3THRA

Crystal structure of rat native liver glycine n-methyltransferase complexed with 5-methyltetrahydrofolate monoglutamate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
292
structure length
286
Chain Sequence
VDSVYRTRSLGVAAEGIPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLALKNIASMVRPGGLLVIDHRNYDYILSTGCAPPGKNIYYKSDLTKDITTSVLTVNNKAHMVTLDYTVQVPAPGFSKFRLSYYPHCLASFTELVQEAFGGRCQHSVLGDFKPYRPGQAYVPCYFIHVLKKTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycine N-methyltransferase
publication title Differences in folate-protein interactions result in differing inhibition of native rat liver and recombinant glycine N-methyltransferase by 5-methyltetrahydrofolate.
pubmed doi rcsb
molecule tags Transferase/transferase inhibitor
total genus 90
structure length 286
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.20: Glycine N-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.46.10 Alpha Beta 2-Layer Sandwich Glycine N-methyltransferase; chain A, domain 1 Glycine N-methyltransferase, chain A, domain 1 3thrA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3thrA02
3KKZA 1I1NA 4E2YA 4QQKA 2AOTA 2OXTA 2YXLA 1SQGA 4FT2A 4KIGA 4Z2YA 5DM2A 2PX2A 3NWBA 2ERCA 4PCLA 3OE5A 5EMKA 3DMHA 3MCZA 4PYJA 4OBXA 4QTTB 5K0NA 3MERA 5CD1A 2CWWA 5CVUA 2YX1A 1QZZA 4CTKA 4RTMA 3FYDA 3KPYA 5ERGB 1G8AA 2GS9A 1NV8A 2PSSA 2I9KA 1JQEA 1R00A 1NW3A 2Y1WA 2GB4A 5EG5A 1QAOA 1R8YA 1FP1D 4U7PB 5HZMA 5EC8A 2PXAA 3KR0A 3I9FA 3UJ8A 2AVNA 1KP9A 4CKCA 2ADMA 4RTJA 3UJAA 3TRKA 5BW4A 1JSXA 3ER9A 2P35A 3L8DA 4PIMA 5DRTA 3DXYA 3DXZA 3HCBA 2NYUA 5HIIA 4E2XA 3M6VA 2AZTA 4YMGA 3HVHA 5LQAA 4GBED 4M37A 2AOUA 1NW6A 4AX8A 4X61A 5C0OE 4ZTBA 4LG1A 3GJYA 2CMGA 2P3QA 3B89A 3UA3A 2JH8A 1KPHA 1MHTA 3HEMA 4EVIA 1RI4A 3GNLA 5U4XA 3EVEA 5DLYA 4RTNA 5ICGA 2QYOA 4G56A 5FHQA 2BR3A 5HIKA 5HOQA 1F38A 5CCBA 3SVZA 3EVZA 5EQJB 3BZBA 2ZBQA 4E70A 1G8SA 2G70A 1O9GA 1KYWA 2JHPA 4DKJA 3CKKA 2G71A 2YXEA 3G8AA 3LSTA 3OZTA 5DWQA 1BKYA 5K0GA 1ZGJA 1XDZA 1SUIA 2FYTA 2O0LA 2YUIA 2ORED 5JUWA 5ICEA 2UYOA 4F84A 5DM0A 3LECA 3HCDA 3SGLA 4RTPA 2PLWA 5EHGA 4FSXA 4C4AA 5LQCA 4C07A 4XUCA 2ZVJA 5T67A 3ANXA 3NTVA 3Q87B 4E2WA 2OY0A 4K6MA 4YUZA 3DULA 3BKXA 2HR1A 2G1PA 1SQFA 3EVDA 5LSAA 2GAFA 1YFLA 4X63A 1YUBA 4RTKA 2O57A 1NT2A 4KDRA 1RJEA 1X1DA 3D2LA 3P9NA 4RVFA 1UIRA 3B7PA 3X0DA 2EJUA 3FRIA 3GRRA 4CTJA 4KIFA 5BXYA 4R8SA 1M6EX 2XYRA 2XYVA 3OZSA 4RWZA 3CVOA 3TMAA 3C0KA 3P2EA 5E1MA 4RTSA 1JG3A 3THSA 1OR8A 1SG9A 4MIKA 5DTRA 5K01A 2XBMA 1EAMA 1AV6A 2FK8A 5E1OA 3FPFA 1EQAA 2JHAA 2WA2A 3AJDA 3G2QA 2PX8A 5DPMA 3KPJA 5DXJA 5M5BA 2ZLBA 2IH5A 1RJGA 2B2CA 4U7TB 3TQSA 2PKWA 3KQMA 4PIPA 3JWHA 4EKIA 3GO4A 4LWPA 1TW2A 1NV9A 4POOA 3LCVB 2EG5A 4EMSA 2C7OA 2OPBA 4RSRA 2PT9A 5T64A 3FUXA 4F85A 1WXWA 5CVEA 3VC2A 3M6WA 4RTLA 2I62A 3GGDA 2UYHA 5T6BA 3FUVA 3QOWA 3R6TA 2LD4A 2DPMA 4V0RA 4OA5A 2YVLA 4RTOA 2IFTA 5FULA 3BT7A 3R0QA 5FWDA 3KQTA 3EMBA 4RV9A 1TPYA 1D2CA 4RTRA 2Z6UA 3P97A 3NW9A 3BGIA 3HM2A 3DH0A 3O4FA 2XVMA 5JR3A 4H0NA 5IH3A 4QQNA 3UJ6A 1AQJA 4DF3A 3GU3A 4IV8A 3LBFA 2BR4A 3FPGA 4R05A 1QANA 1BHJA 1L3IA 3UJCA 4P58A 3WSTA 1NBIA 3G89A 2P40A 3KPWA 3FPJA 5EPEA 4PGHA 3A4TA 5DM1A 5GM2A 3HTXA 3IEIA 4HRAA 3DUWA 5G02A 2PY6A 3DOUA 2CMHA 2GPYA 3I58A 4GUAA 3PTAA 3OPNA 2ZCJA 3KR1A 3HCEA 4BP1A 4RVDA 5E9QA 3PX2A 2IH2A 3PS9A 1JTEA 1RI2A 3BWYA 2GA9A 4MTLA 1RJDA 5GP1A 4E32A 5F2OA 3E23A 3RW9A 2OO3A 4RVHA 4RYLA 3RIEA 2IH4A 1XDUA 3PB3A 5C9ZA 5K05A 3CBGA 2AOXA 1KHHA 1Q0SA 5EOVA 5LQUA 4HC4A 1G38A 4PYLA 3CJTA 4KVZA 5E8RA 4Y2HA 3G88A 3SXJA 2PXCA 3R3HA 3EVAA 3ELYA 1KPGA 2QM3A 4GF5A 2C7QA 3EEYA 2P3OA 2PT6A 3LDFA 4E2ZA 4OQEA 2CKDA 1KXZA 2YXDA 5EGSA 3QOXA 4MHTA 4GOMD 3E8SA 4B17A 4HGYA 3UA4A 3LHDA 3BWBA 2VP3A 2ZTHA 3IV6A 4YV0A 3M70A 5EMLA 1R18A 4L7VA 5HIJA 5P8WA 3R24A 4HTFB 5E9WA 2PGXA 3UJ7A 3UWPA 3GRZA 3HNRA 1YFJA 3G2MA 2IPXA 4PWYA 2AOVA 3KR9A 4YMHA 1ZGAA 3F4KA 4DCMA 2FK7A 3G2OA 5F2KA 4BLUA 1XVAA 3DTNA 3T7SA 1ZQ9A 3GXOA 2GLUA 4LWOA 3B3JA 3FZGA 3MCTA 5DX0A 1JTFA 1INLA 3C3PA 5CUQA 3LL7A 3MHTA 1JG4A 3LPMA 2ZIEA 4FP9A 5DTQA 2C7PA 3EPPA 3LKDA 4NECA 4GC9A 3BKWA 3FTDA 4ER5A 1VBFA 1P39A 1G55A 2BM9A 10MHA 2IDKA 3TLJA 5FUBA 2O05A 1XCLA 4PYNA 3BGDA 5HIMA 3A26A 4DM3A 3EEOA 3A7DA 2I7CA 3C3YA 3T0IA 3LBYA 2PJDA 4BP3A 3TM5A 2JJQA 2R6ZA 2VZ9A 4IKPA 3TOSA 3TPZA 4E31A 1R6AA 2G8NA 5DSTA 3PFHA 2OKCA 3JWJA 3THRA 1WS6A 3EVBA 3O7WA 2ZZMA 3M6UA 2PX5A 3LCCA 3DR5A 1IM8A 4R6WA 4YV1A 3A7EA 1Y8CA 3HCFA 3AXTA 5CIYA 1NE2A 3H2BA 5ICFA 5FADA 1P1BA 4BLWA 2ZSUA 2P7IA 3KHKA 2DULA 2I6GA 3EVGA 4QVGA 1M0EA 3S68A 2HTEA 2P41A 3G5LA 4KRGA 3VYWA 4A6DA 1VIDA 5KS2A 2ZWAA 1V39A 2AS0A 1XCJA 3DLIA 1O54A 1JSZA 2BR5A 3KPUA 1YF3A 4JXJA 4YUYA 1VPTA 2NP7A 5EKXA 3SSNA 1L3BA 4WVLA 5E1BA 3PLAE 3I5UA 3OU2A 3UJ9A 4ER3A 3EVCA 5DX1A 3FUTA 5B1SA 4C04A 4CWAA 4PNEA 3NMUF 3KQPA 2NXNA 3GRUA 5CVJA 5F2NA 3FTEA 4PYQA 4R6XA 4CKBA 2AN5A 3AXSA 3BWCA 5EIFA 3GCZA 1QAMA 4X41A 4FT4A 5DT2A 3KPVA 3MTIA 4LECA 2ZBPA 5E8JA 3HA5A 5DM4A 2O07A 1RI3A 5DRYA 1EG2A 2YTZA 3EMDA 3E7PA 2AOTB 4GQBA 4IV0A 1KIAA 2QRVA 2H00A 4MWZA 3OCJA 4A6EA 5K0BA 3P2IA 4GC5A 5CVVA 4M36A 5FQOA 2PWYA 3RODA 5K0CA 3K0BA 