3THRA

Crystal structure of rat native liver glycine n-methyltransferase complexed with 5-methyltetrahydrofolate monoglutamate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
286
Chain Sequence
b'VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine N-methyltransferase
publication title Differences in folate-protein interactions result in differing inhibition of native rat liver and recombinant glycine N-methyltransferase by 5-methyltetrahydrofolate.
pubmed doi rcsb
molecule tags Transferase/transferase inhibitor
total genus 90
structure length 286
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 3thrA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3thrA02
2AOUB 1IM8A 5MHTA 1KYWA 1WXWA 2FHPA 2H1RA 4GOND 2FPOA 2NNWB 4DCGA 1XDZA 10MHA 2CL5A 2E5WA 3KR2A 1JG3A 4HTFA 4RTOA 5E1MA 1Z3CA 5E8JA 2YQZA 3M6WA 4EQZA 4RTNA 3BT7A 2AS0A 2PWYA 3KPJA 4XCXA 4QDJA 1JSXA 3OE4A 4AZVA 2JHCA 4RX1A 5ICGA 5LQCA 5EEGA 3UA4A 4PIPA 3ANXA 4JXJA 5E2AA 4PYJA 4MQ4A 3R9XB 3MHTA 1KPGA 1NW7A 5IKMA 5FHRA 2ZZMA 3G2MA 2FYTA 1WZNA 4PCAA 1XDUA 3G8BA 5CCBA 2BR5A 2YX1A 2PY6A 5HFJA 2GB4A 4GQBA 5LSAA 5EC8A 3NWEA 3S68A 3H2BA 5LQJA 3EVAA 1DL5A 1O9HA 3PT9A 4DZRA 5FULA 3MTIA 2C7RA 3KQOA 1KXZA 3FPGA 1I1NA 1X1CA 2QRVB 3HCDA 4PYQA 3P2KA 1SG9A 3A27A 1FP1D 2OPBA 4R6XA 1SUIA 5DRTA 3EVDA 4EKGA 5BP7A 3BGIA 2V7EA 1BC5A 5EKUA 5HILA 5BW5A 5IH3A 4DQ0A 5EOVA 5D1NA 3CJQA 2IH5A 4HSGA 3DR5A 3KQSA 1N7IA 3C6MA 4P7FA 3LL7A 3P8ZA 4PYKA 3TRKA 1Q0TA 1KR5A 3TR6A 3NWBA 2Z6AA 3CGGA 3T7TA 3GRRA 2B9EA 2ZTHA 3B89A 3EPPA 1KPIA 3TMAA 5BXYA 2AOXA 1P1BA 1X1DA 3UJBA 3FUUA 5KVAA 1NV8A 2R3SA 1EAMA 4QPNA 2Y1WA 2ZSUA 3CVOA 2UYHA 1NBIA 1XDSA 2JG3A 3KU1A 2H11A 3ID6C 4MIKA 1NW6A 1R8XA 4PCLA 5K0BA 5LQAA 2Z6QA 1EQAA 2PKWA 5ICFA 5E9WA 5CVDA 5K0JA 1YFJA 3T0IA 3G2QA 3GNLA 3BWBA 4PGHA 4RTSA 2ZW9A 4C04A 1L3BA 3EMDA 3CCFA 1F38A 3KPUA 1YFLA 3MQ2A 2GH1A 3E8SA 5T6BA 5DX1A 3O7WA 2GA9A 3M6UA 5DTMA 2WA1A 4OBXA 1O9GA 5LQUA 3LCVB 2F8LA 4LG1A 3LDFA 1MJFA 4M7RA 3GWZA 3NTVA 3CC8A 1KP9A 5CVUA 3OZTA 4E2XA 3HP7A 4WVLA 2FK7A 4OA8A 4QQKA 4RTQA 2ZWAA 5LQKA 2V74B 3OCJA 1FJXA 4RTJA 1IXKA 4M37A 4GBED 2OKCA 4PNEA 4EK9A 3TOSA 1AQIA 1NV9A 3EVCA 2Q41A 3HCCA 3M4XA 5DWQA 2PXAA 3P9CA 3RODA 4CTJA 3ER9A 5EVJA 1Y8CA 4RVDA 5F2KA 1SKMA 5B1SA 2IGTA 1JSZA 2ZVJA 3TPZA 1ZGAA 4L7VA 5HIJA 2BR4A 1DUSA 3GRVA 4GOLD 1L1EA 1RI5A 1X1BA 2KW5A 3MAGA 2G72A 3GRUA 2XYQA 1HMYA 3JWJA 5EQJB 5EMMA 3HA7A 2PX5A 2CMHA 4KDRA 2HMYB 3KR0A 3SM3A 3KQQA 5C9ZA 1ZKDA 5LQNA 3A26A 4R05A 3FUVA 2IP2A 2B25A 5HIIA 3P9KA 2EX4A 4F84A 5FADA 2P3LA 1RI1A 4WXHA 1D2GA 3BWCA 2ORED 5CVVA 1R74A 4CKBA 3LCCA 1ZG3A 1G38A 3HEMA 2PBFA 3GXOA 3UJAA 1KHHA 4KDCA 4GEKA 2BZGA 2O05A 3BGDA 3NW9A 4E32A 3QOWA 2EJTA 3RIEA 2EG5A 3AWIA 3B3FA 3R0QA 1ZHFA 5JUWA 2IPXA 5C0OE 4YUWA 5F2OA 1TPYA 3ELDA 4FSDA 3P71T 3SXJA 3C3PA 5FQNA 3TKYA 3FUWA 2PX4A 4LECA 3TM5A 2PWPA 3G2PA 3G7UA 3HNRA 4EVIA 3KQYA 1JG4A 2WK1A 4RV9A 3E23A 1BOOA 2N47A 3KKZA 3R24A 4UOEA 5HIKA 3TFWA 3ELUA 4EKIA 2XBMA 1MHTA 4NECA 1XCJA 2VDWA 3UBTA 2C7PA 3C3YA 3SX0A 4DA4A 5DX0A 2I9KA 4RTMA 5CVEA 1JTFA 1FPQA 3SMQA 4QDKA 4R8RA 1ZGJA 2JHPA 3SSNA 1L9KA 2CWWA 3DLCA 2AZTA 4Y2HA 5E9QA 2K4MA 8MHTA 1JQDA 4AZWA 4HC4A 2QY6A 1TW3A 4HGZA 5CUQA 5DTQA 4QQNA 3VC2A 1DCTA 3FPFA 1U2ZA 5ICCA 3PTAA 2AOTA 5GINE 2XVMA 3M6VA 4BLWA 1SVUA 1NBHA 4PGGA 4BLVA 3I5UA 3AXSA 5FWDA 3REOA 1QAOA 1VLMA 3O31A 3ELWA 4MTLA 1FBNA 7MHTA 2PVCA 4GUAA 1M6YA 5CM2Z 3LPMA 2UYOA 2CKDA 2OZVA 3NVKI 2PT6A 1JR4A 1EG2A 1G8AA 2NXJA 2ESRA 3FUXA 3HM2A 4RVFA 1UIRA 3GRYA 3JWIA 3RW9A 5C1IA 1VQ1A 1YZ3A 3OFKA 2ZWVA 3X0DA 3IHTA 4OA5A 4QPPA 1JQEA 4X60A 4FR0A 4G56A 5U4XA 3QV2A 3KPYA 1X19A 1P91A 3TKAA 1ORHA 1L3CA 1NE2A 3OZRA 4HRAA 2ZCJA 1Q0SA 4X41A 1RI3A 3EVZA 1VL5A 3LBFA 3VYWA 2VDUE 2YR0A 3TM4A 3BXOA 4MHTA 2ADMA 5K03A 4E2YA 1N2XA 1RI2A 3PFHA 3R6TA 3ERCA 4YUZA 2UZ4A 5K0EA 2PX8A 4C06A 4FSXA 4DF3A 2YTZA 2VZ9A 2NYUA 2AN4A 1XJ5A 3T7SA 1TW2A 2QM3A 4GC9A 4HH4A 4DM3A 2G1PA 2WA2A 3HVKA 3V8VA 3IEIA 1RI4A 3DTNA 1JTEA 3BUSA 4KRGA 4U7PB 5E1OA 5FTWA 2LD4A 5K0NA 3KR1A 4E2WA 3HTXA 3CBGA 3C0KA 3OFJA 1VBFA 3PX2A 1XTPA 1NW5A 4QVKA 3TLJA 1KIAA 1UWVA 2ZLBA 3GDHA 2JH8A 3NMUF 4KWCA 5E9JA 4RWZA 4QTTB 3OZSA 2PGXA 4EMSA 1JG1A 4OBWA 2VS1A 5K09A 5DT2A 2Y1XA 2P7HA 1F3LA 1SUSA 3FPHA 5GWXA 3KQPA 4X63A 1QYRA 3MGGA 4LWOA 2P8JA 2XYVA 3BKXA 5JR3A 5H02A 3NJRA 1R18A 2P3OA 2AOVA 3DMFA 3HVJA 3THSA 5FUBA 5EZSA 3UJ6A 5HEKA 2BH2A 5DRYA 1KPHA 3B5IA 3KQMA 4GOMD 1RJGA 4OQDA 4RVHA 4BY9E 3F4KA 4PWYA 4QTUB 3FTFA 3UJDA 2ZBQA 4F86A 2NP6A 1ORIA 3EGIA 4IKPA 2ZBRA 4OQEA 5D1HA 2IIPA 1WG8A 3V97A 9MHTA 3ELYA 4PONA 3FPEA 5HIMA 4ATNA 1NW8A 2P40A 3G2OA 4X1OA 2O07A 2IBSA 3G5TA 3K0BA 5EHGA 3FTCA 3FTDA 1B42A 3GO4A 3LKDA 5CD1A 4RTRA 2QYOA 4GF5A 4E33A 2NXEA 3PB3A 3HA3A 4XUEA 4POOA 3L8DA 2OXTA 4Y30A 3CJRA 1YZHA 3E7PA 4P7JA 4RTLA 2GAFA 3G88A 1I9GA 4RSRA 1EIZA 4PYNA 2C7QA 4YV1A 2YXEA 3FRHA 3GIWA 4A6DA 3A4TA 4H0NA 2NXCA 3AJDA 3AXTA 1NW3A 3QOXA 3FYDA 3KQTA 2PXXA 3G89A 5EIFA 4HGYA 4YV2A 3THRA 1P1CA 2B2CA 5K0CA 5FQOA 3I53A 3P97A 5FA8A 3MTEA 3ORHA 5E1DA 3UJ8A 3GCZA 1QANA 3I58A 5FCDA 2ZIEA 3EEOA 