3THTA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
336
structure length
302
Chain Sequence
TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVDRRVKHFGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Alkylated DNA repair protein alkB homolog 8
total genus 72
structure length 302
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thtA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thtA01
1QM9A 2VONA 1K73T 2J0QD 3CD6S 1XN9A 2RS8A 3IRWP 3I55S 2KFYA 1YHQS 2M2BA 3G4SS 2KXNB 1CVJA 3VAGA 2DNNA 2F3JA 1RK8A 2FPHX 3CMES 1X0FA 1KQSR 2DH7A 2I38A 1VQLS 5GMKa 5DDRC 2HGNA 3R1LA 2MZQA 3CCJS 1K9MT 1SJ4P 1VC0A 3MURP 3MUMP 2DNOA 1WG5A 2HGLA 4C4WA 4YB1P 1JJHA 2EK1A 2YKAA 3CCES 1WF0A 1VQ7S 1BY9A 1ZZFA 4EGLA 2XB2D 3CXCR 2FC8A 5IQQA 3VAIA 1VQKS 2D3OR 2V94A 3UWTA 4LMZA 4Y0FA 3VAHA 1F9FA 2DGXA 2MPUA 1WHVA 1U6FA 1P27B 3D2WA 2M52A 1UAWA 3SXLA 4TU9A 4RU2A 2DGSA 2DGUA 5GVQA 4QU6A 2MMYA 1Q81T 1UW4A 1H6KX 1M5OC 3B4MA 2YTCA 4ERDA 1S72S 2MKJA 1U1PA 5LSLA 2XS2A 1M5PC 1O0PA 3CC4S 4WCEQ 2L41A 1WG1A 2CQGA 4Y00A 5LXYA 1U1NA 1S79A 2DHGA 3US5A 3CF5Q 2N7CA 2EVZA 3ZZYA 2GHPA 2JX2A 1SXLA 2L08A 1FJ7A 4C0OC 3U1MA 2MGZA 1X4EA 5CXTA 2KVIA 3VF0B 2LXUA 1OWXA 4OZ1A 3UCZP 2CPHA 3U1LA 2NZ4A 2AYGA 3TP2A 3Q2TC 1HL6A 2DNLA 2MJNA 2CPEA 2CQBA 1Q86T 1N88A 3IWNC 2MY8A 2E5GA 2NLWA 1OIAA 5JVHQ 2CQCA 2A3JA 2RUGA 5GADU 3CC7S 1QVFR 2LECA 2LA6A 2DO0A 5D77A 1QVGR 1JJ4A 2AYEA 2QA4S 3LPYA 2SXLA 2F9DA 2E44A 5GAEU 1U1MA 3MD3A 1HD0A 3HHNB 2RS2A 1VQ6S 2RRAA 1ZZNA 3H2VE 2E5IA 1W2BR 2YWKA 2CQHA 3MUTP 2KU7A 2DISA 1VQOS 4CQ1A 3THTA 5HO4A 3I56S 4TLQA 4FXVA 3CUNA 3VALA 2DH8A 3CCVS 5BJRA 4UY8T 2MZSA 3CCSS 2KXHA 4M5DB 1R8PA 1WG4A 2LA4A 3P5TL 2U2FA 1SJ3P 2KH9A 3SMZA 2DGVA 1U2FA 1WTBA 2XSFA 4PKDB 1FO1A 1X5TA 2LCWA 3OW2R 2CPXA 2I2YA 1HD1A 4QU7A 3G8SA 1WHYA 2MQPA 2CJKA 1PGZA 3CC2S 4W92B 4TU8A 1U1RA 2MQOA 3VAFA 1WELA 5EN1A 3SDEB 1YWXA 1X4HA 2MKIA 3V4MA 3UD3P 5LSOA 1VQNS 2VODA 3FEYB 4IOAQ 4W90B 4WFAQ 2JWNA 2X1AA 4WFNQ 1WF1A 2MB0B 2WBRA 2KI2A 3B4DA 3NNHA 2CQ3A 4V19X 2CQ2A 2Q79A 4IUFA 2E5JA 2GO9A 5D78A 2G1DA 2ZJPQ 1HA1A 2CPZA 2KRRA 3EX7B 3H2UB 2OJ3A 1FJCA 1FT8A 1KOOA 1WHWA 3J7YU 2DNGA 4WIIA 1JJ2R 1DBDA 3EGNA 1P1TA 5GAGU 3K0JA 2MZRA 1X5SA 2O3DA 5FJ4A 1M1KT 3SDEA 4QPTA 2K8GA 2KHCA 3VAMA 3BO3A 2DNHA 1N54B 4IO9Q 1VQ5S 1U1KA 2BOPA 4CH1A 1A9NB 2DITA 2UP1A 2RVJA 3G8TA 3G6ES 2OSQA 2DGQA 1U1QA 1YITS 5IM0B 2ERRA 2LXIA 2OTLS 1VBXA 2PE8A 3ZZZA 3R27A 2DB1A 5IM0A 2KM8C 3CCUS 1M90T 1VQMS 2XS7A 2MQNA 2X1FA 3RW7A 4A8XA 5JVGQ 1M5VC 4WFBQ 1X4FA 2AD9A 4BS2A 1FNXH 2DNRA 1WF2A 2LQ5A 2L9WA 2RQ4A 4PRFA 2CQ0A 3UD4P 4WKRA 3S7RA 3J7ZT 1OO0B 3S8SA 2DNZA 2LMIA 2BZ2A 2M0GB 4CIOA 2CQPA 5H1SV 3MUVP 1WI8A 1WWHA 2N3LA 1N8RT 2U1AA 3VAKA 2HZCA 3MI7X 2M9KA 2KRBA 2E5HA 1X4AA 5CA5A 1UP1A 5LJ5Y 3NMRA 2MQQA 2ADCA 2CQIA 2MY7A 2ADBA 3RW6A 1KD1T 1KOHA 2MKCA 2LEAA 2FHOB 3UE2A 4C7QA 3Q2SC 1VQ4S 1UFWA 2QFJA 2HVZA 5MLCV 1NJIT 1ZH5A 4YUDA 2MKKA 2MQMA 2FC9A 1U1LA 2ZJRQ 1YIJS 4WF9Q 1VBZA 1URNA 2KYXA 5LJ3Y 2DNKA 1RKJA 2J76E 1H2UX 1N52B 1FXLA 1JMTA 5DDQC 2FY1A 2J8AA 1SJQA 2DNPA 2KN4A 1YJ9S 2M7SA 2XNRA 2MJUA 1WEZA 5CYJA 1VQ8S 1WI6A 2MZTA 4Z2XA 2DO4A 3TO8A 2MSSA 2YH1A 2EK6A 1WEXA 2G4BA 3NS5A 3NNAA 1B7FA 2F9JA 2LYVA 4ED5A 2MHNA 3JB9k 2X1GA 4UQTA 1VC5A 2MGZB 1YI2S 1Q7YT 2MYFA 3UCUP 5ITHA 1Q82T 1VQ9S 3R1HA 3G96A 2DNQA 3CCRS 3G9CA 2RRBA 1FHTA 1IQTA 1X4BA 1X5OA 3CCMS 2M4MA 1NU4A 2MKHA 2CPDA 1FJEB 2CPFA 3P6YC 1NO8A 2ZJQQ 2OIHA 2M8HA 2N82B 1VBYA 3CCLS 2CQDA 2MQLA 4F25A 3MOJB 2DGTA 2HGMA 1U6BA 1R8HA 4LJMA 2DIUA 1SJRA 1X4GA 4F26A 2JVRA 1M5KC 5DM6Q 5GAHU 2QEXS 2XS5A 2CPIA 2DHXA 5DM7Q 2X1BA 3BO2A 1SJFA 4J5OA 3NS6A 2CQ1A 2G0CA 2B0GA 4U67Q 1U1OA 2RT3A 2HYIB 1A7GE 1PO6A 1AUDA 2M88A 1K8AT 2RNEA 3LQVA 3N9UC 4IOCQ 3P49B 1X5PA 2CQ4A 2PEHA 1WEYA 2KG1A 1YJNS 3PIPQ 2RU3A 3BO4A 2OSRA 1VQPS 1VC6A 3EGZA 2N3OA 4CH0S 2DHAA 1H2TZ 2VOPA 3VAJA 3BEGB 1X4CA 2AYMA 2K3KA 2D9PA 3MDFA 4LIRA 3MXHP 4OZ0A 5IFMA 3BS9A 3CTRA 1G2EA 2CPJA 2LKZA 1KC8T 1X4DA 2AYBA 3TYTA 2VOOA 1YTYA 1WHXA 2M70A 3S01A 5HL7Q 3CMAS 1H2VZ 2M8DB 3P3DA 4FXWA 4P6QA 4PR6A 3PIOQ 3NNCA 4QQBA 2YH0A 2KG0A 2JVOA 3DLLQ 2DGWA 1D8ZA 2LEBA 1DHMA 2RQCA 3FEXB 1DZ5A 3THPA 3S6EA 3CPWR 2MKSA 3HI9A 2JRSA 5DDPC 2DNYA 2MXYA 4TU7A 3MD1A 1YJWS 2DHSA 5LXRA 3DXBA 3ULHA 1D9AA 3L3CA 2J0SD 2KM8B 5DDOC 2MZJA 3G71S 2XNQA 1DRZA 2DIVA 2MZ1A 2DK2A 2KXFA 2KT5A 2DH9A 1OPIA 2DNMA 4YOEA 2CPYA 1L3KA 5DETA 2MSTA 3UCGA 4ZKAA 4F02A 3CCQS 3CULA 2OTJS 2DGOA 2D9OA
chains in the Genus database with same CATH superfamily
