A 1ZRSA 3ESQA 3FFXA 1HFJA 2I22A 3HADA 3UT0A 3F6CA 4PAMA 4QPZA 3EA0A 1Q0SA 3AUYA 4Q3KA 1ZS9A 4M1KA 3PCTA 1FS6A 2WQZA 4D80A 1S5PA 3RSLA 4DLPA 2AUNA 4ZK2A 1HZZC 3G5TA 2HREA 4X90A 4BUZA 4DLAA 1VG1A 2JFFA 3IAM1 2AC4A 4IDAA 721PA 3L46A 2WJZB 4B31A 4RKYA 3RVSA 3BFXA 2DPMA 4N0MA 3AINA 1XIVA 3ABSB 1Q1AA 1WVGA 1O2DA 3U16A 3MCWA 4LK3A 3LD9A 4KVFA 1GPBA 3DOJA 1C9DB 1SUPA 1OAAA 2I8AA 2WPDA 3F8SA 4GXTA 4MGKR 4ROTA 2V1UA 2FUG1 3GOQA 2HK9A 3P9RA 4XCVA 3GDGA 3WA7A 4X3OA 2FFAA 1NOIA 5BYBA 4CM3A 3RC9A 2JBHA 3NTOA 4PTLA 3ACDA 4R84A 3ESCA 5K8CA 2XWJI 2YOGA 4FC6A 5ALLA 3WHLA 4BQFA 1A7JA 3B2NA 3WQBA 4GYKA 1XDBA 3LY7A 2CNDA 1KMHB 4L73A 2G9RA 4ETNA 4BGUA 1E2KA 1KO7A 3I12A 2P9HA 1R9JA 3G0OA 4OYLA 3T99A 4WXRA 4EHDA 1A2BA 1T91A 3CVJA 3ER9A 3E53A 1NBOA 5EHIA 1ZL2A 1FTWA 3FNBA 2ZSBA 1YR9A 4PSCA 5LR6A 5TARA 2O5CA 2FF5A 5JALA 2PXAA 3UKJA 3MJHA 1NUAA 3KXKA 3RU7A 1MA0A 1L8OA 2O2XA 4MUGA 3BVPA 1GZDA 4YAFA 2XYGA 4PIMA 2H1CA 3OPXA 1H3NA 1F14A 3OM0A 2CE7A 4ECAA 2R85A 1G63A 1Y8QA 4O4JA 1M1NB 3U9SA 1VL0A 2C42A 4ZVNA 5ITZB 1NYLA 2RB5A 2QAGC 4TT3A 3TNJA 1XD2B 3GXBA 3SYNA 2C03A 4CG2A 4OL9A 3OOWA 3H5OA 2A1TR 4EVIA 2FN9A 5HRUA 2WEKA 4EOGA 1W25A 4GL4A 4UU0A 3U7QB 2WIAA 1KC3A 2QE7A 3BXZA 3GUCA 4RH0A 2BPOA 3VPGA 2H4HA 5KJFA 4QBGB 1CFJA 1BOOA 2QX8A 1TJ5A 3N8IA 4IIFA 4URZR 2X5XA 1PAUA 1GQFA 4GLLA 1OYVA 4LZNA 4B4VA 4GWLA 5JT1A 2UXCB 4OLJA 2ISCA 2D0PB 5HIJA 5BUCA 1ZH0A 5INTA 4J3JA 1SUCA 2OCGA 4HDCA 1L6IA 1A98A 4KYTA 5E1DA 5JMPA 3F5MA 1WZNA 2ODQA 1KYTA 4IHAA 2HJWA 2YHBA 3KJQA 3R7BA 2H07A 1MFZA 2VP6A 3PXAA 3HUDA 1TJ4A 4JOSA 4ZKDA 1E4VA 3NB0A 4BJ6A 1KZ7B 5DLDA 1L4KA 4PLPA 1DC5A 1PW5A 1CJSA 4AWBA 1PDWA 3IR6A 4J91A 5HR5A 4PYQA 3K0FA 