3THRA

Crystal structure of rat native liver glycine n-methyltransferase complexed with 5-methyltetrahydrofolate monoglutamate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
286
Chain Sequence
b'VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine N-methyltransferase
molecule tags Transferase/transferase inhibitor
publication title Differences in folate-protein interactions result in differing inhibition of native rat liver and recombinant glycine N-methyltransferase by 5-methyltetrahydrofolate.
pubmed doi rcsb
total genus 90
structure length 286
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 3thrA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3thrA02
3UJ7A 2FYTA 1G8SA 4PYMA 3B3JA 2AR0A 4OBXA 2PXAA 5DX0A 3QOXA 4C03A 4K6MA 5FWDA 5F2NA 2HMYB 4FP9A 4E2WA 3BGVA 4CKCA 4POOA 2YXDA 5EZSA 3TKAA 4YUYA 3OU7A 4F86A 2JJQA 3P97A 4PINA 2ZSUA 4AUKA 4E2YA 3SSMA 4MTLA 2GLUA 2PXCA 3KKZA 3WSTA 5K0JA 5LR6A 3GU3A 3KQOA 1MHTA 1X19A 3TKYA 2HNKA 1YB2A 3DTNA 3OZSA 4WVLA 4AX8A 3OE5A 5T6BA 5ERGB 4EKGA 5FHRA 1ZKDA 3DH0A 3HVIA 5FUBA 3GDHA 4BLWA 4RTSA 5DX8A 1U2ZA 2AN5A 4PGGA 2I9KA 3C0KA 3FUVA 2VDVE 1HMYA 2VZ9A 1Z3CA 4JXJA 4LWPA 2IH4A 4KDCA 5KYGA 5KVAA 3FUUA 2JH9A 3KHKA 4XCXA 5DRYA 3NMUF 2PLWA 3SXJA 3SM3A 2ZZKA 3EVBA 1Q0SA 1VP9A 2H00A 2Q41A 3C6MA 3G8AA 3KQSA 4PCAA 5DTQA 5E9QA 1VP3A 2JHCA 2ZLBA 3EVDA 5DXJA 3V8VA 3LDUA 1ZGJA 4OA8A 3M4XA 4BP3A 2PV0A 1R74A 1ZGAA 3TQSA 3MHTA 1AV6A 5E8JA 2ADMA 2AOWA 1XVAA 3LCVB 3L8DA 4GC9A 5FCDA 1P91A 2AS0A 3UA3A 1WXWA 1P1BA 3P2EA 5G02A 4E2XA 1BHJA 4M38A 4DZRA 5JR3A 4YV2A 1UIRA 1KXZA 4XUEA 3G2MA 1L9KA 1RI4A 4BP1A 4ER3A 2HWKA 4OQDA 4E30A 5E2AA 1G55A 2ZFUA 3HVHA 1NW3A 2O07A 2PKWA 4G56A 4OQEA 2FK8A 3NVMB 1R6AA 5ICCA 4RX1A 5K8VA 2AOTA 3TR6A 1KYWA 3HCEA 3LPMA 1XCLA 1FP1D 2IDKA 1N7IA 1BKYA 2ZULA 5DTMA 5EHGA 1NV8A 4CWAA 4RVFA 3S68A 3GIWA 1QZZA 1YZ3A 4DF3A 4RTMA 3KQTA 3V97A 2AOUB 4XUDA 3VSEA 2AVDA 2B9EA 3IYLW 2DULA 3M6XA 4RWZA 3T7SA 3BGIA 4R6WA 2NP6A 3ELDA 3G88A 3MTEA 1MJFA 4CKEA 3G8BA 1T43A 3EPPA 3MGGA 5HIJA 5C9ZA 3B3GA 3GRRA 4P7KA 2EG5A 2PT9A 3TLJA 2AN4A 2UYQA 5GWXA 5E9JA 2AOVA 4FZVA 2YX1A 3A7DA 4HTFB 2AOTB 1TW3A 1DUSA 4P7FA 5LQAA 2G8NA 1YUBA 1JG3A 5E1BA 4QQNA 5C0OE 1TW2A 2IDJA 4LG1A 3OFJA 5HEKA 1RJGA 2BR4A 2O06A 3B89A 3UJ9A 1DL5A 3SSNA 1EAMA 4QTUB 3A7EA 4IKPA 3TM4A 2O05A 2G1PA 5ICFA 1R18A 2P40A 2OYRA 3P2KA 1M6YA 4IWNA 2Z6QA 1FPQA 2A14A 3BWMA 1IM8A 3HCCA 5EC8A 3RW9A 2NXNA 1NW7A 2BR5A 1UFKA 3KQQA 4NECA 2NXJA 2Y1XA 2GH1A 2C7QA 2B78A 2YVLA 3CJTA 3FRIA 5EPEA 4ER6A 1FP2A 5IKMA 2CMGA 1VLMA 5DRTA 1QAMA 4C06A 1R8YA 1ORIA 2Z6AA 4P7GA 2IH5A 3MCTA 3GWZA 5LQNA 3I5UA 1FJXA 2VDUE 4WXHA 3BT7A 2AVNA 2PGXA 1VPTA 1JG1A 4AZWA 2HR1A 3DLCA 3P9NA 5KQSA 1NE2A 2CMHA 1R8XA 3AWIA 3P2IA 1JQDA 5DX1A 4GBED 1ORHA 3LDFA 4RSRA 5DWQA 1ZG3A 3I53A 5EEHA 2JG3A 2ZZMA 3LSTA 3OFKA 1VBFA 3C3PA 5C1IA 2QRVB 7MHTA 4EMSA 3KR2A 1O9HA 5BXYA 2PT6A 3CJQA 2ZWVA 3LBYA 2DPMA 2IIPA 1UWVA 4GQBA 4M7RA 1JG2A 5HIIA 3X0DA 4RVGA 3SVZA 5K0EA 3HM2A 3MQ2A 3EVGA 3ER9A 5EKXA 3A26A 1XCJA 1G6Q1 1KHHA 1NV9A 1SUSA 3A27A 1KR5A 3DXYA 3KPYA 5K0NA 5BP7A 1YFLA 2P41A 5K03A 3HCBA 1JR4A 3TOSA 1NT2A 1N2XA 2P8JA 1KP9A 3AXSA 4PIPA 4QVGA 3FUWA 3CCFA 2P3OA 3FYCA 2PSSA 3GRVA 3KQVA 3PX2A 2WA1A 4UOEA 4ZTBA 3OE4A 2OB1A 4ATNA 2HTEA 3FPEA 3O4FA 3P71T 3HP7A 5EG5A 5LQUA 3SSOA 2ZVJA 3AJDA 1YZHA 3G5TA 4MWZA 3NW9A 4PYLA 3UBTA 4R6XA 4M37A 2NXCA 3BUSA 3BWYA 5K0BA 3PS9A 2WA2A 4L7VA 3Q7EA 1I9GA 2QE6A 3IEIA 3B3FA 3ORHA 5D1HA 1WG8A 3B7PA 3DMGA 4DQ0A 5KQRA 3C6KA 3M6UA 2ZIFA 2P3LA 2FK7A 2YR0A 3ANXA 3Q87B 4X60A 5E1OA 3MCZA 1L3BA 3UA4A 5DT2A 2OB2A 5GM1A 4MQ4A 4RVDA 5E2BA 3AY0A 2UYOA 2E5WA 2ZBRA 3DLIA 3G2PA 4FT2A 3O7WA 5E8RA 5EQJB 4KRGA 5B1SA 4E2ZA 3PLAE 4QDJA 4RV9A 5EIFA 1V39A 3BGDA 5DSTA 5EMMA 1HNNA 2JH8A 4R05A 4YV0A 1JG4A 3LCCA 2PVCA 1OR8A 2H11A 2YTZA 3GXOA 3NWEA 3PFGA 1SQGA 4AZTA 3LDGA 3A25A 3ERCA 3HVKA 4GC5A 5DM2A 4RVHA 3TM5A 1INLA 2B25A 5T64A 4DA4A 2BH2A 2EX4A 5FA5A 3FPFA 4GOMD 5HOQA 3OPNA 4PWYA 2ESRA 3KPJA 2F8LA 1Q0TA 4HC4A 2UYHA 4DMGA 1N7JA 1RI1A 1QANA 1X1BA 5CD1A 3R3HA 3CC8A 4QDKA 3EVZA 5FQOA 1JTFA 3REOA 1NBIA 2EJUA 2FHPA 3CVOA 3KQMA 2OXTA 3EGVA 4RTOA 2HV9A 1SKMA 8MHTA 4QTTB 2FRXA 2PY6A 5F2KA 5K09A 3FRHA 4CTJA 2R6ZA 2OKCA 2XBMA 4FGZA 4LWOA 5K05A 5D1NA 3THRA 1SG9A 2XYVA 3G89A 2P7HA 2FPOA 4OA5A 3MB5A 4PCLA 5CUQA 1L3CA 2OO3A 2EJTA 3I64A 2AN3A 4R8SA 3TRKA 3HVJA 3FPGA 3EVFA 4LECA 4C04A 3P9CA 5GIOE 4QPNA 3CGGA 5CVEA 3GCZA 3P9IA 3DUWA 5DM1A 5HFJA 1XXLA 2NNWB 4GUAA 4PNEA 2ZWAA 3CJRA 3DXZA 3HA7A 4Y2HA 4DCGA 3LX6A 3E05A 5ICGA 2QY6A 2V7EA 2IGTA 4HTFA 2V74B 2PWYA 2QYOA 3M6WA 3SMQA 5ICEA 5KS2A 3GGDA 1RJDA 5IH3A 3HNRA 4RTNA 2ONYA 5LQKA 2ONZA 3KPWA 3BKXA 3LECA 4HH4A 5FQNA 3JWIA 3QOWA 4YUZA 4DKJA 1ZHFA 2PX5A 3UJDA 4RTPA 5FTWA 3KQPA 5EVJA 5T67A 1QAQA 3KQYA 2ERCA 2PX2A 4IV8A 1RI3A 3NVKI 4FT4A 5LQJA 4GEKA 5K0LA 1VQ1A 4V0RA 3MTIA 1WY7A 5GOZA 3VYWA 4X63A 3R9XB 1QAOA 2GS9A 5GP1A 1IY9A 4C4AA 1IXKA 2ZCJA 3A4TA 2UZ4A 3IV6A 3OZTA 5HILA 3KU1A 5BW5A 3P8ZA 1YFJA 4GOND 5CVJA 3FTEA 4KW7A 5DM0A 1RJFA 2FCAA 4FSDA 1D2HA 1XTPA 3CKKA 1QYRA 3BKWA 2PX8A 