3OUYB 2W95A 4DSJA 1S1TB 4PWDA 1NCLA 3VVUA 2OW4A 2P1BA 1G9BA 2F3JA 2B42B 4IGOA 4CEYC 4IQMA 3J80Y 1J3PA 1BLUA 2KDOA 4P10A 5FO7B 2ZEYA 1YRXA 2MEV3 3DOKB 3MUMP 5FMBA 2ET1A 1NZCA 4Z7YA 3BV8A 1VMHA 3H42A 4R5PB 1VQ7S 5AFEA 2YC4A 4AL5A 2JG8C 2XHKA 2HWB3 1KHWA 3CXCR 4CM0A 2FBEA 4IFYB 1GNZA 4LPLA 2XLJA 4NLSA 4TU9A 2D44A 1RUH2 1UWWA 1K5MC 2OUJA 2VASA 1YQCA 2YTCA 2VVDA 1UEVA 3DXSX 2XJQA 4QWDA 4QIEA 4FPRA 2PA8D 4RUBA 2YKOA 2WOMB 3WIVA 1U8SA 1G4CA 1EV11 3OB8A 3IN5A 3MAAA 5BXIA 3FZBA 4RS5C 3TOJA 4IG3A 3NBPA 5T5PA 3U11A 1IKQA 1JXEA 2HFOA 3TNPB 3MF9A 1FJ7A 1N36F 5FMOL 3NY0A 1F9KA 1XJWB 2KVIA 4CLTA 2FZ1A 5FZAA 2BDPA 2I8EA 5I8SA 4YZ2A 1RAGB 2NZ4A 5C3RA 4U7CA 2ZMKA 2V4AA 2PD1A 5CABA 3KJVB 2RDDA 1V9U1 3QFWA 1YQHA 1RP5A 1Y11A 3PXGa 1CBKA 3SCGA 3MYXA 5IHRA 3DXTA 4QW8A 1JJ4A 2AYEA 4N8NA 2F9DA 5IVVA 1UWBB 3UETA 4M4PA 1IQZA 3J7AN 2RS2A 4XO0A 2QE5A 2RRAA 3FFIA 3N5BA 1FE4A 3SEPA 1YIPA 2XY6A 4CLYA 4NLOA 1S0GA 5L36A 2B39A 5DN2A 5GLTA 3HT3A 2QQJA 4S2HA 1EV13 1S9EB 4MAKA 2H5JB 2A3WA 2DCUB 3VDCA 2CVEA 2VFRA 4ZHNA 1HN1A 3MR2A 4UQGA 2I2YA 5EPAA 4KMQA 2CJKA 1MACA 3OXGA 3ZFGC 4BLIA 4XDQA 4GKXA 4XBQA 4KHPJ 4A41A 4DR3J 2MKIA 3DGPB 1OI6A 2LP4A 1FE0A 5EQUA 3UD3P 1JXLA 5J3UA 2JDMA 3KG0A 2HBYB 4CWBA 2OAUA 2K2SA 3VKNA 2YWFA 4RD7A 4MO3M 3W2VA 1A8DA 1WNEA 3HP6A 2E7VA 2QQUA 3MM5A 2HPUA 2QT7A 1CAWB 1JZ2A 1XTZA 5ETKA 2NUHA 5D78A 1VISA 2PYTA 5BY5A 5FO9B 2CPZA 5IV3A 4DFJA 1S0FA 4OUSA 1IKWB 3IO1A 2BXJA 4Y5TA 4WIIA 5KT5A 4NWBA 1DLOA 1IG3A 2QMWA 3RRHA 5GAHI 3V4IA 1LCLA 3SDEA 2ZC4A 3GBFA 5FY1A 4C8MA 1NK0A 4IV1B 4LF9F 1RDRA 2JEJA 4E98A 3I2OA 4H14A 4JI8F 2DWRA 5C42B 3J7NA 1GQHA 2JX9A 3GCXP 1VLYA 4Y22A 2DITA 2FJDB 3ZTQA 1UCXA 2EXHA 2I45A 4Z1VA 4RNOA 2DGQA 3ZFFC 2PSZA 3VBRB 1RHI2 2GMJA 3LD8A 1S0BA 2V5HG 1YCIA 1ZX5A 5DUXA 4RUHA 4X4PA 4JV4A 2XG3A 3JYTA 4BS2A 3NV1A 5A7NA 1QXJA 2VJUA 4CXYA 4NCAA 5T5LA 3AP6A 1DY3A 5EJZB 4WM8C 2W68A 2ZUGA 4HVOA 2ORXA 1FRIA 3PVXA 3MUVP 1W8FA 2PHWA 4C1WA 2N3LA 2P9EA 3PO5A 5FUPA 3E6BA 1EUUA 3R2DJ 2CGNA 3RPQA 2YG0A 2GA7A 1RXOB 3M8WA 2J5AA 4LEJA 1RWNB 5C2GA 3DFEA 4QQHA 1E5IA 3G6JB 3NKTA 3VBSA 3GZEA 4FYWB 2A10A 2ZGOA 4IFVB 3D6EA 4AI1A 2NYHA 3IR5B 4CDQC 1R0BG 1S2KA 3PVNA 4JUZA 3M6VA 1IKPA 2HFVA 2JJ6A 1CGPA 4V1Ak 3WNXA 1VBZA 1RTIB 4K40A 4QQOA 4OQ8A 3TA0A 3I4PA 5EX3A 3OUJA 2WZR1 1SLAA 4V1PA 2FDFA 4CT8A 4DV7J 4BE3A 2UZAA 4BWJA 3C16B 4RO0A 2ET7A 3RYLA 3IR6B 3I96A 3VGTA 1WLTA 2CDPA 4I01A 4YW1A 3VL8A 3I0SB 4Y3OA 1MWYA 2BUNA 2ZKNA 4XBNA 2X1GA 5GALA 3WG3A 3D6TB 5AJ3F 1YI2S 2VICA 3EXCX 2XZWA 5HLFA 2NZ9A 4FPKA 1VQ9S 2BJ1A 1SLIA 3G96A 4GB31 5FV3A 3SSRA 3POYA 4EN6B 4JOUA 3PG9A 3MR5A 2FLPA 1KGYA 1RBAA 1JODA 3WNPA 1GXLA 2M8HA 4JV0A 1GZWB 4XJWA 3O1TA 4LJMA 4P2FA 2QLXA 1KONA 3ZXKA 1YJUA 1RT2A 2QEXS 4CO0A 2ATLA 2DHXA 2W47A 1PIV1 4Q1PA 3S7EA 3WW4A 4FAHA 4C3LA 3TX0A 1JHJA 3D28A 2BV4A 2AT1B 1IS6A 2YBSA 4IERA 1UYZA 3TJAA 5GAEI 2H0VA 4DL6A 3AA8A 5FZ1A 1NK4A 1QQP2 3WF2A 4JGYC 3JXOA 5EYYA 1WEYA 1ASJ2 1X9SA 2EXKA 4HT7A 5CQGA 1SPPB 2UU9J 1IS3A 1T6BX 1WLCA 3MFHA 1ZBTA 1JLCA 4MXWB 2LXFA 3LH2S 5BUVA 3MUZ1 1RINA 2XJUA 1KQKA 2HK2A 4OFGA 3TVYA 1KJRA 2BERA 4OQJA 5HROB 1OLMA 1J3QA 1FV3A 2TEPA 4HN0A 1NAEA 1UMIA 1GTHA 4OHZA 2HWF3 3P4UB 4IDKB 2OEMA 2P8IA 5HCBA 1T9TA 5KFPA 2GVZB 4QWNA 3LANA 5F6KA 2B9VA 1JTZX 4WM8B 1URXA 2ZKUA 1AL23 1DHMA 1S1TA 5HQLA 4LULA 1HNZF 2JE7A 3THPA 4FZVA 4X2BA 1Q5YA 2AJ0A 1R082 4Q4V1 4S2GA 4OI3A 4AEKA 2DPIA 3G71S 1US2A 2VQFF 3RGBA 4RLEA 2YKNA 4R0JA 4DPOA 5CD4H 4WYLA 1OD3A 4E9KA 1W2TA 3HFVA 4M3CA 2JLFA 4YOEA 1J2VA 3OL8A 4TWTA 1LKNA 1FMD2 3H5SA 5E7OB 3RAQA 4JAAA 3BSCA 3ZN6A 2CJAA 2E1MC 1IBKF 1DQ2A 4CLLA 4NLRA 1S0MA 3NNMA 3N4WA 2NM1A 3DLEB 2QYGA 3L7UA 1OUXA 3VGVA 2KXNB 3GZUC 5J2QA 1POV0 4NVPA 2L9LA 1X0FA 4QGNA 3NJXA 1RUJ3 3DLHA 5GMKa 1L3UA 4D8MA 1W90A 3GJSB 2BWAA 2Y26A 3IRXB 1ZBE2 3R4DB 1TU0B 3DN9A 4AQYF 3HBZA 1PZ8A 2O5DA 1UIJA 4ECQA 3VKOA 4E4DX 3OPKA 4P73A 4PEOA 3VQSA 3ZNJ1 1HQUA 2A0FB 1FAYA 2J1EA 2VQ0A 3KLHB 3KVAA 1LOEA 3NJVA 3M9MB 3NQHA 3OFGA 4HVRA 4YW5A 1JLBA 2DGXA 2MPUA 1S7IA 1WHVA 3DHWC 1SL2A 4ID5B 4RW9A 1XNCA 1T9UA 4DR4F 4SLIA 2CSGA 4DX8H 1BBT1 3T08A 1R8AA 4ZXKA 3WZ1A 5K20B 2XSJB 1TNRA 1U5IA 1U45A 1IJEB 3B4MA 5IK4A 1DYPA 2UV8A 3DRXA 2XS2A 3MEDA 3FK4A 1LWEB 2XO6A 4D0QA 2CQGA 3TJ8A 3GF6A 4P72A 3BU0A 2OPSA 3HQRA 3VQTA 2VDIA 4GO5X 1XRUA 3LB9A 5I0RA 2OQ6A 1HL6A 2CQBA 1N88A 4K4TA 3ILIA 5AXLA 5T41A 2VTFA 1RWWB 3RZMA 5BR8J 1ZBA1 2ASJA 3FLPA 2EICA 5SZTA 1MZFA 4NRUA 1QVGR 4AEJA 1FVQA 1N4LA 1OSGA 3ZXJA 1CX1A 5HP1A 1W2OA 1GSLA 2AZ5A 2B7YA 4IEOA 5F5AA 3T1YF 3LCPA 3T1MA 2WO7A 3KD4A 4MXWA 2ES3A 3HSGA 1RCXB 3FRZA 1HFEL 1CQ9A 2DISA 4YY3J 2ZNZA 1T03B 1IBLF 4AVSA 5FY5A 1UVKA 1OVSA 4P7TA 1EP4A 5FAXA 3S30A 1Z4UA 2YBPA 1WC3A 1Z78A 3CEWA 3D0IE 2AACA 3D9BA 3I2DA 3GJAA 3VKLA 4LK7A 4DRVA 5IQ6A 3SSSA 3BPSP 1WORA 5F9LA 4UT4A 2W9CA 4XFBA 2DD8S 3HFKA 5ETPA 2Z42A 3L7OA 1MWQA 2OPRB 2Y1IA 4XJZA 1Q8OA 4I2PA 1DLLA 2VQTA 3T1AA 3UESA 4PXCA 1CWPA 4ES2A 4ZN3A 2YV8A 4DL3A 3OGJA 3P1IA 1DQ9A 4KH0B 1RHJB 2X1AA 4A6OA 4YLZA 5E6HA 2BQRA 1NA1A 3UDCA 3RZGA 2CJ9A 3LW5C 5IYYA 2AGOA 3VZOA 1WUUA 5ETOA 5FPBA 4ATNA 4WP3A 3HOBA 3GV7B 5FZIA 4FFGA 4DDFA 2ARAA 5FJ4A 3MMJA 2YPDA 3TEXA 4E8DA 1YFWA 3O14A 2P34A 2W9CB 4AFAA 1N1SA 1N54B 1HB4A 4DV3F 4DCJB 5A1FA 4JTOA 1HWIA 3AZVA 4DY5A 3AODA 3EXYA 3TEWA 2OSQA 2Z2YB 4DRRA 1PAUB 2WSVA 5FZOA 3DGVA 4FFIA 5KFVA 1W9FA 4U8VA 4CYUA 3LP1B 4N43B 4I30A 4RW8B 3ZZZA 5IM0A 2G9ZA 2KM8C 3CCUS 1LWEA 3OBRA 2MTLA 1VQMS 2FJAB 2X1FA 4QPYA 4A8XA 3KUGA 3KHRA 2GC0A 3AD9C 4ID8A 1EARA 3O8WA 5L9BA 2GQCA 4N56A 5IFPA 2RB7A 2CDOA 3KUEA 3FHQA 3U07A 1OO0B 1HIXA 2LMIA 4F3QA 4JX0A 4CCCA 1LOGA 4JI2J 1SEFA 4RKUC 3AJ1A 