3THTA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
336
structure length
302
Chain Sequence
TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVDRRVKHFGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylated DNA repair protein alkB homolog 8
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 72
structure length 302
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thtA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thtA01
2KFYA 3K0JA 1VQ4S 2DISA 2MZJA 2MB0B 5GADU 1VC5A 5CYJA 1YIJS 1FJ7A 2DNOA 2X1GA 1SJQA 2SXLA 2FY1A 2XS5A 1WI8A 2MKJA 3SMZA 2QFJA 2DITA 1X5PA 3RW7A 2D3OR 4EGLA 3R1HA 2X1BA 3MOJB 1XN9A 5HL7Q 4ED5A 1N88A 1R8HA 2CPIA 5GVQA 2RU3A 5LSLA 3J7ZT 2DGXA 2VONA 2M88A 1ZZNA 1SJ4P 2KT5A 2MKHA 2J76E 2B0GA 5EN1A 2XNRA 3B4MA 3UE2A 1VC6A 2RUGA 3B4DA 5LXRA 3VAMA 2CPDA 3VAHA 2F9JA 2MXYA 3CCSS 3OW2R 2DNMA 4LIRA 1U1OA 2RRBA 3VAGA 1M1KT 1U1QA 3MUVP 4LJMA 5DDRC 2DK2A 2MKSA 1YI2S 2XSFA 2JRSA 1G2EA 2KXFA 4YOEA 1DZ5A 2DNZA 4WFNQ 2KM8C 5MLCV 1M5KC 3CF5Q 1X5TA 1ZZFA 2CPFA 1SJFA 3HHNB 2VOPA 1NJIT 2ZJRQ 2DNPA 3RW6A 4ZKAA 3V4MA 2MGZB 5D77A 3VAFA 4ERDA 1FHTA 2KH9A 2PE8A 2KVIA 2YH1A 1KOHA 3CCMS 3G71S 3U1LA 5FJ4A 1WWHA 2FC9A 2NZ4A 1FXLA 2LCWA 2CPEA 5ITHA 4WCEQ 1WEZA 1IQTA 2MJUA 2DO4A 1N8RT 3NNAA 4Z2XA 2MGZA 4C0OC 1P1TA 2MY7A 5GAEU 2RQCA 2ZJPQ 4W92B 2DGOA 3G96A 2YTCA 1KC8T 4QU6A 1VQ7S 2E5IA 2RS8A 3G9CA 2FPHX 4CIOA 2AYMA 2MKKA 1Q82T 3DLLQ 3G4SS 5IM0B 1HD0A 3MDFA 5DM6Q 4TU8A 3UWTA 3I55S 1B7FA 2QA4S 5CXTA 4PKDB 1A7GE 2GO9A 2X1AA 2YH0A 2K3KA 1VC0A 2I2YA 2HZCA 2OIHA 2F3JA 3MI7X 2JWNA 5LJ3Y 1H2TZ 2U1AA 4CH0S 5BJRA 2JVOA 5IM0A 2M8HA 2D9PA 1K9MT 3S8SA 1VQOS 3BS9A 1K73T 3UCGA 1VQNS 2RNEA 5GAHU 2CQHA 1WTBA 3EGZA 2EK6A 2DB1A 3CMES 2DNLA 2FHOB 2DGTA 1U1PA 2JX2A 1WEYA 3CCJS 4FXWA 3CULA 2CPHA 3S7RA 4Y00A 5LJ5Y 2DHAA 3H2VE 3FEXB 1UAWA 3CCLS 2J0QD 2BZ2A 2Q79A 5CA5A 1URNA 5DDPC 1SJRA 3US5A 2J8AA 2MYFA 2LA6A 2N3OA 3BO3A 1H2VZ 2EVZA 4QQBA 3PIOQ 4WKRA 4PR6A 1DRZA 4WFBQ 2JVRA 1WHWA 2MJNA 1O0PA 2CPZA 2MZSA 3MD3A 3MXHP 2RRAA 2LYVA 3MD1A 2KI2A 4OZ0A 1VBZA 1QVGR 5DETA 4W90B 4C4WA 1HA1A 2CQPA 2DO0A 3ULHA 3U1MA 3CUNA 2KN4A 3HI9A 5LSOA 1VQLS 3VAIA 2U2FA 2KRBA 2RQ4A 2WBRA 4RU2A 1NU4A 2DGVA 1YJWS 2OTLS 1UFWA 2LEAA 4U67Q 2DNYA 1OO0B 1JJHA 1U2FA 1D8ZA 2DIVA 2N3LA 3J7YU 1YHQS 2RS2A 1WHVA 3R27A 