2GB4A 4KDRA 2IFTA 3FPHA 3THSA 2G70A 3KPVA 5EGSA 3C3YA 5CCXA 3R24A 5GIPE 3HA3A 2GPYA 1VIDA 3K0BA 5DTRA 3HTXA 3CBGA 3DP7A 3LGAA 4ER7A 1JSXA 4FR0A 2UYCA 1O9GA 5K0FA 4EK9A 3FPJA 5FADA 3GO4A 3E7PA 2IBSA 2QM3A 3ER8A 3G2QA 2WK1A 1F38A 3UZUA 2K4MA 1PRYA 2B2CA 2C7OA 5JUWA 5CIYA 3FTFA 3QV2A 4QQKA 1JQEA 3KR1A 4U7PB 1VE3A 5E1DA 3PVCA 4PYIA 1D2CA 3HEMA 4HGYA 2JHAA 1KIAA 2PBFA 1BC5A 3BZBA 5FA8A 4HG2A 3LBFA 5LQCA 1EJ0A 1JQ3A 3OZRA 2CKDA 3UJ6A 4BY9E 4MHTA 3ME5A 4GF5A 2ZIEA 5EOVA 3EMDA 3EVEA 2C7PA 3FUXA 3HCDA 2OBFA 2NYUA 1VL5A 2ZZNA 3EGEA 3FUTA 3EGIA 3DR5A 3FTCA 5GM2A 4C08A 3UJ8A 4R8RA 2AOXA 3NTVA 5LQRA 3JWHA 4YMGA 3PX3A 5EIWA 1I4WA 5BW4A 1NKVA 3T7TA 3T7RA 3I9FA 3OU6A 4FS8A 2CL5A 1SUIA 2GA9A 4X41A 3BXOA 2XVMA 4PGHA 5K0GA 4HSGA 3NDJA 3VC1A 4RTLA 3PTAA 1XDUA 2VP3A 1NW5A 2BM8A 2VS1A 1I1NA 4HRAA 4O29A 4IV0A 1M0EA 2I6GA 2AOUA 5H02A 2B3TA 3NJRA 1X1DA 2OZVA 2ZBQA 4B17A 1EQAA 1DCTA 1SVUA 2G72A 2Z6UA 3GNLA 3ELYA 1RI5A 4F85A 2GAFA 2PWPA 1AQJA 1H1DA 2LD4A 4YUWA 3D2LA 4Y30A 4AZVA 3U81A 3KR0A 1XDSA 2ZTHA 2O0LA 3LL7A 4H0NA 4X1OA 1ZQ9A 3BWCA 4CTKA 1WS6A 2IPXA 1SQFA 3G7UA 3LCUA 3E23A 1F3LA 3NDIA 4PIMA 3SR4A 2P35A 2BZGA 3JWJA 3HCAA 2XYQA 3T0IA 2IBTA 1AF7A 3IHTA 3P9KA 3GRUA 4CXMA 1D2GA 2I7CA 5DSXA 3RIEA 2PX4A 3GRYA 5DPMA 4ER0A 2CWWA 3KQWA 3M70A 1AQIA 3UJAA 2ZBPA 2EFJA 3GRZA 5HIMA 5U4XA 4GOOD 4BLUA 1R00A 4QVKA 4DCMA 5HIKA 4KVZA 4PYKA 5K01A 1L3IA 3TFWA 2PXXA 3UWPA 1TPYA 2XYRA 2YUIA 3RODA 3SX0A 4CKBA 1G38A 3EEOA 5EZQA 4DM3A 3KPUA 5EMJA 5DXAA 1P1CA 1YF3A 5HZMA 4E32A 3TMAA 4KWCA 1B42A 2PJDA 4BLVA 4P7JA 4F84A 4MIKA 4XUCA 4V0QA 4A6EA 2NXEA 4RTRA 4E33A 3F4KA 4YUVA 2IH2A 1Y8CA 3ELWA 3ID6C 2H1RA 3LKZA 3O31A 4AZSA 4C05A 1P39A 5FULA 4PONA 4YMHA 1L1EA 4Z2YA 4QPPA 4RTJA 3TPZA 2KW5A 4KIGA 4PYNA 4E31A 5LSAA 1XJ5A 4OBWA 1RI2A 1G60A 3B5IA 3BWBA 3HA5A 5EMLA 3MAGA 3LKDA 1JSZA 2VDWA 4RTQA 3G5LA 3PFHA 4U7TB 4RTKA 1EJ6A 1X1CA 2XVAA 5DLYA 3G2OA 3LHDA 5MHTA 5FHQA 2P7IA 3FTDA 3PB3A 4C07A 4RYLA 4EQZA 2YQZA 4KIFA 3EEYA 5GINE 4FSXA 4OX9Y 2AZTA 2YXEA 5EKUA 3FZGA 2OPBA 3ELUA 3DXXA 1PJZA 3MERA 3R0QA 3KR9A 5DM4A 4M36A 1NBHA 2BM9A 3JWGA 1EG2A 3PT9A 5CVUA 5F2OA 2P1DA 3NWBA 3R6TA 1XDZA 3DOUA 3UJBA 1X1AA 1O54A 3UFBA 3GJYA 5EEGA 5K0CA 2O57A 3FYDA 4X61A 4YUXA 3DMFA 3DMHA 2R3SA 2IP2A 3OU2A 2ZIGA 10MHA 3UJCA 2BR3A 5CCBA 1RJEA 5E9WA 3VC2A 5EHIA 3HCFA 3EVAA 3K6RA 4PYOA 2I62A 1NW8A 2ZW9A 1M6EX 1KYZA 2N47A 4GOLD 1NW6A 2G71A 1WZNA 1BOOA 3E8SA 3OCJA 3M33A 4PYJA 1KPGA 5FWAA 1JTEA 4YV1A 1EIZA 4HGZA 1WXXA 4ISCA 4P58A 1KPIA 5P8WA 3SGLA 2OY0A 2NP7A 4EVIA 5CVVA 2ORED 2QRVA 5CM2Z 5CVDA 4A6DA 5M5BA 3M6VA 4E70A 2C7RA 4EKIA 3EVCA 1FBNA 1G8AA 2JHPA 3EMBA 1KPHA 3H2BA 3I58A 4PYQA 9MHTA 4ER5A 5EMKA 2Y1WA 2P3QA 3DULA 2YXLA 3AXTA 5E1MA
chains in the Genus database with same CATH superfamily
3F6CA 2AR0A 2HLPA 2OP0A 1P18A 1UZUA 5CMLA 1WXFA 3LUKA 4YRQA 4I8DA 3K92A 4P82A 2PFGA 1IWPB 2O8DB 1FU4A 3IGFA 4CV3A 4X6YA 5EWMA 2I3GA 2IC5A 2IEBA 3B78A 1IB6A 5AM2A 3O3CA 2HJHA 5JALA 1OYWA 1ONOA 1JDUA 2VTVA 3A31A 3MXTA 4AF7A 2C77A 5K0JA 2HIGA 2XGSA 5AKJA 1X19A 4AS1A 1UC5B 1S2DA 5AOAA 4AX4A 2OV8A 2RGUA 5FXMA 1USUA 2J30A 3A4VA 1UOOA 3AIIA 3E53A 2CFOA 3MJHA 2WQ7A 1ZCBA 1Q91A 2PYIA 1PJLA 2UZ1A 5BWNA 2QL7A 4Z54A 1A4IA 3GDFA 5CLGA 1KSHA 5CK5A 3UJPA 3A6JA 2VZ9A 4JXJA 4K3VA 1WU8A 3IAS1 4IKEA 4MWEA 5ALIA 4DMUB 4DWWA 3ZDEA 4A2PA 3X1JA 3DE2X 3L7KA 3TLCA 4RD3A 5KYGA 5MN6A 1PGNA 1V0JA 3HEBA 2JD1A 2CMDA 1YQ9A 2LDXA 1WQ4A 4URZR 2ZS8A 4WPGA 5FI3A 2C2KA 4GDMA 5B1YA 4MR8B 5EHIA 5KSPA 1HG0A 3H9BA 3IEKA 2JHCA 3FOZA 1R2QA 2D5CA 1MCZA 4E11A 5IG2A 1W4AA 3OM9A 1H8EA 3GT4A 2QD3A 4OGGA 2Q8QA 4M9XA 4QARA 4AZ3B 2RSLA 4IIJA 2W93A 3EBOA 4HMQA 5DCUA 4IR7A 4UHFA 4EUKA 3O2SB 3WYAA 1XVLA 3GB9A 1WU7A 3NIFB 4OI2A 2XMZA 3R6LA 4XUEA 1E2NA 1PSZA 1XROA 1A9SA 3EQZA 1Y34E 1ZHHA 5AP9A 5K8LA 3DA8A 4G89A 2HF8A 2XB6A 5AVWA 3GVPA 2L82A 2W6ZA 5AXAA 2ZITA 4RKWA 4MGYR 1GPH1 4O2BF 5HJEA 3QEBZ 2Z9DA 1SC3A 1T0JB 4MLZA 2YXNA 1EXNA 3TR6A 4UAGA 1XCLA 3I5XA 4IUYA 4ER0A 3VPAA 2EJWA 3Q5EA 1D4ZA 1R27A 1NXTA 4Q4DA 1BDJA 4KLRA 1LF0A 2AFIB 1R6DA 2WJ4A 2RJOA 2E4XA 4LYHA 5FWXA 2ZUVA 3ELDA 1KJQA 2P3SA 1NVXQ 4YRFA 3U5ZB 4E09A 1T43A 3QX3A 2ZYDA 1E6KA 4CL2A 3H2YA 1Z7YA 1UPCA 4UTOA 1WBJB 4S04A 3KQKA 1XYVA 3NHJA 4O4JB 1V45E 4X95A 2ZS7A 1CQXA 1H1LA 2ZJFA 3VKFA 4EKYA 3VPGA 1PUIA 3LF1A 3DEIA 4OXKA 1VRCA 5M2QA 2FHSA 1GUFA 1CERA 1WHSB 2X2OA 4QQNA 1D09A 1UCFA 3EN0A 4ZT4A 3OECA 3RS3A 3KD3A 3MT0A 1NRJB 2ZWMA 3DG9A 2HPZA 5F33A 3K9CA 2YWHA 4HXYA 3SSNA 4GMGA 4HQOA 4BNXA 2QTLA 1OUMA 1UFRA 3K1AB 3WNBA 3DL0A 1M2WA 2BHRA 1IM8A 2DSTA 2H5IA 1DIHA 1XZPA 2VZ0A 4Q4AA 4TT3A 1P9OA 4NYJR 1G6OA 1OA0A 4P1ZA 4EPRA 4NYMR 5F7JA 1QO0A 3T7DA 3MF4A 4ER6A 1GPWB 2DBVO 3O8OA 2PRKA 4M9CA 5C1PA 5IKMA 1EB9A 3O73A 5T3UA 1VYHA 5AVQA 5ALGA 2FUNB 4YP6A 1XEWX 4RVCA 2EKPA 1N2EA 1WLSA 2ZDQA 3S2IA 2VDUE 4HAOA 3FAZA 3BT7A 2AVNA 4LDQA 3MM4A 4JI0B 3QRWA 4RXMA 2ZJ3A 5G1NA 2HMTA 3WIBA 3ZYZA 2OO5A 1AMNA 4BMYA 2CXNA 5JQGF 5A2GA 3BULA 5G41A 2IHJA 3S7ZA 2YVQA 1DXQA 2VP5A 4UUPA 2QRVB 3SJAA 3V4LA 4R84A 4JYMA 4BZXA 2G6BA 3TWOA 5HM6A 3WIDA 4D3XA 4YIKA 3QF4A 2ZYAA 3L6BA 3NH9A 3V42A 