5LR6A 5FHQA 5E1BA 3DUWA 4KIFA 1G6Q1 4B17A 3DXXA 3FYCA 2JHAA 3B7PA 3EVBA 3OPNA 5HOQA 3G8AA 1VPTA 1FP2A 2ONYA 4LWPA 1M6EX 2AVNA 2ONZA 2PLWA 5GIPE 5KQRA 3MCZA 3NVMB 1RJFA 3EVFA 3T7RA 3HA5A 4C03A 5GIOE 2O0LA 5K8VA 3AY0A 1SQGA 3LDGA 3HVIA 1R8YA 2GLUA 5EHIA 4U7TB 4HTFB 2O06A 5DXJA 2OB2A 2ZBPA 2UYCA 4V0RA 5BW4A 2FCAA 5DM1A 1VP9A 4KVZA 5EIWA 1XXLA 3UJ7A 4AX8A 3JWGA 1UFKA 4FT2A 4QVGA 1PJZA 5G02A 3UA3A 4C07A 5M5BA 3G5LA 1M0EA 1T43A 2IBTA 2OBFA 5EGSA 4YUVA 2AOTB 3IYLW 2AR0A 1D2HA 2IFTA 3KPVA 5DM2A 1YUBA 5K0LA 4AUKA 1X1AA 5KQSA 4XUCA 4P7GA 2AOUA 5LQRA 4IWNA 5EMKA 5DSTA 3I9FA 3KQWA 4FP9A 2P7IA 3SGLA 4R8SA 3VC1A 1EJ6A 4CWAA 4HG2A 2HR1A 1HNNA 1VE3A 4M36A 2OY0A 2VDVE 1EJ0A 2BR3A 2YXDA 4IV0A 3GRZA 2O57A 3GU3A 4ER7A 5E8RA 5GP1A 5T64A 3BWMA 5EG5A 4AZTA 5E2BA 2JJQA 4OX9Y 1I4WA 1YB2A 1WXXA 4XUDA 3LECA 5EEHA 3O4FA 4FS8A 2G8NA 2ZIFA 2HTEA 3GJYA 2AN5A 3DXZA 5DM4A 2ERCA 2P35A 2UYQA 3EGEA 4YUYA 2ZFUA 2NP7A 3I64A 3EGVA 3OE5A 3BZBA 3NDIA 4PIMA 5GOZA 1XCLA 3BGVA 4AZSA 3CKKA 1BHJA 1AF7A 1NT2A 5CCXA 2YUIA 3FTEA 4YUXA 3MCTA 2VP3A 2OYRA 4C4AA 4CXMA 2QRVA 3D2LA 2AN3A 5DX8A 5F2NA 4DKJA 2XVAA 3EVGA 4E70A 4YV0A 1WY7A 4P58A 3OU7A 1VP3A 2GPYA 3KHKA 4GOOD 1ZQ9A 2OB1A 2HV9A 4CKEA 5EZQA 3KQVA 3SVZA 3M70A 3ME5A 3PFGA 4P7KA 5DPMA 3K6RA 1PRYA 3KPWA 5HZMA 5ICEA 5T67A 2C7OA 3EMBA 4BP3A 3M6XA 4R6WA 3WSTA 4E30A 3SSMA 2EFJA 3UJCA 5K05A 3UWPA 4E2ZA 3DMHA 1YF3A 3DH0A 3UZUA 1V39A 2Z6UA 3LKZA 3R3HA 4M38A 3DULA 1G55A 3A7EA 3B3JA 4KIGA 1AQJA 2FRXA 4PYOA 4PINA 3FRIA 4Z2YA 1OR8A 4DMGA 4ER6A 3DP7A 2GS9A 4CTKA 4YMHA 4E31A 2IH2A 2OO3A 3A7DA 2PV0A 4PYLA 4IV8A 1JQ3A 1SQFA 1IY9A 2ZZNA 3Q7EA 3HCEA 4YMGA 2CMGA 2PSSA 1RJDA 2IDKA 2P3QA 2I62A 5EPEA 4MWZA 5EMJA 3OU2A 4BLUA 3MERA 1QZZA 3HCAA 3UFBA 3LSTA 1JG2A 3JWHA 4RYLA 3LDUA 2DULA 2R6ZA 5P8WA 1N7JA 2PX2A 3PLAE 5FA5A 3PVCA 5FWAA 3UJ9A 2ZZKA 3TQSA 2DPMA 3CJTA 2ZULA 3ER8A 2IH4A 2BM9A 3LBYA 1P39A 2PXCA 3A25A 3MB5A 4CKCA 1QAQA 3DMGA 3PS9A 2PT9A 1D2CA 2I6GA 3M33A 4K6MA 3LGAA 3C6KA 2XYRA 2B78A 2H00A 2AOWA 4A6EA 3EVEA 1VIDA 2BM8A 2YVLA 1G8SA 1XVAA 3BWYA 2NXNA 3P2IA 3P9IA 3P9NA 1R00A 1WS6A 1KYZA 3FUTA 2AVDA 2P41A 2B3TA 3HCFA 4PYIA 5CVJA 5K0GA 3SR4A 5KS2A 3OU6A 4FT4A 4RTKA 3HVHA 3LCUA 4O29A 3NDJA 1G60A 2EJUA 1BKYA 2ZIGA 3EEYA 4RVGA 4F85A 3B3GA 2A14A 2I7CA 3GGDA 4GC5A 4FGZA 2IDJA 5DLYA 3DLIA 4C05A 3FPJA 2FK8A 3BKWA 4BP1A 5K0FA 5DM0A 4ER5A 5DXAA 1INLA 5ERGB 2YXLA 3DXYA 5GM2A 2PJDA 4ER3A 3Q87B 3IV6A 5EMLA 3U81A 3SSOA 1AV6A 5EKXA 3FZGA 3VSEA 4FZVA 2QE6A 4PYMA 1H1DA 2G71A 5K01A 5DSXA 1NKVA 2P1DA 4ER0A 3LX6A 2HWKA 4X61A 2G70A 5GM1A 4DCMA 1O54A 2HNKA 4V0QA 3P2EA 1R6AA 4RTPA 2JH9A 3HCBA 4C08A 4KW7A 3LHDA 5KYGA 1L3IA 1QAMA 5DTRA 3E05A 4ISCA 5CIYA 1RJEA 3PX3A 4ZTBA 3DOUA 3KR9A
chains in the Genus database with same CATH superfamily
4MPTA 4C0KA 4EYSA 5ER9A 3JAWB 3GQVA 1JLLB 2OCPA 3KTAB 2FPUA 3NBMA 2JLQA 5ES3A 4UTNA 1K88A 2LDBA 4NYIR 1YJ8A 1P2TA 3A0RB 3HYNA 4GKAA 5AKZA 1M6HA 1TKBA 1VCIA 2FUKA 4ROTA 3EPKA 1DX9A 1V43A 4KNYA 3KKEA 5HZGA 1FQWA 1Y37A 5J43A 2VJMB 5LP6A 1NFRA 2PWYA 4YT2A 5EERA 4D57A 4MA0A 1I3OA 1QYWA 3L1JA 5TGTA 3CYFA 3K35A 3HCWA 1PFUA 3BERA 4KP7A 4LV8B 1UP6A 3H9JA 3HYLA 5CDHA 3C6ZA 3BGWA 4ZREA 5CCBA 3R7WB 1SCJA 3ZDEA 4BIMA 1U7UA 1H23A 2GB4A 3AJRA 4UVGA 1O6BA 1GZSA 1N0IA 4RZUA 4BMYA 5LQJA 5LVAA 1NG9A 4DZRA 5BN4B 5C5DA 1FVXA 4EYEA 1ETHA 1PX0A 1AXGA 1X1CA 2EW1A 3HCDA 4QGBA 4G0VA 4D9FA 1SG9A 2W2TA 4PV7A 3RSLA 1SD1A 4K3UA 5BP7A 3PVZA 1AHHA 1ZMBA 3DEJA 4NJOA 4OI0A 4ODIA 4EDFA 4D74A 3ZY6A 2PGJA 4G65A 1I4TD 5TMDA 7AT1A 2IXFA 4P7FA 5I9TA 4X91A 3KBBA 4BAZA 1ZAKA 1DGQA 1G3IA 5LOVB 3TR6A 1WOYA 2JJMA 3GD5A 2R84A 5C8DA 5IAJA 4DA9A 3N70A 2DLDA 2BSAA 4YRMA 2IPLA 3BL8A 5DASA 4IICA 4O8CA 2GM9A 3E22B 3FUUA 4XQCA 1XDBA 1NYTA 5C8XA 1M34B 5G0VA 4EUHA 4BO8A 3BIWA 3KU1A 3T4XA 4BLQA 2C9YA 3B5JA 2B5OA 2QI9F 2FE1A 2QZPA 2VEOA 2YXPX 3C3MA 4AS2A 5EHXA 1C1XB 3MK31 4H4CA 3KYCB 3Q1KA 1QG2A 5IT5A 4Q1FA 3IPYA 5ALOA 4KR0A 1UK8A 1BE6A 1XR3A 3TI9A 2R8PA 4LJ7A 1T2AA 3O7WA 4ASUD 1X9HA 4NS4A 3SP1A 1UPCA 2NG1A 3TLXA 1VL2A 2ZE5A 3GLVA 1ZCZA 5DWDA 3LL4A 1PE0A 5LKRA 2WFAA 2YWRA 3K0SA 1S8NA 2YC4C 5SV2A 3GJ0A 5DLPA 3SF0A 4CT5A 1RLUA 3ZNQA 4OOFA 4C0AC 3TIGA 3P2YA 4FFVA 3ODGA 1W5EA 1A2KC 1WUJS 3AONB 4I4CA 4XXHA 1NP7A 4MW4A 1P45A 1DZ3A 1IATA 4GXNA 1QCCA 5KUTA 1RQ2A 2IUFA 3VTKA 5ALDA 2GEVA 4FJ2A 2J32A 4GPIB 3CRZA 3NIFB 2OMKA 4DWWA 1IEQA 4ZJPA 3MBKA 2QQFA 3KLBA 4P82A 1GG8A 3SEAA 3E4DA 3IVGA 5BNTA 5DWQA 1Q92A 4LISA 4ZK6A 1N92A 4K7JA 4ETMA 3J81k 5I47A 3IH5A 2FSGA 5IXYA 5IM4F 4QT0A 1ZEMA 3PUHA 4ZJUA 3BH0A 5TQ0B 2G5GX 2V58A 1XL1A 4I08A 4C4XA 1WZIA 5EJMA 4ZOAA 4DEXA 3A9SA 1T2EA 5DBFA 2G72A 2PKXA 2WIFA 4MQ5A 1PEYA 5FPTA 4B79A 1XWWA 3QXGA 3S2ZA 4DSOA 1VI5A 4L5CA 1YDFA 3A6ZA 2ZJ3A 4R05A 4O4IF 1WXIA 3N8GA 5K5EA 1HZZC 4DIKA 4UMEA 4KWHA 1QIHA 4INAA 5IF9A 2EQBA 3F3YA 3GJQA 4TV9A 2ORED 1I5RA 1G4HA 1QUEA 1BVRA 2W4IA 3B51X 3BEOA 4JLSA 4D56A 2H1HA 1NLMA 4DQUA 5KQMA 4MVJI 3TBKA 5BMVF 1QK3A 2J85A 3NW9A 2NM0A 1KE2A 3QPWA 4ZGBA 1FFXB 2QEQA 3R0QA 5I3CA 1SXQA 4TYPA 3EVTA 1YUMA 4YUWA 3G8CA 2NYVA 4DC0A 1HE2A 4R1TA 1KBZA 4LVCA 2FB9A 1N6PA 1TZMA 