5K0FA 5BW5A 3R9XB 5K0LA 4P7JA 4P7GA 4C08A 3HVJA 2ZFUA 5LQJA 5LR6A 3SX0A 3GRVA 5EKUA 5ICCA 3ME5A 3MGGA 4MQ4A 1BC5A 5EZSA 3LGAA 2ONYA 1NW8A 4F86A 3SM3A 3GRYA 3JWIA 1SKMA 4AZVA 4OA8A 1YZHA 5LQNA 2ZW9A 2YQZA 1QYRA 2VDWA 5FHRA 3OZRA 2BZGA 3PFGA 2UYCA 1ZHFA 4FZVA 4YUWA 5GINE 1NW5A 3GWZA 3EGEA 5DX8A 1G60A 3OFKA 4DA4A 3G7UA 3T7RA 1L3CA 1MJFA 2H1RA 4UOEA 3UBTA 3ORHA 4KW7A 5CVDA 9MHTA 3HVKA 3TKAA 4FS8A 3EGVA 1H1DA 1WY7A 4EQZA 5E2BA 5KQRA 4C06A 2PXXA 2AOUB 2B9EA 2F8LA 1D2GA 3ER8A 5EEGA 1NKVA 5FTWA 3V8VA 3A27A 5EMJA 3NVMB 3GIWA 4FSDA 4YUXA 3NVKI 3NDIA 4HGZA 2VS1A 1PRYA 4DZRA 1AQIA 1I4WA 4PCAA 4XUDA 3C6MA 4DMGA 2PBFA 3FYCA 2NNWB 3KU1A 4HG2A 1SUSA 2YR0A 3FUUA 4AZTA 4GOOD 2E5WA 5KVAA 4BY9E 1VLMA 1DUSA 1L1EA 3KR2A 3HA7A 2HNKA 5MHTA 3ELUA 4OBWA 3HVIA 3BWMA 1XDSA 2G72A 2PVCA 3BUSA 2NXEA 4QDJA 4RVGA 1DCTA 2Z6QA 4DQ0A 2OB1A 1RI5A 1KPIA 3G8BA 3NDJA 3TR6A 1XTPA 5E9JA 1ORIA 2ZWVA 5HEKA 4PYIA 5HFJA 3ERCA 3MAGA 3REOA 3G2PA 1VQ1A 1NW7A 1P1CA 1T43A 1VE3A 3QV2A 1X19A 4CKEA 5LQRA 2O06A 1O9HA 2B25A 1FP2A 3AWIA 1G6Q1 3KQWA 4IWNA 1Q0TA 2EJTA 5D1NA 1EJ6A 5E2AA 5D1HA 3EGIA 4HH4A 3MQ2A 4EKGA 3T7TA 5GOZA 4E33A 5EIWA 1EJ0A 5FA8A 4WXHA 3O31A 5C1IA 2IP2A 1JG2A 1U2ZA 2Y1XA 3OFJA 3K6RA 5EHIA 3VC1A 1DL5A 3LKZA 2FCAA 3B3FA 2AOWA 2CL5A 2A14A 1N7JA 2NXCA 2AVDA 3G5TA 2B3TA 4X60A 1WG8A 4OQDA 2ZZNA 3UFBA 2VDVE 3LCUA 2P3LA 3JWGA 4X1OA 3M33A 5EZQA 2JH9A 1IY9A 1JQDA 2OBFA 3PT9A 2QE6A 2R3SA 5EEHA 4PINA 4BLVA 2PWPA 3KQYA 3NWEA 4ER6A 2V7EA 8MHTA 3SR4A 5GIOE 1HMYA 1D2HA 5KQSA 1QAQA 1PJZA 2H11A 4GEKA 2Q41A 1SVUA 3A25A 1IXKA 2XVAA 4YUVA 2Z6AA 3B3GA 4EK9A 4QVKA 5GWXA 3E05A 1YB2A 3SSOA 3PVCA 5DXAA 4GOLD 3TM4A 5H02A 2UYQA 2P7HA 5KYGA 3U81A 1FJXA 4QPPA 3KQSA 1NBHA 4FR0A 5FQNA 3M6XA 2QRVB 1N7IA 4P7FA 2B78A 1P91A 5DSXA 4E30A 2IIPA 5CM2Z 3FPEA 2EX4A 1KYZA 4QPNA 3HP7A 2AR0A 4M38A 1FPQA 4KDCA 1JG1A 2EFJA 4QDKA 3TKYA 3SMQA 2ZIFA 3ELWA 1ZKDA 4GOND 1N2XA 2HMYB 2JG3A 2WK1A 1M6YA 1VL5A 2PV0A 2OYRA 3PX3A 3EVFA 1F3LA 3FUWA 3M4XA 1R74A 3OU6A 2GH1A 4HTFA 3DLCA 4RX1A 1R8XA 2ZBRA 2N47A 4PYKA 1B42A 3KQOA 3UJDA 3SSMA 2C7RA 1TW3A 2P1DA 4PYMA 3I64A 1AF7A 1BOOA 4ISCA 1FBNA 1UFKA 1EIZA 2AN3A 2UZ4A 3CJQA 3VSEA 1XXLA 5FWAA 1WZNA 2IBTA 4PYOA 2V74B 5HILA 5K09A 1XJ5A 3DMFA 3P9IA 2IBSA 3HCCA 3V97A 5CCXA 2ZIGA 3KQVA 4OX9Y 3ELDA 4P7KA 3CCFA 3LDUA 1RJFA 4Y30A 5FCDA 1RI1A 3CGGA 1ORHA 2AN4A 2HWKA 3UJBA 2FPOA 1JQ3A 2ZZKA 3BGVA 3GDHA 1YZ3A 3Q7EA 4CXMA 3DXXA 3UZUA 3P2KA 4AUKA 3DMGA 3C6KA 4V0QA 5BP7A 2HV9A 4RTQA 2PX4A 2WA1A 2IGTA 2FHPA 2IDJA 3DP7A 5EMMA 2BM8A 4C03A 1Z3CA 2BH2A 2JHCA 3FRHA 2XYQA 4DCGA 3OU7A 1WXXA 1L9KA 3KQQA 4M7RA 4YV2A 2OZVA 3IYLW 2ONZA 3IHTA 4O29A 3LDGA 4AZSA 5GIPE 2NP6A 3FPHA 4PONA 3P8ZA 4KWCA 3FTFA 3OE4A 3AY0A 4FGZA 3HCAA 2QY6A 1X1BA 3B5IA 1KR5A 3HA3A 2KW5A 2P8JA 1X1AA 4XCXA 1X1CA 4ER0A 1JR4A 1HNNA 3MB5A 4PGGA 3TFWA 5K0JA 3CJRA 5K8VA 1ZG3A 3I53A 5K0EA 1I9GA 2ZULA 5E1DA 3FTCA 2ESRA 4ATNA 3P9KA 4R8RA 5EVJA 4HSGA 3ID6C 5FA5A 2K4MA 2NXJA 2VDUE 2FRXA 3BXOA 4C05A 4QTUB 4ER7A 4XUEA 2OB2A 3LX6A 3MTEA 1UWVA 3CC8A 3NJRA 1VP3A 1VP9A 3P71T 5IKMA 5GM1A 5LQKA 7MHTA 4AZWA 5K03A 5DTMA 3P9CA
chains in the Genus database with same CATH superfamily
4HDMB 5KVQA 1J6UA 1CUZA 4QQKA 3W9YA 1NFQA 4WZAE 2ZUBA 3WQQA 3TG8A 1PQPA 4P3KA 4UREA 2XKKA 4DKXA 1HFJA 4BLOA 1W36C 1NASA 1SXJE 5ECWA 4B76A 4DWVA 2J41A 3IEMA 1BXGB 4GX5A 5CVUA 3O8LA 1H65A 2HO4A 3L7LA 1T6ZA 4GYWA 3GN1A 1DKQA 1NHGA 3D0QA 1GO2A 1MIOA 3FVVA 4EIWA 3EPLA 5H1YA 2IHKA 3DM5A 3I4CA 2JI6A 3QTTA 1Z2OX 1C4OA 2QTNA 3GGPA 2G6BA 5EC8A 1RP1A 2PXAA 2C2MA 4FQ7A 4KX3A 3PXXA 3QTLA 1DTSA 1FDTA 1KP9A 1OIVA 2Q29A 3C3EA 3BRWD 1PKEA 1ODKA 4GRIA 4CUJA 1P5JA 3NFYA 1GL3A 4CL0A 1KARA 2P9EA 2VJMB 3DXZA 4W5HA 4WERA 4YJ3F 5EZYF 3L7MA 1N4AA 4F46A 2W6JD 1P5HA 1E18A 3FJYA 2GBPA 3C4QA 1TU0A 4C0WA 3STVA 2O19A 4N5NA 3RSFA 4HZUA 4ZXFA 4CCAA 1NLZA 1SQSA 1EINA 1TO1E 2FDXA 5K3SA 2MYUA 4O2AB 2OFFA 1W35A 1MF7A 3RF7A 4B0PA 4R3UC 1L4NA 1R4ZA 5DBOA 1QGYA 5F98A 3KD2A 3RVNA 3DBIA 4G24A 1YC5A 4UDYX 3TAUA 4ZMRA 8ABPA 5IAAA 5ITZB 3L4KA 1CUWA 5U1PA 3BRCA 3MF4A 1AS3A 1I6KA 3IVMA 5J47A 1OXKB 1Z9BA 2HJSA 3KB8A 4X62B 1H2AS 1UKEA 1NDQA 3TL2A 1O9GA 4RY8A 1CJTC 4TVBA 4AKSA 4V1CI 5LXTB 4DR2B 3PUKA 4IQGA 2F3SA 3CLRC 4X8MA 3LSTA 4F3CA 5FPSA 3I34X 2BGGA 2A67A 1CVLA 1XD2B 2ORED 2FI1A 4F84A 5HHTA 3SGLA 4A9AA 3NTLA 3KTFA 4EGSA 2ZRIA 5P21A 3ESQA 3EZ9A 2V7TA 2VP9A 3M2TA 1ECCA 4FCWA 1AKEA 5AOVA 3ZEAA 1Q0ZA 4H17A 4RK4A 1CEQA 4JXKA 5ALGA 1R7RA 1HZJA 3OIWA 4N0MA 3ZQ4A 3DXFA 2ZUSA 3O6VA 1C3LA 5K0SA 3AG5A 3DC7A 4GVPA 4JEIA 1JX6A 3J81A 4W5NA 1WEKA 1VA4A 3QYFA 3IP9A 1OLSB 3ESZA 4IJ5A 5ULLA 2Y0PA 1E8DA 2OD9A 3B7PA 3FWZA 4D97A 3FRIA 4G5RA 3U4GA 4BVHA 3VU3A 2XXAA 1HSZA 2DHCA 2C5BA 2R6GA 1J0AA 1NY6A 2ZYGA 1N0UA 5DNVA 2MSLA 4LXIA 5DHUA 4MIKA 5EESA 3ZD9A 4WGGA 4H60A 2TMDA 3DT9A 5E1OA 4EF4A 2HUPA 3GLHB 4GI3A 1VYVA 4E7OA 3ZDEA 2PX8A 1G5HA 1USWA 3DFKA 3KPJA 5GJVC 3Q9LA 4L5IA 2HJWA 3H2YA 3SY8A 4HEA1 3F3SA 1K8QA 2F1HA 1TW2A 2GGSA 3KJQA 1E9EA 2R44A 5AVKA 4POOA 2XAAA 2O4UX 4I3GA 5I7AA 5B6JA 1KTVA 1JBQA 1GCIA 1Q3TA 2MYPA 2VAXA 4RZHA 4Y2PA 3F47A 3ZCSA 2GZMA 2QXUA 5T7BA 2XKJE 5HJ5A 1OREA 2BEVA 2C42A 2UYHA 2AG6A 2PKRA 3IFSA 