3C5CA 1AQNA 1RTTA 5JHGB 2XQVA 3HM2A 4EB3A 4FMBB 3RI3A 1IZ9A 2X7XA 1RBZA 2E18A 3TVYA 1L5VA 2VPWA 1DFIA 3GJRA 3K0CC 4U2GA 3NTLA 2RONA 3FPCA 4ASUD 1NT2A 5JROA 1KP9A 4LF8B 2PSSA 3EAGA 1X7GA 1QE0A 1J6UA 2WA1A 3X1KA 1YCDA 1N2CA 1M73E 3ZZTA 1KSGA 4BDTA 3RSHA 3BXHA 1RHMA 4O2RA 3DMPA 5JNVA 3BFPA 3EXIB 4D6XA 3VYTB 1V8OA 3D7KA 4H4DA 3U09A 4G2TA 2RC6A 4RDHA 3WISA 5B1IA 3E3AA 3QTTA 4GKVA 2B21A 1PFWA 1ZK3A 3JD1A 4PE5B 4TXNA 5JCJA 1I9GA 2R4UA 3PIDA 1YACA 2IHYA 2QP9X 2BFDA 3IR5A 1UAYA 4KBGA 4MA5A 1E4OA 1G19A 4B43A 3X2SA 4A0RA 1A8UA 3BEOA 3OX3A 4ZVRA 2P5YA 3ZBQA 3AINA 3EDCA 5L7YA 5THQA 3KKOA 1U0BB 1JH8A 1KRXA 2FZWA 1SEPA 4DILA 4PGFA 2FPKA 3H17A 3V55A 1VIVA 4WXYB 3WLEA 2QROA 2FTKE 4PAGA 4A27A 4X71A 1FFCA 1Z2AA 1RZRD 1NG1A 1GR0A 3MRSA 2I3ZA 1X9IA 4MR7A 2PQ0A 3E9ZA 2HF9A 3OOHA 4KZPA 3GAZA 1K97A 3R5FA 3T7CA 3P96A 5LP6A 2OWDA 2I1QA 2H11A 1NVFA 1Z12A 2HJ9A 3GXOA 3NWEA 4LIPD 4U9IS 3VHRA 1OX4A 1X0XA 3HB1A 1CZKA 2P75A 4HF7A 3WGYA 2XHEA 4J9VA 5CJJA 2WB2A 4UVHA 4WGFA 2XAUA 3O1LA 2OT3B 3KPJA 1S1CA 1GCOA 2BCEA 1DX4A 4DCVA 3S81A 3P2OA 3AR3A 3I9OA 4BB6A 1DEHA 4BFYA 1BJTA 4TRMA 1SOWA 3I0ZA 3VJLA 1U0FA 4V2IA 4RTOA 3RVPA 2I0FA 3CB2A 3SDBA 3SR3A 3HJUA 4XWOA 1XLUA 5F2KA 1H2ZA 2GDJA 1YQGA 3M2PA 4OOFA 1TRKA 3E35A 4IHJA 1ACJA 4G0PA 3GPBA 1OGJA 3SIWA 2WF5A 3Q5DA 1LC0A 1OZFA 2PKQO 4M9ZA 3R41A 1SOVA 4AB1A 5IFKA 2BTQA 1VKRA 4LECA 1KI6A 1KAEA 1RADA 3T12A 1CF2O 4OL0A 2BI8A 3BZWA 5DV9A 1QHYA 3BA6A 3CW8X 3CVVA 5HIAA 2ANCA 3CJRA 1WA5A 2RAPA 1LSJA 3HA7A 3MJTA 3PNVA 1Y8RB 4MWCA 1A5TA 2R00C 5DWVA 2HA6A 2V74B 4GBMA 1J56A 1OGYA 3AHIA 4DLLA 4EG0A 3CEAA 5ADUS 2NX2A 3C41J 3M5CA 4D0SA 3KPWA 1JE1A 4EECA 4CV1A 4TVBA 2HU5A 4IRUB 1WXDA 4YY3B 1BVHA 4FNMA 3TLEA 2FCRA 1TYCA 1O8CA 1HFWA 1QE3A 3UO8B 5LQRA 4JAVC 1L1FA 4GGPA 3UGKA 5MN4A 1FXSA 2O2EA 3E3MA 5CYGA 2BGGA 8LDHA 4EBBA 2XCRB 2ZIZA 1XD9A 4WNYA 4JYZA 2OHHA 3EH2A 1WIWA 2FWJA 3QG1A 4CQMA 5LL6P 3D6HA 1EGVB 4EO7A 4P84A 4GSKA 4W8HA 2OOKA 2XQGA 3JATA 3MWGA 5A5EA 4TM8A 3AJAA 3WWEA 1NLUA 2YRFA 3KVRA 4U2KA 5CAEB 3S44A 4H59A 3GJ4A 5H83A 1NQXA 4JI3B 2B99A 1P8JA 2QG9A 4TM7A 4NABA 5CP8A 3CFYA 1FSPA 4QOHA 3QNUA 3PRJA 1FVHA 3EHDA 4S1VA 4QQ8A 2HUPA 2Q3LA 1EUYA 3C85A 3ZVLA 3GX1A 4R2HA 3W04A 1TGVA 4F9TA 1X1QA 3AVPA 1QQ5A 4ZYLA 2ARKA 3KPVA 5JXJA 2ZUTA 1K7CA 1YK1A 2B5WA 3CISA 3GY0A 4PZLA 4RJTA 3IKTA 2QT0A 1JHUA 4URVR 2W48A 1GQRA 1HQKA 1NN1A 2AG0A 4CMIB 1HE4A 1JSXA 1SCBA 1OH6A 2O2CA 2FRDA 3E7PA 4TKUB 2F8SA 3KO8A 2ZJ6A 4PQRA 3ZN2A 4E4YA 1ZM9A 3ABSB 3IOMA 1BHQ1 1CD5A 1M72A 1NULA 3EZLA 3V7WA 3VNQA 1LPAB 3L82B 2VYVA 1PRYA 1V2GA 1SZJG 4TMFA 1SB8A 2GUWA 5CFMA 4ECAA 1RHKA 3WLTA 1EUCA 1QRTA 4DPKA 4DSNA 5BMVA 1XU4A 1BA2A 4NNPA 3RD5A 5AJYA 1CUYA 1XU7A 1YRQA 3FM9A 4I1IA 1JA0A 4JOBA 1KVQA 3V4RA 3AO0B 1FFGA 3LBFA 5FUMA 1YA6A 4ND8B 6AT1A 2PXHA 4L3WA 4RF5A 3UUGA 2WILA 3V3TA 4Z4EA 5EXDA 2AH5A 3L4JA 4GF5A 2IF2A 2XKJE 5H70A 1CY4A 2RHTA 3QVMA 4JWTA 4MVJF 3A3PA 1DO2A 1EM6A 5JMPA 2ZJ2A 2BGUA 4IPTA 4LZZA 4F4HA 4AJ9A 2OXFA 2VI5A 2VJMB 4L57A 1N2GA 4EY4A 3H9JA 3KKNA 2HMAA 2WU1A 3AT1A 2CVZA 1NKVA 3M8KA 4HP8A 4XX1A 4C0BA 1DKRA 1VJDA 2CY0A 1V7PC 3ANNA 4AKTA 2J3LA 1G59A 1RLUA 4L6IA 1NN0A 1DMSA 2Q5QA 5K3EA 2E7ZA 1W36B 1P9LA 3U4GA 1JPUA 4CG0A 3IELA 1N2IA 2FZKA 3G5UA 4YYEA 1BGWA 1TF7A 1ZIPA 4E15A 2XECA 4ZI7F 1XHEA 2Q29A 3IODA 1WF3A 1FYWA 3NAQA 5HKBA 3GNLA 3IQZA 1CDDA 1Z28A 2AFVA 3RS2A 4LZLA 4BFVA 5K6AA 5D6OA 1CS4C 4AZVA 4IYJA 4N5LA 2GMWA 3HKDA 3H4VA 1KOFA 2ZTHA 3DZBA 4IMRA 2NZ2A 4KQJA 4TSFA 1QZUA 4QREA 5F1KA 2IYXA 3AFMA 5LYJF 3ENVA 2ZSJA 2L42A 4ALJA 1TJYA 2BP7A 1EHIA 4B3TB 1KI6B 1YCFA 2VP6A 1Z39A 2K2QB 2XRFA 5DSXA 1QIHA 1J70A 3HO1A 5DPMA 4F6RA 3AHHA 1KZYC 2CWWA 1IVNA 1AQIA 1CDEA 3T61A 1F51E 1YDGA 3MWDB 1QG4A 4GNRA 2ZE7A 3DZDA 1ZMRA 4HN4B 1J22A 2J3DA 4G86A 1QH1B 1E9AA 2XYRA 4JCOA 4AMVA 1C3LA 1JHYA 4UFPA 4YLYA 4NNOA 3ESXA 2FMUA 4KQIA 4PEVA 1UDCA 3OCUA 3NIGB 2HYIC 1G8PA 1UK9A 4K6HA 4RDCA 3ZI7A 2KHZA 4LOLA 4CEHA 3G8DA 1F3OA 5ETJA 4QE3A 4GOXA 5FV4A 3UXEA 4B3XA 2I4IA 4A6EA 3UHAA 1HFJA 4RTRA 3KCQA 1XI2A 2YVKA 5BN5B 5C80A 2X8BA 3V32A 4HZUB 1UM8A 1UR5A 4JX8A 3RRXA 4C7VA 5IC4A 4YRIA 4E51A 4NF2A 3I42A 3MINA 3CT4A 4DRZA 4TYNA 5JZMA 4LOKA 3JQAD 1IBCA 3Q1KA 4C5BA 1XMQB 2QQEA 1DEOA 1NNI1 3B51X 7MDHA 5H4GA 1D7OA 3O4IA 3TPFA 1AXEA 1ZM3A 4EJMA 5FPTA 4B4OA 1W1IA 1VSUA 4IL5A 4CIAA 4RTQA 4YAEA 1MENA 3A6LA 3CPSA 5JCJD 4HX5A 1SUDA 2AE1A 2BHLA 1JR3E 3F4BA 3NC0C 4MB6A 3TX2A 2W8BB 3EJ6A 3THWA 4KVGA 1LV7A 3HMKA 3MGKA 1WSDA 3JYPA 3A10A 4C07A 3W6ZA 4O3FA 3PNMA 3ILSA 3DAOA 3FA2A 1NZDA 3WKAA 4U7FA 4EELA 3U80A 5LNK1 2VQDA 3OIGA 3R0QA 4XQEA 5DBIA 1YSCA 1QIEA 4BB9A 2C9DA 4R8LA 3MTGA 5IASA 2RI1A 3LC1O 3FLAA 4ZEVA 2ZI6A 3JU3A 2PBLA 3ASZA 4UMVA 1HMPA 5F2OA 2P1DA 1N8SA 5BSHA 1A1VA 1OX4B 5D5PA 3GJYA 4RA9A 2HTFA 3THYB 4B34A 4MP6A 5DYYA 2QTRA 4ZAZA 2ES4A 2R3SA 3O0DA 1QGAA 4OP3A 2YV2A 3NIDB 4UJ5A 5EQTA 3U4HA 3UJCA 4PN3A 4U39A 4F2DA 1XD2A 3UV3A 1P72A 3VC2A 4UNRA 1HZZC 4UTZA 4ZHQB 4WJKB 4QOIA 2HF2A 1YC2A 2B37A 2XR1A 1WP4A 5KOJB 4GL4A 3K32A 4HLNA 5BSKA 5KYNA 2FEPA 1KBOA 4M60A 3SNKA 5ANRB 4YUZA 2PANA 1T0HB 1JYEA 4JJ6A 1HLDA 3KOWA 4RD2A 3KBBA 3ZJ4A 