3KL4A 3EVFA 1N2GA 2DUNA 2VZ9A 4R0NA 2IUTA 3RTDA 3IDFA 3PX2A 2HEIA 2WSMA 4XUEA 2R8OA 3TLGA 2ES4A 2V0CA 1M1ZA 3MTAA 5EHNA 4EUEA 1ADYA 4XQ9A 1WL8A 3C41J 1ZM3A 4MR7A 2OLJA 2EOAA 1ST2A 5BR4A 1L1QA 2O3UA 3WADA 4BNZA 3GCDA 3LCJA 2Q6VA 3KWFA 1E6UA 4WBNF 2QX7A 3S4YA 4YI3A 4RY9A 1IN4A 3O5AA 4JNCA 3ND7A 4D9MA 4JNKA 3FKJA 1NJ2A 4TYQA 1GNVA 2ZRPA 1IEVA 3ROFA 2QL5A 2EQBA 4RDIA 4JDPA 4BHTA 4CG3A 3WKAA 1IBMB 4HX2A 2J31A 4CIVA 5AW0A 1OXMA 2VYNA 2ZYSA 5TRTA 5LUBA 2VNSA 3U49A 4YR9A 1XGKA 2RHJA 3NWEA 1Z8FA 2WF6A 4LBYA 4ASUA 3OX1A 4AWXA 3U44B 3F90A 1T25A 2BEVA 2XIJA 1ODTC 4YC7A 3MRVA 5FIUA 2FSGA 1W30A 2AFHE 3AFIA 4J43A 4XSVA 5JRJA 5JD6A 2XUOA 3CLRC 3INNA 1RPTA 4JJAA 3QEAZ 1JEYB 1L5FA 3TW8A 1SU4A 2GD6A 1DWPA 1Y80A 1VPDA 4KX5A 4IJQA 2H08A 4Z99A 4PFSA 3TQIA 4QTZA 1TF5A 1C9JA 3PXBA 3H6HA 2B4YA 2PGIA 2ADFA 2IHKA 4IMIB 4BATA 4CCWA 4FMDF 1U2TA 4JIGA 2JVIA 2G9NA 4C4XA 4DIUA 4JXZA 3WGGA 3RADC 2IY8A 1JYSA 3EWAA 2XCUA 3GFRA 3ZQ6A 2W0MA 3H5WA 2HBQA 3A3KA 5JISA 1SBIA 4QUHA 4J0QA 2O52A 2V4ZA 1MAHA 2C4NA 4NOLA 3PQCA 4AWAA 1RJWA 2ZB7A 4JWKA 3E4DA 5EMNA 5JNVA 5KYWB 3ZBTA 3N75A 1GU0A 4REQA 5I7RA 2XE4A 4EITA 3OSZA 1NQTA 1FP6A 3ZH2A 1J0BA 3PL5A 1ZA2A 3UJ9A 2ZULA 3R3VA 5IARA 2JJ8A 4K88A 4QTYA 4MUYA 4AU1A 3IQWA 5HOEA 2PR7A 3Q72A 5A6VA 3NEPX 5EP3A 1DADA 4Q4HA 2BOVA 4FBLA 4F86A 3QEBZ 2I9PA 1FU8A 2ZUCA 3JXEA 1PVDA 1RHUA 3LUCA 3PJEA 3ONEA 2XMDA 2FPWA 2J3LA 4GEGA 1BNCA 3JAWB 4MS4B 1ADFA 2NUPB 2Q4RA 1FQKA 1G3RA 1ADCA 1NVFA 1UT5A 4I8IA 4JUBA 4OK6A 4BL5A 4CV0A 1P4JA 4AS3A 4G0MA 4LOHA 5K0FA 2DUJA 5IUKC 5J9FA 4XASA 2OA0A 4J07A 3A9SA 4ABYA 4ZIRB 1NQXA 3DYIA 4KACA 3MB5A 2I62A 3AR9A 3K05A 4KX3A 2FEWB 3TRDA 4XW2A 5JWRA 3GJQA 3HKCB 