3ML1A 5AT1A 3TVYA 4BO4A 2H18A 2VXYA 4QHTA 1UFRA 1YR6A 1V1RA 3OIFA 4E5YA 3ZWWA 4GUDA 1B2RA 4KI0A 4LYAA 5EL0A 4ZDWA 3I5XA 4KI7A 2H3HA 3C8UA 4K9NA 1E98A 3NYWA 1UC4B 2JIOA 3H5VA 1M8GA 3ICCA 1XLTA 1XLWA 4JIGA 2C7PA 2AUNA 3ZY5A 1U8AA 2DHCA 2SECE 1KAEA 3MTGA 4UDNA 3GGJA 4N5DA 4O2BB 1IK6A 4LKRA 3DMTC 4OMUA 2E18A 2K4MA 1QWOA 1YIOA 3UMVA 5BR8B 4OGGA 1SUBA 4NEGA 3I28A 5CUQA 1DCTA 4X92A 5BOSB 2W48A 5EWJA 3B9RA 4ZCTA 4HFJA 4RZIA 3LT1A 4ZICA 2AOTA 2WILA 4B3TB 4CQMD 4P8RA 1TK3A 1K7YA 1IEXA 4B4DA 3UJNA 5EIBD 2J67A 4AYXA 2X4IA 4OLHA 1U0GA 1WUYA 4DVGA 4CTOA 5HGXA 1Z5PA 5IX8A 1ZGZA 2HQRA 2BFPA 3O31A 4LV5B 1WWKA 1D0VA 5D5QA 4LI3X 1QC5B 5GAJA 1HYGA 3NHZA 2AQHA 4PHCA 2RGXA 2QG9A 4NQZA 4YAFA 4C01A 3PQ4A 1NMYA 1W88A 3KEGA 2HHLA 4WXPA 5A9SA 3TF5A 3NVKI 1N6IA 3GMDA 3H0EA 1AZWA 1KI8A 3HM2A 4LKOA 4MKRA 3UAOA 2C99A 5HX7A 2JGJA 2J5RA 2O0JA 3STWA 3CLHA 3LUCA 3W4JA 1V45E 5K51A 1L5VA 1Z83A 4N3AA 4X60A 4DXDA 3OCCA 3KVYA 4YWHA 1ISSA 1ML4A 1A3CA 1GAQA 3D0KA 3KHSA 1N5JA 2PGLA 5ELMA 3I73A 1T9KA 3UIEA 1OBCA 4PW0A 3RC2A 2G67A 3O5AA 2VDUE 3JRXA 1RWBA 3HU3A 2NZYA 1E77A 2ADMA 3OJXA 5EUCA 2EF1A 1WETA 2I8AA 1X6VA 2OC4A 1HQCA 3CCCA 2JFOA 2PA0A 2R8RA 2YTZA 1T5LA 3R5SA 2XNKA 2DJIA 1AXRA 3H4VA 4R31A 1AKYA 4HQNA 2F48A 2IV7A 3URMA 5L8VA 1HT2E 2QE7D 3WRYC 4KRGA 4G1EB 4U7PB 4RBNA 2C0QA 4J1TA 2PXHA 3ITKA 3N2KA 4PC6A 5DW3A 1XZQA 1CPYA 1QOQB 3WHIA 3AUKA 3WLSA 3NMUF 4HUTA 4FFPA 3N2GB 4UPEA 2BUCA 4EUEA 3BSWA 4ZTUB 1JG1A 3C45A 3UKDA 1EFDN 3OEWA 1ESMA 3PNYA 1ABBA 1F8FA 2RAFA 4FBGA 4LDQA 1M0SA 4QO8A 1PBTA 3HN6A 2EC5A 1XFDA 1F2DA 1PT7A 4M8IA 2JH3A 2O3UA 1UJCA 1I2MA 1HG1A 2C88A 2VHVA 3KZMA 3NNNA 4BBAA 1R18A 1RE0A 3GCDA 1ZVKA 5A0FA 1HE3A 5L6LB 3WGVA 1H6BA 4G5HA 3B5IA 5DDIP 1OJ7A 3PC4A 5J4LA 1QHNA 3PP8A 4ALJA 1AGRA 2O3SA 1PR0A 1QHHB 4A92A 4MWBA 1ORIA 3GZJA 5HWSA 1XAIA 3M4NA 5A5GA 3S81A 2CJWB 2JHGA 1Q83A 2I2CA 2EL7A 4MRSA 3H3JA 5KJ6A 2QV0A 2IPOA 2FEPA 4EJMA 3DTYA 3WKBA 3CZ4A 1SO8A 3FPLA 5IJ9A 4LDJA 1LLQA 4YROA 1QH0A 1P0QA 1S1CA 1XMVA 4IJWA 3TW8A 1EUQA 2K6GA 2W8BB 4GMHA 4ND5A 2PCLA 2WT8A 1CUHA 2ZREA 4PXYA 5LNK6 4RSRA 2OCBA 4X8LA 5H0IA 4O02B 1REQA 5L7YA 2C7QA 3FRHA 1RCFA 1U0OC 4ND8A 5JSZB 2A88A 3DUFA 1EBBA 3AXTA 4MUEA 3T5CA 3O47A 3CLKA 1IWOA 1AKVA 4YJFA 3U7QA 4DJFC 4DG5A 4E7OA 5CD1A 2MYUA 1K5GA 4OHKA 2GM4A 1Y5LA 5DYIA 3VR3A 5JIBA 5EXSA 3TO5A 3HLKA 2JFWA 2PZJA 2BM0A 2PDAA 4GL4A 4MR8A 3RSZA 3GMSA 3I2FA 3S3TA 4O4IA 5ALHA 3T5TA 4PPYA 5T8KC 2VK1A 2RGWA 3EFHA 3Q2KA 4PR3A 3IOCA 5DHAA 3TLCA 1DX6A 1I3KA 4KPFC 3FGNA 1VECA 5B4VA 1WIWA 2R6AA 2WTMA 3INRA 1TM7E 4KAJA 3EDMA 5GIPE 4M0CA 4R2HA 3FF4A 3ZUPA 4OI2A 1AB5A 4UHEA 4UCWA 3EVFA 3NEPX 3T7RA 4COOA 1TD9A 4ED9A 1E2HA 3FKJA 4OBBA 1GTVA 2CNOA 4NCIA 4N0EA 3A4NA 3PTLA 2PZAA 2QN1A 2FPPA 4C6TB 1XJCA 1QPBA 1CB7A 1E1QD 1FSZA 5A05A 3DS8A 3VR2A 4HDSB 4PLYA 1HNZB 3VR4A 1XXLA 3ZHTA 2FFQA 1COZA 3QEMA 4MYCA 5BYAA 4KXLA 5J23A 2A4KA 5COQA 5JAMA 4R1OA 1F8GA 1JIXA 3HKEB 3NUGA 4UUOA 4Y7CA 3RNLA 2QXUA 1Y8QA 2CNLA 1QM5A 4GOJA 1ZIDA 1JHXA 1DC6A 1Y7LA 3IOMA 1G2IA 2NTEA 3BJEA 3FNEA 1UXGA 3GY0A 4P7GA 5E3IA 5A2QA 4TKUA 4TYNA 2I1VB 3JQAA 1PKEA 3AEQA 1XALA 5KWJA 1AJEA 1SOWA 3GFBA 1E3SA 2I1QA 2XYHA 3N2NA 3S2EA 1I94B 1JKJA 4KGDA 1EUCA 4LTNA 1MF7A 1E62A 1K86A 4W9NA 4IQFA 4CHTA 4ZCIA 2P4SA 1ADYA 5GOTA 1XHEA 2O57A 1SRRA 1KMMA 4ABYA 4RK4A 4OX9Y 2RC5A 3CUVA 1I4WA 3UMCA 2WSMA 4GEGA 4MCIA 4MJ3A 1IXZA 5L40A 1CJCA 1SBYA 4LBYA 4H7HA 2FFHA 1QKJA 3B38A 1CQJB 1JU9A 4GYJA 4L74A 1E1RA 1YB5A 1UT5A 3DXZA 3IULA 5GOZA 1A76A 3GYBA 3H0KA 3T7EA 2F8MA 1M2GA 1X1EA 2PD6A 3CKKA 3DDSA 4Q05A 3ZWPA 3MZ0A 5BWNA 1K7EB 3EF1A 1LGYA 4HSEA 1U5BA 3MCTA 1RIIA 4CXMA 5EY5B 2BBSA 3F5FA 4ZCRA 1VJ5A 3R5XA 1QTQA 1Z74A 3EVGA 2FMHA 3Q40A 5BVGA 4KJZA 1CDZA 1CEQA 4P58A 3QXSA 3I1JA 1JA0A 1SBZA 4Q6BA 5I9BA 4E09A 4A27A 1GM5A 2C04A 2WHRA 5FPYA 2PWBA 2P65A 3LGSA 4P08A 5DV9A 1NPTO 5HF5A 5T67A 1XCGB 3ACBA 3CZCA 1RDFA 2QR3A 1I6WA 4GWKA 2ILTA 4E30A 3A6LA 4Z6KA 1R0RE 3W5IA 2J9YB 3AK4A 4HYQA 5A9TA 1VPLA 2D2XA 2NSYA 4BFXA 5KSYA 3A7EA 4KIGA 3KSZO 2ZRKA 2RAUA 4OSOA 5GMOA 5CYOA 1XNJA 2IHJA 3WG9A 4ENPA 2MMCA 5AVJA 1UMCB 1GSIA 5JS2A 4DAEA 5IVPA 3VZRA 2QAJA 3HRIA 4ZWNA 1G59A 2J0VA 3I72A 4DLVA 2R8EA 5BUZA 5SYNA 4IBOA 2C0CA 2VHYA 4Y2GA 3ZK8A 4U7DA 4WL0A 3EIQA 1LW6E 3OCZA 1NKTA 1JQ3A 1SQFA 2C5BA 4G37A 4YMGA 4DGQA 1KK2A 3KL2A 1QE5A 3PDWA 5G53C 1R16A 1CERA 1K5PA 3LXMA 2I62A 1WCWA 5KYUA 3OQIB 1R7RA 2HRBA 2GF9A 3AF2A 4HXGA 3HCAA 5FF9A 3OJLA 1X8LA 2I3DA 5TC4A 4D9EA 5C4MA 1A9ZA 1TCAA 2IUSA 1MENA 1VA4A 1A72A 1B0PA 3KEFA 4XZ3A 3EY9A 3ANNA 5D6OA 1S4MA 3IE1A 3VQTA 3V1YA 4DBLC 5KDDA 2FMIA 3DEYX 2XIQA 1CR0A 2RBEA 4X71A 1QGAA 3VTFA 1Z63A 1RYBA 4MH0R 2D7DA 5JDIC 5TVGA 5T4HA 4HXFB 4OQXA 2O8VA 4K88A 1OT5A 3U3OA 3H8JA 3D0OA 2QLNA 4NS1A 4HAUA 4V38A 2WIKA 5WRFA 3Q8WA 4H0FA 4O29A 3K2IA 2CHUA 5H83A 3ABZA 1C9JA 1VE7A 1YMQA 5B6JA 4S1OA 4AI6A 4BP1A 3RADC 4US2R 2Q0SA 5EWLA 2WZCA 1KH1A 1JN0A 4JLBA 2NUAB 2VDQB 1PJ3A 1U0FA 4AY5A 1ISPA 2OTCA 2VZEA 3OF5A 3QSGA 2XTJA 3COPA 4MNTA 2AFHE 2IYEA 2Z2XA 4QDUA 2D0DA 3QOYA 3EXIA 3MMXA 3FHOA 2JFFA 4LS3A 3RUAA 4CQLA 4MIYA 2O5RA 1CT9A 3QA3E 1ULHA 4O4JF 2HJSA 