2FRDC 2EP8A 2WQ6A 1AUOA 4Q01A 5DGCA 3ZE7A 3QU2A 1KMQA 5LYJA 1SU7A 1YZTA 3LUGA 3NTOA 4LRQA 4RK1A 2Z6UA 2X4LA 4YP6A 2W98A 4EELA 3A3YA 5KDDA 3VZDA 2ZTUA 1RHQA 4LY9A 2QE7D 2CXXA 4DF3A 1GQSA 3I1YA 3JQFC 3QTBA 3MWDB 1TYCA 4CEHA 4R05A 1Z6ZA 4WK6A 4DJDC 4DM4A 1CUYA 1FJ2A 4X6YA 3WLEA 5A9SA 2CT8A 3AC0A 5G0SA 3G89A 1BH6A 2D1SA 3VR4D 1L6RA 3LUKA 4YJHA 2XB9A 4F9GA 3OT1A 4XLZA 1NATA 1JIQA 2G4CA 3QF7A 3BD6A 4GS5A 4ZVSA 4CM8A 4GQAA 1WEHA 1Y42X 4MGEA 3SI7A 1JQJC 1U8AA 1FDOA 1XAHA 5FTNA 4GL4A 3P5BA 2HHHB 5H3HA 4QECA 2V7QA 2EZ8A 3BIWA 3UJPA 5FEMA 3BXFA 1JFVA 1VG1A 3IDSA 3H04A 4G36A 4RYLA 1YBFA 2C3UA 1EG7A 3K9CA 5FR1A 4U5QA 3QVTA 3DGFC 4B83A 4IGFA 5BVHA 3W8NA 1KI4A 5KDLA 3K1TA 2I6SA 5REQB 5IMSA 1KQFA 1O0BA 1Q0SA 2YNMA 4IZOA 1C7ZA 4W8HA 3B1XA 1B1AA 1CFZA 3TZLA 2RCYA 3EPHA 1D03A 4Q3DA 3F5MA 1N2CA 2IYEA 4NAHA 5K6RA 3P4YA 2HH9A 1QJCA 2FN8A 3UCFA 4D99A 2Y68A 3EVAA 3B6EA 1YZUA 2GEVA 1U6JA 2XE7A 4Y2TA 2X13A 5A3QA 4RACA 5CBPB 2PT6A 2YWHA 2QYTA 1XRNA 1SKUA 2REXB 2XRFA 1Z47A 3LXRA 5DYIA 3IMFA 4DCTA 5CFNA 1CRQA 1SRQA 1JDZA 1E9RA 2QENA 2JL1A 2WKRA 2XWJI 4DCVA 4EYEA 1H8HA 3GOQA 4YACA 4ZYVA 2ZJ0A 3MLBA 3L46A 1TEHA 3NYIA 1W2WB 2HIMA 1ZRNA 3QUCA 3I83A 2OGWA 2I6QA 3GRZA 2F1RA 3UMMA 3UF0A 1JVBA 3PF9A 1LWNA 3R5JA 1CRLA 4LZAA 3ZUGA 1T9DA 2Q6TA 2VHEA 2FK7A 2WJJA 3HNPA 3IPRA 4FFPA 4RKFA 2G06A 2OV1A 4N47A 1V71A 3DFFA 1NXXA 3PQEA 1D4AA 3M2PA 3MWEB 3UOWA 1WF3A 1U8EA 3V8PA 4LHEA 3EXAA 1VMEA 1YSCA 1WX1A 3M5PA 1WMFA 1ZM9A 4FP9A 3W2FA 2QG9A 4WSOA 2Q6LA 3YASA 2JGNA 5TV2A 1G7TA 1WHSA 2QD5A 3QBDA 5A5GA 2XNHA 3GP5A 4L50A 2FPLA 4OVKA 1B93A 4WW0A 3S2GA 3UVEA 1NOJA 3QXHA 1MEOA 1PWHA 1XJCA 1WWKA 1XCLA 4OQLA 1A9ZA 5HIMA 1YI8A 1BXGA 3T9BA 2JAWA 4BP3A 4EY3A 1OX6A 1MQAA 1A50B 2J7PA 1HSOA 1I36A 2ISQA 3OZFA 1ORWA 4PFJA 2B36A 2BMFA 2YJ4A 3H9BA 5AKJA 4R2WA 3ADBA 1WS6A 2XYHA 3G7NA 4ZCSA 1XKXA 1SG6A 1GAQA 2IHJA 3DR5A 4X7RA 3BB4A 1Z5WA 1QZTA 1DFGA 2B1RA 3DO5A 1OXVA 4MA0A 1SK8A 3UGJA 4FWTA 1LJ8A 4NCBA 1MPTA 1U3GA 2FMUA 1YDFA 2VJMA 4QPJC 4F4HA 4ITUA 1GDHA 1N3LA 1GFIA 1ZJ6A 2Y0DA 4L4RA 2I0FA 4DIOA 5B3KA 4YUYA 3BTUA 4EI9A 3H2GA 4FYIA 4TWZA 5E1BA 4KR2A 1RKUA 1HGXA 3JVVA 1FMTA 1T6NA 2NACA 4OUDB 2Q4OA 3I3OA 4ZEOA 3VNBA 5BW6B 5LLSA 3TSYA 2WHQA 4ZPXA 2E4XA 4L8LA 2WIFA 3H2IA 5ITZA 3BHJA 5AK3A 3WLNA 1AN9A 1E3SA 2P0YA 2P2ZA 4C5CA 5LMZA 4M8SA 4TYNA 4C3VA 2QRUA 1Y1KE 3ZKAA 1BG6A 3N5KA 5JJLA 1L4GA 1RT9A 3P0JA 5DM4A 5AW2A 5HR5A 1JLLA 4LXTA 2H00A 2NZXA 4YGYA 2H07A 4EG5A 4LK3A 5LXTA 3IAS1 1DB3A 3B1KA 2FVXA 2MINA 5EJEA 5I51A 4F45A 2VOEA 4YRFA 1E3TA 2PH7A 4F8JA 4Q4JB 5JMTA 3RGGA 4LOHA 1PG2A 1XD2A 3H3FA 5A9TA 5F35A 4BNHA 4P0PB 3ZBPA 3AFNA 1BGVA 2BJWA 4KO3S 3HSKA 4RQBA 4V0LA 2V7BA 5DN6A 2YZ7A 3VI3B 4A0QA 1L7EA 4D8TA 3JCZA 5HW0A 4LKOA 4RETA 4ZAYA 3UO8B 3WADA 3WXMA 1VG0B 2YQZA 4B3IA 4GE0A 2ES4A 2JFFA 1G4UR 3FA2A 5CP8A 4KGVA 5ALUA 2H65A 1PL8A 4M1MA 1BMTA 2B4RO 3VVBA 1J0CA 4II7A 2GVNA 3GBSA 3KE8A 4P22A 5I9TA 1OLSA 2A94A 3LLMA 1TAHA 2BGLA 1JJ7A 2PMBA 3QZUA 3U6KA 1Z12A 3ZWCA 2J87A 2JCSA 2PSJA 5ES4B 5JSZB 4KO1S 1WY7A 2V9ZA 4QGHA 3QY0A 2EBUA 4XH9B 4JH0A 5LZ8A 4CDMA 4BCBA 2PZEA 1SUPA 3IELA 5LBTA 3RROA 3DT8A 1PZHA 4WDRA 2V0NA 5E38A 2BELA 2EBHX 2PA3A 3P45A 2OQ2A 3IPXA 1C1XB 1GAWA 2Z0MA 3GLHA 1FSSA 2BFEB 1LU9A 1RM5A 2E1RA 2QRPA 1XRQA 3GLQA 4FDUA 4HG2A 3QFSA 3FUUA 4UULA 1EKXA 4AZTA 5IVDA 4YK7A 2HHJA 1LSOA 5D3MA 1ZLYA 2AUMA 4Q3AA 3D4LA 2WSLA 2ZPAA 4NY1A 4Z86A 1P74A 2YXNA 3JD3A 5I4BA 4QDJA 1EK0A 3I01A 1Z6AA 5AUOB 2QRKA 5HX7A 2GI4A 3OLCX 3AVUA 3PRKE 4CQJA 3H42B 1QO0D 3CS3A 4H7IA 3UMBA 3A3KA 3L04A 2X6TA 1AS0A 1JHRA 3CUYA 4YCCA 5LQRA 2H9YA 1OIXA 3AWIA 2ID4A 1DRWA 4L16A 2VCEA 2XWSA 1EVYA 2J0EA 4QDZA 3QYJA 2B98A 4KEAA 3FLMA 3KKNA 1E1RD 3E1GA 3OE7A 3PRJA 3U62A 4EUSA 1Y4SA 3T7TA 5CTAA 1YIAA 4E33A 1HDEA 1I30A 1RBMA 2ARKA 2A9KA 2W6ID 4WXHA 5EGNA 3IEPA 1OV4A 3MWDA 4CDRA 2RBEA 5JJIA 1HDZA 1QHSA 5AHKA 3D2AA 5DGDA 4KB5A 1GQFA 2QQFA 1B00A 3WLQA 4I7EA 1F2TB 4JP1A 1XRSB 3A4YA 2TMKA 1XNGA 2DXIA 2HDOA 1DEKA 1PT8A 5FNZA 1Y5IA 5ADUS 4B0OA 4ALKA 4L0QA 1EUCB 2OPHA 1UK8A 3JWGA 4AN0A 1AMUA 1M5RA 5M3BA 1KOFA 5FH9A 2RK3A 1EFDN 1IPFA 5LWHA 1B73A 2VCYA 3JD1A 2W0SA 4LA4A 1ETHA 3VKVA 4NH0A 3A25A 3II6X 3ZV4A 1TECE 3EUFA 1XXHB 3IOYA 1Y4AE 5K6TA 1YI0A 1F4PA 5DXAA 3U56A 3M9WA 4LJ5A 5REQA 3OOJA 1HNXB 1JPVA 3V3KA 5J3JA 2G17A 4ZT7A 2NVWA 2P2LA 5FIUA 1SB9A 3D02A 4OSOA 1YJXA 2WI8A 1BDMA 1B41A 4ZCMA 1OJLA 2M6SA 2ZRAA 3DTTA 2F9MA 1E6WA 2LIVA 4U3JA 3WYAA 2BN4A 2DLNA 2IYAA 2V59A 4LYJA 2FR8C 3VU8A 2X5OA 4LDQA 1VKHA 3ZJVA 2HPHA 2P0EA 2V0CA 1AS2A 4L6CA 1K08A 1CUUA 3BAZA 3A9VA 2QUZA 1RMTA 1HG0A 2GD0A 3NIDB 5F1YA 3TKYA 1TGVA 3GDOA 4XYLA 2CCKA 4G0PA 2ZJ5A 4UXIA 5JQGA 2R65A 3EY9A 4MVJE 3CPHA 1KMMA 1EGMB 4KE8A 2WK1A 3DB1A 2PV0A 3RYIB 5JAOA 3OHSX 2VWHA 3FVWA 4U2EA 1GGNA 2DUWA 3DV0B 4UUOA 2MYTA 2JDID 1A9RA 2GWHA 1UAAA 3GLTA 3NLLA 1RKQA 4H7JA 2BZSA 1Z5GA 2MMCA 4BLRA 4OK3A 2B0CA 2H4ZA 4KV9A 2ZR0A 4LRWA 1AF7A 1XEXB 2LWIA 3E9QA 3LLUA 1HNZB 5FL3A 3OFVA 4Q02A 3GRPA 2IBTA 2J3HA 3MWEA 1N34B 2X3YA 4OX9Y 1QOZA 3K73O 3QX7A 1XTUA 1BHO1 3V7FA 1P73A 3CCFA 4FKZA 3V5NA 3HXTA 3BGVA 3W05A 1FFSA 5CXXA 2JKYA 4Z0HO 3DE0X 5LIPA 1RLTA 1E69A 3L9WA 2PHZA 3DP7A 3FLEA 4R5MA 