3IAAA 3A3PA 1N3IA 4BEWA 2QIPA 5CT8A 1DQZA 2XOEA 3KKZA 2IQ5A 4FHDA 4YRNA 3QFFA 2CB9A 2R6CA 4RL4A 3RVQA 5KX5F 3EISA 4D9FA 4YV7A 3ZWPA 1RJ9A 1NHGA 3MJFA 1C8LA 2Q1XA 5IKOA 1CBUA 1NKVA 3GBVA 2HOQA 1NNEA 4ZZ3A 1A9RA 1OI2A 4EI9A 2GDZA 5BNWA 1LQUA 3OURA 2XUGA 4MW2A 5BXQC 1FZTA 3SD7A 1EM6A 4J9UE 4DCNA 1KDTA 2Z9DA 5AHRA 3P1JA 5KEIA 2Y1GA 3GW8A 3UMCA 4RK5A 3QVUA 4RY8A 4E31A 3U60B 2KE5A 3ZS9A 1MP0A 3KM0A 3GP8A 3OE5A 2ZU0C 4HLUC 2ARKA 3K72B 5G41A 4W9NC 3D1VA 5BUSA 3N2GB 2VJDA 1B6RA 3HVUA 3KKNA 4RM3A 1KI6A 3BXHA 4G1UC 4QC2A 1WVIA 3TIVA 5CEEA 1X92A 2VT6A 3AFHA 4EO4A 5ITZA 1KEVA 1RMYA 3LQFA 5IDQA 1Y3IA 3HXTA 3ZWKA 3FMOB 1A2QA 4ON9A 4DLLA 1X7YB 1RYMA 2GEBA 3DV2A 3PUXA 2C1ZA 3NS7A 1J6UA 1ZITA 3D54D 3F5QA 4GPEA 4GGPA 4DN6A 5C1DA 3NTXA 4GXQA 2XDQA 2JFZA 4MO9A 3EIOA 3QI2A 4F84A 2QM8A 4R4JA 5K4AA 4Y6GB 2VNAA 1LF5A 4BVKA 2A86A 4BNKA 1F2TA 4N5DA 5FOWA 5JSKA 2CXUA 3HMKA 4QVGA 3ILVA 1Z4IA 2GHTA 1YZUA 2VT3A 1YJ5A 3EXFB 5DRYA 1GTJ1 3D4BA 1FFDA 3ZK8A 4E5MA 2IGBA 4ZC8A 1MH9A 4NNPA 3WX0A 4EVSA 3AQIA 4IVRA 3ABOB 3U3JA 1TO6A 2CWDA 4NBSA 1J5XA 4N6OA 3AG6A 4YREA 1E7WA 1Y4SA 4YV0A 2WB2A 2QUBA 3HR8A 4ALKA 1WXIA 1BO6A 1PD1A 4K9PA 1IN8A 1NW4A 4QT0A 4D4MA 2Q3DA 4BGIA 1U5BA 4XQCA 3FPSA 3RR2A 2Q5EA 3LYHA 5ARCA 1KOFA 1E5XA 3C3AA 4RA6A 3X1ZA 2WYVA 3OJCA 3H2YA 4LRYA 4W5WA 1SZPA 1GOTA 1I0LA 4JLJA 1R0KA 5LQSA 4NQRA 4HNAA 3F6EX 4IV0A 2RG7A 3T9DA 3FUTA 4O3FA 2AW3A 3SM9A 4W8OA 1TCUA 2HY7A 1DB3A 4MYUA 1QG0A 3HWRA 3GGSA 2F90A 4DDUA 4ASUD 5E8RA 1CDDA 4G5YA 3ENQA 5F2KA 4ZOEA 2LNDA 1EA7A 5E6UB 2GZAA 1Z28A 4FDUA 2YXDA 4AMZA 1H94A 1IZ0A 2QPLA 3UTDA 2O14A 3N05A 3FM9A 4ZTUB 1HBJA 2MR5A 1YS7A 5HKAA 2XADA 4B6OA 1G5RA 3TLEA 4K26A 4CM9A 