2UUBB 4TWIA 1NM5C 4OD0A 2QN6A 4A6DA 4GWLA 4ZYTA 2C5BA 1O1YA 5A4IS 2WNHA 4IDDA 5KOYA 3ROKA 3FFAA 2O5EA 1EDDA 1HDRA 5JE8A 4DANA 5CA1F 1NBME 7REQA 1JAXA 2JIZA 1Y1TA 1ZMTA 4LEIA 1XOIA 1XG5A 1P2GA 2CXOA 4KCGA 4MR7B 2GTHA 3OFSA 4N0EA 3P94A 1P75A 3D02A 2BPOA 3PQ8A 3DHWC 3HC7A 4J1NA 1TQ2A 2OBLA 3QQPA 1FS5A 1QRRA 3UAVA 4DC1A 5BURA 2P5UA 4J7UA 3QPVA 5EJ5A 1MAAA 4M8KA 1PBNA 4AUKA 5BYAA 4PW0A 3TUZC 4JXZA 4AKGA 5AJUA 5LR6A 2HWUA 4E5YA 2YHIA 2NYAA 3FCYA 3M4ZA 1WW2A 4ETWA 3VKHA 2Q46A 1V71A 3IKMB 1O95C 4C7KA 1T6ZA 3R7SA 5ERGB 2I91A 2P2DA 1L4HA 4LE0A 1CBUA 1H9AA 2GHQA 3OE1A 4N4AA 5AMXA 1GQQA 3SCZA 4BVJA 1E64A 2PBRA 3BSWA 3LIPA 2NU8A 3SEZA 2H2DA 2WT4A 5H3CA 2A0WA 2AJBA 1DKLA 1ZIYA 2A3RA 3WMEA 4BFWA 4B31A 2XQJA 3BZUA 4YH1A 1WDTA 1FTSA 1KJIA 4XCXA 5EP2A 2QT1A 5E4YA 2NU9B 3S1LA 1H42A 1WCV1 2JGDB 4NCHA 2ZZKA 3RVQA 5A3JA 4DBVO 5J1SB 3GLIE 3UH1A 2Q41A 3KJHA 4P54A 4TMYA 1LJLA 3CLSD 4P7BA 1CZHA 3B7GA 3NCTA 4LCEA 3AVXA 2ZWPA 1IG3A 4XB1A 5IF3A 3WV4A 3H5WA 4LJYA 5KAMA 1BFKA 2O59A 3P2EA 1P0FA 3QFSA 2V98A 4YV2A 5JRJA 5B53A 4FTWA 3IPRA 4OJKA 2YASA 3QENA 1NI3A 1L8QA 2VJBA 3P0HA 1HSZA 1YA8A 3NRCA 2XZPA 3HVHA 4QPZA 4RAOA 2VOEA 2CNLA 4K9LA 2GD6A 2XIQA 2HHAA 1R6AA 4IMPA 1JFTA 3VPCA 1KYWA 4DPMA 3JYHA 4LE1A 2FW1A 4YCCA 2QGNA 2HA3A 4PFSA 2FFRA 3FMIA 3FN4A 1XZDA 3STUA 3BMQB 1VECA 1U2GA 2OCKA 1B7GO 3H7IA 1ZYUA 1WL8A 1QP0A 4WA7A 3I0NA 4XD7D 5AM4A 2ZM5A 1DXYA 4E1VA 3VX4A 1H8HA 3KTAB 3VTAA 3QKUA 4KE8A 2C5AA 1K3UB 1MOQA 1U2GC 3L07A 5KIAA 4P7KA 2VDKB 3O4JA 1DLIA 1FB5A 1JDZA 1JSRA 1ORTA 2O7NA 5JDCC 3BWXA 3EOZA 3O8NA 4JJ4A 3ZBUA 3C39A 1PX0A 1TQ6A 4UBOA 1P74A 2GNAA 1BE8A 1W1UA 4HTFB 4ODIA 4WLFA 4BIMA 5GY7A 1GN8A 1TW3A 1W8DA 2NPIA 1X7XA 2REBA 3IC5A 3Q12A 5LQAA 1N77A 4JT8A 1KWKA 1ZH4A 4DA9A 3OFJA 1ZXXA 3HB9A 1QGZA 1PV1A 2UZAA 1E1LA 1Z7WA 1GL9B 2JZOA 5KTKA 2WWGA 2CK3A 3HDJA 2YW2A 4IKPA 1II8B 1X2BA 2OCYC 1P4JA 1ADFA 4NESA 4UDXX 3QV1A 2NG1A 2WP0A 1Q2UA 2JFYA 1BEUB 3WBKA 5JS8A 3W5AA 2HI0A 2XH8A 2TMYA 2ECFA 3A37A 3L02A 1PNVA 2NXJA 4GLOA 1GGHA 2YVLA 1ZGBA 2JGMA 3E81A 1EFPA 4IIJB 1M7BA 1TKBA 5EPEA 1IUNA 1QV7A 1X87A 1D2RA 4NZ9A 1RLTA 3NHAA 4G5GA 5TF4A 1VYTA 1GGNA 4RPCA 2ZT8A 5FNVF 4ZHSA 1EFRA 2GM4A 5ED0A 1WDWB 3V8RA 3R09A 5LJLA 1M34A 1J42A 3ND5A 1AUPA 2RKWA 4RFSB 5L40A 3KKMA 3BXGA 1MBZA 2IH5A 5FF9A 3IHLA 5BMVF 5AJXA 1JVSA 2ENWA 3FNQA 4RHCA 3BFVA 3QGMA 4V0NA 5F3RA 3A8TA 2IBMA 2PFSA 3K0FA 5KQSA 1A8IA 5ALTA 5A0FA 3F49S 2HRZA 4N65A 2JLYA 1E1QA 4FGSA 2RGCA 4G9BA 1WZCA 2HK9A 1JT2A 1CUGA 1X1EA 1KC3A 2V4UA 4XEUA 3JR7A 5FUVA 5T8KC 3EULA 3PD7A 1L7XA 2WR8A 5TE9A 1PKEA 4DCTA 3O2QB 1C1YA 1ORWA 3Q15C 4MQEB 1GGVA 4MA0A 2Q4OA 3DNPA 2GZ1A 1BFUA 2H5JA 3SZOA 1P9WA 3AUXA 4ZA2A 1B2LA 3E5HA 2OL4A 2R97A 3MSCA 2G80A 1DINA 2P41A 5G0SA 5K5EA 2NT3A 4MWOA 3LBAA 3F4LA 4MQUA 4EZBA 3WC4A 1TAUA 3R3YA 4KQHA 4MS3B 5LA6F 1JB1A 5BUQA 1CJVC 4DYDA 1GCUA 1YS9A 2O2DA 4UQLA 4KYVA 2DHRA 1VCMA 1RXEA 1L7BA 2H07A 4ZV4A 3QBTA 2B8JA 2REQB 3PICA 5HF5A 1FE8A 3V8PA 1JDBB 3SBEA 4F06A 1STOA 3LBHA 2FQQA 2B94A 3TIGA 1B15A 1QORA 5G4LA 1NR5A 2ZUEA 2QTCA 3K16A 4A15A 2Q5CA 3RPEA 2EFDB 2FWAA 1QK3A 2NW6A 4Q3KA 1U8FO 2N1MA 4UFOA 2GN6A 4I8IA 4DQ0A 3PDIA 4Y2SA 4F92B 1E8DA 2GASA 2J85A 2OD9A 3AF0A 4L51A 4QICA 3EC1A 3N5KA 2QPOA 2HU8A 2W2TA 1H22A 3Q87B 4K88A 2E9SA 3NFYA 5BYBA 5LQDA 1JU4A 2R6DA 2PCJA 3F3SA 2IU4A 3NM5A 4ZJZA 1YI1A 2QLFA 1D8AA 3O7WA 4FILA 4JOSA 5JAQA 4EKNB 1WUIS 2JLRA 4KRGA 3FGNA 3N0TA 5EINA 3KEMA 1V39A 2UV8A 3FMOB 3ROGA 3RYHA 1U2QA 3S29A 3BGDA 1XA0A 2QTNA 5DSTA 1Q2XA 2QT9A 1NU8A 4MI9A 2QS9A 2C8JA 4IJVA 3O5AA 4OQYA 4B6SA 4B9EA 2FDCA 2HF7A 4WL0A 1IM2A 1GU0A 1R9JA 1ZINA 1FUIA 2BKUA 3RYIB 4UE2A 3SLKA 3N6VA 2JFQA 2XODA 1QIJA 2P9QA 1PL8A 4RK7A 2VH1A 1Q0TA 4OHOA 1ZD5A 4DMGA 1MA3A 4WW0A 3W3ZB 4AJEA 1RKBA 3CNHA 3D4IA 1S2OA 3GGPA 2LNDA 1RQGA 3L3BA 1YJ5A 4JLPA 4K5QA 1A50B 1GZ6A 4JBIA 3H9CA 1NBMA 1UBFA 5CA1A 3KJNA 2ANBA 1K5HA 1V5EA 3OZCA 2SBTA 1I0IA 3DMYA 4FFWA 4NRDA 3A6FA 5FOXA 3OZGA 4C0XA 3UQZA 4EOGA 1IRIA 1F17A 5IVIA 4WDRA 2XDQA 3I1YA 1KZ7B 4FDVA 4R9SA 4GP7A 4EI9A 1UAAA 1T4CB 4KC0A 4E5NA 2AN3A 5BW8A 3WB0A 2EP7A 1KA9H 2C1EA 1DBSA 1SBTA 1FFEA 2GK4A 5FOQA 1UMBB 2XCIA 4ITVA 1I51A 1IE3A 1P3DA 4S1OA 3WWDA 3AY6A 4F1WA 3MS2A 3F6EX 1E20A 2I6QA 2DQ4A 3IP7A 1N7HA 4MJLA 4JYPA 4L0CA 2QI9F 1R8QA 2B20A 3RSGA 6CHYA 3ITNA 3LBNA 1Z36A 5TS2A 4LNUB 3IAXA 1C7ZA 4HQNA 3VTZA 3QELA 4XJTA 3FVRA 3VH4A 1JJBA 1UBJS 2J3MA 3BKXA 5DGXA 4ZT5A 3UT5B 4F4CA 1KQFA 5IF9A 1ZD3A 2RHCA 4YUAA 1P7CA 5C35A 3RRZA 3HZZA 3ZIDA 5KWIA 4C78A 3U4AA 4XGKA 4L4RA 1NM5A 2Q6TA 1WXHA 2X58A 1ENPA 3AEUA 1Y5LA 3DDCA 3NOQA 4FT4A 4IH1A 5ILOA 2F00A 1N3YA 4XDGA 4YHHB 3OP4A 3QE9Y 3ZUPA 1TLTA 1WZEA 1UKEA 2FFQA 1XKXA 5SYMA 4TV9B 3MUEA 3FOBA 2C3MA 3Q3GE 2VP2A 4RESA 4QGSA 3NTUA 3GLGB 4Z4GA 1OFVA 3PIRA 2X4LA 3ETCA 4ARUA 4CL8A 4EJSB 1DOZA 1V2HE 4K6KA 1N9GB 1NSYA 3N8GA 1JILA 4H7PA 1XTPA 1QVAA 4G01B 4LK3A 2F3PA 2XOXA 4ZI3A 1LI4A 2N3ZA 4MQBA 7REQB 2VP9A 4G4SO 1ZD8A 4I9HA 5IJWA 5AFSA 2LZ0A 3RK1A 1AZLA 1N6HA 4WLUA 4PNPA 2R60A 3EPRA 1SXIA 2BISA 2EJVA 3KL2A 5FYQA 2ZRQA 1UZMA 1OB2A 3SYNA 3CBGA 4BL5A 2O6HA 5TQ2B 4BWYA 3VU1A 1WDMA 1I3OA 2D3WA 