3THTA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
336
structure length
302
Chain Sequence
b'TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVDRRVKHFGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylated DNA repair protein alkB homolog 8
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 72
structure length 302
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thtA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thtA01
3U1MA 2DGUA 3NNCA 1A7GE 4M5DB 1KOHA 2N82B 2DNPA 4PRFA 3NMRA 2GO9A 2FPHX 1VQ4S 3CC4S 1U1RA 1M5OC 1JJ4A 1D9AA 1PO6A 1WI6A 2YTCA 1U1QA 1VC0A 4PKDB 1KC8T 3CCMS 2AYGA 1M5PC 2KRBA 1FO1A 5IFMA 2CPJA 3MD3A 5MLCV 2ZJQQ 1VQ6S 3UE2A 1FHTA 2DNQA 2OJ3A 2E44A 1VQ7S 4TU9A 2DNGA 2DHGA 1YITS 2RNEA 2JX2A 1P1TA 4WFBQ 1FT8A 3G4SS 2MZRA 2DH9A 2RT3A 2YKAA 2L41A 2FHOB 2CQ4A 2KN4A 4CIOA 1SJFA 2KHCA 4QPTA 3BO4A 1VQ8S 1S72S 3L3CA 1N52B 4IOAQ 2DGOA 2LCWA 3H2VE 1B7FA 4UQTA 2MSSA 2VONA 4Y0FA 2BZ2A 3SDEA 3CCLS 3UCGA 2DGXA 2YH0A 3R27A 3DLLQ 2LQ5A 2HVZA 2LMIA 1YTYA 1P27B 4A8XA 2RRBA 3UD3P 2LKZA 1SJQA 1WHWA 1WELA 4C7QA 3P3DA 2B0GA 3RW7A 1UW4A 5LSOA 3MOJB 2L08A 2ZJRQ 3S6EA 2F3JA 2YH1A 2FY1A 4WCEQ 3BEGB 2L9WA 1WG4A 4TU7A 2NLWA 2XNRA 2DNYA 2Q79A 2AYBA 1F9FA 1U1KA 5H1SV 2LECA 1X4HA 2M2BA 1AUDA 3P49B 2F9DA 1YJWS 3G8SA 3CCJS 3THTA 5DDQC 1ZZFA 3JB9k 2KVIA 2KG1A 1CVJA 2DNOA 1X4FA 3VF0B 5LXYA 1SJRA 1UP1A 1K73T 1NJIT 3S8SA 2QEXS 3S7RA 2FC8A 5ITHA 4ZKAA 2OTJS 3B4MA 2MQPA 1Q7YT 5HL7Q 5CA5A 4TLQA 1UAWA 3FEXB 2M52A 1M5KC 2CPDA 1X4CA 2DHAA 3TYTA 2M4MA 3MURP 2DIVA 2CQ0A 1WWHA 1SJ4P 1WHYA 5GVQA 5BJRA 3MUTP 3NS5A 4CQ1A 1KQSR 2M7SA 2CPXA 1DRZA 2KXHA 1X0FA 4YB1P 1FJEB 5GAHU 3CXCR 3UCZP 2CQCA 5CYJA 2E5GA 1DHMA 3S01A 3MDFA 4C0OC 3CTRA 3CCSS 2D9OA 2E5JA 2JWNA 2JRSA 2OSRA 2DB1A 2DGSA 1H6KX 1ZZNA 3I56S 3EX7B 1K8AT 2CJKA 3VAHA 2VOOA 2M88A 3RW6A 2YWKA 2KM8B 3UD4P 1N8RT 1VQKS 3MI7X 2D9PA 3B4DA 3G9CA 2MJUA 3ULHA 2DNNA 2M8HA 2RUGA 1VQ9S 1U2FA 2AYMA 2M0GB 3OW2R 5FJ4A 2CPYA 1G2EA 2AD9A 1Q82T 1JJ2R 5HO4A 1U6FA 1HD0A 4QU7A 4CH0S 2OSQA 2KG0A 3IRWP 2U1AA 2G1DA 3D2WA 1VQ5S 2HZCA 2MKKA 1X5TA 2DGVA 2MHNA 1R8HA 4U67Q 2CQ3A 2MKJA 4LJMA 3SDEB 3THPA 1FJ7A 1M1KT 1YIJS 3MXHP 4YUDA 2DO4A 3G96A 3LPYA 2X1AA 4WFNQ 2MKHA 4F26A 3CCVS 1DBDA 1RKJA 2MKCA 5DDRC 3TO8A 5JVGQ 2HGNA 1VQOS 3VAJA 4OZ1A 1FXLA 5DM7Q 1OPIA 4F25A 2MQLA 3VAMA 2CQIA 1WF2A 1IQTA 2MYFA 1H2TZ 2HGMA 1KD1T 2KXFA 2DITA 5DETA 1D8ZA 2J76E 5LJ3Y 3CD6S 3CCUS 2U2FA 3VAIA 2CQHA 2M8DB 1X5OA 2EK6A 1JJHA 2LEBA 4YOEA 1U6BA 4WF9Q 2MPUA 2LXUA 3EGNA 1YJNS 2K3KA 2DHSA 3G8TA 3CC7S 1WEYA 3CF5Q 2MZSA 2KU7A 4ERDA 2MZQA 1U1NA 1N88A 3MUMP 1QM9A 1WHXA 2VOPA 3CMES 2DH8A 3CUNA 1FJCA 2CQ2A 2NZ4A 2RQ4A 3UCUP 1VBZA 2G4BA 2EVZA 1QVFR 1X4BA 1YJ9S 2I38A 1X4EA 1W2BR 2MMYA 2E5HA 2KYXA 1YHQS 2KRRA 3CCES 4WKRA 2PE8A 2LA6A 3K0JA 2I2YA 2DGTA 1JMTA 2CPIA 3BO3A 2RRAA 2RS8A 2XNQA 2CQDA 2DNZA 4OZ0A 2LYVA 4ED5A 4Z2XA 2ERRA 1VQPS 5DM6Q 2DIUA 2HYIB 2QA4S 2CPZA 5JVHQ 2KXNB 1X4AA 2DH7A 3I55S 2ZJPQ 2XSFA 3CULA 4EGLA 3DXBA 1WEZA 3IWNC 2CQGA 3ZZZA 3HI9A 2LXIA 3NNHA 4V19X 3ZZYA 2MZTA 4FXWA 3UWTA 3U1LA 2KFYA 5DDOC 4IO9Q 3N9UC 2CQ1A 1VQLS 2DHXA 3Q2SC 2F9JA 1YI2S 1U1OA 1U1PA 2E5IA 4FXVA 3VAFA 2DNMA 4Y00A 4CH1A 2MQOA 1H2UX 1OO0B 4QU6A 3PIOQ 3US5A 1WI8A 2N7CA 1NO8A 2DNRA 1SJ3P 2MGZB 2RQCA 2MGZA 1SXLA 2DK2A 2LEAA 3H2UB 1HL6A 2HGLA 4IUFA 2XS2A 3VALA 3Q2TC 3SXLA 2DGQA 2MQNA 3P5TL 2A3JA 2CQBA 1RK8A 2PEHA 2N3OA 4QQBA 2G0CA 1S79A 2KH9A 5CXTA 5IQQA 1OWXA 2QFJA 2FC9A 2DGWA 3CPWR 5GAEU 2CQPA 2J0QD 2MZJA 1VC5A 2RS2A 1QVGR 4LMZA 2MY8A 2JVRA 4J5OA 2O3DA 4RU2A 4UY8T 4W92B 1U1MA 3MUVP 1WHVA 3MD1A 2UP1A 2JVOA 1A9NB 1WG1A 1Q86T 4BS2A 3FEYB 3P6YC 1O0PA 1VQNS 2X1FA 1WG5A 2GHPA 2SXLA 3R1HA 5LXRA 3CMAS 4TU8A 2V94A 5GADU 1PGZA 2M70A 3R1LA 2BOPA 1K9MT 2ADCA 4F02A 5DDPC 2MJNA 3VAKA 5IM0B 3HHNB 5IM0A 2XS7A 3NNAA 1UFWA 1XN9A 2MY7A 2XB2D 1FNXH 1U1LA 2VODA 2DNKA 5LJ5Y 4IOCQ 1X5PA 1HA1A 2DISA 2KM8C 3BS9A 1VBYA 2RVJA 1Q81T 1VC6A 1R8PA 1X4DA 3V4MA 3NS6A 5LSLA 2MQMA 2MKSA 2LA4A 2D3OR 2J0SD 3TP2A 1URNA 1HD1A 1VBXA 4WFAQ 4P6QA 2OTLS 2MXYA 2X1BA 2CPEA 2MB0B 3SMZA 5D77A 2DNLA 4C4WA 1BY9A 5EN1A 3G6ES 2MKIA 5D78A 5GAGU 2N3LA 2ADBA 3BO2A 4WIIA 1ZH5A 1DZ5A 2DNHA 4W90B 1WF0A 3J7YU 2OIHA 3CCQS 2AYEA 1WEXA 1N54B 1M90T 3J7ZT 2MZ1A 2X1GA 1WF1A 2KI2A 1L3KA 3CCRS 1OIAA 1YWXA 2J8AA 1VQMS 1X4GA 2RU3A 2MSTA 3EGZA 3VAGA 2WBRA 2K8GA 2CPHA 2DO0A 3PIPQ 3G71S 1KOOA 2MQQA 2EK1A 1X5SA 2CPFA 2M9KA 1M5VC 1NU4A 2KT5A 4PR6A 4LIRA 2XS5A 5GMKa 1H2VZ 3LQVA 3CC2S 1WTBA
chains in the Genus database with same CATH superfamily