1R6VA 3V4FA 3ZW9A 5JD4A 3O95A 2XVXA 3C1UA 3LDGA 1QFYA 3E9EA 4YRRA 4E14A 4HFMA 4P3XA 2YUIA 4MUBA 4O4LB 3ROZA 2R7MA 3VXKA 3AR8A 3TFQA 4I2VA 1VBKA 3T4EA 3TLAA 4BZZA 1YB5A 3DOIA 4GX2A 4NHEA 4YIHA 2H8GA 4KH0A 4B4WA 1PFUA 3FCUB 1MKYA 1TEVA 4M54A 1VQ1A 2G4LA 4HB3A 3IMEA 1M33A 1T9AA 2AG1A 3ZXSA 1T2EA 1P7WA 2A9VA 2K2QB 2YRWA 3GJTA 4QNMA 5EAIA 1K89A 4H1VA 1O5OA 1XZHA 3OPYI 5BRAA 5LZ4A 3R3UA 2OZEA 1DMSA 3ONDA 4RLFA 2GEKA 2JJ1A 3LC2O 3CLHA 1T2VA 1QQAA 1NUSA 4N3NA 4R7GA 5CXSA 2WFZA 3I42A 1SIBE 3HFSA 4FD3A 4U2EA 3RVMA 3UGTA 4M0KA 2RHLA 2YWEA 1N2ZA 2GZHA 1XQ9A 4R01A 4UULA 2Q3LA 4DMRA 3HYSA 4F92B 2BAGA 3UK0A 2C2MA 2XB6A 4DHWA 2WKQA 4XLLA 3R7LA 1FMLA 5F64A 2Y68A 4F5YA 1EZ4A 2Q2WA 1SVLA 1CEYA 2YOFA 3LW7A 3O83A 2A0UA 4ENTA 3CR3C 3PE4A 3WL8A 3D8NA 4YQZA 2WYWA 4CKYA 5GQSA 3K6SB 1DEXA 3GQBB 2GZ3A 1PNRA 1GU1A 3B9RA 2LPMA 2CJWB 1YKGA 5FUBA 3WLRA 5DCLA 1BA3A 2W4QA 3LRTA 2B8NA 1V5IA 4TLMB 2WJVA 4UHBA 4TSRA 1XMOB 2VDWB 3S1LA 4NS4A 4XD2A 3P4YA 3DAPA 3MGCA 4QFDA 5HKOA 3R7FA 1E58A 2OKCA 1IN7A 1FNDA 1PJZA 3NCHA 2W6ID 4LIPD 3G5AA 1N8SA 1DPFA 4NEHB 1ZU5A 3CF4A 3ICWA 3S1AB 1AXEA 4MVWA 1H3FA 2QTAA 5HFJA 3STXA 2W6ZA 3HJGA 1UMCA 4B76A 1ADGA 4PZYA 2DM6A 3PIIA 2V9PA 3WS7A 1NQAO 2ZWVA 4Q02A 3LGXA 1WJGA 2AV6A 4INAA 2AIRA 3EEQA 5CU7A 1E69A 3RWOA 3TL3A 1MJGM 3OPYB 2MMCA 3W7AA 2E3JA 3BKXA 3N8DA 5FLYA 4RXMA 2PIAA 2WU3A 5EQTA 2OZVA 3RTAA 2VDUE 3KTAB 2V9ZA 5BW8A 4C4AA 1Y8RA 1A7KA 1Z38A 2Y9MB 3OZSA 1ZOPA 1PSZA 1BJRE 2RGDA 1S8NA 5EIOA 1NW7A 5A6SB 1L9XA 4EQ6A 2AG8A 3SS9X 3AUUA 1O03A 2VJOA 3ZHXA 2I34A 3CMMA 3DBOB 3EBPA 3A8TA 4MEAA 5I9NA 3X1YA 4RV9A 2WTEA 5HKBA 1GCIA 1I3KA 1KBQA 3CVUA 3TMKA 4DCJA 4NS1A 4ZQHA 5KPDA 4PZUA 1JA1A 2FETA 