4QPCA 4DJEC 2LWIA 5DVZA 2WUWE 1YMVA 5CA0F 2P11A 1VDMA 3T5PA 4BO6A 1DIAA 1F38A 2Q1TA 3QMWA 3T5GA 3UWSA 1IK4A 4WOPA 1ZCJA 4MV8A 2OBNA 3WO0A 1ZN9A 4OM8A 1QIDA 3TRDA 5C81A 1LZLA 1OFGA 5ENZA 3WSVA 4S05A 3JQFC 5JRDS 4V0ME 4TYYA 1Q0RA 2PLAA 1XHFA 3ZD6A 5I3ZA 4Q9KA 4YCMA 5K8CA 3UCXA 3WA7A 4CUZA 2KBFA 2NU7A 3C1AA 1NWHA 4BY9E 3OZRA 4HYYA 5I4CA 1ZW1A 4F2PA 3ZS8A 4X66B 2W6PA 4RA9B 5F2EA 4Z2AA 1RC1A 3WHPA 3KXLA 4PCVA 1LRJA 1Z8FA 1NXOA 2X0NA 2RAVA 4FYXA 5ALNA 3RK4A 1F6DA 1RD4A 3AIOA 1JPVA 4RE6A 3TECE 2DH6A 1UPAA 3HP1A 3G1WA 3OCCA 1Z34A 3AHJA 2DCMA 3UOGA 2HFKA 1UC4B 3IS3A 4NULA 4PY2A 5EIWA 4EQ6A 3QW2A 5IPFA 4AMYA 1ODTC 3I9JA 2UVQA 1TYDE 1XD8A 2QIPA 2W8BA 3NH6A 3BXOA 4JMPA 4DDVA 4AQYB 1DKMA 2ZIXB 4HSGA 1V11B 3BWEA 1A7UA 4WASA 2J6CA 1AGPA 1UP4A 5HUQA 3DXFA 1VG0B 1LNQA 2RGGA 4BYGA 1NBWB 3OZWA 4ZQIA 1DJOA 1UP6A 2ZYSA 3LCMA 1KRWA 1NZJA 4NZMA 1OC4A 1R5BA 1QHHB 4NIMA 2W5UA 3HGMA 4NQRA 1JYSA 4PWZA 2RBEA 4RFVA 4HDCA 1OX5A 3E1GA 4F85A 4MGZR 1DO8A 2OAP1 2LD4A 2Q7OE 5LC1A 2PZJA 4AYTA 4B6JA 3U81A 2PJUA 1IQRA 6PFKA 1I1HA 4BQSA 1WS6A 2N75A 2VJLA 4WKBA 5AVSA 4PX3A 3I32A 1T2UA 2O2JA 4L07A 3T0IA 1OYOA 1PR2A 5KOHB 2DLDA 1VXRA 5LNK6 1YV9A 4B3GA 2F3SA 3LZCA 1NW4A 2I71A 1ZICA 3GAFA 4WD3A 4OP1A 4MS4B 1MXHA 1Y4UA 4JBXA 1Q0PA 3ROTA 1GV0A 1TCAA 3WGKA 4R8MA 3DJFA 4BLUA 4D80A 4PYKA 4LTMA 4RL6A 3F3KA 4FVTA 3R6DA 3WLFA 421PA 1B6TA 1IZ8A 1UINA 1FFHA 3FCXA 3PQ4A 1QPGA 3CHYA 4FR5A 4W5TA 4LJ7A 4LYAA 2GZDA 1BCRB 4QTZA 3GROA 1XB2A 4MK4A 2VTEA 1YI8A 5A9TA 3RYTC 4JI4B 1W48A 2BT4A 3IILA 5KKCA 4MROA 1B23P 5KVVA 3IXLA 3PNPA 1R64A 4OUKX 4KFRA 4R2IA 3CVJA 2I78A 3VH2A 1R8JA 2O1XA 16PKA 1QTIA 1WZIA 2KI5A 2QMZA 3O03A 4QPPA 1MIOB 4ZAFA 1II0A 3UMJA 1MLDA 2HJRA 2VNIA 3BCUA 4PYNA 3ESRA 4KLNA 1J25A 2BJWA 2C04A 2ZSEA 4OHRA 4RKQA 5CYPA 1D3AA 4YPFA 4D0GA 1UDWA 2HQRA 3GMSA 2A5JA 3PRYA 5FBWB 2GF9A 4A8HA 1YL5A 4EL5A 3DYVA 1FP4A 1KGSA 5AW0A 2GAOA 2DHDA 2ZU6A 1QCZA 3FTDA 1W4CA 3R8XA 1P2DA 2HCFA 1GG2A 4C7XA 3C3BA 3OJWA 1W36C 1CVIA 4PHFA 2XXBA 3NANA 4Z9YA 1BW9A 2ZRFA 4CF6A 3ZXSA 1QTQA 3UMRA 2D5IA 1K1EA 4ZMRA 1XZEA 4P31A 5JD6A 1XDZA 3GLIB 3ZDBA 2Y4OA 4LJ4A 5EEGA 4YMWA 1T3TA 5K0CA 3QKSB 3W77A 1RNLA 3I01M 1GL7A 1XTIA 1EEHA 4ZK6A 4U0JA 3P26A 4YXWA 1T3HA 5JAOA 1W2WB 3WMXA 2VCHA 1FYFA 1NI5A 1Z29A 1Q50A 3Q9LA 5ALHA 1NW6A 4P35A 1U80A 3DVLA 5KQLA 5GGXA 3V7FA 1RM5A 1SO8A 1TDJA 3AGPA 3D2AA 4G6ZA 2VNSA 1BO6A 4ZOLB 3TQHA 4HGZA 3H0KA 4ARIA 4HDRB 5IYZA 1MVOA 1IG0A 3IQFA 3SGLA 2PMFA 4CM5A 4CG3A 3HO8A 4GI3A 1C7JA 3UFXA 4E70A 3WGLA 1G8AA 3E1KA 2I2XB 1XZAA 4PSKA 5JS7A 3EFBA 4YECA 1A71A 1XVIA 2VPXA 1SELA 3MRTA 4P3KA 2BUCA 2FYTA 3QPUA 4G5SA 3ZHQA 5ECYA 2HLDA 3DW1X 3FHJA 3UK0A 3NR2A 1DOHA 2FQYA 1C8LA 2Y0BA 2XB2A 1MRSA 4UCFA 1YIAA 4Z3OA 3A6DA 3M6IA 2JBWA 5TB5A 5GZ1A 3K9NA 3C5VA 3RWBA 3STXA 1WABA 2PXCA 3OIVA 4P34A 3KEOA 2QV0A 2NO1A 4Z0TA 4DT1A 5FEUA 2O1SA 1QONA 4JR1A 5EHXA 2GJ4A 3I4FA 4G84A 3WKEA 4PR0A 3TKYA 1G21A 4DUGD 1A82A 1OXBB 4RIEA 2YKGA 4EG4A 4TMZA 1DDGA 1YTLA 3GQBB 4G1UC 5THXA 2GXQA 2WWFA 4Y7CA 3CURA 1OT3A 1AIPA 4TS9A 5LMNB 1NJ1A 4A16A 4C01A 2CUKA 3GGGA 4PLPA 3OOWA 4G5XA 3SZ3A 4F2WA 2PMWB 4NPCA 1O6ZA 2NNLD 4Y1GA 4HAWA 4OP2A 3L77A 3SXJA 1Z26A 1U04A 3FNBA 1QP8A 1Q0SA 4PCAA 5F12A 4YA6A 4J0JA 1ZHOA 1B93A 3EVDA 2Q6IA 4PX9A 4AVYA 4EUSA 4HSEA 2RBKA 3O1JC 3TZ6A 1V3UA 5F7ZA 3OQ6A 3LLUA 4KO1S 3TSYA 1WQ1R 2XE6A 2ZRLA 3I1FA 4F46A 1H2EA 4AG6A 1V5FA 3E8MA 4YCAA 1W47A 4GMHA 2EW8A 3AL0C 2VHZA 2OYCA 2X6RA 3R7AA 3LVBA 2J07A 5E0KB 3RREA 1RI4A 1CUFA 3HB0A 4MKGA 4ER3A 1PLJA 1V8DA 3AUSA 5HCIA 1Q1ZA 1F2UB 1SU8A 1KY4A 2VF4X 1J1ZA 1ICIA 1R4NA 1ID1A 1MRNA 2PKWA 1RQRA 3LO8A 3K0CA 1IIBA 5CHYA 4DNOA 1Z73A 2Q50A 2H4YA 3LWNA 1T0PA 5K8VA 4TN1A 2GD1O 3SICE 2GARA 4KXNA 1MFZA 5L6MB 2J9FA 1NVMB 3CWQA 2WF7A 4QUAA 4CKZA 1ZGCA 4QNNA 1YZ3A 3VI3B 3WLHA 4ZMSA 1ZRNA 3IHWA 4JP8A 4ZIRB 1Z0ZA 1E2QA 5IEBA 5JYBA 3DTVA 3FJ1A 3K6JA 3PD1A 2QTWB 2C61A 3OZEA 4N0MA 4QFDA 3MTEA 4EWLA 5JQGA 1M0TA 3GOHA 4WVFA 3B7WA 4UBKA 3RHTA 1LBTA 3EPPA 2WQ6A 4EHBA 1N33B 1RXUA 4Q0MA 3U0BA 4EX6A 3WAKA 3EZ2A 4RZXA 1N8KA 2EERA 2WFLB 2PG3A 1IJFA 4R2KA 4QXOA 5CYFA 4B35A 4XVUA 5IRCD 1S7GA 2E3JA 3MK31 4LQLA 1MTZA 2ZWIA 1I8TA 1DUSA 3HBLA 3M1AA 1QNFA 3E3OA 5DW0A 2DF8A 3GIDA 1TW2A 3MBIA 3M81A 1EXWA 1RJGA 4D3SA 1X74A 1Z8NA 1O94A 1AN9A 1MB2A 2I29A 5EWJB 2AQKA 4QLAA 1VC2A 2WV7A 4FZ5A 3A7EA 4IIHA 5AM5A 1QFXA 1TMGE 2I1VB 2BFBA 1KOLA 4QQFA 3VR5A 1QFMA 4HPJB 5EYPB 4D9KA 2P40A 1EM8A 3E61A 1T5DX 2JAXA 4CCYA 3NTRA 2O23A 5BR8B 2V59A 5A4DA 4PHCA 1RC8A 3H16A 521PA 5JSZA 2DWUA 2D1QA 2H4WA 3RUEA 3BJMA 1QIKA 3KSZO 5BQ5A 2BJHA 3MILA 3G6WA 3OAAD 3OJ0A 4I66A 4RL4A 2CMGA 5H16A 2B5VA 3WB2A 4CT0A 2P69A 4N5MA 3UF0A 2QAGC 1JEDA 2O0HA 3LWBA 3ZDYB 2NUTA 1P45A 4KV7A 3BEDA 2D0DA 4BFSA 3NALA 2A4MA 3QQ5A 5IMSA 5E4FA 2QYHA 1QO0D 2IOHA 4LVNA 4DV3B 1XF9A 2ZTSA 2HR1A 1CEEA 3DLCA 2NM0A 4L9AA 2JFVA 1JXMA 1R5NA 1JPNA 2ZEJA 5KB3A 3HDQA 4NEHB 1VBFA 4M0PA 2P2YA 4KXLA 1HDIA 4XX0B 1KYXA 3KR2A 1YKSA 3RS7A 2PT6A 4REQA 4M7RA 5I7RA 1L4NA 4CVNA 2QNIA 3OO1A 1KFKB 4EMTA 4CF7A 4IW3B 2Z3ZA 3UOAB 5I4BA 1W5EA 1YRWA 1XCJA 1KHHA 2B7BA 1ISFA 2I55A 2J5BA 3FR8A 1M66A 