3PUAA 5D8AB 1VBKA 2PHLA 4ZITA 2X3GA 4URGA 1FRXA 5LBBA 2GZOA 4LF5J 1P6TA 2BV4A 5E41A 5J2PA 4DZ6A 1O5UA 2FTRA 2ENRA 4BPZA 3AYAA 5FV3A 1N32F 2RIJA 4PIYA 4RHV3 2ZHOA 5CEHA 3U27A 1ST8A 2RKIA 5HV0A 1HBMB 2RT3A 4BA6A 3IBCB 1F8VA 3L95X 2BQRA 3M2MA 1SJFA 2A6OA 1ZBE2 2H54B 3D0HE 4OMCA 4YVWC 2ZBIA 4A42A 5SZTA 5CKQA 3SEPA 3BREA 3IIIA 3H7YA 3FFIA 4NLQA 4QZVB 5CYQA 3J80Y 2DDUA 3OQ2A 1NAQA 1SJQA 2RU9A 3PG9A 2XSJA 4M95A 3SV4A 2GHVC 2BE2B 3PR4A 2A6MA 4A7ZA 1RUJ3 2RHPA 3C6UB 4DL5A 5CIRA 4NLYA 1MS5A 4XE9A 2ZKNA 3GHNA 1N48A 1QXRA 1OY6A 2Q8CA 2XO6A 3ALQA 2FJXA 3A23A 1U1KA 1GWKA 2XL7A 3RBZA 2YV8A 2ZABA 2E29A 3DOKA 3MR3A 4V19J 5BNOC 1XNRF 4GKKF 4ZJOA 4RNFA 3QJJA 3HD1A 2DFCA 3BIEA 2WCXA 2KT2A 2WNVB 1I5OB 3I9V9 3NY0A 5LXYA 3FDSA 3TN92 2CWXA 3VBOB 4DR1F 2QEXS 4HL0A 2NZ9A 2O1PA 2ZHNA 5EJ3A 1H0HB 4YZ2A 4U7UK 1F60B 3NCRA 2CJ9A 5JXSA 4QGNA 2ZUAA 4Y22B 2ZC4A 3LIGA 3LP1B 3FBEA 1W8TA 1LW2B 1KQFB 2PI4A 4IV1A 5C2CA 5FY0A 5FLXU 1B0VA 4PQ9A 2VUAA 3NVCA 3MUTP 2QCSB 1QDOA 4QPIA 4WKYA 4DU7A 2XCAA 4HDGA 4ZPCA 2YNFA 5B4NA 3H0OA 1IG3A 3CXCR 4KQZA 1X9PA 3I3MA 2XJVA 4UW2A 4G1QB 1STMA 2JWNA 3MAHA 4WTOB 3D1HA 4K7QA 3UT0A 4RW8B 2ZNYA 2XLAA 1Q5YA 3HR9A 2J6TA 3UN2A 3UL2A 5FYVA 4OHYA 5LZ6A 4CLKA 4USKA 1NXIA 1OH3A 1MVQA 3TBDA 4C3LA 4EEYA 2LRPA 2AU0A 2IBOA 4Y1VA 3N7KA 1F5BA 4ET7A 3BKUA 3NV3A 1I94J 4FPYA 1FXZA 3D2WA 1YJRA 2VMIA 2RQKA 4GWIA 3IM9A 3S6PA 4AVVA 4QX0A 3SDEB 1W2NA 1N1SA 4NJ4A 3FLTA 2QYGA 4TN2A 4LR7A 4DS5A 4UTGA 2VQEF 3AB4B 4JI0F 4CTAA 2I9SA 1IS5A 4LPLA 5FO7B 2OEJA 4LT6A 5JVGQ 2HHSA 1FRLA 4AT1B 2VUGA 3MPBA 2QV6A 5B0GA 1TAUA 2CQIA 2FGOA 3RAMA 1EY2A 4AUKA 1WMXA 2C2EA 2Q1MA 5K0UC 2WOMA 1LWEA 1S0CA 4Q45A 1TU0B 5D8HB 4J9QA 1NLSA 4XUPA 2LM3A 2R16A 4YZ3A 4E4SA 1DTTA 4LBMA 1J5OA 4X6QB 2WW8A 3O3LA 2DHSA 3Q8AA 2E5LF 3CF5Q 3OJSA 2MZQA 1YQ8A 2AREA 1G9CA 5KFYA 1HNXJ 1VB4A 4KU7A 4ISQA 1X4BA 2EIDA 3PHEA 4L73A 3GGLA 4AAXA 3HPNA 4OLLA 4WKRA 1ENQA 4MK7A 2IYGA 5CB7A 4DPOA 2NXNA 2VMFA 3NWGA 1YSJA 3IBFB 2EFVA 1KITA 1HRI1 5CBLA 3MGJA 4GVBA 5D3GA 4GH4A 4YM2A 3HNBM 1ND3B 2NM1A 2HYIB 3ZXGA 2HNZA 3OBAA 5KT7A 1SZBA 2NMNA 1FXRA 1VMJA 4JGZC 2HQGA 2XI3A 4BCUA 3D1OA 1GMUA 2XMVA 2YG0A 2BVBA 1A78A 5M2PA 1DURA 3A0KA 1PM7A 3EBRA 2YBKA 1V6HA 2Y34A 1K3IA 3D28A 3FBFA 3N9UC 3J9SA 2E7TA 4CH7A 2F9JA 1QJX1 3NGRA 2B7BB 3P6BA 2D6LX 2NCKL 2MQOA 3G8QA 4WVVA 2QE3A 1NDKA 3K5LA 2ASDA 2O0OA 2C2DA 1CIYA 4B02A 2DXEA 2QE5A 3IAM9 1KEKA 2UUBJ 2MGZB 4JYAJ 5F9NA 4QW9A 3CDZB 2Y60A 3QATA 4WTYA 4O4RA 1X8EA 2FLOA 4RZRA 2XS2A 2GMEA 3AMNA 1IKPA 1NY71 3B9IA 4ZVGA 4IRKA 4HKQA 5IT9U 1HXS1 3R2CJ 5LOQA 1OWXA 3WQ0A 1SL1A 3VGTA 5I42B 5LRRA 5K8NA 2RS2A 5ANQA 1X9MA 2ZH1A 4J5OA 4Y5Z0 4P14A 1YBTA 4JGYC 4XF3A 2NXCA 2HEVF 2YROA 3MLJA 3VV1A 2VG6A 4OJ1A 3MD1A 4DCJB 5J1XA 5CKNA 3SSQA 2GP3A 2XJPA 1N6QA 4P52A 4EBCA 4XHXA 3GP9A 3ZZOA 3IFEA 3BOWA 1OS5A 2X1FA 3M8QA 4Y2CA 1WCDJ 2D44A 5J3UA 3PRVA 4FXKB 3AYEA 3T0BA 3GMGA 4DL3A 1FOD2 3BGAA 1GK8A 1PJ7A 2Q1FA 4JZRA 2BBAA 4IDKA 4HZFA 2WNUB 2GN7A 2X7IA 3PU8A 4BXFA 1REEA 2PXJA 3L9JT 4K50A 1WMDA 3VKLA 1Y3JA 4NLRA 2VQUA 1UCXA 4F4YA 3KKFA 3PO5A 3M3CA 1DTQB 3O8WA 1D4M2 3CL1A 4QU2A 2ZHMA 1YRUA 3WCRA 3BGUA 3BJYA 3PUIA 4J9MA 1LRHA 1HI8A 1S1TB 5DG1A 2QZ3A 3QT6A 3VDDB 4IEQA 2RUSA 1C0UA 2OTLS 5CG9A 3CEDA 1OSGA 2UUTA 3HOBA 4PWDB 1HWLA 1BY9A 3W21A 1RUD1 4K4XA 4K4YA 2E7QA 2ADBA 1RUF3 3DHWC 1I6XA 3ACLA 4TVAB 5C8CC 3T2PA 2DVIA 4AQ2A 5E3PA 3KLFB 3V4IB 4UF0A 1M5HA 1RINA 3HDSA 2VG9A 1OIAA 4BLIA 4LBIA 1HMVA 2RU3A 5B0DA 4QWNA 3C66A 2FJDB 3ILFA 3ZYBA 3VN4A 4CNYA 3GJSB 3JBG3 1REFA 1HR0F 3EVMA 2OPSA 3BSAA 2FMYA 1JLEB 2Y6JA 2C9AA 2AGQA 5F3CA 1UZVA 5B7WA 3CC2S 1WTBA 4RS5A 1PYTA 3MEKA 4O4GB 5HVGA 3NMRA 3DMJA 2N7GA 1FKAF 1D9AA 3H3LA 1IPJA 1JX4A 4DY5A 2NYIA 4B3OB 5F0WA 1W8OA 1A6CA 3VDAA 1FDDA 3J26N 3ZZ0A 4CLLA 2ZDPA 1CJVB 1SFYA 5EIYB 1NLQA 2HZVA 2YKAA 2WZ1A 1U2RA 2FZKB 1D0GA 3BODA 4FOYA 4XZPA 2WK4A 3ZFFA 1LWCA 1MMLA 1QF3A 1AYN1 4CEWC 3GDBA 1SLAA 5JSRA 2OQ6A 2DGOA 2KKHA 3M1VA 3H5UA 4UQTA 5DZ6A 3JAMY 3WW4A 1YBAA 5A2QY 3I2FA 1TZOA 2R49A 2P6SA 2GIFA 2VZ9A 4I09A 1OA3A 2LMIA 5IVVA 3V6HA 2VKZG 4XPCA 1WHWA 3K48A 1FD8A 3P3DA 1TKXB 5C7GA 2YQ0A 2VL4A 3N3HA 4FZVA 3HQRA 4NRPA 4OZJA 4WCEQ 3THVA 3FBCA 2Y8KA 4QW8A 2HK2A 1GNYA 2HQCA 5GZGA 3RZMA 3CJ0A 1H98A 2QL7B 2Y6LA 2FHJA 3G8SA 3CCJS 4FOVA 2XWBB 4ZS2A 3DDIA 2WYSA 1PX4A 5C25B 4RUBA 1S0NA 1CC8A 3CF6E 2A2DA 3UR3C 2QJ3A 1VAVA 5L7OC 1R092 2R7UA 1Q8LA 2VTXA 2HLUA 4N8MA 3B4MA 1DGRA 2LU2A 4ECYA 5HL7Q 3M3IA 3FCHA 2DPJA 2KR2A 4IH5A 4A8FA 3OUHA 3I7DA 1AR71 1HQUB 1IBMJ 2IXIA 1WWHA 1VBC1 2EIGA 1ZM4A 3CSKA 4DS4A 5A32B 1QEXA 1RC6A 3SCFA 2M7SA 5JZGA 1OH4A 3KHRA 2CJAA 3LW5C 4Q43A 4Q4X1 5GAHU 2F1FA 2XEXA 3LPGA 2Z79A 2YZ4A 4JI6F 5F2WA 1JLFB 3IMQJ 3DYMA 3SQGA 3T2OA 1C8M2 2VC9A 1GFF2 2ARAA 1H6KX 5LL6d 2W9CB 1VRTB 2EXUA 4H7MA 4M0HA 2VR4A 2XMJA 2GVZB 5JR7B 4GZ9A 2VMHA 1RWWB 1G9DA 1IR2A 3B4DA 1QTMA 4JI3F 1GUIA 1D8YA 2B4VA 2MJUA 1MLAA 2VG7A 5D15A 1VQ9S 2O8QA 4OLPA 2J7WA 2VTXJ 5JSOA 4M1KA 1EIYB 3N01A 2W1QA 2UUAF 2J9EA 4WM7C 3IRWP 1GMWD 3TN93 1UETA 4DF8A 4JI8F 1JYIA 4AK3A 1GNKA 2VBBA 5J1EB 4FF2A 4GB32 2ZX2A 3EM1A 3DPRC 1CS4B 4P2XA 2V5DA 3OHAA 2E9QA 4CDXA 1TQLA 5ETQA 4N41A 4YW2A 2D43A 4ZHNA 4GALA 4OI2A 3MFAA 4C0BA 1UYYA 3J8F1 4GD4A 1UWWA 1NK9A 3UDCA 5DG7A 5F41A 2JEMA 3KLIA 4W65A 3AMHA 5H9EK 3DLEB 2EFGA 3GWCA 4OZXA 1RTZA 1D4VB 4LHLA 1UOFA 1D8ZA 3C15B 1F2HA 1ZZCA 2JDYA 1A34A 2W91A 4LF1A 1UXZA 2WTFA 3ZXLA 3DGVA 3GSIA 3UDVA 4EI2A 4MADA 3MMAB 5D8AC 3OGJA 3P5BP 3NAPB 4I64A 4QX3A 2ZHLA 3G8TA 3KB5A 3W9JA 2EICA 4ED2A 4ERDA 3OTCA 2HH9A 3HULA 4RW6B 2EKYA 4M3CB 2DH8A 1SH3A 3CUNA 1Q8BA 1HYSB 1RUE2 3ITHB 4LRBA 