3CWCA 3D31A 3OTIA 4F3RA 2OFPA 1WM1A 3L40A 3Q7SA 1T6XA 4E30A 3UAOA 2JAQA 2ZBRA 2Y99A 4UDXX 3ODPA 5G0WA 5LMUB 4NH0A 4ZCLA 3M6UA 4HBZA 3GLHB 2HSDA 4NZYA 3L9WA 1BHO1 4J4TA 3TQCA 1X7DA 1L7PA 2XYVA 1MW9X 3GEMA 3N7TA 4C4OA 4ZN6A 5K2MA 1BQEA 4L3VA 3RLFA 1Q57A 3WNDA 1E1RA 4IPTA 2X4IA 3X2SA 1Q0HA 2V0GA 4MB0A 1UXKA 4IJ6A 1ZD2P 3UBMA 4CTNA 4QOEA 1CS4C 9LDBA 1E9DA 3RPEA 1CQJA 5JAMA 5JZ9A 4FX2A 2ZYDA 3KKOA 4BVFA 1XU7A 4CLHA 2C8JA 3HDQA 4YDHB 5K6TA 2P9JA 1XTKA 1ZCZA 3F6PA 2NU7A 4Q6WA 1VHQA 5DBEX 2VTDA 1VSBA 2QN3A 2QF7A 2Y8EA 5G3ZA 5CA0B 4LA4A 2W6QA 5DEIA 3WYDA 1QSGA 1IN6A 1SEVA 2BEUA 4FQ8A 4ZARA 3JAMA 4RQAA 3R5XA 3EVCA 1A9QA 3ZBQA 3HBJA 1YOVB 2OXRA 1FY2A 1H9AA 2GVNA 3TXXA 4CTOA 2G6TA 3P7MA 1TM5E 3QJ5A 1HE3A 4HWOA 3ZHBA 5C1OA 1ZK2A 4NBLA 3P96A 5FTWA 1OXVA 4X6UA 1MC4A 4KXLA 4AMVA 2I8CA 1RHMA 3Q41A 2IYUA 4B3XA 4GL2A 4MJ7A 5ERXA 3G02A 2FWNA 5AW1A 1CUIA 1V96A 4MA0A 3OIVA 7GPBA 1ZVVA 5C46F 3E8SA 4UAGA 5FBRB 1O4WA 1U5CA 2FZEA 1IPFA 3H3XA 3KWJA 1HC7A 1OCEA 3QIAA 2O1EA 4A26A 3K73O 1V48A 1NG1A 3PV0A 2D3TA 3OE4A 4M4SA 4Q00A 4XVQA 1Z75A 4LHVA 4S1NA 5EXDA 2XRFA 4RDCA 1SG6A 2BH2A 5K3OA 1BKYA 4KBFA 3NOOA 4EF6A 4HVTA 1A9XA 3EAGA 2EJVA 2FW7A 5HUQA 1E0AA 2ZBUA 2Q8PA 5L3QA 5JBQA 2PKQP 3FXAA 4EJMA 4AY2A 1JR2A 1QAOA 1PBTA 5KYXB 4ILKA 1TMOA 3HJCA 4ZVQA 5LOVA 3GLGA 2PS0A 4EYKA 3TF5A 4C07A 2N1BA 4E1AA 2DF8A 5LYJF 3B1JA 3TM5A 3RNLA 2Z6VA 3QOWA 2P2DA 3L1VA 1Q7EA 4G8CA 4H0CA 1C4OA 4JL8A 5JAQA 3C4QA 2EV9A 2QAIA 4KOEC 2ZXFA 2VFAA 3VOSA 2WJ3A 3IMCA 4CF5A 3FCSB 2Z8YM 4HX9A 5KTKA 1LWOA 1A5AB 4TYWA 3B6ZA 3DBHA 1GQSA 1W87A 2AR0A 1CLEA 3M1AA 4CQLB 4O4HF 3VNUA 4OHYA 3H7AA 2O8DA 8GPBA 3ESZA 2BEJA 2D5CA 3BAFA 1R0WA 3HA5A 2DZDA 