1GOGA 2WWSA 5F8PA 3WSOA 5KBFA 4F2SA 3JSBA 5J98B 1Q0NA 4DV3J 3H8RA 1YJRA 4CM2A 4IG3B 1U25A 1OQEA 2UY8A 5DG1A 1UP1A 1NSQA 1IZ3A 1IKVB 2A2CA 3TI0A 2RS53 2DU0A 5JXJA 3RW6A 4QYZK 4KG0A 4Y1YA 3ZZTA 1DQ8A 4J9UE 1FMD3 2B6AA 4CLUA 3CDBA 5MLCV 1NPRA 3VHOA 1OYEA 1CC7A 4PYAA 2FC9A 1LESA 1WW6A 3OEAA 4PG4A 4OULA 1RI7A 2D6PA 2NYIA 3M8SA 1O3QA 1S1UB 2GHWA 1AUYA 2XMVA 3SCJE 3MI8A 4FOYA 2J1RA 2Z5WA 3KLHA 1GQGA 1MG7A 1PKUA 2R1DA 1C8M1 2MJUA 1BBT3 3QZ7A 4P9LA 4CO4A 5L7OB 5HQ8A 3A3NB 2EK6A 2ZGTA 5KFZA 2ZZNA 2JDAA 2B9YA 4B3OB 3KHLA 4XJ9A 1Y9OA 1F1BB 1FD2A 4YR3A 3AB2B 2QKDA 5KFRA 1O5JA 4LSNB 2EAAA 1W9SA 2HG4A 1OQ3A 2C2OB 4GH4B 3ECQA 1RUE2 1VR3A 1ZZ8A 3IGNA 4QQ2A 1XNQJ 5LA1A 1GOFA 2CPFA 3NGKA 1C28A 4AVTA 2ZJQQ 3BYWA 1LK5A 2VMHA 2Y1LB 5IT0A 4CCLA 2Q8DA 3LKJA 4PLMA 4FOVA 2EG2A 5FKCA 2VG7B 1FPN3 2V9WA 3MMAB 5IVCA 1S1WA 4YHHJ 2H0BA 5JPNB 2CQ1A 5HBMB 2XUMA 1W7WA 3JSRA 4MGZE 4WU2A 3QH6A 2OPKA 2CFXA 1XERA 3ET6B 2GFFA 4H4MB 4NOHA 3VR1A 3N9UC 3AP7A 3OTDA 1JJCB 4P2MA 4LBLA 3I54A 3VBSC 5C5UA 2KYZA 3VD9A 2Y33A 4CCNA 3SV4A 1VQPS 1H2KA 5F32A 1W8TA 2VOPA 3BPDA 4Q2MA 4CDQA 4B8EA 3QIPA 5FY8A 3IDCB 1PYSB 4FOQA 2FMYA 2ZH9A 4QYZJ 5KG7A 4LLOA 4HPKA 4TYBA 4CO1A 5F5QA 1PIV3 1VRBA 1YWKA 3UKVA 4YG6A 2VCBA 5C4WA 1YIFA 1KHVA 2DYAA 4DIQA 4ZPVR 2NZCA 3DRSA 4B9SA 4LR9A 1PNFA 4R25A 3HD8B 4DINB 4P00B 4UFJA 4E4HA 3ZO0B 1OSDA 4FYVB 1W26A 2VMFA 3PW0A 2VECA 1ZA4A 4LF7J 2YMZA 3SH4A 5FP4A 2W91A 1CC8A 4L73A 1BHGA 1AYN3 1YJWS 2AJFE 4O3PA 4HZFA 5A6WA 4K7JA 2QQWA 4WXWA 4GKJJ 1AVBA 2P6HA 3KTQA 2A75A 4OZLA 1GQPA 1DGRN 3ZFVA 5ABJC 4CE8A 3OJBA 2ZGPA 3LZZA 2RMLA 2MSTA 1DQ5A 2FY8A 4IR9A 4P9IA 4IEWA 4DFKA 3JQMA 1TKDA 4Z37A 2B5JB 4F0MA 5A70A 2KFYA 3CWJA 2M2BA 3BM7A 4Z8BA 1W03A 2BE2B 4NXMF 4IE7A 5A80A 4CDXB 3DOKA 2FDHA 5D0RA 3GP9A 4HHJA 1VQLS 3SI8A 3WHTA 2EIBA 4J9RA 2EG1A 1TK0A 4AEDB 1SBDA 4BQYA 2KD7A 1D0HA 1T9YA 5FZFA 1VAKA 3FGVA 2RDNA 4BBYA 3NW4A 2ZGNA 5FZMA 1UMZA 5LCWL 2WS93 4LKEA 4YM2A 2YKAA 4KV8B 2Y6KA 4TN7A 4ED0A 5EZWA 4DL4A 4YDXA 1T0TV 4LFAJ 3ISNC 2BYVE 3N7JA 3R4SA 5A8RA 4LUKA 3UT0A 2V09A 3PRVA 4KKOA 4Q1RA 4ZZ5A 4FXGB 5F2SA 2M52A 3ONQA 4XDOA 2BQUA 1COV3 5AXNA 4A42A 1Q43A 1UX7A 1S5ZA 1Q81T 1NNDA 1WCSA 3GFHA 4RWWA 1NEEA 1TQ5A 3NMBA 2ZH8A 2FD8A 4O4RA 5CCMA 3CNAA 2WZ1A 4LF4J 2UUBF 1BQNB 2ZC3A 1NCQA 4MGSA 1RAJA 4Y6IA 5LMUF 5C6CA 1RAHB 5GKAC 4CU6A 4NMXA 4X4UA 2FJEB 4LFBF 1BC6A 5F0WA 2LXUA 2HLEA 4OZ1A 4O23A 3T5LA 1FDNA 5A8WA 2WHOA 5RUBA 4AXIA 4WYWA 1PMHX 4EFAC 1RMU1 1HI1A 1RAEB 5C25B 3H1MA 5KG5A 2OQ7A 2ZGUA 4HACB 1RUI1 2EXIA 4TN2A 2QA4S 5GAEU 3O1SA 2B5HA 4DQAA 4N90A 4WVWA 5K0UB 2J7WA 1K0TA 2CNLB 4DU8A 3QT8A 1BGXT 1GP5A 4G1PA 1NCQB 1IG0A 3EMRA 3VGUA 3R5DA 4BQWA 1XC9A 2YWGA 2BANB 2G9FA 1H30A 4OI4A 1Q8KA 2C0ZA 5FDBA 1RCOB 1A0OB 4B3MF 2HNZA 2A70A 1EKSA 1AR92 3LIHA 3WEZA 4HBNA 4M3CF 2BW7A 1YFUA 1RUE3 3JU9A 5CFDC 1VBA3 4F4KA 3O7OA 3PFEA 3J81Y 2WQZC 5GZEA 2UXDF 2JWNA 2FZGB 1WF1A 2Q0AA 4G3YC 3U14A 1SC6A 4IQXA 3POEA 2LQ9A 5D8HB 4ECVA 2I2SA 3MW2A 5JUMA 1GOHA 3LIGA 3RWNA 3VWSA 3MPVA 3AMNA 2GMEA 2Z2MA 2OJ3A 4O7XA 1KOOA 4LF1A 5E89A 1FK9B 3OPZA 1WKYA 3L2HA 1ZREA 1P1TA 4KE5A 1I9RA 4KGGA 2DBBA 2V67A 4TVAB 2UUBJ 4Y26A 5DLGA 1NB2A 3BN4A 2BA9A 5FXXA 3KK3A 2HWD1 2PELA 3B5LB 5FUNA 3TEGA 4UXAA 4JGZA 4UW5A 3T0BA 3BREA 2R16A 1BXNA 1GZ9A 2KZZA 4LF9J 1HKDA 4USVA 3BYPA 4DEQA 1APNA 4CP9A 2UUAF 3U75A 4UUWA 2XMMA 4FPIA 3TVZA 2ZDOA 3K3OA 2ZAAA 2RQ4A 4PRFA 2PHDA 2WFF2 3S7RA 4UYBA 4LA3A 4QX8A 1TKTB 5DMYA 1W6PB 2VBZA 5I42B 2IPOB 4KBIA 1UZDA 2AENA 2JDKA 3AOBA 1A34A 3FQLA 2DXDA 1UPMB 4NPLA 1TL7B 3KKFA 2TNFA 3RAMA 4DCPB 2RJLA 4CDQB 2BNOA 1YFXA 4FPJA 1OMSA 3UE2A 1O8SA 4USIA 5KG0A 3KF3A 4IH7A 4FPOB 2P6SA 1NA1C 1U1LA 1AT1B 1IHMA 2W1WA 4OHXA 3PMEA 2AREA 3OR2A 2AJ1A 1N52B 3K4ZA 3VKFC 2V8DA 3O5SA 1R081 4DSIA 1UY1A 2HAIA 4BLJA 2YKMB 3N6MA 5HMWA 5GLZA 2Y1JA 1YQ5A 5L1KA 2A2DA 3CEDA 1NDKA 3EYPA 4OYBA 1C0UB 2XWJB 1FRXA 2MZTA 4RNMA 4KU7A 1EY2A 2K9ZA 3RFRA 5E3QA 3SIPB 1TME1 1OA2A 2F8MA 2CG4A 2IBOA 2VA3A 4XUQA 3MF5A 3PVOA 4TZDA 2O01C 2V69A 2ZBQA 5DGBA 1NHVA 4LKSA 3WT3A 3RB6A 1JYCA 4DPUA 2PI5A 1JX4A 1PNGA 1VBB3 1GH8A 1FJGJ 5K7PA 5SUHA 4RHV3 5LBCA 3N7LA 2ZMLA 4Q8FA 4XPCA 1DJ0A 5KHIA 2I07B 4UF0A 1VLNA 2C9KA 4ONUA 4C6AA 4EWDA 3E3XA 5A8WB 3OHAA 4ED8A 2R0FA 1QD1A 1Q8VA 1IPJA 1UY0A 1HBNB 4X64J 3GGLA 3FJSA 5DM6Q 2XDVA 4EI2A 4O44A 4PDWA 3R6LB 4CEWB 5DM7Q 1SJFA 3NGSA 1U48A 4DV6F 4I56A 5GZDA 2VD7A 4CCEA 1BLZA 3VBUA 2HYIB 4GIQA 3KLGB 2GCFA 4DUWA 3SKJE 2GAUA 2CADA 2ACYA 4LF8J 2Z2SB 4AFMA 3NL1A 2ZX2A 1SLCA 3OCPA 3GZTB 1C5IA 1BXHA 3PIPQ 3C46A 1BEV1 2OSRA 3HNMA 3EGZA 4KKOB 2RDRA 5H9EJ 1Q79A 2IUWA 5CKMA 4JRLA 2EC0A 1UYYA 2X10A 2WT2A 4NHLA 4PWUA 4LBMA 1SQ4A 3BS9A 5CISA 3OHBA 2W46A 3KLFB 4LHNA 2HWB2 3N35A 3VBUC 1QJFA 3OXFA 3MOZA 1UMHA 1TG7A 4TY9A 1D7PM 1RTJA 1J59A 2D43A 4L72B 4ZPDA 1FV2A 4IV3A 4FBTA 3SCIE 2W39A 2NQYA 5FMOS 1RMU3 2ZE2B 4OYPA 3QRPA 1D8YA 4NCGA 1ZM2A 1VRQC 2RILA 3KF5A 2WBKA 4N7IA 1OH4A 4XTPA 4ZVTB 3ZYIB 3LUYA 4XPVA 3WQBA 4AK3A 3ULHA 2VG6B 3AXMA 1QDCA 2MEV2 3MM9B 3UD5A 4ZLJA 4CA9A 4DSFA 3W1YC 4B9TA 1MPXA 1B35C 1SI9A 3BB5A 2B45X 5DAPA 