3T9EA 4EB3A 3OVMA 5KYNA 3O3CA 4WASA 4FFOA 5CK4A 4YJDA 5AM4A 5JOQA 2QLTA 1OAKA 3QQ5A 4B82A 5ALTA 4B6GA 1EJ2A 1L9KA 1ONSA 3BH6A 1VJRA 3KSRA 1AUXA 3SQWA 4HCJA 1D2RA 4AI6A 3MD9A 1Z7EA 5JJ5A 1JU3A 4FILA 2BSQA 2FSPA 4WECA 2CJYA 4X6LA 4FKBA 3H7IA 1KF0A 3I1FA 3QQPA 4FGZA 5JAQA 1D0VA 5K6AA 3PXCX 5FLXA 3QWFA 1D9ZA 2K7FA 2YN2A 1NKTA 4XLLA 5TMDA 3BN3A 3ABIA 3I12A 3BTSA 2QUHA 1HTBA 2GZ2A 1YH3A 1JXQA 1NG1A 3MB5A 4OAPA 4XYGA 5E6RB 1ZG3A 1FS5A 2ZULA 2XCQA 1YGPA 3ETLA 3IQWA 5A1TA 4JKYA 3KOYA 4C0AC 3X1KA 4OUDA 1UR5A 1A4XA 2FKNA 1P0FA 3ET4A 1AH2A 1NSYA 4UCXA 2XB4A 2QIOA 2PQ0A 5CGQB 2DTXA 3JTMA 3VH3A 5AVTA 1T9KA 2BPOA 2F2TA 2ZE7A 4J0EA 5GM1A 1Z7YA 5IJWA 2Q4DA 4GKAA 4A27A 4OIMA 2NVOA 4C7JA 1WPGA 1OYVA 2HLDA 3RG2A 2IUFA 5EQDA 4BQFA 5KC9A 2X8AA 1RFLA 2YJ3A 1ABBA 3KJIA 1CK4A 5DM2A 4NFSA 5EJ7A 1EE9A 2OSVA 2HA7A 3CLRD 4OGWA 4EMTA 5EMKA 4Q4JA 4L27A 1S2NA 2WUDA 3KTAB 3WY9A 3MJ4A 4BGIA 3R8FA 1RRCA 2YX1A 5JD5A 3EXG1 3GPDG 4ZGGA 1JTVA 1F12A 2BGUA 3U4IA 4J1SA 2R85A 2EKZA 1TRHA 3B7WA 1U3WA 1XVLA 2QTMA 1H66A 1GZHB 1NDUA 1VE5A 1FP1D 1OXTA 2RHRA 3BAFA 3PZBA 3L2OB 4JGGA 4TKLA 5AKKA 2XPCA 1ZK1A 3U3MA 1KQGA 4CKCA 3LJKA 2DC1A 3B5EA 1P5FA 1V0JA 1YIOA 5TEVA 4BPBA 1YJBA 3UJNA 2J4CA 4YMTA 4BZQA 3KFVA 4P3PA 4R68A 1IUNA 5KNBA 1L5MA 2VHWA 4K6OA 4W8GA 1CFJA 5JSZA 1D4ZA 4M21A 2C2OA 2JJ8A 4TSKA 4RVOA 5I7RA 1MJGM 3EFBA 4MINA 4MV8A 1UDAA 3SIXA 4BNDB 1LQ2A 1MW8X 2YYAA 3L7IA 3ZHCA 3PICA 2OG1A 1UC4B 1IH8A 2BT4A 4RJIA 1NXWA 3OT4A 2BFEA 1WQ4A 4G2NA 1KI7A 1A8QA 4JOSA 1MC1A 1TMGE 3BIXA 2R8BA 3DKRA 3MAJA 3OQOA 1SMKA 2R86A 1XRLA 2OBLA 4OMUA 5FHQA 1J23A 4JODA 2PN1A 1IK4A 1CJUC 3V7UA 2X3UA 4TLAA 4DTIA 3QIVA 3GT4A 3GWGA 2Y4OA 2YXEA 4DQLA 4QFMA 4Y1RB 2P9TA 2Q5IA 1LBHA 2R96A 3BSSA 2CUNA 3RSZA 1RZ3A 5F1OA 3O9MA 2A6PA 1IY1A 3OX3A 4PNPA 1LFAA 2IHBA 4NONA 4PW0A 2YBEA 1H5QA 2REBA 5LQCA 2ZIAA 2BFCB 4GKKB 5EIEA 3NTVA 1NRIA 4A6PA 1FFHA 3DWFA 3IIJA 5ESWA 4KQ2A 4X8LA 4N0QA 1QB8A 2QZ4A 4DCNA 3WK9A 4E2WA 4K0KB 4EARA 2HR1A 2FPPA 3WHPA 1XQ1A 4KQCA 3WGNA 2ZKLA 5LSAA 2G1PA 1U7WA 4CF4A 1F2TA 2R6AA 5D7BA 2PZAA 4NBLA 1KDVA 4GP9A 1T35A 3MIIA 3RR2A 4TZKA 1S2DA 4CLOB 3L7KA 4ZMSA 2BTQB 2VDQB 4JQZA 3B1YA 1RJEA 5J9FA 1G5FA 3X0DA 5BUCA 2O1SA 4EOGA 3AHEA 4AFNA 4ZYTA 4R8SA 1J8FA 2XH8A 4ME6A 1QPGA 2B9VA 3F6YA 3H5OA 3IDOA 1SBIA 3P2EA 2JGMA 1SVWA 4BNMA 2FK8A 1OBFO 1XCGB 3KQHA 1IRIA 1P4HA 1XXHA 1MUUA 4FYYA 5DPMA 3O4GA 1CEYA 3OHPA 4LRYA 1BJRE 3EC1A 2B0JA 1CJSA 2A9FA 2W4QA 5CCEA 3NGMA 5KVVA 2DUUA 1KO8A 4XYMA 3R23A 1EFKA 3KT8A 3L18A 1NLUA 2X2FA 2H06A 2C7OA 1RDFA 4M0EA 1T0UA 2RGEA 3DZIA 1PFQA 2WF7A 1QBGA 3QPVA 2HF7A 1MX3A 4PLPA 4XPIB 4EYSA 2NV0A 5D3KA 1GKYA 2COEA 1QX4A 3B2EA 3ILVA 3SN6A 2QGZA 1Z45A 3ENQA 4EJSC 4OA5A 1YQXA 3NTUA 4NDAA 3A4LA 1N6PA 1YZGA 3ZBUA 4IV5A 1KIMA 3EMBA 3N2KB 4RV9A 3OIVA 1KAMA 2GA8A 4OQXA 4RYDA 5FOUA 3RYIA 5IABA 1LPSA 3SE0A 2BAGA 2XVMA 4UATA 5IH3A 3DV0A 1QHXA 3V7WA 2F3QA 3GU3A 1AQJA 1P72A 2QN3A 4DYVA 1XZQA 2B4YA 2O3TA 1CVIA 3BGWA 4GBMA 2Y99A 4CIWA 2D4HA 2BBOA 3KYBA 4AZ0B 1XEXA 3ZDQA 3DDHA 3Q3EA 5A2GA 1ATZA 2HQOA 2YW9A 2JVIA 3Q15C 4MYTA 3SS9X 3WBBA 5LCXA 5HPYB 1M54A 3C5VA 3OCWA 3D6HA 4HAYA 3WRWA 2J1LA 1ZM2A 3HGTA 1KFCB 3I58A 3OPNA 4ZZ0A 4IJVA 4WKGA 4KWTA 3BWYA 3L93A 2YWJA 4RGBA 3WJ1A 1QGDA 2HMSA 2R7KA 5F2OA 3UWSA 4DHEA 3NI2A 4DNFA 2DB3A 1MCZA 1KYXA 4TSFA 3WIEA 2WJYA 1PVDA 3BMQB 1ILWA 4CYMA 4F93B 3ETJA 3UG6A 1SC1A 2QLBA 2WYUA 5EJGA 4KVAA 1QIDA 1H2YA 4N01A 4RLFA 1OC4A 1E6KA 2HWWA 2Q3FA 2DR3A 1QG2A 1R5OA 2ATVA 2SKCA 4KVZA 3B1FA 2BIFA 2FMTA 3VBCA 3H2ZA 4NU5A 3WLPA 1DUIA 3IE2A 4MGZR 3H1FA 2NU9B 4AS2A 4KFRA 3ELYA 4ZDJA 1KPGA 4MV6A 3MBKA 3JAMA 4CFZA 3THWB 2C7QA 1J9ZA 1JNYA 3E48A 1GRNA 3IILA 3L8CA 3DVQX 3S44A 4JT4A 1TD9A 4KPUB 3E8SA 5ESRA 4HDCA 2GEBA 2JH3A 3L8FA 4CF6A 2D13A 1HZZA 1XVTA 1JHYA 3LA8A 4IJ6A 6ABPA 1AHHA 2BSXA 2FHSA 3EYWA 3TKLA 1AD2A 5A5EA 1F1JA 1JQAA 3AB8A 3TVYA 2HCRA 1WB4A 2Q1TA 2ZRHA 3D1JA 3C8MA 4JGBA 1YFJA 3FFBA 4QD3A 4B2IA 4DMMA 2PNFA 2ZI6A 3D2CA 1H2HA 4ZJZA 5CPBA 4BMDA 1OFUX 2HJGA 2YIMA 3UAGA 4ZV4A 2NQTA 5DX0A 3FZGA 1YOVA 3BIOA 3IA7A 1E2PA 2FWBA 2HU2A 2F9LA 3HO1A 1RQRA 1VZ3A 3GC6A 3ETGA 4UNRA 4BFZA 2HF2A 3FF1A 4JBWA 3PT5A 2YH2A 3K5PA 1Q11A 4F92B 4M8KA 1K7XB 1QP0A 2V0GA 1UJ2A 2B82A 2WUGA 3OY7A 4JFAA 4UZFA 3KTAA 3NHRA 3CZMA 4YT2A 2VP4A 4XX1A 2V7XA 2KYRA 1TQ8A 3OF2A 3TFQA 4C0QC 2QUKA 3SBOA 3FOAA 4RELA 4LHYA 2ETXA 1RYYA 3B9QA 5ADHA 1RWWA 2R97A 5AXAA 2QJRA 4GR9A 1TMYA 1FMJA 2IELA 2GBFA 2P4HX 5AK5A 4ZVRA 3ZU6A 1P4RA 2FW7A 3W1EA 5KJ1A 1MGOA 2G9QA 1K92A 1VTKA 1DU4A 3AXTA 2AMYA 4OJQA 5K0ZA 2D7DA 3LNTA 3FSRA 5EXSA 5AW6A 1LV8A 3AT1A 4QFBA 4XWKA 2CVFA 1OFIA 4ICIA 2J4DA 4JIMA 4OJMX 2I8CA 1D1PA 3OQPA 1E2EA 1U04A 1UXIA 2JBHA 4Q9KA 5AVVA 4KMSA 4NKRA 4BNDA 4FGWA 4CMIB 5IVKA 4CWAA 2JGRA 2J45A 2GVDC 3IMEA 3UH1A 1LWOA 4HMPA 4AQ7A 4PHHA 5ALNA 4Y0NA 6GPBA 4FD3A 5EUBA 4HP8A 3G9ZA 1UADA 3LT1A 2OWEA 2FEWB 5KHLB 1J33A 3EY4A 4B7XA 1E20A 2AK2A 2HA5A 2XB6A 3BWDD 4I5GA 4IDAA 3P4XA 5DRYA 1U28C 5DTJA 4EFKA 4TUYF 3WWDA 1R8SA 2V54A 1V5FA 2VNAA 3DD5A 5DGIA 2X5JO 3DOOA 3E0QA 2IXFA 4KAJA 4B6PA 1YA6A 2VG8A 4Y1RA 3K9HA 3PU6A 1WMAA 1EAYA 3C4JA 1NUSA 1E0DA 4JX9A 1MFPA 2JW5A 4JJGA 4ND7A 5F1PA 1TTTA 4GG1A 