4IL7A 5KFLA 1VBZA 4X4UA 5M2UA 4CCKA 3I54A 3SHRA 4GMP3 4O3OA 1IM6A 5KFWA 1SBRA 1S76D 5KXCA 1TKZB 4XUTA 4QDSA 1IKYA 1JLQA 1HNZF 1FT9A 4M5GA 5DDJ1 4TXSA 1T3OA 1C8NA 4R0EA 1UWBA 1X60A 3J7NA 3IT8A 1I51B 2PHXA 5IC4B 3VKMA 1MWZA 3A22A 1RACB 4N56A 2GGPB 4HT1T 3RZGA 4AQSA 2QA4S 3DLGB 3CJSA 3GBFA 3H3UA 3MI8A 3M8ZA 1LODA 4BQXA 3Q8QB 1CAWB 4PLOA 4XJWA 2RB7A 3VBHB 4WBFA 2JDHA 3D8CA 5FY4A 3UDEA 4K7JA 5K0UA 2V2ZA 1T9VA 1CPMA 1RL3A 4FXWA 2P3IA 3U1LA 5LMNJ 3Q8UA 5FPVA 3I4IA 1GOFA 4PCQA 3VDCA 2B45X 5DQHA 3US5A 2PHTA 2RQCA 5DAPA 1VLYA 7FD1A 1UWAA 2IVMA 4CNZA 2WNVC 4ECZA 1W6QB 3SXLA 2ZHBA 2PA3A 2R0HA 3WIUA 1ZZ6A 3VBOC 4HONA 2RS11 5FD1A 1T6BX 2RILA 4AL9A 4AQ6A 2AEMA 2WSUA 1XE7A 4UUWA 3WG4A 1YYNA 1B3TA 2HKXA 4X8NA 1VR6A 4N43A 2JDNA 3ZPYA 3S5QA 4NLTA 5A6XA 1T7PA 3AKRA 4NN0A 1WUUA 2Q43A 2P6TA 4UBGA 2VVDA 4JBCA 2BOIA 3MEPA 3OR1B 4DU8A 4WM8A 2VM9A 3JXOA 1RKIA 3MV01 4U7UD 4XMIA 4A3XA 1FPN3 2FDKA 3AVRA 4TTGA 4NCGA 4Q1RA 1WOSA 4MYTA 5DO2A 4USMA 2VZUA 1TK8A 1CJUB 4FVCA 3ZFEB 1FKPA 3TUZC 5A0YB 5KFCA 2QQNA 1OSDA 2ZGKA 4FTSA 2WVEA 3HSDA 4Q1PA 4CPBA 2X5IB 1HXS2 4KGQA 3R5GA 1S9EB 3T3YA 5I0DA 3M30A 1XMQF 1ZYQA 4AFBA 5B0CA 4L92A 4ED3A 4RW9A 2XPJA 2V69A 4I69A 2Y38A 1N5VA 4UZCA 3ITQA 3I97A 4C8OA 3M3EA 2DVGA 2HW3A 3KSCA 4DXLA 2P8IA 2DR5A 4JGYA 1NUEA 2SLIA 2YKNA 5IOLA 5C4WA 2J8SA 2J8AA 3LF0A 1VQMS 2HK3A 2VNVA 4PWUA 2DUQA 1DQ1A 4X4NA 1MS4A 2AGPA 2Y0IA 2RDDA 1JU4A 5FYZA 1RTIB 1M5VC 3FQLA 1V6MA 4ECTA 1OD3A 1GP5A 4DPYA 5GMKa 1FOD3 1G9BA 2TNFA 1EP4A 4PQAA 2BU9A 1KOHA 1VBE1 1IKWB 4DEQA 3HVTB 1L3TA 4X4SA 2V73A 3KZ4C 1RUD2 4AGGA 5FQ0A 2J1TA 1R0CB 1NZIA 2ZJQQ 3UVJA 1IR0A 5IAXA 1CAUB 1UF2C 3WR0A 4NI2B 1ITPA 2OJ3A 1D4M3 1S7IA 1IQZA 4IE6A 1AFJA 1FT8A 3DLJA 3GALA 5FAXA 2RMLA 2WZ8A 2EIBA 4Q0UA 4CP2A 3MCOA 2EF6A 5D21A 3TEWA 2EC2A 3WNMA 3GCXP 2MKYA 4AG4A 2VV5A 1RHRB 4Y0FA 4NXMJ 5C8CA 2E9RX 1N3PA 3R4DB 4B8EA 2FUG9 2J7MA 2VB6A 1RTJA 3WXPA 2Q8DA 4RNOA 2YH0A 4PQUA 1ND3C 1G6NA 1UN1A 4PXBA 1IOAA 1Z7S2 1BMQB 3ZN6A 2HRYA 1WELA 3C7HA 3WLUA 4IQPA 2GAHC 1HNIB 3TARA 2FCVA 3BBFA 5EGYA 1ZAWA 2L9WA 2CRLA 5FOJB 3PEJA 5FMOS 4LKDA 5FRAA 1RT1A 4RFT0 2F63A 4FAGA 1U0HB 4ES1A 4X65F 3H1YA 5FZ1A 4YZ1A 3W2WA 2OS2A 3G2XA 4H4KC 3SKVA 3V6KA 1Q4RA 4O0IA 1BJQA 1AYN2 2Y1JA 2EBGA 1CVJA 3DRSA 2ZDOA 2VOXA 1SJRA 4K2JA 1QOTA 3RMYA 3ET6B 5H9FJ 3MZHA 4PHZA 4NE9A 2H6BA 1JLGA 4XYXA 4IG0A 1PAUB 4QDQA 4HVQA 3GYGA 3E6DA 1UAWA 4Y5TA 4P9XA 1KS4A 2ZOEB 3K51A 3VGSA 3A3NB 1V6KA 2WUHA 3AQPA 1EETA 2AZ1A 4CEWA 3OXGA 4ES9A 4FPRA 3I2GA 1C0TA 4IERA 3N6MA 5KFVA 1QOSA 4GO5X 1UMJA 1NPPA 3FBBA 1X31C 1RXGA 1ZAVA 4PBOA 4EWEA 3D3CJ 4F83A 1DHMA 5JXGA 5FXWA 4ITCA 3SISA 4OLOA 5T5PA 3N36A 2M5YA 1XK8A 2ZBQA 4L8QA 3JSRA 4OHXA 1JLBA 4FN5A 1D9FA 3WNXA 2F40A 1RT6A 1K8AT 1SPPB 1XE8A 3Q0AA 2WNUC 3OJUA 3VAHA 4DL6A 3CZUA 5FPAA 3M32A 1X33A 4F7ZA 1W6MB 2APOA 1MPXA 2BJ1A 2GNKA 5HATA 3O12A 1DDLA 1H30A 1JZ7A 2M8HA 5IVCA 1BE4A 1QJU1 3VBSA 2ZA9A 4ED6A 5LA0A 4FTBA 3B94A 3VDDC 2A3YA 4I3GA 2LP4A 2PMHA 4CH0S 1R093 4R4XA 1SL0A 3E5QA 2B4OA 4RPFA 5E16A 3N28A 4CYUB 1LB2A 2HQ3A 1M1HA 5DUXA 4BHQA 2CNOB 3LPYA 2X1AA 2UURA 1H8VA 1JI6A 2YFZA 3FKBA 1FXLA 2AF6A 2EIEA 5LT5A 1KD1T 3ZXKA 3BALA 1XWLA 4MVTA 2IM1A 4OQ8A 3G82A 2K1RB 3NV4A 2HNDA 4B9TA 1EB0A 4JHTA 1C8M3 3ZTSA 5D2AA 1BQNB 4WF9Q 4F3QA 1DZTA 3LFIA 1M06G 3WF0A 1WC3A 5KT4A 2ZGLA 1WHXA 3E8OA 3FLRA 3M2UA 4DR4J 1TL1B 4WVMB 5JOWA 4B3TF 1QVFR 3I3EA 4CXXA 3NGKA 4K4WA 2MMYA 4N7TA 4O3QA 3GONA 5A3TA 5K8OA 4R9BA 2PE8A 4RQPB 2P2KA 1S4FA 3TJ8A 4M5LA 1S1AA 1QAXA 4R8UB 3MOZA 4PXDA 4IFYA 3DXSX 2NQYA 2WNOA 4OZ0A 1MZ6A 5G0RB 4GB33 1VQPS 2BRTA 3I2IA 5DAVA 1PGSA 1JNZB 3JSMA 3ZC4A 3BYRA 4C97A 2A5ZA 5GM0A 4EN9B 4HDHA 5JVHQ 1H2MA 3WG3A 3W5YA 1GZTA 2PQQA 4AFCA 3AA8A 3VBFB 3TAMB 5CNAA 1RVF1 2PQSA 2Q3PA 2ETEA 5KT5A 1C1FA 3Q8CA 4XIUA 3RZHA 2PHUA 4Y20A 1PKUA 1GTEA 3DF0A 2J0XA 4LQRA 1RBLA 5IWAF 3ES4A 4J37A 3EXCX 1CZVA 1WW4A 1UCNA 1ZBA2 2XBPA 3T1YF 3BB6A 4XF9A 1C4CA 2HHTA 1RUE3 3BKTA 3I8TA 2PELA 3IRXA 2V34A 3MPDA 2E7AA 3HD8B 4LFCJ 2EXKA 1DCSA 2KB2A 2LUWA 1HBMA 4P71A 4OYMA 3KLVA 2O3DA 3HJRA 2P37A 3ETPA 1XIQA 2FMDA 2AJFE 2I5JB 3PHMA 1JIHA 1AXZA 1DQ8A 5EJ1B 4KFBA 3OTOJ 1O5JA 4LE4A 4GMKA 1JXVA 4LVNP 3RNSA 2KVQE 3MECB 4PCRA 4ZDNA 3CMAS 4OZ5A 5GADI 4P2FA 3PDNA 4LO8A 3V6DB 1AR61 2XS7A 1KLMB 2IPOB 3BTZA 5EUHA 5HQMA 3W59A 1KSPA 5AT1B 2VPYB 1UOJA 4HI1A 2CV6A 1Z0HA 1N32J 1KEXA 3IGNA 5FKCA 3GYNA 2C6SA 3BS9A 1Q81T 4NA1A 3PYFA 2NSBA 3DOMA 4OZ3A 1S0VA 3HMJG 1W0NA 3IPVA 1IKXA 1DGLA 1DYPA 1UVJA 4BXSV 2I1RA 5HLFA 2WZR1 4KHPJ 3U11A 5J96B 1NLRA 4KKOB 4XTTA 2MKIA 2N3LA 2CZ9A 3ECQA 4JTOA 2DCJA 1Y43B 1NLKL 4M0NA 2ZD1A 5FPZA 4YN3B 4CRJA 4CO4A 4H7LA 5ERLA 2RHSB 3QIPB 1OJ4A 3RTVA 1NM2A 2HFZA 3B54A 3H42B 4I3PA 4RL1A 3LTOA 1VYAA 4TXWA 2BM0A 3D6MB 4ZVQB 1H1IA 1NX9A 4CM0A 1HNWF 4IE0A 3T41A 2V8GA 5GALA 2UXCF 2AQ4A 5EP9A 3W3SA 1YQ2A 2GC1A 3ZMNA 2G9GA 1SV5B 2F4FA 2KJVA 3FUYA 1VPHA 5A3LA 3PLQA 5CCLA 2ZH4A 1MEC2 3T1LA 3TVYA 1C57A 4ZKTB 3U1MA 2B7CB 1A7GE 5H9PA 4DIQA 2QJVA 4RW8A 2DNPA 3K4AA 4Q29A 5JOZA 3RSJA 4MKYA 3NAPC 5A8KA 3IAPA 1FX4A 2IUWA 2Q6BA 2AYGA 1FV3A 2A1BA 2IFXA 