5KFIA 3Q8CA 4KSEB 4DFMA 1PG5B 4NROA 2XMTA 2VMIA 2ZNYA 3MFCA 2JIJA 2EIDA 1U49A 3AFGA 2PEBA 4DUXA 4C91A 2JWPA 4F8AA 3NS7B 3LEGA 4ZVRB 4CP2A 2AEYA 5A2QY 3MFAA 2RF2B 5DDJ3 1LGNA 1MN9A 2IBKA 5HV0A 2QC3A 4LE3A 4QZVB 4B3NA 2A5ZA 2ZBPA 2R7TA 3ZX7A 1VC0A 2ADEA 2RG4A 3B9IA 1PC4A 5KG4A 1OOPB 4KC5A 2B8QA 1BK1A 2C42A 2EK1A 3AOCA 4IE5A 4MG2A 5T7LA 1ZZFA 2A73B 2K2PA 4Y4YA 3HD2A 1XNRF 2R7VA 3VBFC 3KG4A 3VAIA 4BQXA 3GG1A 1Z7S3 2IC3B 1JQGA 5K8OA 3PX6A 2YC0A 4ED3A 1JLAB 4C8NA 1GLHA 5AVAA 5FZEA 4M5NA 1JU3A 3R5AA 4AHZA 5KHHA 3GYDA 4F36A 2C2KB 1TP7A 2XGXA 1RT3B 1UL3A 3MECA 3IFEA 1GAOA 1O0PA 2I9SA 1S77D 3GILA 3MM6A 1U1NA 3K5NA 1NH7A 1MZ6A 2OO4A 1DYKA 2EVZA 4I69A 4B17A 5ISLA 3PURA 1F3VA 3QWUA 5FP3A 1R092 4R5PA 2AGQA 1MS5A 4Y24A 1OHFA 2C2NA 5IK5A 4ITSA 1TE1B 4MV2A 4W4ZA 2CPEA 4H54A 2ZJCA 1ULOA 1KS4A 1X0PA 4LHKA 1O3TA 2GVDB 2HMIA 3C15B 3LDKA 2LECA 1LOAA 3NRUA 2MEWA 5T14A 3AKTA 1Y5LB 3ILOA 1VQ6S 3HHDA 1ZZNA 5FP7A 1T8EA 2BW2A 2F8HA 1IWAA 2A6VA 4DLGA 1NLSA 4JV2A 2RH3A 4LLFA 1UJ6A 1PX4A 2LW8A 5HATA 4A48A 4EJRA 4NZ0A 2R42A 3NOCA 4BJ0A 3CUNA 2DDUA 5JIUA 5BJRA 2IM3A 3O12A 2OPWA 1BQPA 5EJ3A 4IRCA 5E41A 3INAA 4JGZB 4MXVA 2LFVA 1YEWA 1ZETA 3AYAA 3WINE 1LW2B 4B3RF 2DGVA 2DYCA 5BNPA 5KFHA 1WTBA 4ECRA 5CFDB 2YKQA 1X5TA 3K5MA 3OW2R 4QU7A 4MKBA 2ZABA 4O4GB 4ZY9A 2XJTA 3VZMA 2YNGA 2NPFA 5B4NA 1HWJA 5FQ0B 5EN1A 4FNIA 1W6QA 3BU7A 1X4HA 4PG7A 3DYPA 1JUIA 5BNPB 3V4MA 2E33A 5LSOA 1JXNA 3FFZA 3HFZB 5IV4A 2J9DE 4CO5A 2JFDA 1AYN2 5T5JA 3VD5A 4JKKA 5A6PA 5HSPA 2VQUA 4N5SA 1RVF1 4YGCA 1WDTA 2Q79A 2IFRA 4LIUA 4O65A 2JH3A 1SCRA 3I7DA 3CE8A 1FVSA 4RWXA 4DL5A 1IQAA 2DNGA 1N5SA 2OMLA 3FFIB 2NCKL 2CNAA 2VC9A 1YUDA 2KJVA 1JUHA 4DO0A 3FLTA 4ES9A 4HL9A 1W2NA 4K0KJ 4OLLA 3J8F1 1CJTB 2LVWA 1KN6A 1XK8A 4C0HA 5ETMA 5DAWA 3DLJA 4HL0A 5D4PA 3GJTB 2WWJA 3TZZA 1RABB 2WNUB 1U1QA 1CQMA 1MQTC 1AJOA 2R7EB 1G9FA 4ASKA 4B3MJ 1F0XA 5DS7A 5J2NB 1RB0A 3NGUA 2HW3A 2FDNA 3OY8A 5F8IA 5EX0A 2X5IC 3VDBA 1CZTA 5ABJB 3HD1A 5KFEA 3VBHC 2E1PA 2HVHA 1JN2P 2JC0A 1ND2C 1SUQB 2M5YA 2FLLA 1N33J 2HEKA 3NMAA 1C8M3 2RIJA 3BIEA 5T3NA 3TW0A 4CXWA 4UOFA 2HSEB 3KLSA 1S2BA 4LF5F 2OZJA 1UY4A 4YQWA 1FI2A 2VPZB 4EN7B 1KFDA 4LR7A 3VAKA 3LF7A 4AL6A 4WP8A 5ERLA 2JC1A 4MIAA 1OD5A 4ILLA 5AJ3J 1SH0A 1NDLA 1C1CA 3W62A 1ZBA2 3POJA 4FBFA 2DUQA 3UQSA 1RTHA 4BLGA 1TKXA 5DXDA 4XILA 3AP4A 1RJ8A 2ENRA 3RB4A 3V64A 5HK4A 1NJIT 2XMWA 4HHUA 4AVBA 4PPZA 4UZCA 1F31A 3VBSB 3ZPYA 1TMMA 1OQDA 1QXPA 1HI0P 3FZ2A 1ND2B 4ZXEA 4YRDA 4YGEA 2W2OP 4CCOA 2GZWA 1LRHA 4IUGA 2XUEA 4LF6J 2YFUA 2PMHA 1G6NA 3KZ4C 5CYJA 4JI5J 2JB8A 2WRAA 1EAYC 1WOPA 4RBUA 4EBEA 1HRI1 1WACA 1ASJ1 1O4TA 4H55A 2D1CA 1NXD1 2HWC1 1S9GA 4QPIC 1S6PB 3U1XA 3HZEA 1NPPA 5CYQB 3AJDA 4IOBA 2AZ1A 2IFWA 2C2ZB 2SBAA 5KG2A 5L19A 3EDRB 4RW6A 1WZXA 1WW4A 1RWMB 1X7VA 1O4ZA 3M30A 3NGRA 5E16A 4PQQA 4ATEA 3TN91 2IXCA 4DFPA 3LP1A 3R1HA 4K8FA 3WXPA 2BJDA 3RYPA 3PFOA 1FHTA 3IBFB 5FLJA 1IQTA 1POQA 5T5OA 4C8YA 3A1YG 2M4MA 3P3NA 2HRTA 3CJ2A 4UAPA 5HCAA 4NLYA 1PILA 1YZ6A 4AI8A 1TVGA 3MCOA 5F3GA 1RIRA 2V50A 1F3FA 2OA2A 5F3CA 5L39A 5GLVA 3TRSB 1T9WA 2R7XA 5LBEA 3J81j 1AX1A 1MEC3 2OPSB 1MU2B 2EPIA 4DR7J 4KGVB 3K57A 2BZDA 3N6NA 4U67Q 3H3LA 3WNKA 4E0DA 1HNXF 5HBMA 4JI2F 2ZBIA 3G82A 3DLKB 4WZMA 4P7VA 2JEMA 4OX7A 3LAMA 4OMCA 5E3RA 3QO9A 2LQBA 3CNQP 5BYSA 5KOWA 3KJFB 4JI4F 1RMU2 1SQFA 4DN0A 3FE5A 1WUVA 4CH0S 3G82B 4DQSA 1Q8IA 2HURA 3RTVA 4FS1A 3FBMA 3DGPA 4PABA 2WAQD 4IW3A 3GONA 2ZKLA 4OZ0A 5DZ7A 1PGW1 4D7TA 4J9MA 2XGPA 1Q3EA 4DL0C 2FHJA 3H9AA 2RDQA 3WF4A 3DYAA 1CD3G 1C2PA 2J1UA 2M70A 3S01A 4UZBA 4G4FA 3RB0A 1H2VZ 5ETTA 4WK1A 4P6QA 2YXSA 2LU1A 1VBE2 3ZVXA 2GN7A 2JG9C 4QQBA 1XNBA 1Y00A 3MR6A 1ZM1A 2FHJD 1RUG2 1DZ5A 1IGOA 2VF3A 3PU3A 4YW2A 1UEUA 4IG0A 2DKOB 1RUJ1 5MAOA 4FYYB 1XQNA 1VBD2 4QR2A 1HQLA 3MIHA 2AX1A 3OXLA 1SC3B 3QIDA 1HLWA 4AFDA 1VRUA 4XTTA 1JZ6A 1DQ0A 2WSFC 1NSAA 1MS9A 3BOPA 4AQ6A 1HBUA 1N5TA 1GYKA 2DGOA 4FVCA 4IV1A 2KT2A 1HQEA 5C8WA 2YX4A 2HWE1 1W04A 4WM8A 3CJ3A 2PMZD 4HOOA 1WOOA 1TNFA 2I38A 2F1FA 6FD1A 4FYXB 3W5NA 2LQJA 4QB6A 3A0KA 3MIBA 1KLMA 5THWA 1H4HA 4X65J 5JMNA 1FYUA 3GHMA 4W50A 2TBVA 2H5EA 2RQKA 4AYBD 4IE4A 2RMU3 1K42A 1PK6B 1LNSA 2HWF2 4QPXA 4ZVFA 4MGQA 4TNOA 3VDDB 1NG0A 3AD7C 3P3PA 2PT0A 2IHR1 1DP0A 3OGGA 2ROEA 1LU2A 2ARBA 4KJIA 1GBGA 3N9NA 2E26A 4AUKA 2OUHA 4IXLA 4YGDA 4RW4A 1I6JA 2VB6A 4I2QB 4RL1A 4R8UA 2WNVC 4EYUA 4MX3A 2D93A 1U0HA 3UVJA 2WUHA 2JDUA 4ZP6A 2C24A 2GC1A 1SL0A 2QGFB 1WG1A 1N6QB 4W8JA 2B9XA 2RVAA 2GHPA 3ES1A 5HXVA 2L08A 2CDQA 4NAMA 3OTOJ 3LQCA 2HWD3 2DNLA 1Y5NB 2MJNA 4HANA 5LT5A 2BW8A 1W25A 3IWNC 3N9OA 2L48A 2EFNA 5JXGA 3E5XA 2K46A 3E6CC 3WCSA 2MLXA 1NCRC 1W0OA 1HQWA 4MIWA 1F2GA 2DO0A 1RT7B 1JZ7A 1LOUA 3JAMU 1F15A 3I6PA 1F4HA 4LSLA 3SQOP 1EZZB 4XZPA 1RGVA 3ZMNA 3BKZA 3ZR5A 3OTFA 2VFVA 4X64F 1WW5A 1CSJA 3MZIA 2QA1A 3C6UA 4CRJA 1WG4A 4EZ4A 2EEYA 3I9ZA 1SJ3P 3TUIC 5C8CA 2CU5A 3WW1A 3OVAA 2AHOB 1WHYA 3PEHA 4YVSC 5E2QA 3G8SA 1W6QB 5BXXA 4JGYA 1JYTA 3NP5A 4AYUA 4HYKA 3RJRA 5B08A 2AGSA 3F73A 3JD73 1C1BB 3SMHA 1TL4A 5CYQA 4OYOA 3WY6A 4WFNQ 3Q86A 3AB0A 4N53A 2ASLA 3NNHA 