4JK3A 2J5XA 3T0IA 1U0LA 2GCOA 3IHTA 4YAEA 5JSHA 3E0XA 4DSNA 2IA5A 3D2BA 4R1TA 4ZOAA 3CRVA 2DY0A 4G9GA 4PAQA 2ZRIA 3KBOA 1A27A 3KP1A 5A4JA 1ACMA 3VPCA 4LRXA 4MZDA 3K9NA 1EQAA 4L74A 1RCFA 4KPEC 1JWBB 2UVPB 3SLGA 1QTQA 4YP9A 1L4FA 2Z09A 3ENWA 4UU1A 5EUMA 2NUAB 3TSYA 3OPNA 2FW6A 3GD7A 5DKFA 4AQDA 3K9HA 3IBGA 5BWOA 1OYOA 3EN0A 2IX3A 3L1UA 4AJ2A 1O94D 2PWAA 2VPTA 3VAYA 2R4UA 3LDFA 121PA 1RACA 3PRYA 2OFOA 4TYYA 1CT9A 1YZTA 5CH3A 3NVKI 4DOMA 3K4PA 5F78A 5TPZA 2WD9A 3H1BA 2WKSA 2BCEA 3DT9A 5JJCA 1NBIA 1E1YA 3A1VA 2YTZA 1Y1SA 3TSWA 2ZE5A 5AKYA 3E58A 2HYIC 3S5JA 3BQNB 2JASA 3RQIA 4DR7B 4HPXB 1H93A 4FZVA 3EPLA 3PF9A 1STOA 3TE7A 3UV7A 1QHSA 4EW6A 1BROA 1ICEA 2OAGA 3NHFA 3D4OA 3ZDQA 2I6SA 3FCYA 4NR0A 4UQPA 2QK4A 4C22A 3TFOA 1FVFA 2FKNA 4M1QA 1F7VA 3KL2A 2GZRA 5B55A 3I2GA 4MW9A 1UKYA 1Z2CA 3CZAA 1SXJA 3DQQA 3IR7A 2X19A 4JMLA 5FL3A 3HUUA 2C3PA 3WWYA 1P2BA 1Y4ZA 4DJAA 1T3TA 1A1SA 1WCIB 3BE4A 1J8VA 1CV2A 1FDSA 1Z82A 2I2AA 2W83A 3I9KA 3OOSA 4P0TA 1V1RA 4PNHA 4Y9RA 2GD2A 3UJBA 3UYLA 4QBTA 1QAQA 1CJVC 3DO6A 3R0JA 4H4EA 2QRZA 4S0ZA 4PRYA 4WT7A 4ARUA 5GVRA 4CHGA 3CVXA 2GFIA 2MJLA 2VQDA 1QR2A 2JDID 3F6YA 3IAM6 3KVVA 4E3ZA 2GK6A 4PZ9A 4C4SA 1MOSA 1II9A 3C3CA 3UKDA 1BC5A 4CL8A 1ZCFA 3BRQA 2L69A 2DHDA 2QZZA 3HH8A 3IUEA 4RX1A 4GD3Q 5DBIA 2PD4A 5EERA 3HYCA 2ID7A 2I6GA 1YL6A 2NZ2A 4R2KA 4P58A 1IZ8A 4D6YA 4QPNA 1AMNA 2RD2A 3LHKA 4GKBA 2LCFA 2Y1EA 4OG2A 1MZPA 3IIIA 4YXWA 4BLSA 2XZOA 1JKJB 4XKJA 3H99A 4D3DA 4EK9A 2O7QA 4UBNA 1EFPA 1L7NA 4MQFB 3UMMA 2AEFA 3T3IA 4XLTA 2N3ZA 1SXIA 3T41A 2AH5A 2OV6A 3R6WA 2JLBA 2Q2NA 2GPAA 1JSRA 3TINA 3AZPA 1C3XA 2CMDA 4HYYA 5J4KA 3JZDA 4YWJA 1N2IA 4R7ZA 2JGIA 3WC4A 1EKXA 5H80A 