4CDMA 5B58T 2JGKA 4K8RB 3LOQA 3ONDA 1XYYA 4WMLA 5DSXA 2P1DA 3PPVA 1L4UA 1XZIA 3GOQA 2G70A 3BGOS 1PTKA 1XQ9A 1TM1E 1NUUA 4DCMA 2DC1A 4ZOEA 1YOVB 5I5EA 1QP0A 5EZYB 1LJ8A 3P2EA 2ZM6B 1BDHA 2GCIA 3FOBA 3TXYA 1K98A 2OAP1 4K9OA 3WGYA 4BV2A 2AE1A 3PT5A 1NBMA 1RRFA 2OG1A 1M5TA 3LK7A 1LY1A 4RHFA 5HG0A 3KKPA 3MCWA 3PIIA 4FEGA 1FP4B 1H8EA 3C5EA 2GR9A 3JZDA 4QUAA 1OBOA 2M6SA 3HVUA 1HYEA 4Y9RA 1T9CA 3TPFA 3WRVA 4BMPB 1L5ZA 4G1VA 2GHTA 1CVRA 5HZKA 4TSKA 2HYDA 1ECFA 1JG3A 4KUEA 5COAA 4OQ4A 3OZXA 5DN6D 2GBPA 1OSNA 3IXMA 3M6WA 1SQ6A 1IVNA 4AP9A 4EF5A 3ZBQA 3QEAZ 4QDJA 3HPQA 3RF7A 3WLNA 2A1IA 2XQGA 4LJ6A 3OMWA 4RPLA 4OMFG 5L6MB 5FHRA 4ISBA 5F9FA 3AKZA 1EXMA 1CY7A 2C4VA 1IRXA 2A0FA 3A3YA 1EBFA 1OWPA 3UH0A 4ZOLB 1VLQA 1E0SA 1L7VC 3GZNA 1J07A 3H2BA 3HHPA 4N39A 4QPJC 1C7IA 1Z4LA 5KDLA 5AW3A 4F38A 1YH3A 1I4LD 4HQLA 4EPTA 3PL5A 4IHJA 1OX5A 2OORC 1SU4A 5IWAB 4BB5A 4OB6A 3FAKA 3W5AA 1L8XA 4QICA 3WB0A 4IXWA 3ZIUA 4TXJA 1GDHA 1UDXA 5EKUA 4AY3A 5D7NA 1H5QA 3D0QA 5K2MA 1A7AA 4XWOA 1H9CA 4FPXA 2WRZA 2WM3A 5FWXA 3DR5A 3QKRA 4XRRA 3OZFA 1R50A 4E3ZA 4I4TF 3L7LA 4FD3A 3NWBA 4V02A 4CMHA 4F04A 1FFGA 1SY7A 3OWXA 4MHSA 2FDXA 3IA7A 4O2RA 2NO9A 4P3YA 4J07A 4UM5A 4B0OA 1L5WA 1X1DA 2P4UA 4IW3B 4RIHA 5K99A 3UICA 4GMGA 3FI9A 2OZLB 1IN8A 2WTXA 4Y7DA 2GZRA 2H11A 4QQFA 2O2ZA 3GT7A 2EFHB 3UYLA 4BFCA 5EE0A 4NNPA 3T94A 3WXMA 4YPOA 3BS4A 3MHPA 1B0UA 3CVXA 3BWBA 3U7JA 4S1NA 3ZLBA 4UE2A 2CLHB 2H07A 1YFLA 4XD7A 1E5TA 1XHLA 3HA2A 4N65A 5T6BA 2OFPA 3M6UA 4P5DA 3U09A 4DRYA 5AVUA 2V9CA 3GRPA 2CE7A 1HL3A 1FTQA 1MJFA 1O6CA 4WD3A 4AM8A 4CVNA 5CLFA 3CC8A 4UU7A 5CJPA 3DD1A 5DK6A 2NTNA 4YP7A 3IXLA 1KRHA 5B1YA 4Y9UA 4DLBA 2XEXA 3NC0C 4TTQA 1B8UA 2VJNA 1DG1G 1CJSA 1PKXA 1N3IA 2HT6A 1F2VA 4YP9A 3ZE1B 4BB9A 1LS1A 1QLHA 1YS6A 1P73A 2RIRA 3QF4A 5TT1A 4ZIRB 3TOSA 2O8DA 1GPJA 3EDQA 3AVPA 1N7HA 4W8GA 4YASA 2Q41A 1MV8A 3NHUA 3PRYA 3B6MA 1QTIA 3OTIA 3M4XA 1AGPA 2YWGA 1DKLA 1W1IA 3GLHB 3V55A 4IIJB 3UY4A 3WKCA 1T1EA 4LVOA 4OJTA 4R54A 4UAGA 5F2KA 5HMMA 5K3FB 1L7QA 3TPZA 4ZYUA 3FHLA 2MSLA 2I4LA 1JI3A 2I2FA 9LDBA 4F9TA 3D8NA 4ZI7F 1WBBA 1Q17A 3PCRB 3V32A 3R3UA 4GGOA 2QA5A 1JKIA 2QTHA 1PYOA 3OKPA 4FYPA 2KW5A 2WKRA 3UT6A 5KOHB 4UFPA 4RXUA 4AC9A 3ZWDA 1UJNA 3HB9A 2X5KO 2IDMA 4WBSA 3QYPA 3A2KA 3ON5A 4HH0A 4B87A 3U4DA 1NQ5A 4M8SA 2ZRJA 3W9BA 2F3SA 3FMPB 4DN6A 4YLYA 5JD5A 1SQSA 2C2MA 2IYYA 2VHWA 3AIKA 4RGYA 1SVSA 2C2WA 3NB0A 5GY7A 4EY7A 2GLXA 3H7IA 4US0R 4AP6A 1HWYA 2VQSA 1A77A 1DWOA 1J49A 2C31A 3HEMA 4KLRA 4JLMA 1AB6A 1UKCA 4PSCA 3H11B 3O4JA 1UMDA 3K0FA 2OD7A 3M5WA 1WLSA 1U65A 3GXBA 3H5AA 3M5CA 3CNLA 4HQ0A 2EG5A 5E4FA 1A2QA 3SIRA 5C0OE 2C4HA 5FLKA 1TZBA 4YNBA 4M4SA 5BQPA 5I51A 2RSLA 1VIAA 5AVSA 2SNIE 4TZ6A 3TM5A 4JP1A 5JCJD 4F4CA 1MB4A 1MABB 2PWPA 3IIEA 1SC1A 4OGLA 4LZWA 3F71A 1RXEA 3SFTA 3WIBA 4D4JA 1CY6A 2K2QB 1IQPA 1JJAA 4O4JA 4RV9A 2NO5A 2XUJA 1XZGA 3M1YA 3C8DA 1JU3A 3VDRA 4DCOA 1QF6A 3WL5A 5IYZF 2CV0A 3ESYA 3F49S 4H3HB 3WTCA 3X2SA 3HZZA 2IVZA 2AXNA 2C9DA 5DX0A 3DLAA 1BN7A 2L18A 5CVEA 4B3XA 4WA8A 3SMQA 1MAHA 4MR9B 3T5MA 3EFEA 1R3UA 4Y2TA 3W04A 1ZNZA 3K5IA 1A4IA 3ZGVA 1U7HA 3QXCA 4C20A 1NX6A 2L82A 2A78A 2Z0MA 4RUKA 2P0EA 4KYUA 2JVJA 3AHIA 1DEXA 2ZRFA 3ECSA 1ZK4A 3OPYA 4RDHA 2VYND 3DWFA 4AWXA 4B48A 4BO5A 1G5IA 4ZZ1A 4HJXA 2QX4A 1YRLA 4G5XA 4PGGA 2QAGA 1HSOA 3HDTA 5HKKD 5THKA 3T1TA 3NXSA 3HRKA 4G0YA 3QKWA 3K1JA 4CMIB 2HHJA 3NM5A 1L7AA 2FSPA 3L0DA 4WLOA 4CYMA 1X13A 2EX1A 2VQEB 1U0EA 1NBWB 2CKDA 2VDNB 3VISA 2JLCA 2OZVA 3LRPA 4AT1A 5IVDA 3FUXA 4RVFA 5ALWA 3X1KA 2ASVA 4RXTA 4C0HA 4V1CA 1O97D 3R9XA 2XUZA 1XUOA 4G56A 1QYXA 2IEGA 2CXNA 4LC0A 3NBUA 2X1MA 1QB8A 3ILXA 3OZRA 1E3WA 1SG6A 3HN7A 5DNCA 1Q0SA 4HDOB 4OY3A 3U44A 1DBWA 3EA4A 4J16C 4CEHB 4IDCA 1SOVA 2FZGA 4HQOA 3U4AA 1J7KA 3F6EX 2CHEA 1I7PA 4Q7MB 5FL7A 4XIYA 3ERCA 1ODCA 3R7NA 3O73A 3GT3A 2ZIXB 3USES 5JQGF 2VZ9A 3TXAA 4NCJA 1DWQA 1Z7YA 3BZUA 2WICA 4BRUA 1MIOB 5KNLA 2YWXA 5K6RA 3T34A 4I4TA 2OZKA 5KHAA 4EQ6A 2HF8A 5IKEA 2D8MA 1KAHA 1XSEA 1LD3A 3GVHA 4RJLA 5HP4A 4ZALA 1P2SA 1I14A 3MINB 4YP5A 1M2WA 3FNQA 4EB6B 1NU6A 1XTPA 3MWFA 4ES6A 2VNHA 5BWOA 4BAUA 5F73A 3U3KA 4NBVA 4HZIA 4AY6A 1UWVA 1RRGA 3B1YA 1P75A 1Z5UA 1D04A 2JW5A 3JQFC 3WK6A 3ZZ0A 1TCCA 4YQFA 3LF1A 5IM5A 4BN4A 4FE4A 5I8ZA 4GXQA 5K09A 2FSSA 4GICA 2SKDA 2O8FB 3NDBB 1OZHA 5FBHA 1GCIA 3VKFA 2F90A 2PEZA 3WFZA 3D8UA 3I0MA 5H02A 1XMIA 3NP9A 3HVJA 2ZJZA 2HHCA 1JSRA 1ZICA 4NEQA 2WZBA 3V8NA 4KQEA 5ITZA 4ZT4A 4WJKB 5IZCA 4GAEA 1ZM3A 2AGVA 2HWXA 3PHCA 2ALJA 4RVHA 5B3LA 4QEKA 3MFYA 4GM0A 1NJ1A 2NU8A 3IPCA 1OHHD 2JVIA 2VP0A 3INNA 5F64A 1N6RA 5B64A 3ELYA 3ZQ6A 2IS6A 5JH7F 3E1SA 1SCBA 2HPAA 4RY0A 4QU9A 3FTCA 2WHQA 3DHNA 2Z83A 4F9GA 5U4QA 4IHKA 3OM1A 2R62A 2RHGB 3GGSA 3JASB 3OFND 3QH4A 2WJIA 3VJRA 4RTLA 2PU5A 1XPJA 4IIUA 4BB6A 3ETNA 1G1MA 4IUBS 5CLLA 1YB1A 4ZI7A 4HLCA 3C39A 2LCFA 1N2SA 3DD5A 4HDNA 3ZDZB 3ZKWB 2B37A 3N53A 3G0CA 3OUTA 2CVHA 4ZCLA 1JZTA 5CB4A 3WJ1A 3VH4A 1FFCA 2XD9A 4TXHA 4RKRA 2PJZA 2ZRGA 4ESVA 3RS2A 1NW4A 3HNOA 1LFAA 3BRCA 5FHQA 4BO7A 3QWFA 4QLBA 1E60A 4HNAA 4KO1S 1LF5A 5G40A 3F0TA 3EDRA 1TZKA 2ONYA 3OLQA 3ZU5A 1FRFS 5B5SA 3R8XA 