4ZT7A 3RT7A 2HY7A 3ZHUA 4KN8A 4NZYA 5GZ3A 2UUPA 4LVOA 1XK7A 2CHVA 2PGLA 3NHUA 5DBOA 2C84A 3COSA 5LLDA 3IAUA 3FYCA 2XGOA 3OLZA 2FG5A 4MZDA 4WNAA 2GYVA 4XR9A 5FAXA 2HRQA 4UOEA 3I6YA 1ATZA 4TMWA 4UM8B 1AK9A 2WMOB 1XVVA 4IO1A 3ZY2A 2JLVA 1NFQA 4LFCB 1CULC 2YRXA 3K31A 4IAOA 2XMQA 4M1SA 2OXCA 3AETB 2OHIA 2BKEA 2LCFA 5A3SA 4KQGA 1BWSA 1YDWA 4HJXA 1W0JD 2HCRA 4Z4QA 2ZR9A 2NO7A 3GH1A 3HBJA 2FSVA 2AXQA 5AUPB 2PUHA 3GN1A 4KDFA 2XB9A 4QUEA 1W73A 2IQ5A 3KQUA 4ZO7A 2XE7A 1X6VA 3DDOA 4IMIB 4Y6PA 5IJAA 5C8YF 1PP4A 5JD3A 5A7FA 3EPKA 3AF6A 5JJ5A 3OPXA 2QF7A 3A3KA 5EIFA 3X43A 4FFNA 1S3FA 3F6RA 4KPEC 4UVDA 1RMTA 2TS1A 3M9WA 5EUBA 2JFGA 2PUWA 3AR5A 3KHSA 4ROTA 2AD1A 1N2JA 4CKXA 4QVIA 4PBSA 4QG7A 2NUPA 2ZUDA 5TC4A 1OWOA 4MO9A 4RSHA 3WBFA 2RAUA 4AZTA 4JJZA 2FFAA 3TQOA 4LHYA 1YJCA 4OFBA 1PR3A 3AFHA 5LD2B 5L3QA 2OO7A 2FSFA 2Z2ZA 3TMKA 3UUEA 3KETA 3CRQA 1Z2EA 1X1TA 2O7VA 4FZJA 3LLVA 4YPVA 4W1PA 1Z3IX 4HX9A 5COQA 3BQ9A 1O0CA 1RI1A 4KJXA 4LYYA 2P79A 1NBAA 3RAPR 1K2WA 2ET6A 2AXEA 4CR7A 4FEEA 1W87A 3CX7A 1ZJ4A 2H0QA 3LFHA 3WWOA 1RSZA 3CVXA 1DIBA 2A30A 2JGJA 1NNSA 2R7AA 3N2NA 1GKUB 5JG7A 2YWGA 4JU9A 4LSZA 1I36A 3INTA 2ODWA 3B12A 5JV5A 1ZM7A 2P7HA 1TTPB 1A5BB 4HDOB 1NMSA 5CX4A 2HEIA 2OAEA 5GIOE 3VZCA 4C0LA 1THTA 2HRDA 3AQIA 3COWA 3PLNA 4MITA 5J5AA 4CQLA 1Q22A 4PNEA 3A4IA 5JDIC 2R25B 1IJEA 2HFJA 3ABIA 1WTCA 2HLHA 3RUIA 2WABA 3E9QA 4BVBA 1N5DA 1QQ7A 3CZRA 5KS2A 3CRNA 3KZVA 1AM4D 2OFXA 5LQKA 1RYZA 2XTJA 1D04A 3SZRA 1EHCA 4BFXA 2F1RA 4AF8A 4PTLA 3LZ6A 4YJHB 1RXWA 3PKZA 4UD6A 1I6MA 4MUHA 4BCCA 3W3AH 4DR3B 3AUTA 1QAQA 4B3BA 4OLJA 3MRVA 3KSUA 4IV8A 2CLDX 3RQSA 3NVKI 1UJCA 1JECA 2DFPA 4GBJA 5AVVA 5JANA 3NGMA 5I8ZA 4AKIA 2GJ9A 3QKWA 3ZHXA 4GLFA 1WY7A 4HLCA 4EY3A 5B55A 1LSUA 3GP3A 5PGMA 5NULA 1ADCA 2EDCA 3G13A 4DLVA 5MN5A 1JA9A 3O3OB 2EIXA 1XZNA 4WEQA 2O8DA 5DM70 4FFMA 4OYYA 1QG0A 4UUAA 4M1QA 2J8ZA 4KR7A 1PJ3A 4F38A 1Z2PX 3QVLA 1A9RA 1F1BA 2H2HA 3HLKA 1XMSA 5HKKA 1LLQA 3FDIA 5KYUA 3BD9A 2A5FA 1EP3B 2C5FA 2V65A 3HA3A 3WB9A 3LKBA 4HT3B 4R2MA 1U90A 1LVHA 2BMFA 4P0QB 2ZE5A 5K0FA 3LC0A 3FPJA 4O33A 2WFMA 3GO4A 5FADA 5I4KA 5CW2A 3EY4A 3PGJA 4PIVA 1DBRA 5H82A 3SDZA 2Q3HA 1T2VA 3ASYA 3NKFA 1WVGA 3F1KA 3UG6A 2CD9A 3DYBA 3QV2A 1C30B 2ZJ0A 1XEXA 4MRNA 3BORA 1YQQA 1AK1A 3DBRA 4MULA 1HYEA 5ALOA 1R5JA 3ZU4A 4EW2A 3CF4G 5BN3B 3LY8A 1MAHA 3R6GA 4Y1RB 4CCYB 2IRWA 3UJ6A 3C3XA 4DV6B 1QUFA 3DFFA 2GYYA 4LGMA 4GP6A 2IYWA 5B3LA 3Q7IA 3DL4A 4LXHA 2EXXA 2OBFA 1BKSB 4L95C 2X86A 1RTKA 4LKRA 1OH5A 5AM3A 2BEVB 2ZR0A 4CQNA 2F1HA 3FJOA 3JWPA 3BE6A 4OHXA 1NURA 3I04A 1LLDA 1ESEA 4FE7A 1FX0A 2YHIB 2QUIA 5DHTA 4ZU3A 1LBIA 3U1VA 4JL8A 3JQPA 1OZAA 1QG2A 4WINA 1Z0JA 1CJTC 2GR9A 4KNYA 2C59A 2PT5A 4DDWA 2WJYA 2QBYB 4XFJA 5HNKA 1DIOB 1NASA 3M1LA 5BOSA 2QRHA 1J8QA 5CT6A 5E2IA 5G0UA 4PS1A 5E95A 2FMTA 5JJBA 3NNNA 1G21E 1RRGA 3HCPA 2Y6UA 3N3AC 4J3FA 5ALUA 3MSXA 2I1WA 2VQEB 2AOUA 1MD9A 1A1SA 4KIJA 3PJGA 4MW2A 4FYPA 4ND1A 4OAPA 2W2NA 3ILYA 4NV3A 4OMCA 4DQUA 4EF4A 1TX4B 4F4UA 1RJ9B 3GFRA 3NG1A 3IALA 4FFBB 4L73A 4NFYA 3HEAA 1ZQ9A 2GFHA 4DY6A 2VNAA 1HTTA 1N9GA 1PJTA 4XQCA 1N0WA 4OHYA 1DXOA 1T8YA 3MS7A 1JVBA 5A0VA 4WLNA 2DY1A 3FVWA 3GRYA 4GVLA 3WVNA 2R4QA 2EFHB 1ZXBA 2E2WA 3KQWA 2DUMA 3JQQA 2OGSA 2R1VB 1CNMA 4UU8A 2IPNA 3JAWA 3L0DA 2F48A 1PEAA 1RIFA 2HXGA 4Y2GA 3TFWA 4DBLC 1U2TA 1ZJ5A 2LUOA 2Z9CA 4WIAA 2H1CA 2R8XA 4IGEA 1XQ9A 3CU5A 4F3CA 1YF3A 2EP5A 3IUYA 3EGOA 4LHVA 4P3XA 4JJ8A 1SWWA 5LZ8A 4BO1A 4H2DA 4REMA 2HN9A 3OE7D 4CLEA 4UUNA 1NNUA 3OC0A 1WNFA 2XUFA 2F9LA 3OQHA 2HHCA 4Q4JA 5HDQA 3OIWA 2H1RA 1KQOA 1XLTA 3A9TA 2K2WA 2VSQA 3C15C 2JCXA 3DO6A 3P4UA 4XE5A 5D2CA 1B0UA 4D8UA 1JDSA 5EJ8A 5K6RA 1GVNB 3PWKA 5BVGB 2FOXA 3IP6A 1K9VF 4H7HA 2IYEA 3IVMA 5HJ5A 4MJ3A 1QMGA 3SOPA 4YRSA 5FTLA 1E69A 2H1IA 3G82C 3D4PA 1KK3A 2BTOA 3FF1A 4OBWA 3EQ6A 3A1FA 3VR4H 3ESZA 2Z4RA 1RR6A 3PE6A 3DLBA 3AW9A 2XZLA 1JSZA 3F5SA 3FGOA 2O2IA 3PFHA 2CLCX 2BKVA 4L74A 5IKXA 4G65A 4LY0A 4A8JA 1M75A 1Q7TA 3WYEA 4MGHA 3L18A 1BCSB 1Z07A 2O0MA 4HPXB 3OJFA 4EQZA 5IJ9A 1XCMA 2AZTA 2XIJA 3TSAA 4M0DA 2VAMA 2Z3WA 1AHHA 1L4BA 1W0JA 2CLLB 4N0PA 4DS3A 1ZD9A 2C9OA 3GQVA 2J3HA 4KUGA 4N5NA 4UREA 3HDYA 5BSUA 4FOTA 4G1BA 1PJBA 4IXMA 5TXGA 2QZPA 3O47A 3A2KA 1DBPA 3FZQA 4G8JA 4QL3A 1G7CA 3H3JA 4H1VA 4LTDA 4WKOA 4A2QA 3BFJA 2FR1A 3L0PA 4K03A 1GPUA 2OAGA 1BKDR 2GWRA 2CYCA 4R2XA 4ZVTA 1G3IA 1ZI6A 4H7FA 1S2IA 3S2GA 4DA8A 4JLBA 4EUNA 3OF2A 1GAEO 4ZEMA 1XLWA 2XUOA 2ZQYA 3B3AA 3H2HA 2CJWA 5HZKA 1FVOA 1YBMA 4FMPA 4D5EA 1NW8A 4TYPA 3FROA 2EC5A 4P32A 4EG3A 1P80A 4E5SA 2MINB 1K7YA 1QHEA 1UBLS 2QLBA 3STWA 5CGQB 2M6KA 5LXTA 3TGLA 4R3WA 3E8SA 2PNJA 4GIBA 4URYR 1Y33E 3T15A 1KMHA 2ONKA 4RA6B 2X6TA 3T9AA 1UPUA 1WB6A 4C6RA 2VQ6A 5JEEA 3OUTA 1CVRA 3RSFA 4BU0A 3AL3A 1KQGA 3NBMA 4Q9IA 4WKCA 2C7RA 4W1QA 2I9PA 4OKSA 3UY4A 5KPDA 3OZVA 3QUSA 3U7HB 3EZNA 2FWIA 2CD7A 2W2QA 2Y1WA 3QEOA 3R76A 2XCSB 4H27A 1UXOA 3O9ZA 4OUDA 3MWYW 3VOBA 2FPUA 1T1EA 4PSVA 5EJ4A 4LXGA 4M1KA 2RIRA 4MV3A 5JBNA 3HJTA 4RCZA 4YRGA 1LZKA 3TLAA 1T26A 4HRYA 2FUKA 2RHOA 2O54A 2Z2KA 3PPYA 2HWWA 3KYDB 5BWCA 4I55A 4V0MA 4KO2S 3L4KA 4HXEB 8OHMA 4MYTA 