4A0SA 1HT3A 5B58C 3ZU2A 4K6OA 2HR1A 1X1EA 1OYWA 4K9MA 3CU5A 2DR0A 1X8LA 2NO9A 1SPXA 2QHXA 3EXIA 3P0EA 1DVRA 2DCUA 1S2LA 1DRKA 2A30A 4JGIA 4IDEA 4KO3S 1SEPA 2X40A 3QV2A 2WWWA 1A8PA 2VI5A 4E5PA 3PF8A 2EVWX 2F7SA 4HWGA 4L57A 4YGYA 5GGXA 3PZBA 3SF0A 4BU1A 1ECCA 1I2MA 2XB9A 3OCUA 3A2NA 1IZZA 3CRZA 4L28A 1PGQA 3LL7A 4MUMA 5AKXA 3MD9A 1TEHA 2ERCA 4GM1A 2JBAB 1RABA 3VI3B 3WIOA 1L7MA 5EJ8A 1L5LA 1INLA 5FB3A 1FFHA 4HI0E 1T5BA 1SCBA 4QUEA 5KWIA 2NZYA 3TE6A 4FD2A 2CLHB 2CVOA 1PK9A 1ODSA 3LT5A 4D43A 4EI7A 5U9CA 5HIAA 4JJIA 2VP3A 3KAJA 1KU6A 2ICAA 4WLFA 3UYKA 4ZT2A 1WQ3A 3R9XA 4O1HA 2J45A 2P9QA 1AHNA 1TUIA 4MV4A 3C24A 3E61A 1THMA 3AERB 5KUTA 2Q41A 2QRVB 3D9QX 3AEYA 2Y1OA 3PT5A 2R6JA 4S1TA 3TW6A 1HL7A 4FDVA 3EEIA 1KJYA 4RQTA 2UXDB 4L9AA 2EERA 3K0FB 1BU8A 2O4CA 2PAAA 2AUTA 1XKXA 2NVOA 5GAJA 4W82A 3L1KA 4FFOA 1TU0A 4RHCA 3O9VA 3O91A 2I87A 4DA0A 3R76A 1I3LA 3SS7X 5JZMA 1V3TA 1VPWA 1VB5A 4TMTA 4TV8B 2WNHA 4FFBA 4RH1A 3THXB 4IRUB 2VHQA 4MPRA 2HSWA 2KW5A 4O1MA 1U8UA 1L4GA 3IRVA 1UDCA 4INOA 4OP3A 5J58A 1FVHA 3WLJA 4BNFA 3BSFA 3E8MA 3THWB 3CG0A 4U63A 3A9TA 5FOQA 1I6MA 1P0IA 2JJQA 4JP3A 3DMDA 4GEKA 2Y9PB 2B8WA 5B1DA 4KK4A 4MYDA 1SKAA 3OPQA 5JD3A 1WZCA 3D3EA 1LGYA 3X1MA 1I5OA 1RI2A 1W5SA 2ERYA 2IPLA 3ANMA 1QGUA 3L0SA 2DCMA 5FBWB 1EBFA 5GM2A 5AVXA 4UZEA 3OQMA 4KMSA 5AIAA 1XU9A 3FGPA 4FI3C 3CKYA 5SY6A 5AI4A 2PWYA 1CE8B 3ON5A 4RTJA 3PNMA 3DZIA 3WSTA 4RD2A 1PT8A 3V42A 5HZKA 2Z1NA 4OB6A 2WMDA 4GI7A 3ETEA 2J3DA 4ZHQA 1L4EA 3NYWA 2JGMA 4LYYA 1N0VC 2NVBA 4Q3AA 4NEGA 4X93A 2D62A 3TTUA 4BKMA 1EFDN 1XJQA 4HZGA 1OWPA 1ZZEA 2Y2UA 3UUEA 5JAHA 3UHAA 2PLWA 1G60A 1GGJA 4HXEB 2XE6A 4LOJA 3S27A 3ETNA 1DTEA 3ZR4B 2EFHB 2XF2A 