2WFF1 2CQ3A 1RUD3 1DZQA 2FQPA 2GO9A 2RM22 1S1AA 4OCTA 2ZITA 4DX6A 4ILRA 4YW7A 2YNFA 3P6BA 1EB0A 1TMF3 4P9GA 4GKKJ 2EWHA 2GSYA 1R27B 3MGUA 2OPRA 5C2CA 4D7SA 3JB8A 1H98A 4P75A 1NK5A 1U12A 3I3DA 4MFBA 1LHOA 3HHKA 4AI3A 3WZ0A 1CS4B 4YMEA 2HWIA 1FWKA 4M5GA 2KHCA 3BO3A 1W2AX 4TY8A 4IO9Q 1RKIA 4F8RA 5DDJ2 3I5CA 1UNBA 3OSPA 3WDTA 4COUA 1UVNA 3D6FB 2V2KA 1YITS 1RYSA 2ZDPA 2LXIA 1NOVA 2OEJA 2BKOA 4ZPWR 2DFBA 3R27A 5EJ1B 2XJVA 4NCBA 3W9AA 2OZ6A 2J0XA 3MEGB 4QX3A 4PUOB 2DVDA 5KFSA 2NPIA 4I09A 1FMD1 3VBFA 1E6YB 1WKKA 1BCXA 3TQEA 4ECUA 1EPWA 4USKA 4RS5B 3T1HJ 2ZH3A 5KFXA 1U2RA 3S8SA 5K9YA 3M4XA 4JHZA 3MBWA 2R32A 2UUAJ 4LRFA 3LEMA 4FSJA 1N8RT 5BNPC 2AH2A 4IYQA 1FWLA 2V8PA 3GE9A 3M2MA 3BPZA 2B51A 3VUOA 3DKDA 1JK9B 2R7WA 3AP9A 2MQQA 5FDLA 3LALA 4LT6A 2HZAA 4HG6B 5EDWA 1J58A 2QDRA 2AZ3A 2VUAA 3FMGA 2FHOB 4F83A 2FLNA 1RJ7A 1EAH2 2DTJA 1Q8PA 3Q2SC 4C8KA 1HYSB 1CJTA 1WWYA 3JSMA 3NSTA 5GJ6A 1R0AB 4L97A 1JLBB 4CDWC 2KYXA 3D6MB 3NKYA 3PY8A 1JOPA 5F6LB 1CULA 2X29A 4QT6A 2B9WA 4RSUA 2UVVA 5KWRA 3RGIA 1S57A 2P3YA 3OLBA 3WVJA 2Y8KA 4X8PA 4OZJA 4K1YA 3VZNA 1IBCB 4BDPA 2AIRB 4F3OA 1VOMA 4Q0BB 2R8HA 3DU5A 4QPGA 4W6XA 3DKWA 3WDWA 4WFYA 3D66A 2XLFA 2J6SA 1RT1A 3NS5A 4XHXA 4EWEA 1B7FA 1NKCA 3Q8VA 5LZ6A 2NP0A 2LQ8A 2IAJB 4HI1A 3ZSEA 1Q7YT 2HYKA 2J8SA 2MYFA 1SMVA 2VL4A 2C28A 2RDJA 4FQZA 3ZPOA 2VW1A 5JIAA 3MMBB 4M4RA 5FY0A 2F4FA 1JKHB 4EMDA 2G0IA 2HQFA 3HBKA 1OY8A 1T94A 2HNYB 2F4VF 1PMJX 1DCSA 3PUAA 1VBYA 4HFSA 4DR6F 1H0BA 1ACMB 3Q8SB 2C3UA 2GIRA 3C14A 1LWFB 4CLPA 2XHCA 3HHLC 2HHUA 3BUCA 5J2PB 4BU2A 1B70B 3BGFA 3NXZA 4A7YA 4XQDA 2XBPA 4RR3C 4Q4Y2 3E97A 2IVIB 3HVTB 4XUTA 3AYDA 2M88A 4DU7A 2ACMA 1CZVA 2WVBA 2XQXA 5G04L 3J81U 2BJ9A 1IBMJ 4N47A 4YG3A 1VIWB 4COYA 2GGPA 4EYIB 1RHRB 3N3HA 4H4MA 1UD1A 2XL7A 2Y0OA 4IE6A 4KFBB 2D9PA 4PG5A 4UFLA 4F4XA 5KT7A 1SBFA 2WKKA 4FPCA 2VUJA 5FZGA 3K59A 3JD71 5AE3A 4WP9A 3CTRA 3OD2A 4PLOA 1KC8T 2HLUA 2E5LJ 2AYBA 3K8WA 3QIPB 4FVVA 1YRTA 2Q1LA 4YGBA 5FJHA 4DQRA 1TELA 1YDLA 5HL7Q 1NM2A 2RAQA 2YWWA 1J3RA 1N48A 4UOHA 5A6YA 3LO3A 1QUVA 1C5HA 3TRGA 3GALA 1WLDA 5KFUA 2IVJA 2DGWA 5DG7A 1LR5A 1HQEB 1U02A 3ZIXA 3PJXA 3MTKA 2JDJA 4M5KA 2JRSA 1X50A 1UVMA 2NS1B 5DDPC 3KDOA 3OY8B 4DEVA 1OKOA 3RB3A 1HPZA 3JUUA 3DXBA 4XUPA 2QYCA 5JJBA 2J0SD 2Y8YA 2WAAA 1VRTB 1POV1 2VUCA 3ZFGA 2MZ1A 2VKZG 3I2IA 4XC9A 1I5OB 3EXUA 3OD0A 4B3TF 3D3BJ 2DH9A 5K9FA 2VG7A 5A7QA 2QN6B 1I1GA 4QXBA 5E3AA 2P3IA 3KLGA 3H2LA 1C1BA 4F02A 1FXRA 2CYYA 2VNGA 2J0QD 3D68A 3IRWP 3KXDA 4KHMA 1Z2LA 4JB8B 8ATCB 1H6YA 3O44A 5KFQA 3MECB 4J7CA 4CU7A 5ETQA 2BOIA 3HKWA 4A47A 2BM0A 3WP3A 1K9MT 1PSDA 2WW4A 3BN6A 4GB32 3MURP 3ELHA 1VJQA 2NLRA 3RSJA 3MAHA 2WO3A 3B69A 5J7MA 4V19J 5FZDA 4B3TJ 4DCOB 5D21A 3ADAC 4MSVA 3MV11 2QTWA 3HJFA 4NA3A 1BQNA 4KHPF 1V9U2 1X82A 2DCKA 2VQEF 2ZPXA 5J1EB 3CW2C 1H6KX 4NRMA 4EZ9A 3ZIWA 1VRH2 5M0TA 3LOIA 4DV7F 1JZ8A 2DRAA 1QUPA 2CZ4A 2ZZMA 4Q45A 2P2CB 5JI7A 1RXFA 4DMIA 5JDBA 2WSCC 4OHWA 4O9EA 3MR7A 5CKQA 2JX2A 3X29B 1XQIA 3WG1A 1ZZCA 2CWMA 1EAH3 1IKWA 2RDSA 2GVZA 2VBYA 3J7YI 4KV8A 3U1LA 1KDKA 1WOSA 2ZUAA 5JSPA 1XE8A 3L2YA 2ZVSA 3DCQA 2VIHA 3AFKA 5A3OA 1GNYA 2CWSA 2L9NA 3CB4A 2A3JA 1FDAA 3PZPA 2RUGA 5D77A 5HROA 1C8M2 2J7KA 2RD5C 1YX2A 4I64A 5I8YA 2PGCA 3B82A 3IC1A 4OI6A 4V2VA 5DABA 5BNOC 4CQ1A 5B0CA 3DYOA 1RADB 3F2ZA 1QWRA 4D3WA 1AYM3 3MPUB 4JHTA 3PTRB 3DOMA 5M2UA 3EUNA 2KXHA 4ZU4A 4A6SA 5HJYA 3SH3A 4DR7F 3S6PA 3S1TA 3CVKA 4ARYA 2OELA 5L9RA 1XEZA 1IBMF 1K44A 2Q6BA 3HNYM 4UFIA 5D6GA 4F4ZA 1N34J 3W65A 1Y43B 3I97A 4EO8A 1UU4A 3V6DB 5LWBA 2YWEA 3I59B 5HJXA 3AB4B 2FJXA 1PK6C 3M70A 4G1IA 3IBWA 3EB7A 4V19X 1T03A 4QB1A 2KB2A 4RBVA 3E1F1 1GP4A 1JNRB 4J9VA 2VFUA 5KFFA 4M0NA 1QDUB 1VPHA 4M94A 4OV1A 4XJUA 5FPUA 1QJX3 2APOA 5IVBA 2W08A 1X5SA 1M4WA 1PO11 1HNZJ 3HHLB 3ZXGA 3EDQB 2IMOA 3ZYRA 3GQCA 2F4PA 3RJ2X 2HBZB 5EWFA 4PQ9A 4ED6A 2XQCA 2BUKA 1GMUA 2ZAHA 4PF5A 2EBEA 1JLGB 1ZM4A 1S2EA 3A8IA 4CH1A 4DZGA 5D4LA 5A7WB 4URAA 4H4OB 1EP4B 2CY6A 5FZ3A 3ZSKA 1RZMA 3TNVA 5KR7A 1RTDA 4RNHA 1WJ9A 4DUYJ 1ZZ9A 3AX4A 3PYDA 2EC2A 3WDOA 1S0DA 4ZVSB 5KOXA 1RYRA 1W6OB 2Y0IA 1RWKB 1TUGB 4K5RA 5APAA 3DKQA 4C8DA 2BANA 1WF2A 1M5HA 3UGFA 5L1JA 1DBNA 3UD4P 1DQAA 2YHJA 3Q23A 1KLMB 2IXHA 4B9LA 4IKAA 3RS6A 3WX8A 1CJDA 1SFPA 1YJ7A 1KDNA 4P9SA 1AXQA 1FKPA 5B0DA 1QF3A 1UQXA 4PPDA 4JBCA 4DQIA 2WYSA 3EPIA 5CA5A 1XNTA 4C0BA 1NY71 4YW6A 1RHI3 3ETMA 4C98A 3MWBA 3G6XA 4WK3A 1DLCA 1T2XA 1KD1T 3FX3A 5A7OA 3HN3A 1IKYA 1RAOA 4NIHA 3VBFB 2HWD2 1FFWB 3FVYA 3D0SA 2FGOA 3LTOA 2K1RB 2JDYA 1DZTA 1PC5A 3VKMA 1VBE3 1IPSA 3EPGA 1V6KA 4UBGA 2UU9F 2PAKA 2OH2A 4D6RA 5CBLA 5I3PA 3MLLA 5AXMA 3GIMA 4FS2A 1Q8BA 4DV2J 4IE0A 4DG1B 1JHNA 3T4VA 1GUIA 5DZFA 2KM2A 4CEWA 1WMEA 1N0VC 2AYHA 2YH1A 2JEGA 1HRI2 1DGWA 2BACA 2IVFB 3CJ5A 2OP5A 5FPVA 2SLIA 2F9JA 4K0KF 1JYWA 1F2HA 4QKBA 2CKWA 4YB7A 5K0UC 1VC5A 2J1AA 1NZAA 1BKZA 3RZZA 3DNCA 1S0IA 2FDGA 5J2NA 4BHPA 3AXEA 4XXPA 3CCRS 3G9CA 2VZOA 3MIEA 3D1HA 3OFFA 2W2NP 2C3OA 2BWCA 3HWJA 1FJEB 4EUVA 4QIGA 1R1ZA 3P6YC 3DC2A 5DUVA 2PO4A 3CCLS 4WVMB 3GCWP 4PJYA 3TA2A 4HDHA 5JZGB 2D3UA 5EIYB 1S1VA 2JNJA 