2GJ2A 2EALA 3UI3A 3PVEA 5FZBA 4QKFA 4ECQA 2K0GA 5FY1A 4LA2A 2BA9A 3TX0A 1DGWA 2HYKA 3ELNA 4DDFA 3G4SS 3K4DA 5ACA1 1IGOA 4DUYJ 2OUGA 3DC2A 1SQEA 2YMZA 4KU8A 4TY8A 4YFZA 2C26A 2YKQA 1PO12 2A1XA 2D74B 2YPZA 2D6PA 4B9VA 3NOCA 3R6LB 2YGMA 2W68A 1J1LA 2W1WA 3SDEA 2IA6A 2FBEA 1NCRA 4RL7A 4BZ4A 2DGXA 2WL1A 1SPBP 2OKQA 2JLFA 1J3PA 3OTBA 3MBWA 3K3OA 1HB1A 5EDWA 1BBT2 2UZAA 4ARYA 5LSOA 1MS8A 5KOXA 1VBE2 4H3WA 3CDWA 3QWPA 3MOJB 3WEZA 4IEXA 1NOVA 5KFMA 5CA6A 4BQ5A 1WG4A 4Q2LA 5ETMA 4TU7A 1OVSA 1PZ7A 8RUCA 2HQFA 1WA4A 3VBHC 4DX5A 2JLEA 3EPGA 5LBFA 5H1SV 1SBDA 3VVTA 1ODMA 3F56A 4K0KF 4CP0A 4IRDA 1G3OA 2J1UA 5AE2A 5C9AB 1IWAA 1UP1A 4R9AA 3NV2A 1QSLA 2V0NA 3S7RA 1VAKA 2ZOGA 2XY6A 2Z2SB 1GXUA 4HACA 2D3UA 4I0WA 2HBRB 3MM7A 4ETZA 4DFSA 4FS1A 3A21A 3IAQA 1F0XA 2DU0A 1TK5A 4Q4W3 1DQ6A 2B56A 4D3HA 4AQYF 3KCCA 2XKOA 5C5TA 2P5VA 1S0OA 3TAPA 2WN2A 3PRDA 3P5BA 1LU2A 4MO3M 4C3KA 3KNGA 1LV5A 1I6JA 1ND3A 4EWDA 2VIHA 1N33F 1Z7S3 4K1ZA 5HANA 1WCUA 3FVYA 1AROP 2E5GA 4NHXA 4HSLA 4ZVTB 1CJPA 4KJIA 1AF9A 4B08A 4LFBJ 5KXEA 4X66F 1Y5NB 4N76A 3DM2A 4DV3F 4J9RA 2R7SA 2YWWA 4I7FA 2CJKA 1WDDA 3ZFEC 3LSDA 2PAMA 3RW6A 3OSPA 2R061 3MI7X 4YS2A 2G13A 4IOBA 2V4VA 4PI2A 2X5IC 4UT5A 4K8RA 3VHOA 3PTWA 3OW2R 4B3MJ 5DZGA 2A18A 1DAXA 2HWB1 3FEZA 4XETA 2W2MP 3AZYA 1W6PA 1ENSA 2PMWA 1N34F 1Y3TA 3OVAA 4Q4Y1 1TL3A 4X64F 4OIXA 1HIXA 3X1LB 3P3PA 4IEYA 3TZZA 4NIIA 4CLPA 5IC6B 3IA0A 2UU9J 3MIHA 4FYVB 1LEOA 4UOHA 4F2RA 4B4PA 4NWVA 1U26A 1HW5A 2ZX1A 2AJQA 4YR3A 3N7LA 3N6NA 4OZ1A 2YY3A 5D4PA 3OPZA 4EV0A 4LRAA 2ZS6B 2VBYA 2QVSB 2YC2A 3TEYA 2HGMA 3C2PA 3NLCA 4EU0A 2DITA 4YWAA 1NH7A 1VHFA 1UYZA 3RYKA 1NB2A 2HWC2 2BNNA 3BQ1A 3UKTA 1OYEA 4L75A 3I5CA 2RM21 4IG3B 4C1WA 2V6AA 2LEBA 1XMOF 1WNEA 2FCUA 1CZTA 5FZFA 4B3SJ 4RKUC 2K3KA 4ZU4A 4GKJJ 4P9LA 2MZSA 1RT7A 2ZNZA 2W2QP 5IW0A 3VGIA 4XIOA 1XOYA 1QM9A 1VMHA 2MPFA 2QQPA 2FJEB 2RQ4A 3UCUP 3AZZA 1TME1 2ACYA 4P9JA 4LSNA 3S30A 3DXTA 4LUBA 2D69A 1S1TA 3N9OA 2O1QA 2NSCA 3CCES 3MR5A 5CU1A 1FRKA 1KQRA 5KXDA 1JLCB 4S2DA 2XNQA 3I0SB 2Y0OA 5LA2A 4C9DA 4KWUA 2WQ4A 4INDA 3RFRA 1JYWA 5E0OA 3ZYHA 4OUEA 3JQMA 3AL6A 4UI9L 2GMMA 3LQCA 3JZVA 3BGRB 2OMOA 1NK5A 2IRYA 2XY7A 3TW0A 3D0JA 3I87A 1DF0A 5DUWA 1M0SA 1HQNA 3KLFA 1KQKA 3PX4A 5DQIA 4CLTA 1H7XA 4QPGB 1ZRRA 2G9OA 3IWNC 5KG3A 1SLLA 4DV7J 4K21A 1C5IA 1VBD2 3R4UA 2YQ1A 2AEZA 2VZ1A 4J1XA 4JV0A 1NKCA 1RAAB 1SLIA 2H6CA 1R64A 2CHHA 3ZMOA 3SI8A 1QSSA 3MM5B 3MHZA 3KK1B 4QU6A 2VD7A 4O4GA 5T52A 4N53B 4Y65A 1NK7A 1AX0A 3CO2A 2XHWA 2K7KA 4LREA 1MN9A 3INAA 4HKWA 3OGVA 1W04A 2F6BA 2CGNA 1RGVA 4BLGA 4E4DX 4EBDA 4QQBA 1JK9B 1S79A 1EAH1 1A8MA 4YSFA 1CJVA 2AC1A 3ZZPA 3PY8A 2FC9A 5GAEI 1OPMA 3TZXA 1APSA 3MCSA 2VQAA 1E6YB 3GCWP 1UAIA 4GO7X 1IKVA 3NNFA 2R1DA 3W64A 2Z2LA 4OVEA 4KV8A 5KFHA 3HP6A 1QHDA 4LTAA 1A9NB 4KWLA 4B3NA 1HR0J 2W52A 2BM1A 4XJZA 4XUOA 4BQ1A 1U24A 4R5PB 1WG5A 2GHPA 5BNQA 2WVCA 1V6JA 1Q0NA 3KF5A 4HEA9 5AXKA 4RBVA 3DLHA 2M70A 2Y6GA 1K9MT 4QPXA 1WD3A 3PVNA 4SBVA 2HBZB 5JJBA 2VMCA 3OV7A 2WS91 2R7EB 3ZSEA 3UPFA 1W8NA 5A3OA 2VECA 2IXKA 5GLZA 4YDXA 5KG7A 1UZZA 3ZO7A 3GCXA 2DCZA 3R0RA 4NIGA 2VBPA 1RWPB 2ZVIA 4DUXA 1QAJA 2UVRA 3DL3A 4MK8A 2D40A 1BQMB 2W9AA 2LA4A 2VUJA 2UV8A 3MF9A 4L6V3 5JXIA 3H59A 4YRDA 4XBNA 1ZYBA 2J9DA 4M4RA 4D6SA 4IGPA 1ZBA3 4OL8A 1SFPA 2MEV1 1EZZB 3ZIWA 1AYM2 5I3PA 3SMZA 1W9TA 3GIMA 4ZIVA 5FUPA 3AXDA 5E3CA 3POTA 4YP3A 1R3NA 4KBZA 1W6OB 5CFDA 3KXDA 3HVWA 1UA0A 4NZ0A 5FJKA 1N5QA 3R9LA 1RXFA 2D6MA 1QJY2 3NQHA 3UKVA 3QWUA 4WK3A 2OUHA 4ZA1A 5A32A 3CVKA 4V1PA 1FEHA 2JG8A 1KWMA 2WBRA 3H40A 1XBFA 4JQTA 3X29B 3K5NA 3ZFGA 3AZWA 4FPJA 2BDPA 1D2QA 1GX5A 2WA4A 2W94A 5FYHA 2CJBA 5J1PA 4MZUA 3HNYM 3H90A 1RUH2 4K9SA 2G0IA 5A76A 4WXOA 1LOFC 2X8KA 3VWSA 2W9CA 1JXLA 1VRTA 1F5JA 3UGGA 1S0DA 2C22A 5C42A 2QL5B 1M5PC 2YPDA 1SLTA 2Y6HA 3VCDA 2D7FA 2NPFA 3I2HA 5DLFA 2KFNA 3B69A 4TU9A 5EPAA 4P00B 4ZCKA 2RKIB 5HVHA 5FO8B 1IS4A 3VZHA 2PHDA 4RQPC 2DU1A 4RJVA 4ORFA 5KT2A 1GOGA 2A6YA 3WOGA 1RUOA 2GZWA 1S72S 1GXLA 1N52B 4ZP7A 1PK6A 4Y24A 5C3OA 1CS4A 2JDJA 3MZIA 3R27A 5T55A 5CYQB 2IXLA 2RR13 4A8XA 4Q0BA 5FP7A 5F8IA 5KXBA 2ZTNA 2RSQA 2XMUA 1J5EF 3TRGA 4AEMA 3PIJA 5B4XA 1WJ9A 3S7IA 3TB0A 1YK9A 4V1Ak 3OGRA 1UXXX 3LEMA 4QX8A 3BEGB 2XMLA 4M5MA 2R072 2D3ZA 4U96A 4AFMA 4LBQD 3VBFC 5IVEA 1QNWA 4P9SA 1OMSA 4JI3J 3N9PA 4K8FA 1MS1A 1ND2A 1MEC3 5CFCA 1SJ1A 4DQIA 1X4HA 3DOKB 1DJ0A 3NKYA 3LSEA 4TZDA 2BABA 1YI9A 3MMAA 3ENWA 2PGCA 3KLHB 2FZ2A 3DLKB 2KVIA 3RUBL 2AYHA 4CI0B 4QT6A 2BWAA 3IDBB 1S10A 3EZUA 4RW6A 3K59A 3OEAA 3ZTOA 3QD6A 3ITHA 1Q7YT 3D5OA 3JQXA 1R081 3CU7A 1GR3A 4PF5A 5FPXA 1RT4A 2M52A 3TX8A 1G6BA 2W47A 2CUYA 1PO13 4BIFA 1K1QA 4CP1A 2GVDB 5FIIA 4PXEA 5GZDA 2XBO3 1C1LA 4W98A 4CDQA 2Q0AA 3W66A 4QPIB 4QJVA 4WP8A 1OUSA 5JCTA 5M2RA 2YNFB 1P9QC 2ARXA 3BCWA 3VQTA 2GGPA 3IAS9 4YY3J 4C8MA 3DLGA 3NL0A 1BBT3 4J7CA 4QIVA 4CU8A 3PJWA 4N9IA 2ZGTA 3WW1A 2FJAB 1SUQA 2D9OA 5L1JA 3M9NB 2DB1A 1CAWA 3I56S 2FCTA 3GJAA 4F0KA 1IM4A 1UPSA 3OHBA 4DZGA 5ADZA 2JE9A 4URAA 1R8CA 5FREA 1FRHA 1S9GB 4UFLA 2D9PA 2E53A 1IR1A 2NMOA 2B7YA 4AEDA 4Z82A 3QSYB 2BRKA 1RYSA 