3KL4A 1JHDA 4HBZA 3RYHB 3SZUA 4D5EA 2HA4A 3KE9A 1VKJA 3GOHA 3FMGA 1UC8A 3LY8A 2ZG6A 3Q7PA 1A98A 3AF5A 1T3HA 1MMFB 1U7UA 1HE1C 2HO5A 4N6OA 2Q6IA 3JQ9C 1M66A 2FFQA 4DLZA 3C1AA 1A4UA 3GWZA 4M54A 4Q7MB 4KXUA 1W2HA 4G8BA 4CLOA 3JVEA 3V7YA 4MKFA 3N0WA 1C9NA 3JR7A 3TX6A 2BTQA 2QSJA 1E59A 5KWSA 2P2YA 1UK9A 3RRBA 3EZ2A 2J07A 3OQIB 4LBWA 2PXXA 3ZLVA 2AOUB 1X14A 1S9HA 2G5GX 3PITA 3RI3A 4DSZA 1V4NA 2AH5A 3V8VA 4PQFA 3NVKI 1VYUA 4FFDA 5B1DA 4BDTA 2MSDB 4C2AA 5FPYA 1Q50A 3M83A 4JLPA 4OQNA 5TPZA 3WL8A 4B7AA 1C2YA 1CUBA 4DZRA 5M2QA 3FLBA 2I4NA 1SUSA 2OECA 2R9VA 3QITA 3CINA 5HQTA 3W04A 3JRNA 2II6A 4DUGD 2QN7A 5ARBA 1VLMA 1RWKA 1QYVA 2ECPA 4HI0E 5CLQA 2B2NA 4EX7A 4DLBA 5K45A 5MHTA 4OBWA 3HVIA 3PDIA 1ZW6A 3L8HA 4RVGA 3QX3A 1YHZA 4P93A 2GN9A 3E9RA 3GDFA 1KPIA 3EC2A 5COAA 1G8GA 3AR8A 3TEFA 3TJMA 3AJ8A 5AD1A 5E9JA 3PPYA 1QIKA 3Q41A 3ZEIA 5HEKA 4PYIA 1GRQA 4XPIA 4NXMB 4AJLA 4J1NA 1G6OA 4I5EA 1ULUA 3KBOA 5T8KC 3VKGA 1NE7A 2C0CA 1RAAA 5ALLA 1M2EA 1P29A 1FP2A 1BQEA 4L4XA 3Q0IA 1Q0TA 1ZESA 4K2AA 3WFIA 1SKYB 2OV8A 4WXYB 4DMCA 3N2KA 3KOZA 2XZOA 1JHAA 3MQ2A 5LZ7A 3FW1A 1NSTA 2QA5A 1FFGA 4OQPA 4LZLA 1PS9A 5E4TA 1EWKA 3WRYC 4AICA 2PPLA 3DKVA 1DQYA 1KZHA 1TUEA 2IIVA 4GLLA 3R0JA 3PQ3A 4QUAA 5EHIA 2AV6A 4P8RA 3VDQA 4BE9A 5A62A 1LS1A 3BRWA 4D3DA 4AZ0A 3T5AA 1QK4A 1AY0A 1A5ZA 3C24A 3G5TA 1NVMB 1AQLA 1DPGA 4FGUA 2JZCA 4IOLA 4DEVA 3HB5X 4EFMA 1O6FA 4D8VA 5A0VA 3TSOA 1X8JA 3DO8A 2W6JA 1IY9A 1XQYA 2NWQA 3GI1A 2ZREA 2CV0A 4PVDA 1MC8A 1Y89A 2ZJBA 4RF5A 5ALXA 4PRLA 2XD9A 3ZK9A 3NH6A 3PQ8A 4TM8A 1PJZA 5KKCA 1F8XA 2A35A 2Q5LA 3QUTA 4CUZA 1ISMA 2G9VA 3WKCA 4UAVA 3IQIX 2ZYVX 3B8EA 2QTCA 1E7QA 3GFQA 4B3JA 3N6VA 4O2BB 4DQKA 1T1JA 1VB3A 4IH9A 3AM3A 2PFSA 2PKQO 1KEEB 1TQ6A 2QRVB 2BGRA 2DU8A 2OVBA 2NU9A 2W6CX 4OFBA 3THWA 3EIHA 1KO5A 3O90A 3MK31 5DCWA 3TIVA 5C4IA 1KKMA 1E9AA 4FYJA 3EFHA 3Q7SA 4V3CA 2C8LA 3JRWA 4L57A 2Z2ZA 2H0RA 1EK6A 1X2BA 2QRQA 3DCIA 5AVSA 1ZLXA 5K20A 2IYOA 4KPUA 2GAOA 3K0CC 2PYDA 3WLOA 5EJ8A 3COPA 2CF6A 4AYTA 4Z54A 3SVTA 6PFKA 4GYJA 3M4XA 2HGSA 2JA2A 2GN0A 2E6UX 1O95D 4N12A 1OD6A 4XWGA 1IWPB 1VXOA 2PUAA 1YBAA 4ISCA 4B84A 4C6SA 2D2FA 4YQFA 1NRXA 2IU6A 3OMXA 4HXEB 1UWKA 1XMSA 1KH1A 4ZEVA 2O2SA 1OV6A 2GXQA 1WXHA 1CUCA 2I2BA 2ZIGA 1Y8AA 3JZAA 3LP6A 3OTGA 1RI1A 2R79A 3U26A 1RQNA 1AHNA 4G4IA 3R6LA 4BMXA 4CXMA 3DXXA 1U8FO 4X44A 1JI0A 4TMXA 3BWVA 5HZGA 1OWOA 3T4PA 3PDWA 5ILGA 2XIQA 1X3SA 1C8LA 1KU0A 2I8AA 3VMMA 3ND8A 1ST3A 1X9GA 2GX6A 4U02A 3T0GA 3D8UA 1QFZA 2Y0CA 3LVQE 1YL7A 3RS7A 3RKRA 1TIPA 4J7CA 4AZSA 5AKXA 4AM8A 1DIAA 1VYTA 1XTSA 3O26A 2Q45A 3QFTA 3V8RA 4GMGA 4PQGA 3AVVA 1ZQ1A 2VK2A 3R3JA 4AAYA 4R0MA 2XLCA 3CO5A 1ZC4A 3WLRA 3CW8X 3LUFA 4LHXA 4BX3A 5LJIA 3HA3A 2KW5A 2BCGY 1X1CA 2VHVA 4DTCA 2HF8A 4XFJA 3WICA 5IZCC 3KVVA 4P5PA 4XM1A 1RFGE 3AHFA 3FTCA 2XB8A 1EWQA 4OHWA 3N59A 1U1EA 4X45A 2LIPA 2B6HA 2QE7A 2QVXX 2ZQYA 5SY6A 2LCQA 4F1KA 4CMIA 3H5WA 3BXOA 3IAAA 3WQBA 2OQVA 4MMZB 4MRSA 1W0JD 4B4OA 1Y5LA 3VR4A 1I51A 4PBSA 1Z4IA 2IZOA 5U4QA 3U2QA 2YL2A 3NIGB 4O08A 3SM9A 1K7YA 3OZVA 4JWTA 2FR1A 3DFZA 5DTMA 3KKZA 1I1NA 5EKTA 2B1GA 4N5LA 5AKEA 1THZA 4YR9A 3CGWA 3QLVA 4BEBA 1U2SA 3WWZA 2I2WA 5TLSA 2YDXA 1FRQA 5BSKA 5KPJA 3OSZA 3UGTA 4ZO7A 2BMDA 3MCZA 5B4UA 1OFGA 1V2HE 3PG5A 4MR9B 3MERA 4OBXA 5A3JA 3I2IA 3HO6A 1H1TA 1UKZA 4RV5A 3FYDA 1JB1A 2QG4A 1X1SA 1YS4A 2GS9A 4FFNA 1NV8A 3EYAA 4P82A 4YJ2B 3RYHA 2PK3A 1YK0A 3NWJA 2XD4A 3EH1A 5JXWA 1EI9A 1JXOA 3LOPA 4QYIB 4AU1A 1WV1A 5AOAA 2Q99A 2RGWA 2NSHA 1KJWA 4TV8F 1TAQA 2Q4TA 5FUVA 3R7DA 5BVHB 2GBLC 3LQYA 3UJAA 1BMFD 1SCAA 4BU1A 2NO6A 2ACWA 5LJLA 5J2TB 2PWZA 1N5RA 3DDUA 3RQIA 1WB6A 2PS9A 2WHRA 3L06A 3OPYI 1GN8A 3KX2A 1GPYA 1KZYC 2JIZD 3OQIA 1A96A 4GBED 4KPYA 2AOUA 1T9GR 4AX8A 1YA8A 1XZIA 3GJ3A 4XSVA 2JGLA 1L7BA 2QY9A 1L5WA 3LHFA 4EVQA 2GQ0A 1EVEA 4YRRA 2IPMA 3AEXA 1LBIA 3EVEA 1RXSA 5IYZF 3ZW9A 3DVAB 4E88A 3JASB 4O0LA 2PL9A 3ZGZA 1AB5A 2XQKA 1SC6A 3HDVA 3HBFA 1DAIA 2WWFA 3QLUA 3WLMA 3WRXA 5EQJB 1WCIA 4TRJA 1A9PA 4NU8X 2YHIB 2P78A 2QAIA 3QEOA 4D3SA 2QT0A 4EYKA 3C85A 1O6BA 1NF3A 2RG1A 4NCNA 2VJAA 2BDEA 3MB8A 1JS1X 2W6PA 3Q1LA 4HFMA 4L4ZA 1R0ZA 1L7PA 3D4NA 1ZGJA 5G4LA 1W36B 1HORA 1GUDA 3T1QA 2ISCA 3L3BA 3SQLA 2HSEA 3TTXA 4QQ8A 5TIIA 4G1MB 4JYZA 2ZP1A 5I3ZA 1E1QD 2B7CA 3NBYC 4RE5A 4M0CA 3ZVMA 3HBMA 3K30A 5JBIA 3DOIA 2HL6A 5GADl 3Q5DA 2OY0A 3M8KA 1SHZA 2Q3DA 5HKKD 3NRJA 2FMHA 3N9IA 4FFVA 4HQ0A 3SF8B 3LY9A 4DXAA 5B36A 2GRUA 4I4LA 5KVSA 2VYND 3PGKA 4HUJA 4JEUA 1J0XO 1JKJB 1Q92A 2EFYA 2GHIA 4IIGA 4WFKA 4DR5B 4H0FA 2Y9MB 3RVLA 2WR8A 1O5IA 1NLMA 2FG6C 2H9AA 4DOMA 1BWRA 5FBHA 2GFIA 1VSTA 3VYRB 1Y6GA 5F4ZA 2NN3C 4IKOA 3ZBQA 1KAQA 3GLGB 1QHGA 4RSMA 4CM9D 2ZDQA 4WCDA 3NKVA 2XHEA 4GM4A 3AO0B 4RSGA 1MT3A 5JH7F 4Z53A 4MVXA 1ITZA 4DV2B 4X0EA 5DXJA 1KDYA 4CKYA 1ORVA 1MTZA 3H18A 3SZ3A 5I3CA 3OT5A 4I50B 2F1JA 3TI7A 3C1UA 4O2BA 1X77A 1C8BA 1JHOA 2R6HA 4A7PA 5TB5A 2Q9AA 1NV9A 1K2VN 2DF8A 2D5BA 2GZHA 2HZBA 2SICE 1LNSA 2HT6A 1EUQA 1E9DA 4UC0A 1CYEA 5E6SB 2AFIE 1TYEB 4HVLA 1VJ0A 2BW0A 5KSZA 3KU4A 3M49A 4IFTA 3B8HA 1UMDB 1DEAA 4V0RA 3U48A 4DJTA 5B64A 2CE2X 4D9CA 4EJFA 4B6FA 2CLDX 4MVJH 5FWDA 2JS7A 2ZRKA 4GT1A 4E03A 3DE2X 4TT3D 2I1VB 