4CR7A 4UD2A 5TMBA 5CFOA 4FP9A 1ZKMA 1DFIA 4MPTA 3IODA 5JS2A 3AYZB 3DGEC 4DMFA 2PQ0A 4X85A 4F4IA 1UIMA 4TMKA 2YINC 4US0R 1BIFA 2C5LA 1F20A 2O3RA 1L5WA 5GIPE 2MDTA 3FA2A 2ZEJA 4L9WA 1MD9A 2BONA 1KAEA 2D1QA 2FPOA 2QT0A 1YB2A 3KUKA 4YV2A 1JQBA 4JYCA 3TGWA 5FT9A 3EGCA 4MULA 1TT7A 3UA4A 1GSOA 1BRTA 1IXYA 1EWQA 4CCYB 3SYTA 4E7OA 2Z98A 3C39A 4TKZA 1P9RA 4IIUA 2QG4A 3EBLA 3DDCA 5BSKA 3SYRA 1OKKD 2BUBA 3I5XA 4A1FA 3MMSA 3HPQA 1RYHA 2GTHA 3L0DA 5DK6A 1Z39A 1ZK4A 4RPHA 1WKVA 2NMVA 3C3MA 4BVEA 4UHDA 1C9MA 4XYEA 1U6IA 3HR4A 1LVHA 3I8XA 4EH1A 4FFBB 5FTJA 2COEA 1ZD5A 4MICA 3LLVA 1RYEA 2Q5HA 3ZLJA 1I8TA 4TV9A 2GVZC 1QORA 3E9QA 3MMZA 4WXHA 3P26A 3UC5A 1WCIA 1ZO8A 2IIBA 4GRDA 4G0XA 4C1BA 1TAHA 3HCEA 1REQB 3CZMA 3V4OA 3WLSA 4E21A 1RWVA 2N47A 4RPIA 4DNFA 5TMEA 4HRVA 4LI3X 5KVVA 4C5CA 3E22B 2G07A 2ORIA 3NBYC 4WD3A 1QDUA 3R3WA 1Q0PA 4KRGA 1KXJA 2Q5CA 3QLTA 1E98A 1GGEA 4DJTA 5HRCA 5C8YF 2HD4A 3TOXA 3TRKA 3V4PB 4TTSA 1TUBB 1B6SA 2O7VA 5FUXA 2J85A 2XAAA 4ZANA 5H0IA 5COQA 1Z3CA 1VKJA 4DVJA 5A3SA 1XKQA 2Y1WA 1HZJA 5EE3A 1RLJA 2VAPA 3QG1A 3GGCA 4XVHA 4DEXA 2ZJZA 1OBCA 2WU4A 3MHTA 1RM4A 4ZAVA 1FMJA 3OU6A 1LPPA 4ZJYA 1KMNA 3QK7A 3RYHA 4LZLA 4LVUA 4UBMA 3TLGB 5J1TB 3X1XA 4ALMA 1U0GA 3U2QA 3ZZ1A 2X0KA 3OLYA 4E12A 4EY4A 3VZCA 5JASA 1KC1A 1U5BB 1WNTA 4OLHA 1RJGA 4LTNA 1SVUA 1NQUA 3DDUA 3ZY3A 4WFJA 2X23A 2HUPA 3HVKA 3P2MA 4R6XA 3SQWA 1CF2O 1V8ZA 2UZ0A 1TT5A 1SRQA 3B9QA 3NIGB 2ILTA 4JR1A 2G76A 5LQMA 2PLAA 4CKCB 2VF2A 3FOWA 4IIBA 4YUZA 1I2DA 2ISSD 2E9SA 4WKOA 1N0WA 2ZWPA 4O2RA 1ULUA 2AI1A 2LZ0A 3CEAA 2B1QA 2JF0A 3N7AA 4R1UA 3FTCA 3ACCA 3RBXA 3P94A 3WYEA 4HGPA 4DJEC 2JIOA 4MRVA 1DWQA 1MU0A 4MDYA 5FLKA 2G28A 2ZJYA