5KVCA 3S2ZA 1RAEA 3TCKA 1JDPA 4HUQA 3UMYA 2YHUA 4IXDA 2I4TA 4HN9A 1E2JA 4XA8A 2C2WA 3IRUA 5B5SA 4AECA 1AS0A 4A0HA 3FCEA 2ZB4A 4D9MA 4ZCMA 3VHQA 4MKHA 1NF3A 3SF0A 5KTTA 1W2GA 3L7LA 3PQDA 1SM4A 3WO1A 5BRJA 1ABBA 1XMIA 1MB9A 3TOZA 4B75A 5K45A 4ZO9A 4GW3A 2QIOA 4ERNA 4NYMQ 4YAIA 4ND8A 1JMKC 2WIDA 1OHHD 1EDOA 3ND6A 3T38A 5HZHA 1ZN7A 2PLWA 1RRFA 2JI9A 2O3RA 3HCNA 3EDYA 3CSSA 3P0EA 4WZBB 1Y4SA 4YRAA 4Q7JB 1BVUA 3VC7A 4DADA 3LUDA 3PEEA 2AN1A 1FSFA 1PT7A 4N7BA 4P5EA 5DXJA 4GWGA 1M6HA 2Y9MB 4OHZA 4ASUA 4BP3A 1SCJA 3IT0A 5CDSA 3GGJA 4B3HA 4D42A 2O8BA 4COKA 4PLVA 3NV9A 5E3HA 2F1IA 2AOWA 5FCDA 1JUDA 2JBHA 4CMIA 1AKYA 1P1BA 4UATA 1Y80A 4R7ZA 1DBVO 3ZWMA 3A9VA 1DJMA 2AW5A 1KXZA 4H3HB 3SX4A 5AXCA 4MNTA 1EPUA 1GQOA 3D81A 5E4TA 3EJWA 4IINA 2KLHA 1II8A 2XQIA 3KJGA 3LPAA 3ZCSA 5L9AA 2H1WA 3DB2A 4HJRA 4HB2A 1QOPB 1L8LA 3NUGA 1OVGA 4X7MA 1G8KA 1YASA 3MN1A 4IJ6A 1R3DA 4CLXA 4FS3A 5CA0A 3NVMB 4BN4A 5C8YA 4PAQA 4LPSA 3BMNA 5HA5A 3OZ7A 5I7UA 5DCWA 4ZU6X 3IJ5A 2F8TA 1GG9A 1NOJA 3QZUA 4ZVUA 4EHLA 5I01A 1CZUA 4JLVA 2C20A 3RUDA 2I8LA 5DWDA 2AK3A 3P9PA 2A0XA 3O3NB 4IJUA 4J07A 4XVRA 2NP6A 1M2VA 3I9MA 4H0CA 4YREA 4F60A 2D1SA 2C58A 3K71B 3JD2A 1NE7A 2GERA 5HIJA 3AUFA 3B53X 2BM0A 5IULC 1GPAA 2BFFB 3L7DA 3GLHA 3DF7A 3GN2A 2QDXA 4WCDA 4M49A 1NATA 2PKEA 2WNIA 2PMEA 1DQZA 4IIFA 3ZWYA 4WN9A 5FI0B 4LJSA 4O3MA 1VPLA 5DK6A 5KJ1A 1K7XB 3OZUA 4R83A 1I24A 1E6WA 5CR9A 5C0OE 2BFCA 4YRZA 4LG1A 2A33A 1QIFA 1BYIA 1KDYA 1Q1NA 2YDYA 1O94D 5JCOA 1OLOA 2DTEA 4BWGA 2PUDA 2O2XA 2H18A 4TZTA 2W2PA 2O05A 2O8FB 1A2QA 1NQ5A 2JZNA 3VPDA 4C4YA 3BGSA 4NENA 3ENNA 2EL7A 2A14A 2G88A 4HGNA 3GW8A 3QEAZ 3OCZA 5JNUA 4O4HB 4Z53A 5GADl 3OT1B 4KK4A 1XUOA 4KR9A 4ZVQA 2UUCB 1WWKA 4ARBA 1OKKD 3D6JA 4NH0A 4UOQA 3SFTA 1OKKA 1EX9A 2ZROA 4KJZA 3G2LA 4ITUA 4PF1A 2VN8A 4CIBA 1WUTA 1SU4A 4Z4CA 3SYKA 3UGJA 3LLCA 2BZ1A 5T4FA 4X1IA 5FPSA 3FI9A 1CUXA 3LPDA 4R3NA 1ZY2A 4DSOA 3PA6A 4R98A 1RT9A 3P9NA 1DAOA 1NUHA 1RWMA 4B82A 4JQOA 1E6UA 1NPYA 4DMMA 5KYYB 2HDHA 1U2PA 3NX4A 4RSRA 3HADA 1WOYA 4FNOA 1ZG3A 2F3QA 2R2AA 5EEHA 1MO5A 5ALEA 2QZZA 2ZZMA 4URHA 4D3YA 4D97A 4DJ5X 1F48A 4KYTA 3WAGA 2HM7A 1Z13A 3KX2A 4DBZA 3L8YA 4LRTB 4L02A 1T9DA 3F8WA 2R11A 2WJPA 5HIIA 1MP0A 2XPCA 2Y93A 3G0CA 3H8WA 5J5VA 3TCXB 4JUCA 5L8VA 1IZZA 1E1CB 4QYIA 3UOWA 2OBYA 3ER9A 1Y7PA 5ALDA 2M2IA 4KPYA 3E84A 2C00A 1XYGA 5CB4A 4NNJA 2FWMX 3G5AA 4D44A 1KYTA 1YFLA 1W52X 2B5OA 2PVSA 1W29A 4G25A 4DCCA 2BFDB 4TS3A 4M0UA 3A9RA 3ZCRA 4QJBA 2OLEA 2LKCA 4BQOA 1KO1A 1CFJA 3G17A 2VYNA 4MWZA 1E5QA 2JJMA 3EYAA 4D6YA 1KH1A 3U1TA 4M37A 2WBLC 4LF6B 3PYLA 1J7JA 4NV1A 1JNYA 2J4DA 4XSGA 1W88B 2H51A 3S4YA 3HU1A 3MHPA 3PDCA 3GGSA 1YOVA 2YR0A 2ZB8A 1M74A 5DLEA 3D6UA 4DKJA 4BIIA 5IUKC 1B76A 2JA1A 2B1GA 2GPTA 1Z88A 3AY0A 2YH2A 3G2PA 3H5NA 4EA7A 4QGHA 1Q1QA 4MIOA 2B4TO 4LQCA 4AW9A 2YHAA 1VPDA 1JL3A 2VBFA 5DBHX 4JASB 4RHXA 3OFVA 4DMCA 2E6UX 5A5DA 4BE9A 2QZJA 4KXMA 4PYRA 3V00A 5IZCC 1JG4A 2IELA 4YACA 1MGPA 1YKGA 1VBMA 1XAJA 3PPWA 4J29A 3KKQA 4Y98A 3KLOA 1G6KA 1KMIY 4XM2A 3UH0A 2ECPA 4FIZA 3RC7A 5TEVA 3JAKB 4B6OA 2XNJA 1QVWA 3HZHA 4YI3A 4BUZA 3DBIA 1Z6AA 1VGVA 5EJMA 4JI5B 1Z6GA 3MWFA 1WKCA 3QOYA 1H5NA 4FWBA 4GR4A 4OG2A 1NBIA 2FHPA 3AYZB 3CEMA 3GLGA 4NZZA 1T2AA 4L0QA 2B6HA 1SKMA 2MR5A 4O4LF 3ZIAA 4TLMB 4P5DA 5I9SA 2WMYA 3ICEA 1U0EA 3AZOA 4GSLA 4YROA 1I3LA 4KN9S 2XYVA 1GT6A 2C9BA 2RHJA 4XVHA 1P4AA 2C82A 3OEHA 3WXBA 1XO1A 5BY2A 3K1AA 4YGXB 3MJSA 4F04A 1QK5A 3WDKA 3K8OE 3LE8A 3VAZA 1JFRA 3RROA 4EIWA 4Z3KA 3D6NB 5CVEA 4EFKA 3I2JA 1MAVA 1AGYA 2VNHA 1SGWA 4GICA 5HFJA 4LYEA 5DB4A 1GYQA 4OYRA 2ZWAA 4RGVA 2OZLB 4WCFC 2IZ1A 4HS4A 3TNLA 4D4JA 5A03A 1GG5A 1ZUNB 3I4CA 5C1DA 3H9EO 4O2AF 1K3TA 5ER9A 2IBTA 4RTNA 4DGQA 4L5IA 3H9GA 5KNLA 3AH8A 5KMGB 4HH4A 2GEKA 2YNMC 4M87A 4GX2A 2B4QA 3TX6A 2XCOA 2PFKA 4QYXA 5LIPA 1DB3A 2A0YA 4TWZA 5I7OA 3GLFB 1JB9A 3MD0A 5GQSA 1TEXA 2FV8A 2OO5C 1T6YA 2ERCA 2G76A 2ONCA 2WSIA 4L72A 1XMPA 3Q88A 1A27A 1EE9A 1U8AA 1ORVA 2CCKA 3MWDA 2H29A 3HG7A 3O92A 3WIOA 1FYVA 1FIUA 4X63A 2QJTA 1YZQA 1QAOA 2GS9A 2P78A 2JKYA 3KUKA 1JSCA 1PTKA 3KWFA 1E9VA 1NI4B 3TD2A 1JZSA 3KOYA 4Y0AA 1UBGA 5LJIA 2WTEA 1U0TA 2WHQA 1XXHB 2WB4A 3WQHA 1IPHA 2IS6A 1Z4LA 2DKOA 1V7ZA 5EI5A 5C37A 1RXVA 3T1QA 3BKWA 3F2IA 1FDOA 4YRBA 3PNKA 4FFSA 4CE6A 1R9GA 4G07A 4ZOAA 5BYKA 3LXXA 4BMSA 1XFAA 4GS5A 1N7GA 2ZRBA 2PWZA 2UYCA 2EP8A 3H2JA 1NONA 3H1GA 3H1PA 3W4KA 1WW8A 2PO5A 1XQVA 5KSWB 2H5EA 4ERXA 1PJ2A 4QU9A 1XZBA 1FJHA 4YJGA 1US8A 4NBRA 4QQKA 4QU5A 3ZNQA 2WT8A 3ZWWA 4AM8A 4U7PB 1DPGA 4MYRA 4N41A 2G77B 1NLYA 3W9YA 1E62A 1GO2A 2GOYA 4BC1A 2HDWA 3WMFA 5AM1A 4W9NA 2BEKA 4AJIA 5AOBA 2Z04A 3LSYA 3PEWA 5JAPA 1L5MA 2G9NA 1KO8A 4JA0A 4PZCA 1PYGA 1E2LA 5IT9A 1Q3TA 3A1UA 3K2IA 1HEYA 4QAQA 1Y63A 3RK0A 1G8MA 4UBNA 5GM2A 1ZC4A 5K6AC 1YS6A 4LBZA 1X7WA 1SCDA 2AOXA 4AZ0A 1G8HA 2B9VA 2CJYA 3IPYA 1O7JA 3KLBA 4N49A 4CG1A 4E21A 3THXA 1VSQA 3WLAA 4K9NA 1GIAA 4ENRA 3O74A 2Q7XA 3D6TB 4KR2A 5BORA 2G08A 1BN7A 1O0SA 1DT3A 1RAGA 2OAQ1 3BMOB 4ALMA 4A0QA 5ITSA 5HTOA 1R16A 3EZ6A 3E4CA 1LFDB 1TM3E 4XQ9A 2QKYA 3NDJA 4C6SA 4CLDA 2BONA 2CK3D 4BCBA 2VT7A 4N0QA 1HQYE 3OESA 