4YG0A 3CJ4A 2YKNB 2BQPA 1QIQA 3URFA 4FXKB 2CRLA 3R3TA 3GJQB 1UKRA 2VKRA 3IA0A 2B8PA 2G0CA 2YKPA 1O59A 2HWF1 1AZDA 3H3ZA 1LW0A 1HNIB 1MS8A 3H0OA 3DM2B 1H2MA 4Q8KA 4YHHF 4HACA 4DWIA 4FTBA 1TZ0A 1UFLA 2Y64A 1B0VA 4P9YA 1TME2 2BJ8A 4LFAF 4G1QA 1FCAA 5K8PA 1PGL2 3KLVA 3WP4A 2RMU1 3WQPA 3DM2A 3KOAA 4M5MA 1XNDA 4NIGA 3VL9A 1SIZA 4ZLNA 3LGRA 3DRRA 3A22A 2IC1A 4DOUA 1JLEA 3AJYA 2RU9A 5D0HA 2WNUA 4WBBA 2VZ3A 5CNAA 1FERA 1SL1A 4Z92B 2Y34A 3EBRA 5ANQA 3PTWA 3QRQA 4XFHA 1SFYA 5I8TA 2IYGA 4E4ZA 3EJMA 1LECA 4HHHA 4DV4F 3VBOA 5A0YA 3M3OA 2RS11 2RKIA 4LORA 2QIFA 4LBQB 4K4UA 4XFCA 3MR3A 3RQ0A 1VJWA 1F9HA 2H51B 3D67A 4J6GA 4I67A 1YNAA 4ZPAA 3Q8UA 4TLGA 3BF4A 4CTEA 4CZCA 2HJIA 2XBO1 1X8DA 1W6NA 2F40A 2JE9A 2E6VA 2MHFA 3ZYBA 3POSA 1GZWA 3M8PB 4NR1A 3NOGA 2NXJA 1LEMA 4XUOA 1HW5A 1S0VA 3UV9A 1AR83 3IB3A 2VONA 2HRYA 2Q6CA 4NWWA 3EVWA 2QVSB 1YG0A 4LR4A 3QJPA 4HKWA 2BJEA 1QJEA 1QQP3 3HHEA 2XM3A 4J9OA 1SKSA 3SQGA 4NJ4A 4XVHA 3WDVA 4DUTA 1POV3 2C2EA 1Q5OA 5F9NA 5LB6A 4P9JA 1WF0A 4MGIE 4FP2A 5L9NA 5H9EK 3CU7A 1HXS3 4N8MA 1Q78A 4DL7A 3UWTA 5KFDA 4LMZA 3D4JA 1STMA 1FRHA 2VM9A 3D7SB 2HKEA 1Z0HA 4RFT0 3C15A 3LGHA 2WSEC 4B4RA 4DV5F 2C6SA 1QJU2 2XI2A 3ZM8A 3KT7A 4WM7B 2DGSA 2Q30A 1V6OA 4NPRA 3BH7B 4ERDA 5HCFA 2WZR2 3R5JB 4YR2A 1HXS1 3AKPA 3LFIA 2R8JA 2IWGB 3HVWA 1EX8A 1QSYA 5DG8A 1QAIA 2MPFA 5LXYA 4P02B 1H73A 1CAVA 1S1UA 3UNYA 2ZH1A 3IZOA 3ZNUA 2FHKA 4AGGA 3ACGA 1VIOA 2QG9B 4A7ZA 2HBQB 1URRA 2EAKA 1X4EA 4H4OA 4CT9A 4RR3A 1OLRA 2FHMA 2LUWA 2ZX0A 2YBVA 3DPRC 5JXSA 3DL3A 3W66A 2Y1RI 2XMKA 3I0SA 1Q86T 4CEYB 1RHKB 2QNKA 4JV5F 1ZS6A 3KGLA 1VS3A 3IMQJ 3IRXA 1NBEB 1SUQA 1FESA 4QKFA 1F35A 3WD5A 2WFF3 3LPYA 3ZTOA 3AMQA 2E7WA 2PTMA 3MD3A 4K4WA 5FPLA 1B64A 4M0HA 1RT5A 4ES3A 4XFGA 2YWKA 2PFWA 2R3VA 1SIWB 5H9QA 3AZWA 4AOCA 2Q4SA 2QQIA 4M5IA 4UY8T 3CCSS 3EMTA 3VZKA 3HO1A 1OBNA 1UO9A 2W52A 2XMLA 4EQVA 5IAXA 4EEYA 4K3UA 2GQQA 4CLZA 2D6KA 3BR8A 3HX9A 2DXFA 4UUXA 2V5DA 3TVKA 4HONA 1JS9A 4X8NA 2VPXB 1PCAA 1E6VB 1U1RA 5G05L 2VBXA 2NYYA 1MS1A 1W8UA 2CZ9A 4EBDA 2UUCJ 1TMF1 7FD1A 3PW5A 1JLQB 3KLEB 2QL9B 3R5GA 5KT4A 4U6PA 2O66A 4A3XA 1WA4A 2YC2A 3BDPA 3K77A 1TV6A 1UOFA 4RW4B 4NZ7A 4OYUA 3UJOA 4B1LA 5GZGA 3Q8QB 1L7RA 1YRUA 3PO4A 3NCRA 1HNIA 4PIZA 3ISZA 3SEOA 4MK9A 3JCIA 2RHQB 3H40A 2K0GA 4OJ1A 2CG8A 1NPKA 3QLQA 4QPTA 2Y6JA 4XW3A 3GPAA 5IW0A 2D3SA 1TME3 1ZPVA 3A7QA 4UW2A 3HJVA 5KFYA 4Q26A 1IS5A 2RV9A 1U1KA 4F67A 5J09A 1ZAXA 1OY6A 3OUIA 1RAIB 2KO1A 3M7VA 2J1VA 5FR3A 5ACA2 1S4EA 2YPZA 1W3VA 2FZKB 3DMJB 1WSVA 4QB2A 2ERRA 3J80U 2GIFA 2OTLS 4DV2F 1IR2A 1BJQA 4DR5J 4FKYA 1RUC3 4WPAA 1HBUB 2HBTA 2W9BB 2VOTA 2A6YA 4IO1A 3Q8BA 3KWVA 3E5UA 5I0TA 2LQ5A 4X84A 1OH3A 5J1PA 1LV5A 4K2XA 1SKRA 4Y2MA 3MM5B 4ELUA 4WKRA 2ZHLA 4R9DA 5TSWA 5L38A 3MCMA 1V9U3 2CQPA 2WVEA 3Q0AA 5H1SV 4JQRA 1B7YB 2V8HA 2IDLA 4HLTA 4NLQA 2G2ZA 2RF2A 4CCKA 2ZH4A 1TTHB 1X4AA 5FZBA 2DVGA 2C4XA 3EO6A 1MEC2 3H7YA 3EGVA 1A6LA 1FRKA 3W3SA 4QXHA 4Y2IA 1ZA7A 5ACA1 1KOHA 2EXUA 2MKCA 2EKNA 4DR5F 5L1LA 2FZCB 1Y9GA 3WG2A 2IXJA 4GMP0 1ZH5A 2MKKA 4RPFA 3I82A 2VXRA 4AD6A 1D09B 3AL6A 1YIJS 3CJ0A 3CQOA 4UFHA 4KQZA 1H2UX 4AFCA 4CCDA 4BZ4A 1HN0A 1ENSA 2OD4A 4J1WA 2DNPA 3KT1A 3ROUA 3TUPA 3K5LA 2R7SA 5IZHA 1ODNA 4OQ9A 2DY1A 5KTQA 4GMP1 5IAVA 4XCAA 3RZKA 5T52A 2XY7A 4GALA 4RW7B 5JZGA 4ITCA 1OY9A 3I31A 2C26A 3RNSA 5KC5A 1O6UA 4YP3A 3W21A 5E88A 5A32A 1F5BA 3HQXA 4Q5VA 2QO3A 3KQ4B 4HT1T 4UOCA 2RR12 4J37A 4FFFA 2Z79A 1PX3A 1EUTA 3GIJA 5T55A 2C2RA 2N7YA 4YZ5A 1R1A1 3MEKA 4RQPB 2ZGQA 5H9FK 2J9EA 2VH9A 3HN1A 3GHNA 4YM0A 3FC9A 3U27A 1JYNA 5HPOA 2HGMA 1EYBA 1BEV2 1SJRA 2K3IA 3PKMA 3ILNA 1ZPWX 4IL7A 2HFNA 2FZ2A 2BMBA 3AM2A 1EQ0A 4AHWA 2CAUA 4FTEA 4OYIA 3NS6A 2IXLA 4DG1A 2F4VJ 2RT3A 3FWEA 1A7GE 3S0MA 4A7KA 3GSDA 1UW9A 2DF7A 3LQVA 4E8UA 1D9FA 3CIZA 5E3PA 2D74B 3I2FA 3NV3A 4BM8A 3VHQA 3VGIA 3QD6A 3K5PA 2UXBJ 5FK7A 3GIKA 2H4YB 1VC6A 2ZZTA 5AVPA 2VQAA 4ES1A 2IJRA 5G0RA 1H6XA 3VAJA 4DV1F 1W9TA 4HMZA 1X4CA 2K3KA 1QSSA 1CAXA 1K5JA 4YPJA 4K4ZA 2QLBB 4TLRA 3O3LA 5F3ZA 2G2OA 4IGQA 4MFBB 5KAKA 1I94F 2WVDA 3WIUA 1VBD3 1PBUA 2CL2A 1V3SA 3FFQA 5FZLA 1LK7A 1RT2B 4AR2A 4DPNA 2QUOA 1HNVB 4RGAA 4OX6A 5JOXA 4ZN1A 4S2DA 3CMAS 1W39A 2BRLA 2M8DB 4FXWA 2Q8CA 4RQPC 2RHPA 4G65A 4XE9A 4ELVA 3PIOQ 5F8HA 3ZDSA 2Y6HA 1IOAA 1HB2A 3POBA 1FNOA 3TEYA 2BKPA 3KV5A 5JZGC 3RUBL 2RQCA 1ZTWA 3I3BA 3DUIA 2ALYB 4CP1A 2HS4A 1HQUB 4D6SA 2BVVA 4L74A 2ZGMA 1QHDA 2FJVA 4YB6A 2HBUA 1FX4A 4P5HA 3WDYA 1NMEB 3C2PA 1UY3A 4YSFA 1PAEX 4G6VB 4WZCA 4CDUA 5F37A 1S9EA 5DETA 2WA4A 2HKXA 4PI2A 2WSUA 4FP9A 4W4MA 4NIAA 1T05B 1KS5A 2G9GA 4BQ3A 9ATCB 1ZRFA 4LR8A 4CCJA 1JXVA 2RKIB 1QAXA 3G4SS 4XZUG 3JSMB 2C3YA 2UYAA 2AP6A 1MMDA 4RHV1 1BQMA 2W8KA 3ZN6B 2Q5TA 2V8GA 1MROA 3VVTA 3MHYA 4U7UK 3MDPA 3DRSB 4LVOP 1I1EA 2OD6A 4DR1F 2QQLA 2PLV3 4ECZA 1SJ4P 2A6MA 1D3WA 2HFUA 2DTWA 3U02A 3KMHA 2YNHA 2WONB 4ENOA 2HHQA 4DS0A 3ZR6A 2O0OA 1NXIA 2W2PP 1RUC2 3PJ9A 3UR3C 2CJYB 1T05A 1RT5B 3U7JA 2XB2D 2G2YA 1KQRA 4JI3J 4IETA 1I6XA 1VMJA 3ZC4A 2D3OR 3JBG1 4RUCA 2J7MA 2XVGA 2C3MA 3PHEA 4LRCA 4BMBA 1C0TB 5EGYA 3HSDA 1W2IA 4RR5A 