1OLQA 1HNZJ 4B3RF 4HOOA 2XXZA 3H50A 4BDVB 5JVVA 3NBPA 3PJXA 1U6FA 4Q8LA 4H4OA 1Q8SA 2EKNA 4F0MA 2XHKA 1W6QA 4HN1A 1V6LA 2KHDA 4UQGA 1ZRFA 1X8MA 1ZZ8A 2B9VA 2EBEA 2GNTA 2V68A 4MJKA 4EZ4A 5IHRA 4CTAB 5KFNA 2UVVA 4FF4A 1DBDA 5DDRC 3U37A 2AV5A 4Z1VA 5A7SA 4DMZA 1N47A 1NZAA 2IIHA 1S59A 1J3RA 1IQTA 1GKBA 1H2TZ 1O3QA 3OR1A 1WLTA 1ZM1A 2WOMB 1LWEB 2VPWB 1KKHA 2HVEA 2BR0A 1OY8A 4WK1A 3LPEA 4HYKA 2YBSA 4W6YA 2QLJB 2HWB2 1DTTB 4YOEA 2WDBA 5IV3A 3EGNA 1BMV1 4TLGA 3ZXAC 4Q4Y2 2XLFA 5BR8F 2CQ2A 1S9EA 3KG1A 4BB3A 1YHQS 2X09A 5EXOA 3WNKA 4PG8A 5F5QA 3QFWA 5T50A 4K4VA 3LA0A 1OBNA 5L9RA 2GNBA 5HVFA 3VKOA 1PYSB 3PYEA 5KG4A 3H20A 4GVBB 3HHEA 5D3GB 4ZP9A 1VQYA 3ZZUA 1VFJA 2XH6A 4QR0A 1HQEA 3GE9A 4O9GA 2RM22 5CH7B 2NN8A 2OAUA 4JV2A 4WE1A 2XSFA 3BN6A 3DXUA 5SV5A 4HT5A 2W95A 4DR3F 5FZGA 3PYDA 3HI9A 4UFJA 3THDA 4F67A 1NEEA 3TNPB 3DU5A 2Q6CA 2HWC3 4ZVHA 1IQDC 1RTIA 1COV2 2MNGA 1G9FA 1KBRA 3TUIC 3GYXB 4ENOA 4QYZJ 3VAFA 2W1BA 1RUNA 2VCBA 1BKZA 4XFCA 4FBTA 1WCKA 2YDEA 1HL6A 1LHNA 4NMIA 3MAQA 3JCIA 3L4BC 5IV4A 3VALA 5C9AC 3Q24A 3SV3A 2V72A 2P3YA 1CAUA 4X4QA 5DPNA 1R8BA 2ZOMA 3JTPA 3TAYA 2QFJA 1UZHA 1XR5A 2HLEA 5CYMB 2AX0A 4LMZA 2JVRA 1XU1A 2X53S 2VG6B 3HSGA 3MUVP 1RU1A 4WBBA 1N6QB 1PM4A 1QOOA 2R041 1UW8A 2VUCA 2ZH6A 3M8QB 4PG5A 4OX9J 3SCKE 1VGYA 2DV9A 5HJYA 4Q4V2 1ULGA 2PHFA 1NQDA 2EFQA 4E27A 3CO9A 1T6GC 2W87A 4R0JA 4BBYA 4DOUA 4EBEA 4KGXB 3VAKA 1O8PA 5A7WA 4AHYA 4IDKB 3LA7A 1VBD3 4ZU7A 5KFIA 3N9LA 5FP3A 3TJ9A 1HN1A 1PC4A 4DFPA 3NW4A 5FBZA 5IK4A 1U0HA 1F1BB 3Q83A 1VC6A 3PR5B 5C33A 1SC4B 4OX8A 4DQRA 1DQ4A 2XJTA 1HD1A 1VBXA 3V0BA 1C0UB 2I74A 2VFUA 1SEFA 3H3ZA 1HARA 3W9HA 4KT0C 3TA1A 3ET6A 1KDNA 4EYIB 4I6YA 5F8MA 2GNMA 5D78A 5ABJA 1RBAA 1B35B 2XMMA 3ISNC 2COLA 3LWLA 5LA1A 3I49A 4F3OA 4HBNA 4UF0B 3ZYPA 1D09B 3FMGA 3ADAC 1RWUA 5E3AA 1XQIA 3APBA 5DRKA 5C24A 5JUVA 4DV4F 2CKWA 2CPHA 2K8GA 4JAAA 4LK6A 2FZGB 3M8SA 5HP1B 4BK4A 1H72C 2VGDA 3BR9A 2KXLA 3JB8A 1NK8A 1BWVA 2WINB 3HZGA 2K2SA 1GMVA 4RS5B 2RH3A 1JOJA 1TKTA 1RWOB 1S0FA 3ZSKA 4LSLA 3B7MA 4PAAA 4PRFA 1RZMA 2XULA 3DMJB 2GO9A 1SPPA 3LOBA 5JMOA 1YKWA 2QZ2A 4BWMA 2PD1A 3QT5A 1U1QA 3EICA 1FNOA 3WX5A 4OYAA 1AW0A 1GP4A 5FZLA 4UW3A 2XB6C 4JB8B 1HN0A 5BXXA 1Q8VA 3WG2A 1JMUB 1P1TA 2OQ7A 3T3FA 2BVVA 1YC61 4D8MA 2WSCC 2IMWP 3KK2B 3NWRA 1AYM3 1LWCB 1KS2A 4DV5F 1BLUA 2KHCA 2IHR1 3U14A 2CFXA 1AXKA 2FDIA 3UW1A 2IRXA 1W9FA 2JD9A 1DZQA 3M1VB 3HVRA 1C1CA 4OJHA 4WFYA 3EPIA 4CYUA 1NDCA 4B7EA 3RB4A 1QJY3 3EDQB 2B9UA 3KVBA 1VR3A 4JDNA 1T9WA 2HIYA 5L9XA 2BJ9A 1DZRA 5K9FA 3I59A 2BFUS 2L08A 3O1MA 4NA2A 1QU0A 4QPGC 2F3JA 2YH1A 3FN9A 5C2GA 2QC3A 2AYBA 1QXPA 2HWF1 4KWJA 2FB0A 3CGIA 1F9FA 1NPRA 1CIWA 4A45A 2EAKA 1RUH3 3W20A 4DR7J 3A1YG 5FY5A 5FCCA 2K7JA 2Z58B 1BQNA 3PNIA 3VZKA 1HBUB 2F17A 4I0AA 1RMU3 2RS32 4N53C 2DPIA 4ZVRB 1X4FA 3GB0A 3VF0B 4C11A 2PLV2 1NJIT 3LEIA 1XTZA 1DGRN 1D2SA 2HRTA 1VHIA 1LOAA 1U7LA 2E31A 2GP5A 3PO4A 3O0WA 1LENA 2QMXA 2UXDF 5C6CA 5A3UA 4YW7A 3FEXB 1VI7A 1TELA 2HVIA 4QHZA 4USWA 1C3HA 4RQPA 1TAQA 1WORA 4URSA 3Q8RB 2ZH7A 2CJXB 4ES2A 3BU0A 4JHZA 2ZBJA 3BYPA 3KVAA 4LRCA 2ACMA 2KTQA 5JZGB 1Q79A 2JC0A 4NPMA 2WVDA 3EVWA 5G0RA 2ALZA 5AE1A 2LDYA 4WFZA 3R5JB 5J98B 1T2XA 1CJKA 1OSCA 1DHKB 1WMFA 4YB1P 4RWXA 4F3JA 4ATEA 1CQNA 3UCZP 2CQCA 4CXYA 3OPKA 3S01A 1KS5A 3B3QE 3HN1A 2WQ8A 1FXDA 3SQGB 2OSRA 2OD4A 5B2GB 2KDOA 4LF7F 1O6UA 2R073 2CG4A 1ULOA 3JQKA 3EX7B 3VBFA 3FZ3A 2QA1A 1IBCB 2ALYB 4B3TJ 2E9ZA 1US3A 4GMP0 1NDLA 3D6EA 1R082 1GFWB 1PMHX 4BYYA 3DKWA 3TI0A 2VG7B 3EVOA 1V9OA 3H4BA 2ASJA 2XL9A 3QLHA 2CPYA 4Z92B 1EV11 4COWA 3GJBA 3CJ8A 3K3NA 1RHI2 3L7PA 1FDBA 2PN5A 1NSPA 3IG1A 3K5PA 3AX4A 3MLLA 3AP9A 2DEJA 3FJ2A 1NK0A 4LJMA 1TFYA 4CLUA 2HKEA 4D6RA 3ZNUA 1SL2A 4ECSA 3A8EA 4CDXB 1W9WA 1TK0A 3PACA 2MKHA 1VBA1 2WYFA 1CWPA 4CCHA 2GA7A 2R1BA 3IWLA 2I5JA 3PW0A 2C2ZB 4Q5OA 2Z57B 3R7BB 3GBWA 1LJ7A 5HBMA 2P34A 2J76E 3AD9C 3W2VA 5IWAJ 4FDFA 3TR5A 1KP6A 1FNYA 1VJQA 5JAXA 1AR93 1T9UA 2EK6A 3PX6A 2LXFA 4EZ6A 4A8OA 1Q8KA 3T1YJ 4UXAA 3TRSB 1WEYA 2PA8D 2WRMA 3ZXWA 1UOGA 1TE1B 1N88A 3MUMP 2GS8A 4DR5J 2FDGA 1G7CB 1XYNA 3RJRA 3I3BA 3LAMA 1S48A 1Y5LB 3HQUA 3OBRA 4IH7A 3PYGA 5F8LA 4YG3A 4EWAA 1NXD1 3PNAA 1IKYB 1JLQB 2LA6A 1RTDA 2VY0A 5KFQA 4ANCA 2RS51 3ZSMA 2I2YA 3K0JA 2RMU2 1UWBB 2RS8A 1EPWA 1H73A 1Z2ZA 4KKOA 1LOBA 4JKLA 3WQBA 1WSVA 2LVWA 2ERRA 4QBUA 1WCSA 5KC6A 5A7PA 3AA9A 3MW4A 3R4SA 4JI4F 2DRAA 1KDMA 1ENXA 4DUTA 3PJQA 4KG8A 3QIPA 3BQ2A 1R1A1 5I3QA 1LXNA 2OPRB 4UBHA 3DXBA 1RT3A 1BMV2 2HHQA 4J91A 3X3UA 1OLME 3PW7A 4Y1ZA 3UYJA 2MZTA 4BC7A 4KGVB 2ZFHA 4R25A 4G9SB 1VRH1 4HVOA 4RGGA 3CMQA 1FFSB 3RDIA 5JWPA 3D4JA 4XXAA 1QY4A 2AZ5A 2DNRA 4OULA 2Y8YA 4I02A 3KT7A 2DK2A 3H7HB 4BWJA 2H0BA 4IUFA 2XQCA 4TWTA 4XXPA 3RZAA 4ECRA 4ILLA 1QE1A 3OYWB 3B6BA 1XYPA 2BNOA 5CG8A 4J1WA 2DCYA 5EWSA 4Q8EA 1GU3A 2VG5A 2WSVA 3UN3A 4IKAA 1QVGR 4CCDA 1Q5VA 2ATFA 4UY8T 3MPPG 4N43B 4FOWA 4ER8A 4XURA 4FFIA 4DRRA 3KNAA 1UIJA 4WZCA 1I5PA 4QPIC 4BS2A 1JXNA 4Y2KA 4UFMA 1VQNS 2DYCA 2R8HA 1RQ0A 2E51A 1YLXA 4DQQA 4DV6J 4WM8B 4LUMA 4LQ3A 3Q8SB 4ELTA 4QIFA 3GNEA 3AOCA 3NJVA 1UPMB 