3BM5A 5FR2A 1NW5A 3Q8XB 4J7AA 4U6SA 5REQB 5IHXA 1YCGA 3KOXA 1SCKA 1TU4A 4N82A 5H02A 1THGA 2AYZA 2ZUUA 3BMQA 4KYUA 3SHVA 2HEGA 1RI5A 3U9SA 5AW3A 2XE8A 5TY0A 1RFLA 2XLBA 1E99A 4D56A 5ALQA 4FI3C 3UXMA 4ZICA 1XDSA 3JQGA 3TR5A 3WGVA 1U9IC 4CTKA 3GFBA 4OATA 1E6MA 3KAJA 1G5RA 4KACA 4UMEA 3E23A 4PIMA 4MKXA 4L75A 4NICA 4H1WA 3JWJA 3MOSA 3OLWA 4RF3A 1VMAA 2G4CA 4RQBA 4RFSA 3UAWA 3FTQA 1UBRS 3GT3A 3WBBA 1LB1B 1N5OX 3A70A 3DBOB 3N8IA 5KPJA 3GDGA 3Q7TA 5LB2A 3IAEA 5E6SB 2EFJA 3C3CA 3VSCA 4C20A 4Z1OA 1PWYE 3Q3VA 1TA4A 2W2XA 3H5VA 3H3FA 3WGNA 1COWD 1FW8A 3IUEA 1YZYA 3OLYA 1XFDA 3LFUA 4X8OA 4X7PA 5BNIA 1KDVA 4EATA 1I94B 2HO4A 3T1TA 4R9RA 4KREA 2IZ7A 5F21A 1N3LA 1LDEA 1XXHE 4G81A 5IJXA 2PJDA 1P4HA 2JK0A 2H2WA 4UU7A 2Q62A 4XD7A 5K3AA 5HKOA 3NBAA 5A1TA 4F7DA 1ZSNA 2A58A 4TX1A 1KY3A 4B6RA 4OMFG 1UC8A 4EJ2A 3U3OA 4F2GA 3FPAA 1GL6A 1E3IA 1JSLA 3WOHA 4OHCA 2POQX 1XK6A 3O31A 1KH3A 4GPBA 4RY2A 5FTKA 2ZATA 1NBEA 5L95A 2B83A 2ZYTX 1LBSA 1QFJA 4P53A 4TT8A 3TPZA 2R5WA 1IHXA 4I36A 2A86A 2XTZA 4LV8B 5DXFA 3HM9A 1FRQA 3UXYA 3U7GA 1RZ3A 1ARZA 4NKRA 4B32A 1WHTA 3BWBA 5CX1B 2V8BA 3G0HA 1H2BA 3V1MA 3UWOA 3ZHOA 4IHJB 2OK8A 2JRLA 1I4EB 1WX1A 2QD1A 4Q02A 4Q9DA 3U9TA 4C22A 2ODNA 4RC9A 3L1UA 4MJ7A 2VTBB 3TQFA 2ZSFA 5FHQA 2H85A 3H83A 3OICA 2A9PA 4IVPA 3I1JA 4Q3LA 1YB4A 4KIFA 2HPHA 4BRWA 5DNEA 1G8YA 1SKUA 1DKPA 2E21A 2HJVA 2D8AA 2OPBA 3ELUA 1JHPA 4LGCA 2WUFA 5BN4B 5CB4F 2WLTA 1ZNYA 3JAKA 4I3FA 4MLPA 2QW0X 3V4VB 5A2QA 2Z1MA 1M2OA 1SBHA 4HBGA 4FN5A 5D8DA 5I5GA 3UJBA 3WRYC 2D59A 3L0YA 4AJPA 1ZNXA 4JLWA 4C3UA 3H8JA 1I2ZA 3WLKX 5CDGA 3F6BX 4MCJA 3DMFA 3B2NA 3EAFA 5CCBA 5D7BA 1A4UA 1F06A 2GJKA 1K86A 1VJTA 1D1QA 2ORWA 3FFBA 5JDCA 5J23A 1QQBA 2M6RA 2WJZB 2IODA 1N6LA 2QJFA 2N47A 1JEQA 2X0EA 4C2BA 1Y0BA 4AJKA 1ZAYA 2ZE6A 4N3AA 3TLYA 4V24A 1E2KA 2C4VA 2ZREA 2XKKA 5CXSA 3RAGA 4C0JA 4DNQA 3VAAA 1SCUB 1JTEA 4HLDA 1AGXA 5JWOA 4NAVA 4JA2A 3JARB 4RIIA 1NQTA 5DE3A 5HWSA 1FTGA 3AUAA 1MB3A 3V7YA 2Q5JA 1RCUA 2LP4Y 3M6VA 4WQMA 5EIBC 3SPXA 2OCAA 3ADPA 4LW8A 3TMYA 9MHTA 5LOVB 5BQPA 1T5BA 2M32A 1SC6A 1TVEA 2P3QA 3QG5A 1M76A 4MVJP 5F4ZA 2JAQA 3L4EA 3IDQA 3N2KB 3VU9B 2O14A 1VI2A 4K6MA 2HZ7A 3AF5A 3G8YA 3DEKA 2J59A 3ADOA 4C14A 4YUYA 4H6VA 5EE0A 5EZSA 2A4KA 3L8HA 4EFMA 4F86A 5LLTA 3EIUA 4TL6A 3PYMA 4P4LA 1EDZA 1BS9A 1X80A 3IVGA 4RH0A 2CV0A 4KQ6A 5GOTA 3R20A 1P9RA 3FRJA 4GXTA 1HORA 3LZDA 5D3ZA 3ZKWB 3AUJB 4D4MA 3PDHA 4AX8A 2GFIA 5FIUA 3RQIA 4G8BA 2BDTA 3S8MA 3IUQA 3VTFA 3NAMA 1IN8A 5AKIA 5E7IA 3BL8A 5HYVA 1FF9A 3X1MA 2ST1A 3UICA 5KC8A 1DC4A 3IESA 2XSZA 4RKYA 3C0KA 3CMMA 2YJ6A 3B60A 3SS8A 2IH4A 5EFOA 1ZIOA 4FNGA 3BHNA 4KWHA 4Z3DA 1TT5B 3F46A 1JLLA 1T3LA 2CE7A 2RGNC 2RIPA 3U7QB 4NOMA 1LNZA 4GMXA 5HF6A 1FDUA 2BI7A 3KXDA 4MSUA 1ZEJA 1COZA 3AILA 1ESNA 2X9NA 3VUEA 3K8YA 3LDUA 2DCUA 1QKIA 3QX8A 1PJSA 1WCIB 4QGBA 1R74A 2CMFA 4RF2A 3ETJA 5DGCA 3Q7PA 2KSQA 1YVEI 3H99A 3Q7SA 1F2DA 1V37A 3ONDA 3VKWA 1GTL1 3HE3A 2GBCA 4Q4AB 1BHSA 1PIWA 4CN8A 2ZJ8A 2IKQA 5A5VA 1M0WA 3EF0A 5JNRA 4EJSC 2ZJ7A 1DBWA 3U3RA 2Z4TA 1H2FA 1ZRSA 3EEBA 2YMPA 5E2AA 4AAYA 1A77A 1I32A 4D74A 1YXMA 1Y4ZA 1KI2A 2H2AA 4QDUA 1VFPA 4OQEA 2L18A 5F1PA 2FNAA 1DTSA 4JL6A 2QVZX 1AKEA 1REQB 3TYXA 1OLUA 2GQ0A 3EYWA 3PUHA 5DTMA 2QVXX 4RVFA 4J0EA 1QZZA 2XUZA 4JI6B 1Z83A 1E2MA 1I0ZA 1XMVA 3NHZA 2WYIA 4OHFA 4PM4A 1X7ZA 2X4GA 4WY8A 3WIVA 1N6OA 1RYHA 2DULA 2VDPB 1MAUA 1T9GS 3GLSA 1SVSA 1VG8A 2PCLA 4I4IA 4Q4CA 2RGYA 2X22A 5CW1A 1PI3A 5KJEA 4PAWA 5D5HA 3MGGA 3RJZA 1XLVA 1YDEA 1KETA 2QSJA 1J9GA 5B4UA 1N6IA 4EJFA 4TN5A 4L2IB 1ZCFA 2X19A 3CBQA 3DVAB 3EIWA 3WQQA 2IX3A 4DMRA 1MOSA 2C7GA 3IKJA 2AFHB 3OETA 4L3VA 1U2DA 2NZ8A 3MLBA 1SHUX 2ZSDA 1CU1A 1G20A 2FZ5A 4KSCA 3RRNA 1B3RA 2MR6A 3EIFA 3BMNB 3KHUA 3ZU5A 1T5LA 2I76A 5E1BA 2OCPA 3OF5A 1GKKA 3GFGA 2O52A 5HEKA 4Y2TA 5AW9A 3UPDA 1KAMA 2IHKA 3SYMA 4N3BA 3QFFA 3BG5A 2X1VA 4LRSB 5AI9A 3O8LA 4JC4A 4ZREA 3DHNA 2D2IA 5I7AA 4ACBA 1T1RA 2FPXA 3LT4A 3QWFA 4FOOA 4M22A 1A04A 3TLXA 1QOZA 3F7NA 5D00A 1Y7IA 2Q4TA 1RKUA 3U9LA 3WKCA 4NECA 2AXPA 5AK3A 2DPXA 2F2TA 3C3MA 3NORA 4WDQA 1E4EA 4OSEA 1P4SA 2OG1A 1ANKA 3INRA 5FLYA 2VT2A 1AKTA 2O7QA 3EG9B 1ZESA 1C8KA 1M7GA 4CMCA 4TLAA 4PC7A 4NH4A 3T7EA 3NHLA 5GTDA 1GNPA 1QAMA 4MJXA 1HE2A 1EVJA 4C0KA 3KE9A 2JAPA 3BXPA 4TLDA 2JL1A 4UTRA 2YV4A 1F4VA 3DWFA 3F9IA 2VJAA 3PPXA 4S1WA 4YJ2B 2PEZA 4H7IA 1E0DA 1K75A 3NHBA 3ZHYA 1PTJA 1RAFA 1B8NA 1W4RA 4Q4LA 5DWQA 3IBSA 1ONPA 1O97C 1WULS 3T1OA 1E1DA 1FQKA 5HQTA 2ZGVA 4U7GA 2PM8A 2GM3A 3LBYA 1CZRA 3ESYA 3HXQA 1XGKA 2CXSA 2FPIB 1BMFD 4HWRA 1J5EB 4ZOQI 4IIUA 3FBGA 5F7XA 3VDRA 4YASA 4EDHA 3H6GA 1G3RA 3A26A 1SUSA 1NV9A 2JI6A 1KR5A 1Q19A 4ZO4A 4KQKA 3BXEA 4KP7A 3K70C 3DVQX 3C43A 2WU8A 1P44A 3H19A 2ORIA 3A4NA 1XDDA 4II2A 4PIPA 1WLYA 2FN9A 1VLJA 3TQTA 1CZNA 1G42A 2GNPA 3TOXA 4D46A 1Z7EA 3K6SB 4PZEA 4AUEA 2FFBA 5LQUA 3AJDA 3LC7O 821PA 1T0IA 5K8UA 3KP1A 2I3AA 5JH7F 4RVUA 3NW9A 4JYCA 1HT3A 1JQAA 1C14A 2FP4A 5FBKA 2NXCA 3BUSA 4K9PA 2YZKA 4R2WA 4BJ3A 1SKAA 2VPIA 1O89A 4X20B 3R5KA 4QU8A 3JZMA 1Y8RA 2ILTA 2IOFA 1P6XA 3IEIA 5GGYA 2ZRAA 4DLPA 5KTRA 4BVEA 1Q1BA 1KDTA 2B7CA 3AB3A 5H0IA 2P3LA