5ELLA 3VHRA 2J3HA 3CRNA 4L1KA 4UTRA 2IUTA 3GFOA 4B5LA 2Q45A 4IS3A 1TJ3A 1VHWA 1R6XA 1NW9B 1I13A 1DRUA 2CZGA 4KQIA 4DUPA 1DKRA 3IAHA 2O8CA 1C30B 1WP4A 4BO3A 1BEUB 2OFFA 1YRWA 4B45A 4B44A 5FNVB 3AEZA 4WJLA 5JMWA 1NSYA 2H1OA 3MBIA 1FLVA 4TTSA 4M98A 2DAPA 2FF7A 1KEVA 1JFTA 1Y7PA 3NIWA 1DXYA 1JPNA 2QIPA 1XZMA 1NC1A 1GFWA 3GROA 3R3JA 4HDQB 1PW5A 4OYLA 4PAOA 4BX3A 3PFFA 4E5MA 5KMGB 4MLZA 1R6UA 3D3WA 2Z04A 3W9SA 3HXMA 5J2UB 2XT6A 3N7AA 5IYZA 2MT9A 5GZ3A 2XODA 2FUEA 4XWWA 2GO7A 4LXUA 1PL6A 1Z3IX 2UZ1A 5DSTA 4RQBA 1LDMA 4HFNA 4WZAB 2ECFA 2ZM5A 2FEMA 2VSXA 3B6KA 3U9TA 2X9LA 3SX4A 3A3KA 4BC0A 3K0CA 2XT9A 3S1LA 2W6MA 3ACDA 4IV0A 5J2TB 3A9VA 3M1LA 1XKQA 2ZT6A 5GP1A 1DKUA 4J2TA 4G2NA 3SKVA 1JT2A 3P9PA 1BFDA 4QT4A 4KH1A 3IUNA 1WULS 3O4FA 4WLUA 4UVHA 4WV3A 3AFNA 2QDXA 5AW9A 2V7XA 2PUWA 3LJKA 2EW2A 2POQX 2YZMA 1BH2A 1NJ5A 3SWWA 5JG7A 3L5OA 3I64A 3RUDA 1E3QA 4PRYA 5F52A 3DYVA 1Y6FA 2XMPA 4FS3A 5CGQB 3ASVA 3ZDQA 4YRCA 4CPDA 5JFTA 1IN7A 3B13B 3B2EA 2C2XA 4B80A 2LBPA 4JASB 1CY2A 1ODFA 2QAIA 3OTQA 3I52A 2RAVA 2KS6A 1NMQA 1SIWA 1WY7A 5TEVA 4EJSC 2H1CA 2A5YB 4EELA 2ZTUA 2ATVA 2P2DA 1L8OA 1NG1A 3AGPA 5B1IA 2GSDA 1QOZA 5DPMA 1U9ZA 4KAFA 3HDJA 2HWYA 4KO4S 1THTA 2WSIA 2XNDD 2BFEA 4KN9S 2FPKA 4GZMA 2QJTA 5CXXA 3TAUA 3DZFA 5FLXA 3DDUA 4Q00A 4PZEA 5DN6A 1PS8A 3BMCB 5IBCA 3ABRB 5K4AA 1SB8A 2MSWA 3UO8B 1E9EA 3ZCPA 1N34B 3RSCA 1HYBA 1G55A 3URKA 3K6JA 5TJHA 4ZGGA 1B74A 5K9ZA 4G36A 1E2JA 4E15A 3UEOA 3IHLA 4YX9A 2CMFA 4LY0A 1FLAA 1F8XA 3EUFA 4G4SP 4IFTA 1Q11A 2QL5A 3A7DA 4FMDB 5FH9A 5B3JC 1C3XA 1GQRA 1OXKB 4JGBA 1SZDA 5LYYA 1ISJA 1G6OA 1YAHA 5FWNA 1OGJA 2X23A 1RJDA 1ODTC 1SVKA 3JQ8A 5DNEA 4UMVA 1TAQA 1Z2OX 4Q3KA 4AMBA 2XMDA 7GPBA 5AK4A 1TTTA 2YBDA 1PR9A 3UXEA 3OEHD 2ZI7A 3D4IA 2CBXA 1MQSA 4M7OA 4AJ2A 2BEVA 4H60A 3CUTA 3VKHA 4WZZA 4Q02A 1K4KA 1X8KA 3H5RA 4S0XA 1C0LA 3SC6A 4CGYA 2QQ5A 1DC3A 1SEPA 4BNFA 2XUKA 3SZLA 3NQ41 4BVBA 3K8OE 1OWMA 1TOAA 2QYSA 5F4BA 2OAGA 2UDPA 2I6GA 3DT6A 2JLVA 1O08A 3ABSB 3H5TA 4JC0A 3IOBA 4P33A 4BFUA 4J4TA 2I76A 4DADA 3EVEA 3OPMA 1LC0A 1EWRA 1RYHA 1ZKMA 3F4LA 2X19A 3NANA 4WX2B 4XX0A 5A0VA 3STVA 5JH7A 3B48A 1R00A 5DM60 5CJ2A 4ZU1X 2B3TA 1E94E 4KQXA 1GNPA 4OD0A 5EFZA 3SR4A 5KS2A 4DQKA 4ND2A 4JBGA 1CEEA 2DGDA 3FR8A 3A2MA 1U0SY 1S89A 4EJFA 3MYRA 5K8LA 1IUNA 1AURA 1ZGCA 2OGZA 3GNTA 4NMLA 4OVKA 4XPZA 4CM7A 2RONA 4B3BA 5HUHA 4B3SB 4P4NA 4DRXA 2A1TS 2HFJA 4UC0A 3WICA 1T0PA 2HSGA 2XUOA 1E2DA 2FFJA 3S5UA 1E3JA 3ILYA 2CD9A 4E4YA 3DXYA 2PJDA 1CRLA 4ER3A 4S12A 3IV6A 1I30A 3T3HA 2IYOA 3JVIA 1AMOA 3U4QB 3CTMA 2JJ2A 2BMFA 1JFSA 1I6KA 2EWMA 4DPKA 4ER0A 3CZPA 3DFZA 4N3GA 1W4LA 2GD2A 4L16A 1H4QA 4H7KA 1JIVA 1O54A 2AN1A 2WF6A 4MLPA 2PKEA 3T95A 1GTL1 4D41A 2VN8A 3QE9Y 1PS9A 2TMDA 2ZS9A 2C9MA 4PM4A 1J25A 1M1XB 1UKZA 1YI1A 3H7AA 3JR7A 4R2KA 1QAMA 4RFVA 5ALTA 4AROA 2ZUCA 3SQWA 1EB9A 5CGZA 1ND6A 2IE0A 5TPZA 4M1MA 2ODNA 2ZPUA 4MYSA 1AY0A 3HADA 4GOND 4A5SA 1PW7A 4Q9AA 1AU9A 1EWYA 1ZFNA 3LFUA 5CH8A 5DSZA 2A7XA 2J45A 4YTEA 4B34A 2FV8A 4PC3A 4GX2A 4BEBA 2AFHA 3WBKA 2IYXA 1XD2A 4EQZA 2YUTA 5HTOA 2EKLA 4PFSA 3ROZA 2CXXA 2F17A 2GNOA 3OE4A 3FY4A 4HAIA 4Q1DA 3I83A 1RQNA 1A71A 1P19A 4C7OB 2EJBA 3T5PA 2JNWA 4LDNA 2VHTA 3EBLA 4PLWA 1OI2A 2JBHA 2OENG 2GEKA 2W71A 1WZNA 4UTZA 4YHBA 4BASA 2O2EA 3ADPA 4L08A 4Q5IA 1MEOA 3SVZA 3S68A 3LUHA 3SYKA 1CBUA 1NLUA 1J70A 2XGOA 3EARA 2RB5A 3PT9A 4PG6A 4NPCA 1BD4A 5F12A 5HCUA 3BHJA 4X62B 3P2KA 3RFVA 3PQDA 1ZITA 2X4LA 3ANTA 2Q99A 2OHXA 4L3VA 1GCUA 4RENA 3O6VA 3U3MA 4CKEB 4DLSA 3RV4A 4P54A 3RYFB 1U0NA 1A9SA 1YJ5A 2EX0A 3I4CA 3MMPA 4CLRA 1GPKA 3RS7A 4BE9A 1KPIA 1EVIA 1C1YA 3JARA 4GP7A 2QLBA 2Q0QA 1KOJA 2E4AA 4TM8A 5KVAA 1EAMA 4X8MA 4LHEA 4HV4A 3VH2A 1G20B 1NIPA 1BS2A 4DM7A 3WYGA 5ES4B 4EMTA 3QKTA 3D6UA 1JHAA 4TKZA 2DECA 1EQAA 2IEAA 4WNIA 3RARA 4O4LA 4EWLA 3D8RA 7ADHA 3QVVA 2P69A 4HHEA 1YFJA 1ZM9A 2OM2A 3G2QA 3M3PA 2X7XA 1Z6ZA 4XFJA 1JJVA 1OX4A 3DKPA 1EXVA 2D1TA 3BTOA 1LQ2A 1Y81A 4YLEA 2H52A 2C92A 5AHKA 4ZKDA 3SI7A 5BN3B 1LBQA 3OTWA 1AX9A 3H8VA 4QUDA 4EH1A 4G6ZA 1B26A 5FOVA 1PCXA 3LDFA 4HDRA 4ITVA 4JYAB 4UEOA 4FFNA 1IXSB 3G8YA 1E1LA 2I2BA 4R8MA 1ACMA 2RC6A 3F6PA 1KYQA 5TQ2B 1XRRA 2BEUA 3CO0S 3A4LA 1LRLA 2EXXA 3BD6A 4CNQA 2RKWA 1J97A 4M1EA 1EFLA 1NXOA 1IZ9A 4QELA 1OI3A 5JAQA 4M1WA 1ZXXA 4OP1A 1UAAA 1R27A 4M8KA 3N58A 3UHJA 3NTXA 4NMMA 4ZVKA 1E2UA 1U8CB 4DT1B 3H5NA 3AVWA 3PVSA 1ILEA 5EWMA 2D59A 3ZBTA 5T57A 4EGAA 1P61B 2V7VA 1TTHA 4L7VA 4Z53A 1OI7A 3E81A 4HEHA 4UE6A 2C96A 4PE5B 4XR4A 5LDGA 1GD1O 4D9GA 2OHVA 1UOEA 3T1QA 4EUKA 3L0SA 4G4JA 1J2EA 4UNIA 1DLJA 3BCHA 2BL4A 2PX5A 3JYOA 4ALIA 3HP1A 3UCEA 4ROSA 3ZHYA 4B6RA 2F4VB 4GPD1 4JI5B 1EE1A 3A26A 1VJTA 4MO9A 4JI1B 4JHXA 2IU3A 5FOWA 3DYIA 3K1AA 4J75A 5A5FA 1NJ2A 2MSNA 2P3LA 4LJAA 1BWSA 4X8HA 4YGXB 1X0VA 2HEGA 5PNTA 2I9PA 2ZR0A 3GA0A 1RTTA 4BQOA 1J22A 4O8ZA 1IL0A 4QGAA 2F55A 2W4MA 2QJFA 4L3WA 3GMTA 4CKXA 2O05A 4XLZA 1RAEA 3ETDA 5HSGA 3HXOA 2ZS7A 4NOLA 3W79A 5IXJA 3OZVA 2Z8XA 3GUUA 4HB2A 2QRMA 4RLQA 3QA9A 5BWCA 2XA9A 5FI5A 1Q7RA 1U3WA 2JBAA 4IUCS 5AKGA 1CULC 3PGLA 3WXBA 4F92B 4EZEA 1V8DA 5GJBA 3AKDA 5CAEB 2CK3A 4PZYA 2W2XA 