1UKUA 4NCGB 3M2VB 5DDPC 2QLXA 1V6IA 4COZA 2FJBB 5IM0A 2WT0A 1FKPB 1LGCA 2AGSA 2AW0A 2DNKA 4OUSA 1DQ0A 1COV3 4O61A 1VRUB 2P17A 3B9CA 2DISA 3LP2B 2QQIA 1OQ6A 1UKRA 2RVJA 4BIOA 2PHWA 1R8PA 1LEDA 3HWJA 3NS6A 1M1GA 1IWGA 3M30B 2FIUA 2HVHA 5EWEA 1EP0A 3KF3A 1AL21 4X62J 1R6VA 1EJ7L 2AX1A 2XMKA 4RW9B 2WZPP 2X1BA 2BJEA 5C9AA 5J2MB 4KH9A 3UDLA 2R042 3M8LA 4L74A 3VR1A 1PVC1 2F65A 3T0DA 4ES3A 2WT1A 1U09A 3I96A 1QTNB 3AP7A 4FQ4A 1AXQA 2QFEA 2KI2A 3AODA 5C4WB 1IBKF 2A6ZA 3D1QA 1PJ5A 2YVSA 2ZEZA 4DINB 2E1RA 1FD2A 2QL9B 3Q8YA 1VCTA 1S57A 2ORXA 2ES3A 2XLIA 1FYUA 4H4MB 4Q4V3 5CZVA 4QWBA 3RG0A 2J7UA 1NQJA 2ZE2A 3RWKX 1EP4B 4K5SA 2W01A 4GWMA 4OZOA 2IFRA 3DYOA 2HWD1 3LA2A 1M5OC 4ELVA 2VBDA 3QAEA 4CCEA 1OVPA 5FQ0B 1QQP1 1F9HA 4NOHA 3M7AA 1YRXA 3C14A 3CCMS 1W9SA 2JEGA 4QHBA 4NLWA 2EPIA 3UVJB 2VE1A 4LNVA 2V4JA 5FDLA 1XNBA 4NXNF 4RNHA 2JX2A 3AOAA 5DS7A 1E57A 3JD73 2XYGB 2R8GA 4USJC 3GF6A 1GXTA 3EMTA 5A80A 1H7WA 5MAOA 1DQ9A 4C98A 4F2SA 4JV5F 4J9LA 2Y1LB 4CIOA 2BUKA 1BWEA 2C28A 3PUHA 4A7YA 2P1BA 3V0AB 1N33J 4OYBA 2D41A 2HHUA 2L3MA 4QWEA 3CCLS 3D3AA 4YR2A 1RTJB 3M70A 2NQPA 3ZN6B 1PBAA 1NA1A 4I67A 2ZGMA 3OLBA 3K57A 1CQ9A 1YJLA 2CA9A 5APAA 4AOCA 2XNRA 1IUJA 1RT1B 2DCTA 3T30A 3ZTQA 2P5BA 3W2WB 4LIUA 2LECA 4ZS6A 5CCMA 3IN9A 4AHXA 4F04B 1L3JA 3BN4A 4CLWA 1Y4ZB 1JTZX 3WW3A 2MLZA 4U95A 2H5IB 4Z2WA 5J1NA 4J9PA 1F15A 3DRSB 3FZ2A 2HFOA 1GZ9A 3UNGC 1JLGB 4OYXA 3T08A 4IG0B 2MQPA 4E8UA 2LU1A 3DRXA 1O91A 1N5YB 3DECA 2ZH2A 2Z56B 5F0UA 1QJZA 3GZEA 2DHAA 2CSGA 3ZYFA 1WDTA 2VZOA 1EETB 1RBOB 3MW2A 3GR0A 1TUWA 1SJ4P 4HVZA 1JLCA 3I0SA 2V09A 2C3MA 1C0TB 4NLDA 2OKXA 2GAUA 4XPEA 2BEFA 3QGHA 1V9U2 4EZ9A 1W99A 3ILNA 4XHBA 2QQUA 1F9KA 2WB1D 1YIPA 4ASMB 1XMOJ 4ZPVR 4XEZA 3OUJA 1JLBB 1PZ8A 3PCOB 3ME2A 4YW4A 3LWMA 4ATFA 2PAEA 2M88A 4FP9A 3UD4P 1JZ3A 2HAIA 1JZ6A 2G2ZA 3PVBB 2XG8A 1ZTTA 4M00A 3MM5A 3ULHA 4YVSB 3KK1A 4OX6A 3T19A 1T03B 3VBSB 3M9MB 4XQDA 2M0GB 2RS33 4N53A 2QN6B 2LW8A 1BYHA 2JIJA 2AD9A 4YM0A 2PLV3 1HD0A 4KGKA 1SBEA 3POIA 4BQ2A 3PUQA 3CCWA 3BU7A 1DLOA 2M3DA 4Y2AA 3HSJA 2V5HG 4QQ2A 1VQ5S 2WFF3 1X5TA 4B4RA 4U67Q 1YO8A 2ZX3A 1Q53A 3J80U 4DV0J 1FK9A 4XDPA 4M5KA 1B35C 1GQGA 4C6AA 1E6YA 4RGKA 4TLRA 3KHHA 1WOPA 4OJGA 3HKWA 2Z4PA 3TO8A 4I2QA 1N56A 1ASJ1 4EK2A 4DXSA 3Q9OA 3DCAA 1UPIA 3ZXEA 4CCOA 2CJQA 5BNPB 3Q86A 1RT5B 3OT9A 2WBMA 3VD5A 1N36F 5A3WA 3HJFA 5CADA 3G82B 4C91A 1N3QA 3L2HA 2OPPB 4B9NA 2QQJA 3MFHA 3BYWA 5T5LA 4RS5C 1QJFA 3R2DJ 3LEKA 3PTYA 1HBOB 2OX0A 2NXEA 1RUI2 4LF4J 1ZA4A 5KFEA 1H2LA 4RR3A 4ATNA 2R8KA 3RPQA 4DNYA 3ACGA 5C70A 3P4UB 2HMIA 1U2CA 3M6VA 2P4EA 4XABA 2XYHB 3M2UB 1FJCA 1QIQA 1HQ2A 1REDA 1TQ5A 1W6NA 4WXWA 3R97A 2I38A 1JKHA 3ZYIB 1YBUA 1WBLA 1EPZA 1WKLA 2NREA 1RHI3 1FMD1 3LGHA 4IFYB 4S2GA 2CQDA 1O51A 1TEIA 4QKNA 1SQGA 4FPLA 5ETLA 2HWE1 2YGLA 2R2SA 4ED5A 1WLCA 4Z2XA 4D69A 5F3TA 3AT1B 1S1WA 1PGW2 3MIBA 2V8PA 2VOTA 5KFSA 4QKDA 4A47A 2VJXA 1ACMB 4WV8A 3D68A 5A8RA 1XJAA 1VQSA 3WY6A 3CJTA 3I55S 4ASLA 3V81A 3SCGA 5AVPA 5F7UA 3BN7A 1F6TA 3WQ1A 5J7MA 4QD2A 2UY9A 2BJDA 1ZREA 2QUOA 1W03A 4PYDA 1LK7A 4Y20B 5DLGA 2HHPA 1SB6A 2YB7A 1VDHA 1YI2S 3BH6B 3N5FA 2FDHA 2ZACA 5I0RA 4HG6B 1ZZ9A 4I01A 4XQWA 2W1SA 4B29A 2HBQB 2RS52 3CB4A 3WF3A 1JH5A 1SXLA 4F7VA 5KFUA 3VQSA 2WVBA 4CTEA 4BDPA 4HKOA 5FY9A 2ZPXA 4XIKA 5GLUA 2JEFA 3IRXB 2G0CA 3KJNB 1S0MA 1YQ6A 1Q3EA 2VW2A 5CZKA 2HHHJ 1ZZ7A 2CQPA 4FPFA 3RRHA 3LZZA 3FJSA 1R1A2 1DYKA 1FRJA 2RMU3 3VZMA 2BDRA 2WT2A 3N7MA 3AJ2A 1WHVA 1PYOB 5KG2A 2GU9A 5FR3A 3BR8A 4KFBB 2VHGA 4GC7A 4PG7A 3P6YC 2KZMA 1HI0P 1O0PA 2HFSA 5JZGC 1S6UA 2SXLA 5K8MA 3J81Y 4B4QA 2VAUA 3MWBA 2BKPA 4MOAA 1ACCA 1C4AA 5E33A 5FK7A 2VICA 1BUXA 3J7LA 1LGBA 2MJNA 3O2IA 2VZRA 1SC1B 3ES1A 1YEWA 1N5SA 3QCWA 1RUC2 5L1LA 5FFOC 5KAKA 2ZH8A 3TUJC 1KHWA 1W8HA 4FCAA 3AP6A 1RUG2 3PJ9A 1CONA 5K9YA 5KFGA 4L97A 3DOMB 1NDPA 2IXJA 2IYIA 3IPVB 1IKXB 2VVEA 2ARCA 1AFIA 3KLHA 4CLZA 3DLKA 2WSFC 3GIRA 2W2NP 5L73A 1WACA 5HLFB 4DY3A 2DY9A 1ZM2A 3UESA 4L11A 1I94F 1S1UA 3BKFA 4NX9A 3MTJA 4W90B 3ROUA 2SBAA 1HRV2 1IVZA 5KFDA 2ZD1B 2J1RA 3POJA 1YX2A 4CDXC 3TZYA 1PO21 2GVDA 4M3CE 1Q95G 3FZBA 1UNBA 3Q8BA 2J1VA 3G87A 4XJUA 1LFPA 4DHVA 1BC6A 2CPFA 2OYZA 4WYLA 3IKWA 1N1VA 1VALA 1LEMA 1XNAA 3CNQP 2RAQA 1YJTA 5C3PA 1TMF2 3VZNA 1PZ9A 4O7XA 3NG8A 4JI2F 3JSYA 1JZ5A 1DP0A 4CE8A 5D0RA 5HI0A 5A8KB 2VQFF 5FMOL 4XAKA 4PKDB 1UX7A 2JIGA 4B7KA 1EHWA 2ZITA 1S9GA 2CPJA 3RI9A 1REVA 3RRDA 3H8RA 4Q27A 4XFIA 1Q8PA 3F95A 4XDOA 1RYYA 3K46A 4NRUA 3FGVA 4HETA 4RHV1 2B4KA 3AJDA 4MTPA 4TY8B 1V70A 3B00A 1UVKA 4NUBA 4QPTA 1SIZA 2AT1B 2P2CB 4IOAQ 1WD4A 2LCWA 4QU1A 3H2VE 3VTIA 2MSSA 1OOPB 3C8YA 1G4CA 4QQHA 1NCRB 3KGZA 4AF9A 3UCGA 3C6TA 4QX7A 4NPLA 3POGA 5D0GA 2XWYA 4J6GA 4IR1A 3WDYA 2LFVA 4LQ9A 2ZJRQ 4XAAA 4Z7YA 4YG6A 2H65B 4AVAA 5ETRA 1RUJ1 5A7QA 1V3RA 2VNOA 3CJKA 2UVWA 2FHRA 1VAMA 2Z2ZA 4DXTA 3KTQA 1FX5A 5C3SA 1KFXL 4B3RJ 2OI2A 2IC1A 1AR82 2XLJA 1UEUA 1EQ0A 2DVDA 3DRRA 4AVTA 2OHDA 2QQVA 5IVYA 1HI1A 1TZ0A 3AMPA 3JB9k 2J1SA 1FCAA 1QH6A 2UXBJ 4YQWA 4DWIA 4KSEB 5DJBA 3N9MA 5J2QB 4QPYA 4J9VA 2PFWA 4IE5A 3RYRA 2H1YA 3T9ZA 4A4JA 5CD4A 