3SXLA 2DVAA 5IFTA 5L8RC 1WA6X 3V81A 4HDGA 1DAXA 1PO23 2F7VA 4ZCIA 1HDKA 4F4WA 2A1BA 3CC4S 4IDKA 2QQVA 3MPDA 3PTYA 2ZWOA 1S79A 2RM23 1RTVA 3CF5Q 5KG1A 1KSPA 3DLBA 4DPYA 3WUDA 1H1AA 5KFTA 3WBZA 4FP3A 3E01A 1W9YA 3C3VA 4FFHA 2WLPA 1BHNA 2LLZA 5I42A 3M8LA 8AT1B 1MVEA 3IIIA 3TP2A 2VD3A 3ZYFA 3NLCA 3H4DA 1UX6A 4K6BA 4CP0A 1RC6A 2KJWA 4QX5A 2ZS6B 1V6HA 1HD0A 5EXOA 4HT5A 3HVTA 2O67A 4J1XA 1M1GA 1OPOA 3Q8YA 4MUVA 3OYWB 3CCZA 2C1EB 4QPGC 1W8OA 2ARCA 1KVIA 3OL6A 3AZZA 3RBXA 2JECA 2XOMA 2MZSA 4L2NA 4MMOA 1RT6B 1RGSA 1QY7A 3ILRA 4XQ4A 4FPEA 4BCUA 2DBNA 1VRUB 2RMU2 2HVEA 1NK8A 3IAPA 3A21A 1SBRA 1HD1A 2IIHA 2VVFA 3CD5A 1N36J 4NZ6A 4LREA 5I0SA 4HSLA 1JLEB 5CFDA 3MM6B 2W7OA 5GADI 3WUCA 1VQNS 3W60A 2IZWA 2AR6A 3THDA 2G9OA 3ZYHA 2ZTNA 1F8VA 1RE1B 1D4M3 2E5JA 4NIDA 4F7ZA 3EZOA 2ZJPQ 1E5HA 3CJIB 1O8BA 3EX7B 3I4IA 3MW4A 1UPPA 2MQ8A 1T3NA 3LP0A 1XE0A 2MZRA 2O3DA 5G4DA 4LITA 3CDAA 1I5PA 3ST7A 2YNGB 2KVQE 5B0GA 1VHIA 4R9BA 4LF5J 2BTVC 3RYKA 4H4KA 1WCKA 1FXZA 3DGTA 2G13A 3ZTRA 1PMIA 1AX0A 1QJHA 1CONA 2UWAA 1U26A 5FYYA 3NL0A 5C9AA 3THVA 3NNJA 4TTGA 1S0OA 3ZFFA 4ZU7A 4MOAA 4L3NA 4WJBA 5B7WA 4YS2A 1B09A 4NLGA 3QWPA 3KK1A 4I0AA 4P08A 5A7WA 3U37A 2D6NA 1JU4A 4JI0F 1FNZA 4BQ5A 3WP5A 1KEKA 3KDNA 1CQNA 5L7OA 1S10A 1XSRA 2MEV1 1FNMA 4FYDA 5JR7B 5ETNA 1QLNA 3PW4A 5FPAA 5HMXA 2W4DA 2E5HA 3DDNA 4BC7A 4USWA 3OJSA 2OPQB 4IV3B 1IUJA 1NAQA 4XDCA 4I0WA 3SKVA 4NUBA 2JJ4D 1WCDJ 1NA1B 3K46A 1NH8A 4NE9A 3K5OA 2VULA 2CAVA 2W4PA 2RS31 1IWGA 3GLJA 4LOSA 1N1TA 4YUDA 5ADZA 2RE9A 3ZZ0A 3GFXA 5HVFA 3OVBA 3G8QA 4QHBA 2RR13 1YJLA 2UVUA 2VVEA 4AI9A 1C0TA 3C7GA 4B1MA 2PFFB 2P4EA 3HVDA 2XLIA 2FY1A 1AFIA 1SJQA 2WAOA 1YJ9S 4FPYA 2P9GA 2PMWA 2BQ3A 1VQ8S 1WI6A 4LBQA 3KT4A 3UNPA 2BNMA 1EETA 4L99A 4RS5A 2ZVIA 4HSJA 4ED1A 4B9NA 3CHXA 2HHXA 2GMHA 1SZBA 1WD6A 3NNAA 3OTEA 2FVSA 4EK2A 2XLGA 4QX2A 3VHPA 4WBFA 2LYVA 4ED5A 2ZGLA 1LODA 4JTNA 1AR81 2DR8A 3LA3A 4ED4A 1W6OA 4UQTA 3CIHA 2L3MA 4DX5A 5HMYA 4GH4C 1RUOA 4XFFA 1L7LA 2VBWA 5SV8A 2VZTA 3OD4A 4ZPBA 5DG2A 4CI0B 3TEZA 3IAM9 4ZS6A 4Q4W1 1H9PA 4E8CA 4WIQA 4Y1UA 2VG5B 2YY3A 4X6QB 5HQMA 1RYYA 4JKMA 1AXYA 4IQPA 3ON7A 5GAHU 2B3TB 2HH9A 4ZONA 4OHYA 4XEZA 2PLV1 2YWHA 1XBFA 1E6VA 3ITQA 1XYOA 2WJSA 1OPMA 1FKAF 5DUUA 3HK2A 2UV8G 5FZ8A 5LM7E 4KY3A 1GQEA 1J5OB 3P49B 4KI5M 3M2VB 4JCKA 1YK9A 1V00A 4RJVA 3OT9A 2ZGKA 4IEVA 4DMZA 1YJNS 4B9VA 2CJBA 1DG6A 4NXNF 1JW6A 3K7RA 3F0NA 4PWWA 2R041 1KRPA 2NXEA 5JLVA 1PJ6A 2Q1MA 3T4HB 1RUG1 1WMDA 2JKXA 2EFGA 4NLPA 3R5CA 4LSNA 3K51A 3D0JA 2W5FA 3IMMA 3ZFEB 2HWTA 5F8JA 1HB3A 4M5LA 4OX9J 4YEAA 2RS32 4E4SA 2ZOMA 5KHGA 3P5BP 1GFF2 4M95A 4X4TA 1G8WA 1FNYA 3NO8A 4CUGA 1F5AA 2ZH5A 4NAOA 2DVBA 1RB8G 3CPWR 1IN0A 5J48A 4DPTA 1VK8A 3MD1A 2DHSA 4DY3A 1WC4A 5ETRA 3E8OA 3A8JA 4K59A 2DR5A 3ZN4A 4ZKTB 4PDWB 1HQNA 3O1RA 3OL7A 1DFDA 2KT5A 2E31A 4MHRA 2DNMA 2V34A 1H3DA 2CPYA 1HPZB 1L3KA 2VQEJ 5C24A 1S97A 2LROA 2PAEA 2BV3A 2IXKA 5FZ0A 4GQ7A 4U7UD 2OTJS 2R49A 4A8KA 5FYSA 1REDA 1T6GC 2ADDA 1HRV1 3ZN5A 2W9XA 1ZZ6A 3W64A 3FUQA 3IPVA 1TFYA 4XF3A 2J22A 2A3YA 1VRH3 2GX8A 1ZYQA 2X51A 4ZP8A 4KGXB 5LATA 1R43A 5FZHA 2XSJA 2AEZA 2POKA 1SH2A 2BE2A 1OC1A 2F63A 3T9NA 4GO7X 2XMAA 4Y4RA 1XU2A 1OQ1A 1JLFA 2CA9A 1BY9A 4WWSA 3USUA 2VZRA 3FDSA 5KHJA 4DPXA 3SLIA 3SCKE 3VAHA 4FDFA 3HR9A 5BNNC 4DLEA 3GG0A 4X4SA 4WM7C 4CLSA 1P27B 5DLFA 2LRPA 3O1OA 2VMGA 3AZXA 3SEEA 4QM8A 1S72S 2XH6A 2DR7A 2ZA9A 5ABJA 2Z58B 1RISA 2KL8A 2ZD1A 1O4YA 4ATFA 3MF6A 3ISND 4RQPA 5FWEA 1YVFA 1UKGA 5C3PA 4AQTA 5A1LA 1ND2A 3B94A 4NLDA 3US5A 4IV3C 5KT6A 1UEKA 3ABZA 4FF4A 4C0OC 5A3TA 5CXTA 5C33A 1Z7S1 1OWXA 3GYGA 4ECYA 3KHBA 2CPHA 2AYGA 1RACB 3ZZRA 4M5DA 2WC2A 2W3JA 2NLWA 3BGRB 2E63A 5D8AA 5EUHA 2DFCA 2GNKA 1GZTA 1L3SA 1UN1A 2QTWB 2VNRA 1LWCA 4YVWC 4PHZA 4BK5A 4Y5Z0 1ENXA 3HHNB 5K14B 2C2DA 4ANDA 1TAQA 2FHRA 1H8TA 5KXBA 4QQPA 4NPMA 4ZVEA 3TEHB 4N43A 5C3SA 3SFGA 3T1HF 2XPJA 3NBPB 3PDNA 1YLLA 3EYZA 5IVEA 1A8MA 1ZZ7A 4QKDA 4JI1J 2V2ZA 2AKWB 4DR3F 3QJLA 3AVRA 4DV6J 3SHRA 5F1RA 2GNBA 2FJWA 1ZAVA 3QMQA 4PKDB 2CZVC 3QT7A 2LCWA 5J2QB 3PMSA 4NXNJ 4ZITA 1PGZA 3IAQA 4CLWA 3OTCA 1F6TA 2OPPA 1CR7A 1CAVB 2B4PA 3CDWA 4DUYF 3PL0A 2OGUA 3KB5A 1YZ7A 3H0PA 4OLOA 4QGMA 1N1VA 3FEYB 4C90A 2EW9A 1VBC3 3GB0A 1FPN2 1FRMA 4ZVQB 1S0CA 4DXSA 4BC9A 3B4DA 4WM7A 4Q0PA 5BNOB 1XYPA 1OPZA 2JLGA 2KRRA 2PMWB 1AJKA 4XAAA 4OX8A 3KLEA 2C2MB 2ZZJA 2VZPA 5FYZA 1JJ2R 3CJIA 4OZXA 3ZOIA 3OTBA 3BGUA 1M1KT 3FSXA 1AR63 1PHMA 3M6UA 2PQSA 3CDZB 1R0CB 1ZZBA 1P1LA 3IIAA 4BYYA 4P9WA 1WCQA 1VFJA 2IM2A 5C3QA 4FXDA 2UP1A 2G0JA 2DCLA 4A8YA 3G6ES 2HEWF 3OTOF 2VUGA 4HETA 1JOJA 2PLV2 1ZBE3 1ZNPA 2JDPA 4LF6F 5FYMA 2ZEZA 1LEDA 4KIAA 1M90T 2OKXA 4OJGA 4O3SA 4DR6J 1QJX1 2MQNA 2WVCA 5DQ0A 1H8VA 2GZOA 1LHWA 2E9TA 3MEEB 1O5UA 4XMAA 4X4VA 3LA0A 2DJWA 2DCZA 3U4XA 3V0AB 4OLPA 3CJSA 2A6ZA 3R6GB 1RVF2 5C25A 1I51B 4QGLA 1ZBE1 5FZ4A 1WSRA 2YGMA 4J9PA 4EV0A 4HVQA 3PJWA 3MMCB 3HIFA 2HZCA 1UVIA 1QY4A 1AW0A 3O6QA 2HWHA 4URSA 1YGYA 2N4DA 4LA2A 5CYMA 1HRI3 1AUSL 4X66F 4XXAA 4EROA 3FUYA 1QH6A 1W06A 2K7KA 1C3HA 1PYOB 2HAFA 1C1FA 3W8PA 4M1KA 2VMEA 3JQXA 1S76D 