3QKRB 4LZJA 5JR3A 3GV0A 4LOKA 4IV8A 2Y77A 3DVLA 2CXTA 3H9CA 1T2DA 2BR4A 1K5HA 1QANA 2EP5A 2GNPA 3FPGA 1IMJA 3MJFA 2WV7A 4P58A 4YRMA 1MXFA 2R0QC 2AX3A 1G8YA 1GCOA 4Y7DA 1USVA 5H16A 1WBDA 4O8CA 3F7OA 3FPJA 3QM1A 1D2EA 5L3RA 4Z4GA 5AK0A 5H70A 4RHYA 5B3LA 5D86A 4KBYA 3SP1A 4FZ3A 5FOTA 4JI0B 2AG1A 2OMKA 1SJ9A 2AYYA 3DOUA 4KU4A 4PNHA 4EAQA 1UP7A 2Z1MA 3CUWA 3OWHA 4C1BA 3L8MA 2ZYDA 5AW0A 3MQ4A 2ILTA 1QNFA 2OESA 1UKAA 1KTIA 1OXSC 5ELLA 5HA5A 5JMOA 3HU2A 1A9QA 3RF6A 1FF9A 3A9TA 4FMDB 3PDCA 4OYYA 4BQIA 1M34E 1WXQA 3EGOA 4ZZ1A 2CXNA 3A9SA 3NM6B 1RJWA 1KK1A 4ZARA 4LVUA 4NCAA 1N6HA 3KKQA 1FX0B 4HZGA 5AVYA 2IZ1A 5JE8A 2ZJ4A 2BOVA 1LPPA 1QO0A 3VI4B 1AG9A 1GAEO 3Q72A 4KVGA 1JYSA 3ONFA 1G291 1TK3A 1DBVO 3QOXA 4JU9A 3STHA 4EYOA 2IEZA 4PV7A 4RU1A 4Z4CA 4KQJA 2ZTHA 4LBZA 1EHIA 1E1RA 1K86A 4O63O 1N4DA 5BO5A 4MUIA 1HOTA 1QDEA 2W6IA 4FKMA 2CL0X 2W2LD 3AL2A 4L9WA 8GPBA 3RK0A 4YMHA 1T0PA 3F4KA 5CA0B 1UPAA 1QZUA 4JDUA 2WUFA 4IVNA 3F6PA 3K3PA 2BVNA 5JU6A 2X14A 3BHNA 5KTYA 1Z4OA 3I76A 3QH4A 3U3JA 1INLA 5HUQA 3D8BA 3GVIA 1PJRA 2I2XB 2IC5A 2V6IA 2VRWA 2D00A 1M2KA 2FMXA 4RHUA 2IDZA 2OA0A 4CKXA 5HZHA 5IM4A 3FOFC 1G9XA 4INJA 3ZKWB 4E46A 1K8XB 2IV7A 3CW9A 1VBFA 4LX8A 5MN6A 1N5OX 1V3UA 4MV0A 2VQEB 1I8TA 1U0FA 2V9CA 3AY6A 4LDJA 4MR9A 3VGJA 3LHIA 3A7DA 1QXSA 4G0VA 1RYMA 4A6XA 1DOAA 4DPMA 3TUJC 2XX3A 1YK1A 4MV4A 5AVOA 3WGQA 4YJ2A 1Y4DE 4Y2JA 1Z15A 3V6LA 4UTVA 3SHOA 4QYIA 2OKCA 3JWJA 1OTXA 1FYEA 4I5FA 2GK3A 2OLKA 1JMVA 3D6NB 1L4UA 4JBIA 3TQCA 4FGJA 4ND6A 3R0IA 3WLJA 3NUQA 4E1BA 1NF9A 1PE0A 3A1CA 3PTZA 1GUYA 4EJ0A 3VYWA 3G5LA 5CNJA 4O0MA 1SK9A 4UU0A 3VSCA 4DC0A 4URFA 6ADHA 3D1LA 1IOVA 1E77A 1O54A 4LC1A 1XRRA 4BAUA 1O57A 4XIYA 3EW7A 1JN0A 3OU2A 4S24A 2VQFB 1ZD4A 2CFCA 2JDIA 2PYZA 4M9ZA 3ANMA 1U2QA 2XWQA 4XWAA 3OLWA 3RUIA 1V45E 3ZU4A 3KVOA 2XOXA 3KJZA 3QGMA 2C3YA 1DMSA 1KAOA 4IIDA 1GTZA 1UPBA 3ZZMA 1A7UA 1L5HB 3I9KA 3R44A 5AJWA 5L3ZA 4R1MA 1CV2A 1HF3A 4RFVA 1HKHA 4G1FA 4AJEA 2X9NA 4ZAVA 5AW8A 2G36A 1EG2A 1RW4A 3IUMA 4M7WA 1SUFA 4IV0A 4NRDA 4YT5A 5DO9A 3V6MA 3M34A 2YHIA 4R8MA 1MA3A 4FDAA 1E6MA 4I1IA 4IHQA 2H54A 5K0FA 1Z2DA 3AU8A 3K0SA 2FZWA 2AEJA 1TZCA 4J03A 1JEQB 5GAJA 5BSMA 1X7WB 2J8ZA 3U1VA 1ISIA 1JHZA 1GT6A 3NDPA 4J0GA 4R0NA 4UVGA 4C7KA 1AUQA 5EFZA 1EZ4A 3ZHOA 5AI8A 3U7JA 3LPNA 4KAAA 1D4FA 1R4NB 2ZIVB 1V7CA 4I66A 3IBCA 5EP1A 2XZTA 5J43A 5KU1A 2NZYA 2QT9A 5LU8A 1T8RA 1LKZA 3SF8A 3WBKA 5CDHA 3ROEA 1G60A 5TMPA 2C1XA 1U0JA 4DA4A 1FUKA 1JKJA 1KP3A 2BHTA 2OV6A 3UHPA 1EVJA 2ILVA 4IXNA 2CLKB 1XALA 2ZT8A 5ALHA 4TLDA 3VMFA 2UXCB 5BV1A 2UDPA 1LS6A 2ZATA 4C06A 3VTZA 1RLIA 3FSEA 3ZZNA 1FTWA 4TWJA 1NTRA 3GLGA 1TC1A 2E3JA 3ER8A 2MU1A 1L7NA 1IJBA 1X7GA 1YZYA 2YVUA 3N3AC 1RKVA 1I4WA 4XUDA 3CNNA 1DIBA 4Q3LA 3FF4A 1HEYA 1HPLA 3GG2A 3WK8A 1ACLA 2DX7A 3HABA 1E6CA 1QJ4A 3CUVA 4I50A 5DBGA 4Z3OA 1TD1A 2R60A 4AROA 1RACA 1Z4JA 3I61A 5JZBA 5JAZA 3HA7A 1RXUA 3NKFA 4BE4A 3FNRA 1VGVA 1JHVA 3ELUA 3KSZO 1YU6A 3B48A 3GN2A 4M9XA 3OMLA 4M0FA 5E6SA 3VR2D 4UQPA 4Y1GA 3ENWA 1UBCA 3ERCA 3GZTB 4HMOA 1KXJA 1U5BB 2IY7A 1KO1A 3BX1A 2EQBA 2IU3A 1UDBA 2B1IA 1UMDA 3QOYA 5D7NA 5G0UA 3ZGYA 5I7SA 3KO8A 4AKHA 2NIPA 3NJ4A 3CB4A 3ZWNA 5GONF 5BSGA 1D5WA 3QKRA 1NYLA 4Q00A 1MFZA 3W5SA 4PFKA 2GD2A 3O31A 4JJEA 3EPJA 1Y1PA 2C9YA 2H3EA 1ZMTA 2KI5A 3OP4A 5ESXA 3TLYA 4CMAA 1KI8A 1EGVB 2NXCA 4QAQA 4JKIA 1NJ6A 1Z35A 5BOVA 4EI8A 4TZ6A 1QRUA 1OVMA 2XQVA 2FA9A 2OHHA 3MMSA 3OOYA 3AMVA 4P3NA 1SZCA 4H7KA 2J9FB 2G5PA 4BLVA 2UKDA 4MIYA 3FE2A 4W8OA 4DDKA 1HT3A 1MAWA 5BN3B 3E4DA 3UGKA 1N92A 4P0QB 1QAQA 3VU0A 1EX9A 1U9YA 2NQ2C 2CLLB 1IPEA 1EP2B 1T5DX 3RRZA 1FK8A 4WXRA 4H4CA 3ZGLA 5CH8A 2I4LA 2ATIA 1KDZA 3TX2A 3E3AA 3PVCA 3U7GA 3DL2A 6REQB 3HZRA 2ZSHA 3EEFA 1W5TA 4MV3A 2IWHA 2QPLA 5B1EA 4X94A 2O8CB 1IQUA 3TPCA 2ZI5A 1BN7A 2POQX 2QPOA 5ITVA 1DWQA 5JXHA 4MUAA 1BX0A 1NAHA 2ZB4A 3JALB 4HEA6 5CFRA 1Y63A 2BKEA 1I32A 3KB6A 1FX0A 4Q3KA 4GPD1 3TDKA 1WUIS 3KOXA 2X4DA 1M72A 2VJKA 1TM7E 4HWGA 1FUIA 4UHJA 4KHPB 5A5VA 1B74A 1M6WA 4N8EA 2K87A 1IEQA 3U16A 3C5HA 4PG5A 2FRDA 1UPXA 3GRFA 5AKZA 4K2HA 4GYKA 3MTGA 4GOND 3LOUA 4RKQA 4UFOA 5GGYA 3QJ5A 1DHRA 1M6YA 3VYSB 4HQRA 4U2BA 2DQ4A 4C0XA 1BEZA 1G9TA 4QAJA 5IDQA 1Y34E 5K8JB 3GLFB 5AQ1A 4L9AA 3AL0C 2A0YA 3P9PA 1JHMA 4C7XA 4H08A 3JQFA 3ZD7A 3HLKA 5CA0A 2D7CA 3W1WA 1JAIA 1RQLA 1RXYA 1TW3A 1C3VA 2VF4X 3I9V6 1C1YA 1G21E 1UFKA 2CN1A 2X9GA 4FJ1A 1UBGA 4JAVC 4J49A 4Z8YA 3OETA 4F91B 1OB5A 4LFAB 4BFCA 1RXIA 4HN9A 4QWMA 1AVTA 3DE3X 4IP0A 1RYFA 1W4ZA 3HWSA 1XZ8A 5J40A 1NL3A 4FJ2A 1NQVA 3OECA 3ZDYB 4EH1A 1EEXB 1H1LB 5E3IA 4HNQA 1ORHA 5KKNB 2NO5A 3VR6D 5IASA 2RHDA 3GDHA 3GFPA 1A9XB 4J75A 3ZKWA 4BNUA 2XCLA 1T5LA 2C94A 4WZBB 1PEAA 2O8VA 4QU8A 5T57A 3N28A 4C4TA 5EMMA 1GPWB 4ENRA 3B6ZA 5F9FA 1KRHA 4BL5A 5FOQA 4BMSA 1PGNA 2WHPA 3Q9UA 3HNOA 4C4PA 1XZBA 4I9HA 1GG9A 4GP7A 4M1KA 5FPQA 3L92A 4I1SA 4XI9A 1EFLA 4QBTA 1VJ5A 1UOEA 2IXEA 1B6SA 4IUBS 4LV5B 3RJ9A 1BDBA 4X9XA 1G2IA 2VF5X 3AY0A 2R8YA 2Y0BA 3AIOA 1KERA 4YDQA 1BWSA 3EQ9A 4KV7A 3HI6A 3ZVLA 5HWSA 3AESB 2WMNB 3HGQA 1HE3A 1NYTA 4ZD6A 1LW7A 2LPMA 4H7HA 3D3WB 3H9UA 3CY6A 2NU7B 1AGXA 4FX2A 1UEIA 4WN3A 4QPCA 3RS8A 1U4SA 2ESRA 3HU1A 4IDEA 2XJ4A 4D9IA 