4I0WB 4HACB 3MM7B 2BQ3A 2VL1A 1W0PA 1S0IA 3S1TA 3PJYA 3LA3A 5F37A 4Z07A 2ZGUA 1TV6B 4YGCA 4D6QA 5CAZA 3CCTA 2C2KB 1LU1A 5M0TA 1T95A 2L9LA 3ZN5A 1WHYA 2R7OA 4N43C 3E01B 2HNYA 1OQEA 2UYBA 4LLFA 1FKOA 4KYZA 4HSJA 2RRNA 3NO8A 2JICA 3OOXA 4XILA 2XR4A 2ZHKA 1PGL1 4MUVA 2JDUA 1WOOA 2W2OP 3QBCA 4BCAA 3CNAA 4ISRA 1PIV2 1XB9A 1KJRA 3WNNA 4JRAA 4WM8C 5JOXA 3RZKA 2I8EA 3OBZA 4ZJQA 4QDRA 3NP5A 4IETA 4HVRA 9RUBA 4O65A 4P08A 4XO0A 3DM2B 1J59A 4XF1A 4I7FB 4CT8A 2VOOA 5BR8J 3F44A 4A8YA 3FNNA 2YWKA 2P6CA 1UFKA 1RHKB 2HJIA 5IK7A 2VF3A 5IYYA 3LF7A 2ID4A 4AW7A 4LF9F 1UO9A 1MWYA 2GIQA 3O1LA 4K8RB 5B0FA 5IK8A 3T5KA 3VKFC 3FC9A 2EXJA 5FZOA 1GWMA 1UU5A 1W6PB 4KY3A 2PMWB 5HAOA 3WUCA 4RO0A 3JAMU 3O1UA 1TL3B 5A2QU 4CXWA 2DBIA 4EWTA 2XZWA 4EN6B 2MKJA 1QWRA 1L3UA 4JI5F 1Y3KA 2FDFA 1S1VA 2VA3A 2Y1IA 4A6OA 1XXNA 2DO4A 2CTVA 3MF6A 5CYMA 3T2QA 4MMOA 4F26A 4DR3J 2OXBA 4CUGA 3G6XA 4DB5A 1VQOS 2QQMA 1P9YA 2FVCA 4GULA 5C4WC 1OPIA 2ZX0A 3VAMA 4YB5A 2MYFA 4HHJA 1V9U3 5L19A 1X7VA 2R4FA 3EMRA 3ACFA 3RVHA 3N0VA 4OUMA 4AQTA 5KHJA 6AT1B 1H1AA 3AFKA 4YYOA 5J09A 5FY8A 2NLRA 7FDRA 4QX1A 1MG7A 3MPVA 3C3LA 2B46X 4P02B 4QXKA 1L7LA 3EE3A 3OCPA 1FFGB 3T1AA 2LXUA 3CD5A 2B6AA 4UYBA 1ULDA 1YG0A 3QGIA 3QOPA 2Y33A 1RT7B 4N8NA 1FVSA 3FWEA 2OD6A 4CA9A 1VBB2 1XQNA 3KK3A 2E7XA 3SYZA 4LSNB 3NL1A 3AAWB 5RUBA 5T14A 2E5HA 5IS2A 3SH4A 2BOAA 3WF1A 3D0GE 2BTVC 1UL9A 1UZYA 1SCSA 2CPIA 5LMUF 4XDCA 4Y1YA 1U4BA 1OF3A 5HK4A 3QPIA 4PPDA 3EYZA 3WX4A 4AWDA 2BJSA 3ZN4A 5CHCB 5FWEA 2DIUA 3I2KA 2KD7A 1NHKL 1B35A 5A7NA 4B9MA 4O3SA 4LVOP 4PG6A 1BCXA 2JLGA 2Q4SA 4Y2MA 2OUJA 3EB7A 5IAVA 1HBNA 1O6XA 4NYPA 1CN1A 1RAHB 1FDNA 1GMWA 4K5RA 4WZMA 5KG1A 1G7YA 2CYFA 5HP1A 3RU0A 2FVQA 2E1PA 1GEHA 2QBXA 3QRPA 5TSWA 2K9ZA 3QZ7A 1LAJA 4N47A 1W26A 3WP5A 1CVNA 2FLLA 1B70B 4FPGA 4F4KA 2VFRA 3MM9B 1DIWA 1X8DA 3H5SA 2NXUA 1RUI3 4AYBD 4ZN3A 4FQZA 4ITSA 2L48A 2JJ6A 1KD7A 1UMZA 1H3DA 1I3OB 3ORJA 3T1MA 3MM6A 3D3BJ 2VMGA 2NUHA 4NE9C 5FMCA 5HN0A 3UNPA 2C3YA 2R0FA 3MUY1 3AP4A 4NLGA 2MLYA 2MZJA 3QMQA 4RLEA 4MGKE 4OYIA 2XM3A 1D7PM 3KK2A 1IKVB 3DDNA 4KV8B 5AC92 4DV4J 5B09A 4LF8J 4NIDA 1IBMF 1UKGA 2PAKA 2HFUA 1O59A 5EYXA 1H4HA 2VQTA 3LCPA 3NS7B 1RYRA 1NYWA 4Q26A 2D5HA 3TZWA 1SLBA 2DY1A 3R1LA 3PZPA 2ADCA 3O7OA 1VISA 4NRMA 2YNIA 4AI8A 3THCA 1XN9A 2ZCWA 3BM7A 1GNHA 4O44A 2VZVA 5IT6A 4YDDB 3JSBA 1PHMA 2EVXA 2W39A 4L76A 1JUHA 4AI3A 1KGYA 2WAAA 4KGGA 5FZ3A 3SC7X 2CVEA 4N9HA 2W0XA 1X4DA 4MT1A 3MCNA 1UX6A 2D3OR 4YVSC 1E5HA 1VLOA 1S0BA 1HBUA 3VBSC 3M9OB 4DV5J 2JFDA 1OURA 3TOQA 3M8WA 1KFUL 2A6WA 3AL5A 2PT0A 2DNLA 3LAGA 1MROA 4DBQA 3POTB 3BKZA 5CFDB 5FZ9A 4ARXA 3MR6A 5LB6A 3CCZA 4ZHRA 2JDZA 4F8AA 3OSNA 1RUF1 3WZ0A 3CJ4A 1TR0A 4CO0A 2OT7A 4ZVFA 1T9XA 1ZBE3 3SNMA 2IM3A 2IXHA 3EGZA 4NOTA 2KM2A 2JG8B 5GJ6A 1WZXA 2DO0A 3PIPQ 5BNPC 5DABA 3ZFGB 1S6PA 1EKRA 3B78A 1S4CA 2HBTA 3JBG1 3GZ7A 3ZSLA 1LOUA 4BQYA 3WP4A 1K5MA 3KDOA 2Y8WA 3NNCA 3AKQA 3PW4A 5E2QA 3KV5A 2Y9HA 2D97A 3FE5A 4MXWA 3GXUA 3IR6B 5E5NA 1RUC3 3CC4S 1YCIA 5F3EA 1PNFA 1U1RA 5C42B 1RUG3 4YB6A 3QO9A 4QR1A 3VL9A 2WZEA 4MIWA 4XCBA 1QGLA 1PO22 4YG0A 3K58A 3DLBA 1AYEA 1TG7A 5LW9A 2VH7A 4ED4A 3BO4A 2AJ0A 3ENRA 2LALA 3L3CA 2CL2A 5A6QA 1XBWA 1PK6B 1HRV3 3LH2S 2YWFA 4ED1A 4A4AA 1S2EA 3DLLQ 2VDIA 4Q0BB 1PCAA 3N79A 1HDKA 4LF7J 4YB7A 3HCXA 4TQSA 5U47A 3MEEB 3TA2A 3MF5A 2DR7A 1H1MA 2OLWA 3CW2C 4MH0E 2V63A 2JOQA 3WUDA 3CDEA 4QPWA 3ASIA 2NLWA 3NWKA 4FBFA 3OY8A 2E63A 4EE2A 1S6QB 4N8OA 4UY85 4AD6A 2K3IA 1ND2B 5CFCB 3RR7A 2HVDA 2VO5A 1UPPA 1GWLA 1AT1B 1XRUA 3AQOA 1C28A 1ZPVA 4LMFA 1TMF3 3GPAA 1PMIA 1ZZFA 2DVBA 1UOBA 3OFGA 5A6WA 1OXCA 4ED8A 1T9TA 2W3JA 1W28A 2DBBA 4ANEA 2GALA 4JTNA 1POV3 4YLZA 3MV11 4DN9A 4EJRA 4A48A 1FVQA 4WU2A 1RT4B 3GFYA 3M1HA 2WWJA 2DIVA 1ULCA 2VCMA 1FERA 1DQAA 2VD3A 4RA0A 1NCQA 4CDQB 1UVNA 1RTHB 4BHPA 1QMJA 3G86A 3KMHA 4OI6A 3PM9A 1AUSL 6FDRA 4L3NA 4BQ4A 3AB2B 2OP5A 4K59A 1ENRA 2I45A 2X29A 4JI1J 1OMIA 1R89A 3V65A 4NMLA 2X3DA 4F4XA 1SUQB 1WW5A 2E5JA 2Z4FA 2JRSA 4PLNA 4OI0A 1MS0A 2UWBA 2OPRA 3OG2A 5I3UB 2JEJA 5BYNA 1GH8A 3FCVA 1XYOA 3E97A 2D6NA 2Q5TA 4BMBA 2W2PP 4Y3CA 3VUOA 2VDHA 4XACA 3BBBA 2PA7A 4Q2FA 4NLUA 4ECVA 1AR83 4AEDB 3AFGA 2GMLA 2UUWA 3DEMA 4BLJA 4ZOSA 3MCMA 2KA3A 4NMXA 5EX0A 3ETOA 1LHOA 4YFUA 3HPOA 4B1MA 4NLOA 3NBPB 1ALYA 4RGAA 2FGCA 5DAWA 3ETQA 3CJ2A 4H4OB 4AEKA 1J2VA 4IH6A 1ICEB 1C2PA 1HRI2 2RJLA 3HN3A 2ADEA 3ZO0B 4YW6A 3OYWA 3TN91 1WCQA 3THPA 1WGPA 3TANA 3BPSP 4E4HA 5JXJA 1YIJS 1ZA7A 2VFVA 3I31A 3A0NA 5T7LB 3G96A 1RKJA 4NZ6A 3BTYA 2HHXA 3S0MA 2HGNA 4E8DA 1FATA 2W46A 5F9LA 3WVJA 4BWOA 2MQLA 4F36A 1YJ7A 2R7WA 3DI6A 1V5IB 1U5XA 5HMZA 1PIV3 1GYKA 2W9BA 3NRUA 3OEBA 3EXUA 1HPZA 1QJX2 1SKUB 5LJ3Y 5C5UA 3M6WA 5IUQA 3VL8A 3FMWA 1YFXA 1X5OA 4I68A 3M2VA 5FZ8A 5LY1A 4JP8A 4NRTA 2VULA 3PKYA 3HBZA 1VIXA 2VTFA 3UGHA 2MPUA 3MPUB 2W08A 3OXLA 3MEGA 4KB7A 5IFTA 4MV2A 3OF1A 2OPQA 1U5YA 1VE0A 1NY72 2V2VA 3MHYA 1VRUA 2UVUA 1POQA 3LP2A 4N5SA 4OHWA 1RB0A 2NZ4A 2H0VA 1IBLF 1REGX 1YJ9S 2E1AA 3A4TA 2CVIA 1JYNA 1Q78A 1SDDB 4GMP1 2AZ3A 2DVFA 2EFPA 1MW7A 4V2VA 1SLCA 1MU2A 4M5JA 5J2MA 3U4SA 3VHRA 2NPIA 