4GR5A 1DT5A 1I3LA 2CW5A 2RHCA 4LRQA 3DKKA 1O94A 2FR1A 1X7ZA 2WU0A 1UH5A 2IOFA 4H1WA 3MWDB 5IT4A 5JY6A 3NAMA 3TOCA 3P9ZA 3H04A 1P80A 1TM3E 5J4KA 2VDWA 3UWMA 4DWJA 4DA4A 2J0UB 5E7JA 2WJZB 4H7PA 3KVOA 4KGXA 1F0NA 4O4HF 2QW1A 3COVA 2PZMA 1PEDA 2B4KA 5LP6C 3LCMA 1UBFA 2QX8A 3DLCA 3WGNA 3GLTA 4LHVA 8MHTA 3WFJA 2Q1UA 5HTKA 1TW3A 2R1TB 4YRLA 5IAEA 4I8DA 4ME6A 1BX1A 1ZJZA 3PQ2A 4HRYA 1YK1A 4CRWB 3PTAA 5K3SA 3ABQB 4Q1EA 4LQDA 3SYTA 2IIVA 2O2HA 2ZTLA 3W2IA 1NBHA 1K3FA 3I5UA 3CLRD 4M7WA 3W8DA 4G0PA 1JH8A 1ZPDA 4U3JB 5FWDA 4EFKA 3DAOA 4N5NA 2PEYA 2WG0A 4LBVA 1PDOA 1PNOA 1EDDA 5H9VA 2YWBA 2PS3A 2ZTSA 2OK7A 4GH5A 4UARA 1Z8DA 2CJPA 1MZVA 1G18A 1BDMA 3RSOA 1NVDA 3L02A 1YDWA 3KT3A 1K68A 3AVVA 1WLYA 1ZX1A 3BFPA 2D4AA 1VRWA 2BN4A 2HU7A 3TZKA 1RRKA 1SXJE 3TW4A 1P91A 1J6UA 3IT2A 2ECKA 4ZD6A 2IYUA 2XT0A 3TKAA 4C2UA 4ENRA 2CYBA 2ZETA 2JZNA 3D6FA 4OGKA 4AS3A 3DLBA 1I32A 4P4TA 5T3UA 4BLPA 1WJGA 3FMIA 3K9NA 5CH3A 2HPHA 2OHOA 3R6TA 2HA6A 3PEUA 4WOJA 4QTXA 2ZJ1A 3LM8A 5KNCD 4ZI5A 2E0IA 3B1VA 3F6BX 1Y8RB 2CSUA 3DEHA 1M8JA 5FTMA 1QH8A 1XZFA 1V1MB 3GJ6A 2PKRA 4QOGA 4M6WB 1H8HA 2A5GA 2JFHA 1J9EA 2PRJA 3EGDB 4FFSA 5T5QA 3UPDA 4EAAA 3RE1A 2NUPA 3CBGA 3NG1A 1ZA2A 2ATEA 1B8OA 1TECE 2BDUA 3E8MA 3ITDA 4BMNA 2Y68A 3P9YA 2GI4A 5FEMA 2FEOA 3IRVA 4J3JA 3TK1A 1ZRMA 3BFKA 4RWZA 1A1SA 1L6IA 1I0ZA 1XROA 2WUEA 4QTTB 1I4EB 4EMSA 2W2NA 4MZDA 3CINA 4TS1A 1A0OA 3R20A 4EI9A 1GG5A 2P6OA 1SC3A 2V8BA 4EPVA 5I7OA 3U60B 6NULA 1YFKA 1D0IA 2QUIA 3COSA 3GFVA 1ID1A 5JYDA 3NHBA 1IBCA 1ULSA 1PR3A 2YV4A 2AN9A 2RG7A 4QFMA 2P8JA 2XYVA 4LYFA 5EJ5A 3GLIB 4F4DA 3QTLA 3DMFA 3T4PA 1FY2A 3J80A 3O8RA 5C7IO 2JLWA 4R8KA 2W6JA 3FZYA 5DGDA 4Q03A 1XO1A 4U7GA 1COWA 1BFUA 1QKIA 4BY9E 3DCNA 3ZS8A 1JEEA 1UK9A 2B1JA 3LDHA 4X7BA 3SR0A 3UJDA 4EHLA 3CUUA 4FGJA 3PBKA 3C1AA 1ATIA 4G0OA 4H2DA 5CNMA 1Z2AA 2X0EA 3LPDA 3O8LA 3NBYC 3HZRA 5CFZA 1NW8A 2P40A 4RHCA 1MIHA 1MVLA 4WUTA 3ZZTA 4MEAA 3HVRA 2Z2IA 2NO0A 1RMQA 1N2ZA 1U0BB 3ONEA 3T9DA 3DVLA 4AECA 3NAQA 1ZN8A 2IYWA 1M1YE 2OXTA 1Z75A 2X8LA 2XNDA 5JMPA 1OH5A 1XCPA 3G88A 3JVVA 4X1YB 5TARA 4KLZA 4BOYA 2O7NA 1DC7A 1DQNA 3BMNA 4P4LA 3CT6A 5GJCA 4CKWA 3JYQA 3GIDA 4Y2VA 3AJDA 5DOZA 2CT8A 1LB1B 3W2HA 4EA7A 1VIYA 3L7IA 2ONCA 2G7ZA 4JXKA 4HDMB 5SY9A 2PZLA 4WCVA 3W7AA 1P1CA 4KOAA 3FPAA 2VG8A 4WVFA 3LQ1A 3OC0A 4BTVA 3CRQA 3FCSB 4YCBA 3SDSA 4C14A 1QE0A 4FI3C 4IX9A 3JATA 4KIFA 3T1NA 4B17A 4FNAA 3EZXA 5LYJB 3V4RA 3QKSB 4RZSA 2HSJA 1A1VA 1FP2A 1X1QA 4UUNA 1EP2B 4YRZA 3UAYA 4B32A 1WXDA 3GJTA 3RFCA 3W1WA 4FR5A 2Y1EA 3A11A 1NI5A 3DB2A 3PE4A 3AFMA 3GEGA 3UPTA 2UZ0A 1IG0A 3V5NA 2O5EA 2PBLA 4WKNA 4JEMA 4M22A 3TDMA 1RD4A 1G1AA 4IDFA 1XLTC 4PPGA 5JXIA 3CG0A 4OI1A 3E1GA 4V0RA 1U9CA 2DWUA 2OC9A 2VRNA 3TNLA 1HDCA 1QHFA 5A1JA 5LDHA 3WAJA 1RWWA 1DO0A 4HP8A 2WD8A 4D46A 4DY4A 4P3NA 2BWJA 1R88A 1NVTA 1JYSA 3IEUA 4Q01A 3TG2A 1JR3E 1BDJA 1X8JA 2W58A 1C1DB 3EXG2 1EFUA 1XMPA 5L4NA 1W49A 4MCJA 3C5CA 4I1VA 1TLTA 2XKKA 4Z4GA 2ZJ4A 3A4MA 1HEUA 1D2HA 1DIOB 2IU4A 2WBLC 3IKLA 5BRAA 1QU3A 2VSNA 3R6GA 4R1UA 2WJJA 5LQRA 2PV7A 2QLJA 2VDRB 1UBKS 1CZHA 4OIMA 2GF2A 4O4HA 5IUJC 3ST7A 2DERA 5DI9A 2O1SA 1MXHA 5K3EA 2IKSA 3GBPA 1ZR2A 1P2VA 1XDWA 4EITA 2QUBA 3ENNA 4JYPA 4WFQA 2BFNA 1DAGA 5KBYA 1MORA 2OYSA 2YWDA 2JJ8A 1CETA 2FSFA 3ETJA 1EJ0A 3FPKA 3IVMA 3KNZA 3H5OA 3LY8A 3QVSA 1OCEA 4K6FA 5K8TA 3O3CA 3Q7RA 5SY4A 3RG2A 5EIXA 1GTRA 1JEYB 4B43A 1VE5A 1GZ6A 2FJUA 1D4AA 1EHIA 5AIAA 4YUYA 5H1YA 5IEBA 4C7MA 3EC1A 2BGMA 3CUKA 1D6MA 3QEOA 4YONB 3TW0A 2Q21A 2JVKA 2Y76A 3C1OA 3QUQA 4HOYA 4QVIA 1THZA 4I5GA 4KXMA 1LWOA 1A88A 2VP3A 3OKFA 4QPCA 4GMXA 3LQFA 4EPXA 2WJPA 1P18A 1QIEA 3VDXA 1GPLA 2AN3A 2GDJA 2NU6A 4HWSA 4QBFA 5J59A 5F2NA 2IY7A 1EX1A 3OLZA 4XYMA 1FQKA 1TAGA 1VG9B 3GGCA 3OJWA 1H2YA 2AFIE 4II3A 3ZE7A 2OXFA 1V5FA 4OAQA 5JMOA 2QR2A 2ZT8A 4J1TC 2OCDA 1X7WA 5AXAA 3ZCRA 3DZDA 1X1SA 3PEEA 3KKQA 4QYSA 4ZOQI 2EKDA 3RK4A 1RE1A 1V39A 4IXDA 4MUGA 3LKZA 4PIVA 5JZ9A 1QOPB 2NSHA 3K9WA 4REQA 2PRIA 1QONA 4G23A 4IEFB 4OAOA 4CMEA 4GZ3A 3UXHA 2CL0X 1U8UA 5E6RB 1WCV1 1VKRA 4QHYA 5CURA 4ER6A 3FDFA 2GS9A 4MDEA 3C1UA 3L7YA 4Q9HA 3BL5A 1FDUA 3FWNA 4FONA 4Q9IA 3WMGA 1GV0A 3DHYA 5KVCA 1W87A 2X2OA 5LU8A 5KSOA 5FI0B 1W85B 1KEWA 2YFQA 3HCEA 5AM4A 4F8YA 4JJ7A 4HR7A 3PR2B 3DC2A 2ZT5A 3OU2A 5ILOA 4QREA 4E46A 4A6XA 5IT9A 1T0BA 1R5OA 2D3TA 3O75A 1XBTA 1RMYA 1A8QA 1MVOA 2PGAA 2NU7A 3CX3A 4I19A 4LJ9A 3WGGA 3EAGA 4G1CA 4ONEA 4CETA 4C30A 2J5QA 1BVUA 2H63A 1ZL2A 2Q1TA 3JZMA 5J5CA 3OSUA 3TQSA 4BWVA 3WRWA 2OAEA 4ESOA 3IPRA 3LXXA 3ASZA 1XZHA 1SHKA 3DTVB 4LDRA 1GTMA 4KREA 1QAQA 1T3LA 2QSUA 2W6NA 3FYTA 3FPBA 8ADHA 3OZGA 4FFMA 1E3DA 5F1OA 4CV3A 1U0LA 1M74A 1H6DA 1GG9A 4GLFA 2QPOA 4DNFA 4JT2A 5CT8A 1ZNYA 2OECA 2IL1A 4O2AF 1TJYA 2F6RA 1R6TA 1WS6A 2G83A 4DLTA 1AQNA 4W4TA 4UPDA 1CY8A 2AJDA 3ISVA 1G8KA 2F43A 3DBRA 4KQMA 4TKVB 4J3NA 1ZH2A 5D87A 5DYWA 1E66A 2PD4A 1BKYA 2WB4A 3WGTA 1GGNA 4BWFB 3FYHA 1ACLA 3V1UA 4FJ0A 1GGMA 4X7RA 4ZQBA 5ALYA 1ZJ6A 5HBRA 1M2VA 4ZK2A 2BRUA 3AVYA 3DMDA 4FC6A 1OROA 3A9WA 4KX3A 1M7GA 2O0KA 1MQ8B 4KR2A 4LAFA 1C2TA 4MUHA 3VU9B 2M1ZA 1NMXA 2Q4TA 4YLGA 4KEAA 2FX5A 2QE6A 