2XGQA 4PCRA 4QPWA 3H3UA 1ONAA 1VBD1 3MCNA 4LQ9A 3JD72 2TUNA 3NEKA 4K4VA 2D6OX 3UW1A 2PHFA 5F8NA 2BDRA 2XNRA 4Q4X3 3T2QA 4KNCA 2HQGA 1RT3A 4OZ2A 3BODA 1S1XB 3V6HA 3NCPA 1PVC2 3RJMB 3QAUA 3IN9A 4B4PA 4U9RA 2LEPA 2Z0GA 3D0HE 3ELNA 5LA0A 3QH7A 5DQGA 4KH1B 3WC2A 2XCAA 4ANCA 3UNGC 3H4BA 4XIKA 4LJHA 2NN8A 2EKYA 5I4MA 3W58A 3LOUA 1FI4A 2ZH6A 1G1XA 3APBA 3UCUP 3W9JA 5ITHA 1Q82T 5HMZA 4AXOA 1Y7BA 4ZHRB 4PBPA 3IKWA 2VFTA 2VMDA 4PXEA 1S1VB 2F8EX 4NX9A 1KXGA 2QV6A 4DV1J 1D2QA 1NJYA 5D3GA 4NEZA 3KQRA 4EBCA 4L92A 2OIHA 4DN9A 3I8TA 2N82B 5E0OA 4IFVA 2ZHMA 1TKTA 1DU3D 4USTA 5CG8A 2WQ4A 4YZ4A 3TZWA 2BPA2 2WFPA 4ZLPA 4NA1A 3N9MA 3C7OA 4BISA 2YQ3A 4QHOA 3NJYA 4HKOA 5LK5A 3DPRB 3OQ2A 5C7PA 4UF4A 4D3GA 2WS91 4ZVOB 1AUDA 4L76A 1AR82 2MNGA 1T9VA 4MGYE 2WIIB 4Q0VA 3MEPA 1V9OA 1APSA 4TSVA 1FJGF 4LIWA 5KFWA 1I94J 5JCTA 2C22A 1P6TA 3S5AA 3B9CA 2ZZQA 5LY2A 4QBUA 4KPCA 2DHAA 2HQ3A 1X9PA 1PO22 1EHWA 4DXLA 1PK6A 1GNHA 5FLHA 3H25A 1D0GA 1TEIA 5JXHA 2ARXA 4ZHRA 3PYFA 1HW9A 4X62J 2XTJP 4ZJQA 2MHEA 3I9V9 1PZ7A 1WD3A 4ZCKA 4FCAA 1ULDA 1WHXA 3CJ8A 3I2GA 4D3HA 4LBPA 3Q9OA 3VV2B 2ASYA 2YX1A 1N56A 3M3EA 2ILMA 1CVNA 1F5CA 4FOWA 1GXTA 3KUHA 4PWDB 2W1UA 2QQKA 2HHHJ 5ETVA 2VPVA 4ZA1A 3HI9A 4Z07A 4JDNA 5FTTC 1U24A 3UFCX 2EA7A 2NXUA 1W8HA 5KXEA 3CO0P 4AQYJ 5IS2A 1QE1A 4Q8EA 3TAMA 1MW7A 1N3QA 3HZGA 5KFOA 3DECA 1NXMA 1OT5A 4LXLA 1M1HA 1ZTTA 4F4AA 4ZKAA 3VDAA 1KEXA 3N6LA 3MMBA 4OYAA 2Y6LA 4CDWB 4C8ZA 4YR0A 3RG0A 4Y1XA 2P3KA 1H4GA 2JDHA 1OJ4A 5HAOA 2FPHX 4UI9L 1GTEA 4A8FA 3WHUA 3T09A 2DEJA 3M8RA 3RYRA 1DGLA 2JZ5A 2IJFA 3RMXA 3DYAB 3WDXA 2QJ3A 3CKHA 1PVXA 4F4YA 1AZSB 4LE4A 3MM9A 4KG8A 4Q7AA 3ME2A 4M00A 5T50A 1FKPB 4X4OA 3BKFA 1N5YB 3OGSA 4DS4A 4QHZA 2C5DA 4Y0FA 1F9FA 4LQ3A 3FUOA 3ZYPA 1SPBP 4JI6F 4CPBD 3WP6A 2BRKA 3B02A 4YM3A 4RU2A 1B35A 5GVQA 1LJ7A 1UW4A 4BQ1A 4MJKA 2BKNA 1XNRJ 4YFZA 1RUG3 4K4SA 5LSLA 2XWBB 2M3DA 1M5PC 1DQ6A 4QM9A 5EFUA 1R1A2 1U5YA 3M8QA 2L41A 1TK8A 2E51A 3I3EA 1NZIA 4CEWC 3CIMA 2XBO2 5IC4B 1T11A 2GIQA 4QCLA 2N7CA 3C7FA 1N5VA 1ND3A 2HQIA 4ZVPB 4D94A 1EP0A 1REVA 3B6BA 1SXLA 1N3PA 1U47A 2ZM6F 2QLWA 2X09A 5LY1A 1LOFA 4M01A 1WW7A 4JVAA 3M32A 4NWVA 2Q3PA 4LKDA 4AFBA 4I2OA 2AQ4A 4BXFA 2HHPA 1ULCA 4A45A 2GS8A 2CQCA 1HRV2 3IG1A 4YY3F 4YFWA 4KO0B 3CC7S 4B9MA 1I3OB 1HBOB 4IEUA 1NKBA 1U1MA 2SXLA 4RN5A 3AYEA 2FJBB 4FPFA 2KKHA 4KR0B 5CD4A 1RSCA 1CX4A 4QYRA 2E5IA 4O61A 4GWNA 3OJUA 1W0NA 1NQJA 4ICLA 4M63A 4ISQA 3VBRA 1J84A 1R3NA 5D1IA 5D0GA 4YZ3A 3ENQA 1VQOS 3I56S 2HS0A 4TLQA 3Q8FA 2IXIA 3H7JA 1NK7A 1XJAA 1EETB 1SQGA 4RNNA 3L7PA 3V6KA 3GCWA 3UR0A 3P5TL 4I4BA 3ZSLA 2KH9A 4K20A 5C8CC 2UWCA 4EN8B 4XDDA 2BOJA 2FVQA 2VUDA 4QDSA 1PBAA 3LP2B 3SZ2A 2UXBF 3CC2S 5J2PA 1AR62 3IDBB 3LPGA 4A3ZA 2W1SA 4Y5SA 4BXSV 1FKOB 4COZA 1JH5A 4GD4A 3AOAA 3T5JA 5LMNJ 4EN9B 4BOWA 1ZA2B 3B54A 1O7FA 2VZUA 2WNVB 4WFAQ 2H9ZA 4IDZA 4OZOA 4JV5J 3KK3B 5BNOA 3M9OB 1X8EA 4WFZA 1PGW2 1UWAA 2W9AA 2VXJA 2NUUG 3FQKA 2G1DA 4BPZA 3RVHA 3UJQA 7FDRA 4ELTA 1MWZA 1QOTA 4L8QA 2WNVA 4B29A 3H2UB 1WHWA 2AX0A 3ILLA 3G2XA 5HP1B 2CXEA 3WNLA 5JR2A 1OYDA 5H9RA 3K0JA 4JI4J 2QFIA 1JMUB 3OV7A 1MU2A 4KU8A 5DAXA 3V0BA 2K8GA 1VAMA 4LK6A 1RVF3 5ETLA 3D8CA 3I5BA 4CO2A 3VD3A 4QPGB 4PQUB 4J91A 1TV6B 2G1MA 1BZWA 2EVXA 1RWVB 3LE0A 4K1ZA 2O8OA 1SDDB 2RVJA 1FD8A 2BEFA 3AYCA 1JNZB 2VBPA 4I3PA 3TUZC 4NI2B 4Y2KA 4RUAA 5C5JA 4LNVA 2VG6A 2PE8A 1TUVA 4N8OA 2EIEA 2H54B 4LKFA 3KGZA 3M8QB 1VIXA 3RW7A 1OS5A 4WFBQ 3LSEA 4NHXA 3NWGA 4Y2CA 3FHIB 1FNXH 1TMJA 1M06G 1UVJA 4OI0A 3BB6A 3OGRA 4Q2LA 3H8OA 1GR3A 3D5MA 1Q8LA 3OF1A 3V65A 3MUY1 1X60A 1BEV3 4ZJOA 2VHGA 3W20A 1SV5B 2BJSA 1S59A 2KRBA 3T2TA 2VCMA 1B0PA 3LGNA 4GRSA 2XULA 1OURA 2J6TA 3NMRA 3TQ1A 1YFYA 3ETOA 3DMJA 1RUD2 3S57A 2JXAA 3NNFA 1ZM9A 4USMA 3N9QA 3DU6A 3NAHA 4QXCA 1O91A 4LHSA 3LEKA 1Q1KA 4HI2A 3PLQA 3VN4A 4CDXA 1SCSA 4J9SA 2ZJRQ 1RTHB 3PX4A 4YFUA 5KC6A 3KV4A 2VOKA 2DNKA 2J76E 4QKNA 1LFWA 1JMTA 2DU1A 2KA3A 4A4AA 1AX2A 4LO5B 2DUPA 2KXLA 1UA0A 4GWJA 2W4CA 1DHKB 3WQ7A 4QIWD 4V2WA 1FA0A 5C42A 1NCQC 1HJFA 2E1CA 3ACLA 3WV6A 5IOLA 2GP5A 3THCA 1FEEA 3M1VA 5E8AA 4K8RB 1UPIA 3JB9k 1RTZA 1L3TA 2UVRA 1CPNA 4L9BA 2PA7A 3EGWB 3DPRA 4Q4Y1 4QDQA 1KWMA 2RS51 3TWIA 1CJUB 2OUGA 5LBBA 2YNIA 1M0SA 2GC2A 2P37A 3J7Z5 1WKJA 2NXCA 3AJ2A 1CJVB 1CZSA 2ZBJA 4FT8A 2NMOA 1TFWA 3QCWA 2CQDA 4Q27A 2P9CA 4ZIWA 4R4XA 3GWCA 1ZA1B 1M5KC 3LDBA 1KLNA 2XJSA 4ZS3A 1RU1A 2UURA 3Q8RB 3PKYA 4N7UA 1VBKA 4LBJA 1VBB2 5AE1A 1EIYB 2A1XA 3CO9A 4KT0C 2X7IA 1WBLA 2WZPP 3AY0A 3EVMA 3IP0A 2VCAA 3P8BB 3KLIA 2D5HA 3KSCA 1H0HB 3POTB 3PIGA 1JLAA 3CCTA 3BYRA 3M6XA 3AMMA 4Y33A 2IFXA 5T7LB 2IMWP 1Z1ZA 3LPEA 5IFMA 1RT7A 1G2EA 4G3IA 4FPLA 3QBCA 2EFVA 3T0DA 1X4DA 3IXQA 4AE5A 2WLQA 4A8SA 4META 1SACA 3ORJA 3DDIA 1XMOJ 2VE1A 3TYTA 4P9XA 3E51A 1YTYA 1RL3A 1NUEA 2NXNA 2QLJB 3MICA 2LDIA 1IM6A 3VTIA 4MIBA 3OBZA 3N5FA 3WNNA 1YBTA 4A44A 5J37A 2Z2LA 5FDLB 3DLLQ 1D8ZA 4PT6A 2V4JA 2ERFA 2ZGRA 3FEXB 3OYWA 3IDAA 3HLUA 1RHMB 3MAAB 5A8RB 5EHHA 3J26N 2X5IB 3IM0A 1S12A 2BYCA 3AMPA 3I49A 2DVIA 5LXRA 3USSA 2IY5B 3FLRA 1MMNA 2ZHAA 1LWFA 2DIVA 2FCTA 5J96B 1UTAA 5EYXA