2EF0A 2HTFA 2YHSA 4R8RA 3OPXA 1AMNA 3KZCA 4CM4B 3ZJTA 1NBWB 1QUEA 4J0IA 3B53X 3V8BA 4RKRA 3IJRA 2AXEA 5I9IA 2OB2A 1ADJA 1WLSA 2VYVD 3M3HA 4PLGA 4HH0A 4UHBA 1M3SA 3RJZA 4YX9A 2LKDA 5CA1F 4YRAA 1L5HA 5CW1A 3RM3A 4F6CA 1EX6A 1QV6A 5K03A 4UPVA 3HPRA 4UM7A 2DHQA 2AEFA 4ZT3A 2EEPA 3GCWA 1NF8A 1EFRD 5EE1A 4YECA 1YTLA 3Q10A 3BZWA 4WESB 5D87A 2YXLA 1XBTA 4EG8A 4UHEA 2PWBA 3HVRA 3SAJA 3VR4H 3E8MA 4ETMA 1PW7A 4DDHA 2LV8A 5J4VA 1JEQA 2X15A 1X7WA 4CTKA 2GAIA 4QQRA 2BKXA 4A0FA 4YREA 3QENA 5H80A 1EU1A 4EDFA 5JADA 1R4NA 2I9KA 4B40A 4GR5A 2M32A 4J4HA 1QAOA 5ALPA 1L4EA 1B43A 3TS1A 1UPFA 2I99A 3ZHYA 4FMBB 2GKOA 4ZOLB 4DCGA 2UV8A 2SKDA 4Z9YA 2VAMA 5LQSA 3ZTYA 2GYVA 2WAMA 1Z83A 4OBEA 4DQVA 3HZHA 3IT1A 5IKPA 3O84A 2A5FA 2GFQA 1G9SA 1RXCA 1ZVJA 2J0UB 2P35A 3QXJA 5HIIA 2VSFA 1H93A 3M6VA 4NEGA 4QOHA 5FO0A 4F71A 1BW9B 3DG9A 3QOFA 4HN4B 1WDLA 4HNAB 1NHWA 1J2TA 4JLUA 5EFOA 7REQB 3ASVA 1A8PA 2EFDB 2F4NA 2Y71A 3M4JA 3QK7A 3MCAA 4I9UA 3LGSA 5F5NA 5ICSA 1FSPA 5CFLA 3TRHA 2ZBEA 621PA 1F2VA 5TNXA 3GJYA 2PX3A 2CMGA 2NAFA 3B89A 4S35A 3W8RA 3HEMA 3L7JA 5LQMA 1ZIXA 3N8IA 2BGWA 3QBVA 3FXAA 4B31A 3U09A 1NBME 2CUZA 4KBFA 1VSUA 2C4VA 4HNRA 2CC2A 1IOWA 4RIIA 2I4OA 3X1WA 5CLGA 3T7CA 4OB8A 5SYAA 1A9SA 4KFTA 4CE6A 2VDOB 4C01A 2JGKA 1CZHA 5BYKA 1X74A 3UC5A 5A04A 3BEOA 1UPUA 3NAMA 4ID9A 5CB0A 5KSYA 1L5RA 2Z5LA 3GRAA 1U5BA 4KN5A 5L3VA 1MDBA 3O4RA 3PNVA 4BUCA 4A5OA 2CNWD 2APJA 2GPTA 3IHKA 4JZYA 4YDRA 1SH7A 2Z09A 3CF4G 3VDMA 4CM1A 1R12A 1M2VB 1BDHA 3HCDA 4N9WA 3MFYA 2EX1A 2PLWA 4L8GA 5AW1A 2HJVA 3FBTA 4ES6A 1Z07A 2QLNA 4GMHA 5B1YA 3FOBA 3TSAA 5ALYA 3NH9A 2HMUA 4OYHA 1C29B 3WIBA 4MARA 4Y2YA 3RLFA 5BQ3A 4KVFA 4OXYA 3IPLA 1MEEA 4WV3A 4N3AA 1MEJA 1UZAA 2AKYA 2TYSB 4BN5A 1QRSA 4YVFA 1XV5A 2YOHA 4PAWA 2PAFA 3UHJA 1U0LA 4FZ5A 1L5QA 1URPA 2X1LA 4RVFA 4EHFA 4YMSA 1QOQB 3VOTA 5IK2D 3QMVA 4CG0A 2J9FA 5CFPA 2LKCA 3AUYA 1H2XA 2BHRA 3ODGA 3OZSA 3TMAA 2X5KO 4C2BA 5BN3A 3X1MA 4YBZA 1X80B 4IIBA 3QMPA 4D9FA 2DR0A 2XTZA 4MVJI 4R4JA 3WDKA 1GD1O 3H1EA 4PAMA 1TOAA 5GV7A 1QQ7A 2CUTA 3W6UA 3ZJYA 1ZD2P 5CEJA 2IHYA 2XUFA 4Q9JA 4F2WA 4ENUA 6REQA 5JS2A 5ICMA 2B2CA 1W4AA 4PIPA 3ITDA 3WGKA 2O8CA 1Y6QA 1Y9JA 2RH9B 1X1EA 4OQYA 5JTUA 4C4ZA 2F1IA 3LCVB 2WZDA 3EE6A 3JALA 4GXTA 4HBGA 4JLSA 4UMDA 3CEMA 2PT9A 3JZMA 2BY4A 3RKSA 3A0RB 2WJAA 4WFQA 1CUXA 4UU7A 4PX3A 3Q3HA 4FUQA 2FSIA 5JI3E 2X2EA 3ED5A 1ARZA 3NHLA 5AW9A 3WB1A 3QOWA 5LZ9A 4LY0A 3AVYA 1OBCA 3KWFA 5COBA 3SE7A 3E82A 2D1QA 3AHDA 1PFGA 1WW2A 1A9YA 1BWPA 4NWIA 4M46A 4DM7A 1PR4A 2H2AA 3U3KA 4G97A 1ZN8A 3TE7A 5JFOA 3GLFA 3C3WA 3CE9A 4H3SA 1E9FA 1AKQA 4LXHA 3PXDA 2PGJA 5CNIA 1J24A 2CGEA 1CQZA 3A28A 3D8TA 3ZHVA 3MRXA 3IQFA 3PFKA 4QXQA 4CCYA 1QH9A 4C6TB 1AOXA 1AXEA 2VHYA 3TBKA 4LXXA 1YR9A 4WLUA 4RF4A 4YASA 5CFZA 1KAHA 2VNHA 1VMDA 5LDGA 1EDDA 1U7XA 4Q1DA 3IKJA 5DCYA 3WJ7A 2ADFA 1M0TA 5ETJA 1U6IA 4WADA 2AQHA 4OEHA 3RK1A 4KHZA 4NAUA 1DC5A 1H1LA 1UL1X 2DTEA 3KR1A 4BFYA 4EGCB 3PX2A 4XWOA 2IY8A 1Y6ZA 1HQDA 4LUCA 2GA9A 4ZEXA 4DV4B 1GV1A 3TDMA 4UEKA 3T9AA 1NN5A 3RTEA 3WTBA 1O0SA 1MENA 2FOLA 5SZIA 3RBVA 4CT5A 4DUGA 5JAIA 2AOXA 3LTNC 1MVLA 3C3JA 2ERXA 3INTA 4LJKA 4PSUA 5EOVA 1RQGA 4JJKA 4LZWA 3ROMA 5IT4A 5GZ6A 5CJJA 1R9JA 3FSGD 1YVPA 4OX9B 4UNIA 3W5IA 1QWOA 3EH2A 1FS6A 1SCIA 2HU8A 3O1IC 2VPWA 2N75A 2MTBA 4TMFA 4O1IA 2FR8A 2VPQA 2QVLA 1N2ZA 2FRVA 2A30A 3AP1A 4G9EA 3VPDA 5B4VA 2IZ7A 2QRLA 3LC0A 4RHCA 4OQEA 4G1EB 2JFYA 2LVBA 3AESA 3EDYA 4J2TA 4PLFA 3OX1A 5DLPA 4ZV9A 4TL6A 3D3WA 4YCJA 2RE8A 3C7DB 3PA6A 3WB2A 2NU7A 2X42A 1ZCAA 3DTVD 4EJSB 3JQBA 1YA4A 3I5MA 3GJQA 5I7HA 1G5QA 5THKA 5GTDA 1G2OA 1Z39A 2XEDA 4WD3A 3OIDA 3ON5A 3F1LA 4Q66C 4CM4A 1XMXA 3NDRA 1BD3A 4PWYA 5FLKA 2AOVA 2XUAA 1PD0A 1TFUA 2HI0A 2EU8A 3AIIA 3KR9A 4A92A 1NWCA 2WC1A 4L28A 2XGOA 1XTBA 3SQOA 4YJ3B 3ZQJA 1I3NA 5EZYB 4URUR 1I3CA 4ENPA 1CZNA 1P1KA 4W63A 4LWOA 2QW8A 4N8DA 3GGCA 3EIUA 4LGCA 1EXNA 5CUQA 1E5QA 2WG2A 4D8WA 1SQ6A 1WHTB 3OM9A 3HXPA 3QX9A 3ODPA 2XUDA 4WESA 4AJIA 4HB3A 3C4VA 1CUIA 1ODJA 5TSDA 3S7ZA 2B30A 3WL5A 1CP3A 1OI7A 1G55A 3FFWA 4LJ6A 3WDMA 2RAPA 1NVDA 3WDSA 4EKDA 4MRNA 4DM3A 5A6SB 3T0IA 1G18A 2QV0A 5C8VA 1R3DA 5ESDA 2PJDA 3HJRA 2R6ZA 4OHRA 2IW1A 3ZHUA 3TOVA 2VK1A 3LKVA 5PNTA 2P3SA 1QIIA 2NU8B 4BVKA 4Q18A 3ETNA 1W52X 4DADA 2PFGA 4GH5A 4DA9A 3FLAA 1PSWA 4L74A 4ZOLA 3BDAA 3FAZA 3HCFA 3IO5A 5AMXA 5DZSA 5EE0A 4EHNA 2GERA 5FADA 4RJJA 4XD2A 5K7SA 1PK7A 4YQEA 2J0UA 1MJHA 4LYGA 5C3UA 1SBTA 4NOJA 1YF3A 1BW9A 1MGPA 2NZ8A 4HNAA 2VATA 1VHLA 2X6RA 2J31A 2NTJA 1L3BA 2XUJA 4G41A 4D92A 3S3TA 1W4LA 2RMKA 4F5WA 2CYBA 3Q11A 5JNWA 1O95A 1H6DA 3G0CA 1C7EA 3IV7A 3VPBA 4YRKA 2EKPA 2EFHB 3W7VA 3AXSA 3NNDA 1WZIA 4BB5A 1B2RA 2I4IA 2UZIR 3CO0S 3N39C 1HE5A 2GK4A 4Z4FA 3H6HA 1H9AA 1YR1A 4B7UA 3OEWA 2H1CA 4PZCA 4YLEA 4ZAFA 2Z2XA 5JSFA 4UDOA 3OZGA 1QF6A 4WFIA 4PF1A 4A6EA 2H1FA 2Q5JA 4EAAA 4BXOB 2UU9B 2E0IA 5HRAA 5K0CA 3RODA 3MTAA 1VE7A 4KP7A 1DG9A 1Q0HA 1VE9A 2DECA 4QYTA 5JO0A 5KNLA 4WI1A 3SX0A 3GRVA 5EJ4A 1OZ0A 3DYVA 1V4BA 3G68A 3H05A 1B8PA 3E5RA 2GRAA 1DC8A 3H5RA 4ZYUA 1JSRA 1M2VA 4F2HA 3B6KA 1U7OA 4F4FA 1PG0A 1Z7WA 2YY5A 3P0RA 4NYJQ 2DERA 1DKPA 5LYYA 2QV7A 1ENZA 1I24A 2BHLA 1AUVA 3IJEB 3H99A 4X7PA 