2Z0GA 2J9CA 2WWSA 2DXFA 4K3UA 4MFBA 3A8KA 2Q66A 3J7YI 4M5NA 4A8KA 5JIAA 2BQUA 1OOPC 1HQEB 3OL6A 3R3TA 2FYXA 3U02A 4FBUA 3HJVA 1NCRC 2PYTA 4NXMF 4ALZA 4LR9A 1X4AA 4Q44A 4WE1B 3E2EA 4QX2A 2QDNA 2IAJA 4KGMA 2W5FA 3WDVA 2F8MA 1BK0A 3DKDA 5ETOA 5EWGA 3R7NB 2WFPA 3AKSA 2GN3A 1XSQA 1VJWA 3UWTA 2C24A 2JDPA 4H4MA 5D4NA 1UMIA 2CQ1A 4RW7B 1U1PA 3MIGA 3ZDVA 2W9XA 1OO0B 3QYYA 3KHGA 1NO8A 5FYIA 1ULRA 2VBWA 5E3QA 4ILRA 3PMSA 4NLSA 3HFZB 3DRPA 3H4DA 1VBB3 1WC5A 2CDQA 2Z8QA 2XZDB 2QSWA 3ZDSA 4FYWB 4Z2AA 2N3OA 4EO8A 3A8IA 2P3KA 5CXTA 1UVMA 5E7OB 4ZP8A 2IY5B 3KV6A 2B43A 4DO0A 3Q89A 4XOGA 4RU2A 1FE4A 4W92B 4PXCA 2DTYA 3UK9A 1EAYC 3IM8A 2J1EA 1WG1A 1CJTA 3V0AA 2O01C 3FEYB 1S77D 2F5GA 5LSRA 2XUEA 2RJZA 1ZOTA 3J4UH 3RZJA 4TU8A 3PTRB 2GIRA 1IS6A 4F02A 4COYA 4E0DA 1X50A 5F8PA 1HW8A 5A7WB 1FPN1 4HPKA 4NZ7A 4M5IA 5AXNA 1FF2A 1W9YA 3HHLD 3TUPA 3CIHA 1IQAA 1AZSA 1O3TA 1Z4UA 2YKMB 1S1XA 1GAOA 1NUKA 3V4MA 2RD5C 2MQMA 3VGVA 3OPWA 3QH7A 4A8WA 4LF6J 4JV5J 7AT1B 2IZWA 3V0BB 1U5ZA 2GC3A 2VBXA 3MLKA 2R7XA 4ONUA 1IPKA 3UR0A 1S2BA 2JFKA 5ABJB 2HURA 3ST7A 3OL9A 2IWGB 3AH6A 1N5YA 3HM9A 2AYEA 5KHGA 4YFWA 3GBGA 4U2AA 2WNEA 2Y0BB 1L3KA 5AC93 5J37A 2BANA 1UY3A 4DX7A 2VNRA 4LHSA 3NGDA 4CU6A 5C24B 3RAQA 5LEJA 1W0OA 3HSZA 4COVA 1VP6A 1O5LA 1NE6A 1E5IA 2GMHA 2PMZD 1SKRA 4FYDA 3NRBA 1UW9A 4AE2A 2F4VJ 5B0BA 3A8JA 3LDBA 1NU4A 1AJKA 5T54A 4L9BA 4ES8A 4HK8A 2HQIA 1TKTB 5DG8A 2RDJA 2YWEA 2YNGA 4IDZA 4F8RA 4M5DB 2G1HA 4MIAA 4LSLB 5JUMA 1FOD1 3CDBA 4PJYA 1WC4A 2H5JB 2YTCA 1GSLA 3HVAA 3UE2A 3WDTA 3ETMA 1VQ7S 3J7HA 5FZ7A 4YVSA 5I8YA 2JZ5A 2OFHX 3A13A 3C16A 5HSPA 1T03A 2DCKA 3CHXA 1D4M1 1XEZA 1AR72 2HEYF 3QT8A 1BLZA 1O3SA 3V2UC 1VBC2 2VA2A 3BBCA 4FFGA 4OCTA 1PNGA 4X4VA 1BXNA 4TSVA 1NH8A 2A2CA 3LP0A 4HLBA 2OEMA 3GHMA 1C1CB 4Q4X2 1YJUA 3EGVA 5FYBA 4KPYA 1CPZA 1IG0A 4UW4A 1P27B 3UD3P 2JDAA 3MGUA 3FCWA 1PILA 4ZK7M 3VD4A 3IP0A 3I59B 4DG1A 2YU2A 4DR2F 3OTEA 1G1XA 3S6EA 3LAKA 1NJYA 4M4PA 3MW3A 5BNPA 1RT5A 1TL7A 3F73A 1QKQA 2Q79A 4KG0A 4LIVA 5L38A 5K14A 2ZZTA 2ERFA 3ISND 1YWKA 3OXFA 2PTMA 3AD8C 4ZPIA 2QQKA 2OPPA 1GLHA 3J7A1 2TEPA 1T94A 3THTA 3LOUA 2R8IA 1Y7BA 1HBOA 1JWWA 2QO3A 4CO5A 4CCNA 2I0XA 4C11B 4NPOA 3C8XA 3SFUA 2ZGPA 1G8WA 2VC0A 4DN0A 4PT6A 2C1EB 3T1HF 4ED7A 3NJXA 4NWWA 2ADDA 2IM2A 1T11A 2HWHA 3ACIA 2R32A 3J8F2 1SH0A 4FKXA 3PRBA 4IGQA 1XE0A 4MG2A 2CQ0A 5F3IA 4EYHB 1N0VC 1KQSR 1QLNA 4LR8A 1N36J 5DN2A 2MDAA 2IRUA 1CJKB 1X0PA 3OTOF 4URQU 5GAHI 1F2GA 3LPFA 4RW4A 2DXDA 2RDNA 1RISA 1S0JA 3CJ5A 5A8WA 1K45A 4DL7A 1MNEA 4Q7AA 1MR5A 3DGTA 2CZ4A 3EYPA 5FP9A 4HH1A 2DUPA 2A73B 3OD4A 3O1SA 2V50A 2KZZA 1VK8A 3KV9A 4BC9A 3W8GA 4HHHA 1PIEA 2OELA 1S99A 1QDCA 5KFPA 2RUGA 4QWDA 3RJMB 3QZ8A 3HAGA 5DDJ2 3QLHB 1R0AA 2NUUG 5FJ4A 2OO4A 2ZH9A 1G2EA 1JJ2R 2V9KA 2DURA 2VW0A 4K40A 4BQ3A 4Y34A 4LKSA 3IG1B 3NKTA 4YHHJ 3WDXA 5LK7B 5J2NB 4KHPF 3SMHA 1CULA 1R091 1UMHA 2IC3A 4EYUA 5CFDC 2LDIA 3MMBB 1I1EA 2ZEWA 3SLIA 5JR2A 2WAQD 2R2UA 4QIWD 2HPUA 1JHNA 3FC0A 5H9EJ 2J22A 3VAJA 1DU3D 3DOLB 2DFBA 4W6WA 5LASA 4JI7J 2O14A 4XC9A 1FJGF 5HBMB 5JOYA 2JG8C 5DETA 3KWMA 3UN5A 3W2VB 2AR6A 1ZX5A 3ZFGC 4P2SA 3H0PA 3VAIA 1DG6A 2M8DB 4E2GA 2B42B 2FDNA 3T5HA 3QNWB 1U6BA 3OFEA 4USUA 1C8M1 1FESA 2ZBPA 1HWKA 3SQOP 4DX8H 4S0MA 3D6HB 3VB9A 1CX4A 4DMIA 3M05A 2CJYB 3I32A 3IS9A 2CNAA 1OQ1A 3B82A 2VXRA 3FBYA 3CMES 1TL4A 2Q1ZB 2RS12 4CDUB 3WF4A 1D9DA 3GV5B 3WW2A 2D3O1 3OTFA 4BJ0A 2H51B 2D93A 2LQJA 1W2BR 5KOWA 4C3MA 4DSIA 2AJ4A 1RTDB 5IXUA 4PBPA 3LALA 1FNZA 2DGTA 2AEJA 2ZM6F 1QAYA 2ZMNA 4XDQA 2FQQB 1HRI3 2C0ZA 4DUYF 2RRAA 4QCLA 2OPKA 1X7NA 2FLNA 3RGBA 5CQGA 5GLWA 2XOMA 3GQCA 4ECXA 2ZX4A 3DYPA 2WC2A 3CLPA 4NAOA 1PK6C 4GB31 2VBZA 5THWA 5T5JA 2CPZA 3LKJA 3KG0A 1O8BA 1YNAA 1GZWA 3U78A 1TTHB 2DH7A 2JJ4D 3CD0A 1RT3B 1NKGA 5K8PA 1HKAA 3LEGA 2J6SA 2AEYA 4Y1XA 3RZZA 1HJFA 4FT8A 2R7VA 1OT5A 4CEYB 2NS1B 1QJX3 3T5JA 4V19X 4QQPA 3PHTA 1CAVA 3TVZA 3URFA 2R2RA 2DR6A 1RHQB 3BF4A 1ND2C 3D9BA 1XNRJ 2WO2A 4GKKJ 3AKTA 4Y00A 5CFCC 2ASYA 1SC6A 4CT9A 3KLGA 1Q43A 4JDOA 3L9ZA 1TUGB 2K2PA 3W9AA 3Q8EA 4WZQA 1RXOB 4DR1J 3UETA 3Q2TC 5KFBA 3SEOA 4ZONA 4YARA 1HXS3 1QE1B 3LOIA 4IV3A 4S2FA 1FDAA 3WCSA 5IQQA 2BX6A 1RUE1 2A6VA 3MDPA 3KGLA 2GV1A 2BQPA 2VG5B 2E1CA 2KYZA 1EYBA 2H4WB 1Q7LB 1E6VB 2MY8A 2HBYB 3WQ7A 4QWAA 3W8PA 1GQHA 1ODNA 2JVOA 5FWJA 4P75A 2DRBA 4CDQC 1Q86T 4EO6A 5L39A 2P6HA 1LKNA 4LO5B 1OOPA 2QIFA 2QT7A 3TJAA 1Q8QA 2IFWA 5E8AA 4H55A 3HT1A 4ZPAA 5IM0B 4JI2J 1UVIA 4CLYA 1YJVA 4QQOA 1BQXA 3EXYA 2VQFJ 3KYLA 1R7IA 2POKA 2PHRA 4LSZB 4LFBF 5LJ5Y 4XAEA 1LULA 4XJAA 4LBJA 3GV8B 1VIWB 2ZGQA 3SCLE 2IDLA 1HQLA 1H8TA 3QH6A 1W8ZA 4LHKA 2MQ8A 4A41A 1O4TA 5F2SA 4AEDC 2J0SD 2BEOA 1URNA 4CUBA 4IE4A 2GC8A 1LOGA 2CAUA 2R6QA 1RUD3 4JUZA 4CDWA 4B3MF 1A6LA 2HLTA 2QLWA 5J2QA 4HH0A 1GANA 1L7QA 5BPXA 4TY9A 4FF1A 1KN6A 4C8YA 3BO2A 5BV6A 3J7YU 3VZOA 2VQEJ 2L9DA 4JI0J 4YM1A 4AI9A 1WEXA 1KNZA 3FQKA 3IMMA 2IM0A 5AJ3F 2JECA 1TV6A 3H8YA 3WDOA 3A7QA 1FPN2 1U5IA 3CCRS 2UU9F 5T5OA 3IB3A 3ILJA 2VOVA 5FLXY 2ZXQA 3E01A 3KS7A 1I3HA 4OFGA 1NZ8A 4K4TA 4OYUA 5EV7A 1RT2A 1KOOA 2X10A 1JZ8A 3G71S 3TYJA