3AYZB 1YRBA 3V1LA 5KKCA 3G82C 3PDHA 1E2QA 2VP4A 3OLCX 3PC7A 3F78A 1RIFA 4HAWA 4P81A 4ZVRA 4NXNB 4GI7A 3ILHA 2ZYVX 3V7WA 4V0QA 4WECA 1R6AA 4LWQA 5CMLA 1ESZA 2GXUA 4OQYA 3KOOA 2ZR7A 2ZJ5A 2V7QA 2D1RA 2W2LD 3JQ7A 5AUQA 1W36C 4ZTBA 4ZQCB 1ECJA 5H68A 2OQ2A 3X1ZA 1P1RA 3LKBA 3O74A 2FPOA 3VXKA 4LSMA 3I09A 2AC7A 5J63A 4LNAA 4PLZA 3JD0A 1ONPA 4G26A 4W9NC 2FWIA 3P9RA 4HS9A 3GBSA 3T5BA 3A6GA 2GKSA 3Q3GE 4EENA 4FHDA 4HDKB 3MD0A 3KPJA 3PYLA 4A0RA 4PQYA 3UA4A 2F9LA 4LF7B 2P0AA 5KHLB 1L4MA 5CA0B 1GLGA 3BRWD 3HJFA 2G0TA 5AHOA 1Q7EA 5BN1A 1U1FA 3MELA 3E9YA 5IHPA 5C8YB 3NHYA 3IP1A 3MOIA 4LX8A 5LSAA 4EHFA 1PK7A 4QL3A 3PNPA 3ZV4A 3JX9A 2XTAA 2RGAA 4H35A 2A92A 4LDPA 3U62A 4ARSA 4HPJB 5CFQA 1G5TA 1PDVA 3PSHA 4OXNA 5JO0A 4EKGA 2QG6A 3V9PA 3AGQA 5AJWA 3RJTA 4B7CA 1PJTA 5BW5A 1UXHA 2PRKA 3G8DA 4FSHA 4UU1A 2G80A 2ID7A 4R4JA 4CU5A 3L3BA 4EYQA 3C6MA 1AHIA 4IIEA 4DLRA 4LGYA 4MQEA 3UMBA 1HRDA 3MQFA 4BQRA 4EG5A 1F6WA 3EEBA 2AJCA 1BWPA 5AKLA 2OK8A 4GPEA 3HK2A 1Y82A 2KWIA 4B4WA 2UYHA 1RJWA 1W0JA 1XDSA 3LBNA 3N2LA 4KU4A 3SCZA 1MZPA 2HA5A 2X5XA 3M9XA 4BVLA 5CEJA 2QMHA 4ND7A 5IDWA 3F4BA 1JLMA 3PGJA 4OJNA 4YXWD 1GO2A 4NG5A 1ZMOA 4ZCMA 221PA 1IN4A 2OMEA 3HJUA 5DBHX 4UREA 1KYXA 1YR9A 4L27A 4FMCB 4QXPA 4DCUA 1JPVA 4N3NA 2NIPA 1IM5A 2WC1A 2X4DA 3F8SA 5DX1A 3P9XA 1QQ7A 1NRXA 1K4MA 3NHMA 4OBXA 4DLKA 3BICA 5LU9A 1N2HA 1UL1X 2VBIA 3L8ZA 2X9NA 2WWGA 4Q47A 4WESB 3GWZA 2IX3A 2FMXA 3N0RA 4JI0B 3BFVA 3RYIA 3WRXA 2QTVA 1TTPB 3FXAA 4J0GA 4LJRA 3PWZA 3S8YA 4H7DA 2ZUWA 4OA8A 5CBPB 4YO8A 4DA7A 2ZBDA 1XAGA 3RGWS 3K1TA 3IDAA 1J8DA 3KTDA 4INOA 4P34A 2HMWA 1I2AA 4LK2A 2Z9DA 2CLOB 1MHPA 4KPYA 1AD2A 4U2GA 2ZPAA 4ETIA 2OD9A 1PWHA 3ZDCA 4NMHA 2PT7A 4RA9A 2ZYRA 1PQ4A 1VGRA 3LF2A 5AR1A 3R75A 3ZDAA 4UBKA 2FTKE 3ZIDA 3WJ7A 3FBTA 3JQBA 1XZPA 3OKCA 3LZDA 1JSZA 2IUEA 3Q3VA 1VLJA 1ID8A 4EKYA 3P26A 3NT5A 3PQ7A 4UHHA 4U8HA 5GPBA 1VHQA 1NI4A 1QLWA 2P9QA 1LPSA 3PUZA 2GX6A 4CE6A 1AK2A 1DAKA 2QZZA 3OY2A 3L4EA 3NTQA 1L1EA 3FSEA 4ZOBA 3V8MA 3W1VA 4C4AA 4CN9A 4F4JA 2C7VA 3QQ5A 1VM6A 1TEHA 4X6XA 4BWYA 4XR9A 5CFOA 3RUIA 2FN8A 1IH8A 3HLTA 4LZZA 4B4OA 1N1EA 4TSFD 4B7UA 4UCQA 2R1VB 5EJ2A 3L8YA 5FADA 1NZJA 1SR8A 4AUEA 3BOSA 1TO2E 2BFMA 2QROA 3DF9A 4O2AA 5D3MA 1QJCA 1H1LB 1II9A 2ECQA 4CG2A 4LNUA 4FHGA 4E6PA 5AVYA 1O77A 5U9CA 2B4TO 3C4JA 3HBLA 2O2CA 1ZUNB 1TZ2A 3BGDA 4O3FA 5EUQB 4BLTA 2DBRA 4CMAA 4P3KA 1K6EA 4JJAA 2D6FA 3MRXA 3OM0A 1Z22A 3L05A 1CEYA 2W6CX 3ELDA 2QMOA 2ST1A 3QI2A 4LF9B 1ONOA 3QJ5A 4PFJA 4V39A 4WZ6A 1NN0A 3HNRA 1ZDMA 3IMCA 2VJAA 3KQYA 1ECBA 4JZYA 4L75A 4BNHA 1OFGA 1PJ8A 3VZDA 5K0ZA 2YNMA 3OOYA 4RHXA 3DFMA 2QLLA 3ROTA 3V8RA 1QGED 1B41A 3AH8A 4MW1A 1N6NA 2JKVA 3IRUA 4F3YA 1KL7A 3BJMA 4CM6A 5EXXA 3QU9A 4LPSA 4H77A 1R0ZA 1F5NA 2P9YA 2VNKA 3IUSA 1USWA 4MLDA 2BZ1A 4J9UE 1DOHA 2JDID 4QDKA 3NGLA 4CCYA 2D0OB 1YCGA 3LCRA 2C8VA 1TAUA 2XYPA 4CM4B 4CG3A 2QTRA 3M6IA 5TY0A 3TZ6A 3VC2A 3E2IA 4C76A 1L0BA 4D4HA 4MS1B 3PUIA 4BRSA 3OCUA 2XMSA 3QW4B 3QWHA 3V6LA 4BNMA 2QWXA 4FINA 4HWKA 4LVNA 5JJBA 2JIDA 1NF9A 2ZB4A 3MRVA 1O96B 1TEVA 3DAYA 5D86A 5KWVA 1WV0A 4N7MA 4ZTZB 1CIVA 3TZLA 3VNBA 5JAHA 2V5AA 4CNBA 3JPYA 4RJ2A 4YRPA 3TCXB 4CM8A 1PR1A 4AG5A 2QMQA 1C4KA 1T2NA 1OC2A 1T26A 2C3YA 3SJZA 3L8EA 3IAM1 4EG8A 2JCYA 5CFNA 3TXXA 5TLSA 1TF5A 5B55A 2FR8A 2WNIA 1SKAA 3UT0A 1NQXA 2ZJ0A 3UWSA 4QE3A 4QXOA 1I36A 1Y5RA 1M10A 4WOBA 1DDGA 1TQ8A 2XWSA 4FFBB 3SBXA 5B6PA 2GCNA 3CFYA 4UD2A 4XWAA 4AF8A 1U9IA 2R0QC 1ADFA 1Z47A 1MKYA 5CDYA 4EJ2A 5KX5B 5C53B 3PIRA 2ZYIA 4WASA 3BM5A 1XKLA 4CDGA 1P8JA 1MX1A 2I2XB 2QUHA 3AB3A 1JEDA 2LKCA 4HZGA 1W7AA 2CYCA 2PX8A 4MWEA 3OIVA 4DLUA 4FSXA 4KXVA 4W7HA 4DF3A 3DOEA 3R7BA 3CT4A 1E1CB 3QFRA 2XDQB 4IZ6A 2CVOA 3B12A 3ZZNA 2BBOA 3P9SA 4MHOA 5E1OA 4F2PA 4HLQB 2ZSAA 1C0KA 1YCFA 2LP4Y 3Q9SA 4M86A 4X00A 1ZK0A 3AJ8A 5EIBC 3W5DA 1E2NA 1KORA 2VK4A 3L8HA 1KKLA 2FN9A 2OGWA 3R7AA 1BN6A 2PLNA 2XQVA 4A73A 2B3DA 3MLBA 4R8VA 4DLNA 1IBKB 3BHNA 1SXJA 2J9FA 3ZUGA 2BMJA 5JEEA 4ZXPA 1F3LA 3C3KA 1WPGA 3LMKA 5EN4A 4DVJA 5K6AA 4M8NE 5GWXA 1N0HA 3CH5A 3ZU6A 3IUMA 4PC7A 2X0DA 3EXFB 1EVKA 3AO0B 3DP9A 2G9UA 5EIHA 5TQJA 1IUOA 1OLXB 5BT8A 2ET6A 4LRXA 2VOJA 3IHWA 3UJ6A 1UQUA 4N4AA 1GG2A 1WU7A 3QP9A 2XNHA 5EQTA 1YBHA 1JEJA 4JMLA 3U3RA 2XWPA 2ES4A 2C3OA 5AHRA 5AJYA 2FRDA 2F00A 1B1AA 5AW5A 5CX1B 4EARA 1LDNA 1V5GA 1PT6A 3RJ5A 4F56A 721PA 3OQHA 5D1HA 1RYZA 2HCTA 4NE7A 1P5FA 2HDNB 3R7DA 3S28A 4D80A 3WYAA 1NL3A 3HBMA 2P77A 4C6RA 4X1OA 3CZRA 1O5IA 4DLPA 3GO4A 5IARA 2M6KA 3K7EA 1Y7HA 2GM3A 1RZVA 3KB8A 1DAIA 3DDOA 2H8GA 3H2GA 3HA3A 3GFPA 2A6PA 5DVZA 4DQLA 5BNIA 4FIDA 4TWAA 4P7JA 5EIEA 4LN1A 3NM4A 4H15A 2IEYA 1EIZA 1GRRA 4G67A 4Y6PA 3F1LA 3FYUA 4M46A 1PL7A 1DEKA 4FGUA 4N0QA 3W1EA 4ENWA 4EY4A 3FYDA 5A06A 1EESA 3E9MA 1JWBB 2LPMA 2N0SA 3FVRA 3H13A 4XYBA 1PSWA 4XA8A 4O6VA 3WZLA 4GI3A 1MJ5A 2CJFA 2IPAB 2B2CA 3NT4A 5K0CA 3IB6A 2JLZA 3GPIA 5FA8A 1LPBB 3QNUA 1DDOA 2QW0X 5ITWA 4F5DA 4EG0A 1GZHB 4RV4A 3IILA 2IZ0A 2P9TA 2R6R1 4FU0A 1CB0A 1MOQA 3COYA 4Z8YA 1IUPA 1HT3A 1PT9A 3VPGA 1IOZA 1Y4ZA 1DINA 1N57A 3MG9A 3NO4A 1QBKC 3EDOA 4RH0A 5GIOE 1PL0A 2QN8A 4TM7A 1UXOA 3N59A 3AY0A 1C7FA 