3GEMA 4ZT4A 1PZMA 1QO9A 2WFLB 1XA0A 1UDXA 2HJRA 2C5EA 5GVSA 4MNTA 4HNVA 4JV5B 1DE0A 1KAGA 1WF6A 3DEAA 2JRCA 2H9IA 3H4TA 1L3CA 4QX6A 4Y2GA 5LZ4A 4ND5A 4G0XA 1V9LA 3UBTA 2LRHA 1ACMA 4KE6A 4KUHA 4RIEA 5WRFA 2OCXA 4J7XA 1ZVVA 5IAJA 3I9OA 3NVDA 1MJGA 1H1DA 4LHVA 1FE8A 4BOYA 4OL9A 4EQZA 4Z4IA 3IVGA 3B9PA 2I3GA 4L72A 1NKVA 1P0MA 2PEYA 1DFIA 1T0JB 1X80A 1ICEA 2WD7B 3PXEA 4F3TA 4P35A 3E03A 2J32A 3NDIA 4HGZA 1TAUA 1FYFA 3DZDA 1P77A 1U8ZA 4HRVA 1P0PA 4FFSA 4KXQA 3G0OA 3HFJA 4O4LF 1SXHA 1W0JA 4S1NA 5AJXA 4YWJA 3ZPXA 2L19A 3D59A 1J5XA 2Z4RA 3O03A 4MROA 4DIBA 4OXIA 1RYDA 2I55A 1IN5A 5KNDD 1LCIA 4LXUA 4QM7A 2QAGC 4DYDA 1PLLA 1OGYA 3I2JA 3TOCA 3JAWA 4TKVB 4QG7A 3UXMA 2K2QB 2VUSA 5CYPA 1KEUA 2HN9A 1C30B 1ODTC 4BRWA 3ZI0A 4GWLA 3REOA 1FS4A 4ZRNA 3ES9A 3HZZA 3NYQA 3KQWA 2Y1KA 1T36B 1G4HA 1OZAA 2EJTA 4NU6A 5T41A 5D1NA 1AZTA 1EJ6A 3RO7A 4NTZA 4H15A 2OAP1 4MLZA 3TEJA 5C8YF 3CPSA 3PEFA 2IRWA 3W8EA 5JQGF 2G5TA 2J6BA 3D7SA 5DEIA 4KDFA 1NF2A 3V1YA 1IAQA 3OFJA 2FCAA 3K4PA 2Q50A 2X23A 4J29A 4C6TA 3EZLA 3K0AB 1LZKA 1JKIA 1JFLA 3VZPA 2WMDA 1Q20A 3RYCB 2D1TA 1WUJS 4WMLA 4EG7A 4FINA 4J07A 2JIZA 4C0KA 3LXXA 3I5XA 2PNJA 3EGDB 1JAZA 1S3GA 2V7EA 1XR3A 3QE2A 5K3DA 4GP6A 4KXNA 3ZWXA 5JCPA 1JU9A 2O3RA 2Y2UA 1ISPA 1ESZA 1F2DA 4ND2A 1QCDA 2LDBA 1GVNB 3IIEA 3JQRA 3A9RA 2GBGA 5L3QB 2A5LA 5H02A 3W3AD 3QE9Y 3DCJA 1K8RA 5LP6A 1KHTA 3BVPA 1VFPA 1PQWA 4UNPA 5AM5A 2V6GA 3OX2A 4Y9SA 2O6HA 3K1YA 5I7VA 1XMVA 1N7IA 4UTRA 2VWQA 4RQUA 1P91A 4BECA 4TL7A 1FNDA 4HX9A 3I9LA 1WPRA 3FFTA 4PPFA 5KX5F 3FWHA 4QBGB 2OORC 4GVXA 4M38A 1QH8B 5BORA 4UBNA 3WYCA 2IYLD 4HAVA 4D2IA 4AJKA 4EJSA 3UCEA 3A6PC 2G83A 1BE0A 1WKBA 3O91A 5IT9A 4K9PA 4D80A 3IR5A 3EVFA 2HMTA 3O47A 5EWLB 2EBWA 1S96A 2W2PA 2QX8A 1R8XA 3DAFA 1EQ2A 4WAUA 4WOBA 3WK6A 3S2IA 2HU7A 2VNKA 3KQOA 5HKKA 3CRRA 3W5BA 1V41E 2JCGA 2VYNA 3DQQA 3I6ZA 4PYMA 1BOOA 5EZYA 4NE2A 3TMKA 1ZOIA 1BA3A 2OAQ1 1Z22A 1X13A 2OCPA 3VSEA 4MICA 1WZNA 1GUFA 3QYAA 1J99A 5FFMA 1LJLA 3M1YA 3P9IA 3UHOA 2V96A 4IMRA 2BCJQ 3K8QA 2QZZA 1WHTA 1QBKC 3ICVA 3KEOA 3A1SA 3N53A 1B0UA 1NXQA 1XYGA 4DBLE 4XEHA 1RJFA 2IW3A 1Y8RB 1GKKA 2FWNA 2ZI3A 4RWEA 3TSWA 4CM9A 2ACVA 1YZ3A 4R16A 1PFYA 1FB5A 2GN1A 5EIOA 4LJRA 4V0QA 4TTIA 1GILA 2DUNA 3A1FA 3BQ9A 2NZUG 1Q5PA 2ZK7A 4MJ3A 1ILEA 4XDGA 3PXGA 2WP8J 1N5JA 5KYYB 2NZWA 2NZ2A 2PMFA 3MINB 4FXPA 2NU8A 4KN6A 1UJCA 1ZVMA 5SZHB 4PONA 4LV8B 2JFPA 2XITA 3TH5A 1ABEA 3I0NA 1EFHA 3L5OA 1V3QE 3C3BA 3CLSC 3PFFA 2ZWMA 1Z4LA 2HKIA 4QT4A 1GFZA 1GLGA 3FJOA 4R1PA 5HRUA 3EA5A 2IXDA 4WIAA 1KO4A 2I3ZA 3R7SA 5K0EA 2JFVA 1I9GA 2GN8A 4JL6A 4XR9A 1R0KA 3W2EA 4TT3A 4BAZA 4GECA 3J80A 3RSHA 1TK9A 1FDRA 3CNLA 4UDNA 4CGYA 1Q6YA 3JYLA 4YRTA 2XCSB 4CF3A 2GYUA 3CT4A 3FDIA 4QU0A 1KAEA 1FRVA 2VYQA 1CQWA 2GMWA 4UCFA 1QVAA 4M8NE 1HYGA 2H1HA 2O8EA 4JJAA 2JI4A 5DE3A 5K51A 3SQMA 2QVGA 2X58A 3DHNA 1Z56C 4B3HA 3ETCA 1I4TD 1JLMA 4J1TC 3H83A 3MMPA 4R84A 4CTNA 1AV7A 3W06A 1RWQA 4QUIA 2CJXA 4JT8A 5EIXA 4BXOA 3ISJA 4Q7LA 4E08A 5JVDB 1NN1A 1VLJA 1Z26A 2JEYA 3NWBA 4E1VA 1V3VA 1DTWB 1GU0A 1HC7A 3KJGA 3I45A 2C2HA 2C3OA 1PEDA 2HFJA 1RE1A 4PLVA 2CWWA 1AHIA 5KNCD 1T15A 3V2UA 2C4TA 2WJ3A 1JNXX 5JSYA 2GBIA 5L7YA 3U1TA 2O2CA 1R00A 3CIFA 2FSGA 4UMVA 4DWOA 4HYYA 3HH8A 2WFLA 3PQ4A 4XCQA 1KMIY 5CT4A 3DOEA 3ORFA 1PJSA 1PNQA 3BRQA 4UW9A 1XELA 2V6MA 2MMGA 1G20E 3LMKA 3VOAA 1Y9EA 3V4RA 3JY6A 1ETUA 3CPJB 2E2WA 1R0BA 2QL6A 1FRZA 2H5LA 3DSRA 3E18A 1FTSA 2O3UA 5HMMA 3HK2A 1GYQA 3H1BA 4KI0A 5EXEA 5JSUA 4Q16A 2XGJA 1U2GC 1GJRA 3FHLA 3PKJA 3WB0A 5CYGA 1JG6A 1R4MB 2XNDD 4DHWA 4GWKA 2WD7A 3EF3A 2MWMA 3EVTA 4JA0A 3W7AA 2QF7A 2W2LA 2QMHA 4PHGA 1JU4A 3AR5A 3DDCA 5AHOA 3TNDA 3PQCA 5LUBA 5U4XA 2QM8A 2HIGA 2H0AA 1ZCZA 3N8KA 4H1UA 3OM8A 3U4MA 1ISJA 2VXOA 4HQOA 4D3XA 2QYOA 1P3DA 4M89A 5BR1A 5C8YB 4LTDA 3EG5A 5CCBA 1LD3A 5DCLA 1WUTA 2ZRMA 2G76A 1U28A 4TKVA 2EARA 3RC3A 5AUNB 3FMIA 5C18A 3C7AA 5FYDA 3GLFE 2ZJYA 4P5DA 1C30A 2ERYA 4R9RA 4F9TA 1HA3A 1P4JA 3G8AA 3OZTA 2G0AA 3GUYA 4II2A 1BKYA 4IDOA 5E7JA 3BE8A 3PKIA 4L15A 3SKVA 3H8WA 2D3TA 3HHEA 3PEVA 5B7NA 2WABA 1A4IA 1T36A 1V7PC 3Q8XB 2ZJAA 4OI1A 1G8FA 1LPBB 3HUFA 1FLNA 1BE1A 3BWXA 3CN7A 3H1GA 4WOKA 5CHYA 1E9VA 2XNCA 4CVNA 1T0BA 5I4KA 5J4KA 3HJFA 3U4DA 2C5GA 2B21A 5FFNA 2OYSA 2WOOA 3S4YA 1B6RA 3FOEC 4ESVA 5HTOA 4RSHA 3RAEC 2X8JB 3UNXA 3JQ9A 4BVFA 3EPKA 2GM4A 5JLJA 2Q1WA 2Y92A 3SBXA 2DLCX 4XX0B 4LKRA 4U39A 3K0AA 4BFUA 3MMXA 2MT9A 2PKQP 3PQDA 4F04A 4KDRA 1OZHA 3RYCA 1KQOA 5FPTA 3QWBA 2AZMA 1COZA 2JIMA 1ST2A 1TUBB 3EGDA 1TIBA 5DK4A 2XYRA 3IAM1 4KMRA 3IALA 2JF0A 2M98A 1SURA 2CJPA 3G8DA 2FU5C 4IILA 4KIWA 4HLCA 4U9IS 5CDGA 2CDAA 2X0FA 4ZYYA 5DV9A 1EAMA 1TLTA 1E6LA 2JC3A 3ESAA 3ITNA 3N7UA 4WE3A 4AN4A 2WA2A 3QKIA 5KREA 1GADO 1MAAA 2Z83A 3QXCA 4TXMA 1Q1AA 4AY6A 1TMOA 2IH5A 4W1PA 1GSAA 4U7TB 3TQSA 4HAUA 5KHAA 2B92A 2ZBUA 1FMCA 3TIFA 1RM0A 1EFTA 1UINA 4OXKA 1JVSA 4LQDA 5AJVB 2I6TA 5FOWA 2C4WA 3N75A 3OQHA 1VCNA 5CH5A 3CEJA 2PLNA 1WO8A 3WQRA 2PSEA 1ZM7A 3AM4A 4K6GA 4F85A 2Q3EA 1WXWA 3EG9A 4IIUA 4M0UA 5FTMA 4A2PA 3UJ3X 2TRSB 2XYPA 1FFAA 3DEJA 3FHCB 2JLAA 4J0JA 1OLOA 3GVPA 1IVNA 2EYQA 3V9AA 1F7VA 5T8KA 1QH8A 3C7CB 4XDHA 5CVCA 1KI9A 4B9EA 5IKOA 1NW4A 4QPDA