1M1YA 1RQLA 3GAFA 3SYLA 1BMFA 2F64A 3AF1A 3BHMA 3V80A 1TJ4A 2OB2A 2FN7A 4F7DA 3VDMA 2QL7A 4LXYA 4N49A 5KYNA 4J2HA 4BC1A 4K8OA 4HGPA 3TJRA 1LCIA 4WWHA 3FIUA 4H0CA 3BMOA 2LKDA 4YMVA 4XD2A 5FFMA 1T43A 1WE2A 4M1KA 5F9HA 2DVMA 2I7DA 3NZEA 3RANA 4BP9A 1VG8A 2HRCA 1STOA 2PFKA 2A9VA 1KZ7B 1E9SA 3IKTA 4PAGA 1XCBA 3MWYW 2QAGC 4D3ZA 1J1ZA 3L1VA 1QRAA 1G3MA 1PFKA 3HKDA 3I9FA 3AR7A 3KQWA 2F3QA 2R47A 4WA7A 2CXPA 5DCYA 2Z2KA 2DZDA 3RVPA 4RS3A 4JI4B 3U31A 1VE1A 4D8YA 3PNOA 1TVEA 2DQKA 4WAUA 1VE3A 4B82A 3GLSA 3Q9NA 4OK5A 4B5KA 3CXUA 1JAZA 1FX0B 1ZMTA 3GRZA 1P1KA 3K72B 4RKYA 4IRXA 3KJQA 2PGIA 3PXAA 4IIVA 1JG6A 5DHPA 1QVZA 5IDQA 4FS8A 2XWJI 2ZIFA 4KHZA 5KTMA 3KV1A 2VQ3A 1GJRA 3IBYA 4G25A 4D5EA 1MP0A 4U2CA 3UB2A 1LX6A 1ABEA 1JR3A 1KJWA 1RABA 3FNRA 4Q48A 2Q4EA 4C1NA 4Q34A 4AS1A 4AZSA 3BX1A 1WA5A 1ITZA 1HQKA 3UW1A 1ZN7A 3E9EA 2ZBUA 1JQBA 4GBJA 1IJKA 5H70A 4TRMA 1NAIA 2WVJA 4MGYR 4NE2A 4EI2A 1BXKA 4HWPA 1CHDA 2SCUA 1FYFA 5FBWB 2O9JA 1OB2A 2JIZD 1M8PA 1VP3A 4C22A 5AK5A 3EN0A 1EEHA 1NDUA 4UXHA 3X1JA 1JDNA 4LRSB 1YQGA 4ZMSA 3K6RA 5HF6A 2VRCD 3HSYA 4GPAA 3BEDA 1Z5NA 1FS5A 3P94A 1ZW6A 2P4QA 1Z0UA 6REQB 3ZN2A 4HAZA 521PA 4LW8A 3E2PA 2RK6A 3A10A 4I36A 3B3JA 4E88A 1OTXA 2EF0A 4MJLA 2Q2WA 2DPLA 3DB1A 4Z2YA 2R7LA 5C5EA 1B00A 3BZWA 3HQ4O 1FDTA 1RJ9A 3K0KA 3OFSA 2Q0HA 4I5IA 4JSRA 4CIXA 1BVYF 1Y8AA 2XITA 1KYYA 1SOMA 3LC0A 3OECA 3T7KA 3VR6H 5I7HA 1YVDA 2XPCA 1VRCA 3L0YA 2B5WA 3SKXA 4DDHA 1JJ7A 1QP8A 5E9AA 2ZTMA 2ZZNA 3GX1A 2YVKA 2KLBA 5IZCC 3Q3HA 2FNAA 4LV6A 4X93A 2QM0A 2SKCA 1OOEA 2OV4A 2R9VA 3OQBA 2I3GA 3C3WA 2YJNA 4OHRA 4R3UC 1XRLA 3LSTA 3MWKA 5CHEA 4EGSA 4RY9A 1ZYUA 4H9GA 1PEKE 1ZY2A 1OLUB 3EWAA 1R4ZA 1GILA 5DW0A 3WJ2A 3GLFE 2I6FA 3WLRA 1MT3A 4NATA 2XJ4A 1GITA 1VSVA 2WHPA 1KGDA 2YICA 1KJQA 2ZYDA 3VNQA 5I8PA 1GNRA 2A94A 4M83A 5J4VA 1OH7A 2X0IA 2BE9A 2DY1A 4GIBA 4IIGA 5DN9A 2VXCA 2GGSA 5HJEA 2X8JA 2R5NA 2H6EA 4MWSA 4Q4JA 4R2WA 2AOWA 4JAVC 5H9WA 3B70A 3JSAA 4KBGA 2J5XA 1LRKA 1SCDA 1NXWA 3P9IA 3U48A 4EYKA 1LDBA 2BGRA 2ZB2A 2OXCA 3UATA 1L7XA 3OU6A 4FT4A 4LGCA 3HVHA 4QNMA 1GWNA 1O6FA 5HMLA 4P3PA 1NE7A 1X80A 3GEMA 4DNXA 1FUEA 4J76A 4WN9A 2QZJA 1RWMA 5JBIA 4L0CA 3SX2A 4GC5A 3W5BA 2IDJA 1ZGGA 4HAVA 3T3OA 1KE1A 3LUAA 4LJLA 3Q2OA 3H05A 4URYR 5G0SA 4JLUA 3ULKA 5I9LA 2X8BA 2HHHB 5GM2A 3AHCA 5CB8A 1TF2A 1Z5GA 3VPSA 1Y4UA 4KXUA 2CFTA 3AUFA 1Q16A 2ZIWB 4W6QA 5AI8A 4TN5A 4D99A 2X5NA 4YJ2A 3HXKA 3OCYA 1H1DA 2G71A 2WV7A 1URPA 3CPSA 2YOHA 4RDIA 4Z5XA 1EK6A 3MB8A 3UK7A 4JGGA 3SXUB 1IAVA 4MWTA 4LOIA 4V0OA 1GKYA 1RBMA 3D3QA 3WMRA 1FS4A 1T36B 1JYEA 3DBHB 3L1KA 1QCYA 4YI3A 1F20A 3PJEA 1JLRA 4C0LA 4ARCA 2B8TA 2DT5A 1NN5A 4I46A 3QELB 1SU8A 4ALNA 3KE8A 3KEMA 5KJFA 1X77A 1DEAA 2CCJA 2CLCX 5JI3E 1UK7A 3KR9A 4W7IA 2ECOA 1KYWA 5J1TB 3RUHA 1BWQA 2P2GA 2QT1A 1I51A 1YA8A 3NIGB 3I2GA 3DXFA 4UPVA 5CVCA 4ZC1A 5I6DA 1G0OA 1O87A 2XADA 3KU4A 3K1YA 1QV9A 4RGBA 3KHTA 3K0CC 5E8JA 1BVHA 4A8JB 2EJCA 2CMKA 2XA1A 1QRDA 4P93A 4B4VA 3IP3A 4XE5A 1V0JA 4KPUB 1VHJA 3E5MA 3LS2A 2ZRBA 4V1CI 2YV3A 4I9HA 2HJVA 1RSZA 2O23A 4R9SA 2A1UA 3DE6X 1E1YA 4EF6A 1CLEA 3IT3A 4DIDA 1UBHS 1T2UA 3PUKA 4G81A 3H75A 2VQ6A 1Z34A 2PNJA 4E5SA 4JKYA 1RTKA 2IE8A 4B3FX 2ZCUA 1FSPA 5KEIA 1FYXA 1ADGA 1ZM2A 2RG1A 4P35A 4X6LA 3OHSX 4HS4A 4WZBE 4IDQA 3A27A 3ZG6A 2LCQA 4J6FA 2HO5A 1MW8X 3AFHA 4BV3A 2CY0A 5AXCA 4FDAA 4DQ0A 5IHXA 3IQGX 3PJDA 4RHUA 4F2DA 1U0RA 3TRFA 1S4QA 4FCCA 5FIUA 3H2IA 2Y0BA 3Q8LA 3LL7A 1HX7A 4FQ8A 4NQRA 1LVHA 3UPUA 1A8SA 4C88A 3CGGA 3EXEB 2PWZA 2HJRA 3GRRA 3EPPA 1FYWA 4PANA 1YJCA 3GJ5A 3OZWA 4Z1MA 1KVRA 1SXHA 2FMFA 2ZSUA 3IDQA 5FO1A 3WB2A 4H7FA 4DLYA 4XQ9A 1HG0A 3SHWA 1HLGA 2JCGA 1NW6A 4NP6A 2C1EA 1UDCA 4NAVA 3CR8A 3JV7A 5FLEX 2J8ZA 2YFHA 3C8ZA 3NOOA 3UMJA 2Q2OA 1P5RA 3NWPA 4JJ6A 1KWKA 4RTSA 2WU4A 2LCIA 1LSJA 3KPUA 3PQ3A 8OHMA 1L5SA 3O84A 3QKUA 5BQXA 1VL8A 4YV7A 5KVSA 2F3UA 2GEJA 3UFXB 3DTVD 5JECA 1AQLA 4KB5A 4L8VA 2RGYA 1WSAA 3CNQS 5CM8B 3DMRA 3MS2A 5F9MA 4Y6LA 4LG1A 1IBSA 1W0KA 4RZHA 1WB6A 1KY5A 2JIMA 1KP9A 1U8YA 7REQB 1ENYA 2PIAA 3D31A 4F8EA 2PQ0A 2BIFA 3GUCA 2IYLD 3EXHB 1WHTA 1EVLA 3HBJA 4LCEA 3RT1A 4WBNF 1FJXA 3PNLA 4MUFA 3FUCA 3HACA 3V2IA 3IPLA 3NKLA 3V1KA 4F60A 3ZGZA 1IM2A 1NV9A 2WSYB 2IYPA 3ICVA 3W2GA 2R60A 3EZGA 2I7XA 2PO5A 3WK9A 1F8YA 1FNNA 2B82A 3OMLA 1RCUA 3ADBA 3WYCA 1XTIA 2CUZA 2GHRA 2H54A 5E4YA 1J21A 3ZE6A 3L07A 1IAQA 4GVXA 2X5JO 4A6DA 3FOZA 4LZJA 3ED5A 4UQOA 3WP1B 4PPFA 4DZTA 4PYRA 4R16A 4OFWA 5JO9A 5EE5B 3RTCA 1G8YA 2IHVA 1WMAA 3ET4A 4XB6B 4P7BA 1QR6A 1VTKA 4PLTA 5LQNA 4XM2A 5GONB 3FX2A 1T9AA 3HZHA 4Q19A 3DVRX 1BMDA 1T9ZA 4Q37A 2OOSA 4WH0A 5ALJA 1H0HA 1GPH1 1QFJA 4ERXA 1T10A 3TQQA 3H1BA 5CVVA 2NZJA 4UEQA 2FPIB 4KDEA 3LCCA 2EP8A 4ICIA 3W5CA 2XE8A 1AIPA 3G1WA 3QVUA 4G89A 4KTVE 4RVCA 1PGQA 2H5JA 4E5VA 3QOWA 5AOCA 1TX4B 1YZGA 1TADA 5DBGA 3QNWA 4MINA 3SC2A 4RANA 1IOLA 1YIDA 3AEKA 3GFTA 1K89A 4FWTA 2HEIA 2FLWA 5FQNA 1AH2A 1Z2PX 4AZ0B 4BQNA 1Z5VA 1QMGA 4KL8S 1AKQA 2EVWX 2IW3A 5EIOA 3GFRA 5BRNA 4Y9SA 3F3MA 2EJWA 2QPLA 4BO1A 2G77B 1L4FA 1YASA 5IJXA 1AUPA 3FMGA 2HW8A 1KJ9A 2LXNA 2YHIB 4Z4QA 1BDBA 4D1YA 1X7YB 4KUGA 4U5QA 2ZP1A 3TLGA