4M5DB 3NMRA 2ADCA 3DXBA 1U1NA 4FXVA 4IOAQ 2MQMA 2M52A 3H2UB 2LEBA 1Q81T 1VQ9S 2OTJS 1PGZA 2YKAA 3R1LA 2DH8A 1UW4A 3S6EA 3CTRA 2VOOA 1H6KX 2N82B 2MSSA 3UD4P 3NS6A 4IO9Q 1KQSR 2KXHA 3G8TA 3VALA 2M9KA 2DNGA 1FO1A 4WF9Q 3EGNA 1X4DA 4BS2A 1X5OA 1M5PC 1VBXA 1U6FA 1YITS 2XS2A 3CC2S 2KRRA 3NNHA 1L3KA 1Q7YT 1VQPS 2CPJA 2L9WA 4UY8T 1KOOA 2E5HA 5LXYA 2L41A 2DNKA 4WIIA 3N9UC 3P6YC 2M0GB 2XS7A 1M5VC 2DGWA 1OIAA 3CCES 5IQQA 2XNQA 1WELA 2DH7A 1X4HA 2A3JA 5HO4A 2I38A 2AD9A 2G4BA 5DDOC 2XB2D 5IFMA 2MKIA 1VQMS 2CJKA 2EK1A 1H2UX 1D9AA 2ERRA 2G1DA 2CQ1A 2LQ5A 1BY9A 1X4BA 2CPXA 1S72S 2E5JA 3BO2A 2OSRA 4PRFA 1QM9A 4QU7A 2LKZA 2OJ3A 2D9OA 1HD1A 2KHCA 3LPYA 2N7CA 1WEXA 2ADBA 2RT3A 1X4CA 1CVJA 4CH1A 4P6QA 3THPA 2DHGA 1FNXH 3IRWP 4TU7A 4A8XA 1X4EA 3VAKA 2DNNA 3CCRS 1WF0A 2DIUA 2LXUA 1U6BA 2UP1A 1RKJA 5GAGU 1U1KA 2KG1A 2LA4A 2CQ3A 3CC4S 1FT8A 2MQQA 3D2WA 1U1MA 4C7QA 2M4MA 2MQNA 2AYEA 3MUTP 1N52B 1WHXA 2KG0A 1PO6A 3THTA 3BO4A 2MMYA 1FJEB 3MUMP 1X0FA 3TP2A 3CXCR 2CQIA 2PEHA 2DNHA 3L3CA 1VQKS 3CCQS 3P5TL 2CPYA 2MZQA 3ZZZA 1Q86T 1VQ5S 2M8DB 1RK8A 2MSTA 2F9DA 1F9FA 2DGUA 3Q2SC 1X4GA 1DBDA 3MURP 3G8SA 2NLWA 2GHPA 2CQBA 4WFAQ 3CCUS 3P49B 2M7SA 2DNRA 4IUFA 2LXIA 3BEGB 3TYTA 3NS5A 2AYBA 1M5OC 1NO8A 2E44A 1U1LA 1VQ6S 2VODA 2LMIA 2O3DA 5DM7Q 3SXLA 1YJNS 4J5OA 2HVZA 2RVJA 1YJ9S 3S01A 2X1FA 2DHSA 2MQPA 1WG5A 2HYIB 2FC8A 1WHYA 3VAJA 2MY8A 4TU9A 2MZ1A 2ZJQQ 5DDQC 2CQCA 3LQVA 3EX7B 2L08A 2MHNA 3CCVS 5JVGQ 1WG4A 2E5GA 2KYXA 2YWKA 2LECA 3Q2TC 3P3DA 1U1RA 2DHXA 5GMKa 1FJCA 2J0SD 1WG1A 1N54B 1WF1A 2QEXS 4V19X 1YTYA 4TLQA 2DNQA 3VF0B 4OZ1A 1W2BR 2MPUA 3IWNC 1JMTA 2HGLA 2BOPA 3ZZYA 4F25A 1ZH5A 2CQ0A 2MQOA 2V94A 1K8AT 3UCUP 1YWXA 2K8GA 1P27B 2DGQA 1WF2A 3UD3P 2KXNB 1S79A 3G6ES 2G0CA 3CMAS 3UCZP 5D78A 2M70A 2MZRA 1X4AA 1X4FA 1JJ2R 3SDEB 2CQGA 1A9NB 2KU7A 3JB9k 4CQ1A 2CQ4A 2KM8B 4F26A 4IOCQ 1SJ3P 1QVFR 3NNCA 5JVHQ 1UP1A 1X5SA 1R8PA 2M2BA 3PIPQ 3FEYB 1M90T 2CQDA 2MQLA 3CC7S 1OPIA 1HL6A 4YUDA 1VBYA 1AUDA 2DGSA 4QPTA 4UQTA 2DH9A 4F02A 2AYGA 3SDEA 1OWXA 1VQ8S 4LMZA 1WI6A 1KD1T 2OSQA 2HGNA 1DHMA 2MKCA 1JJ4A 3I56S 2HGMA 3TO8A 4Y0FA 4YB1P 2CQ2A 5H1SV 3CD6S 2MZTA 1SXLA 3CPWR
chains in the Genus database with same CATH superfamily
4TZDA 1AR81 1BBT1 3WOGA 4ED0A 2IMWP 1PZ7A 1STMA 5I91A 4LIVA 5HMYA 3R5GA 3HJRA 5BNQA 2ZD1A 2WOMA 1X9MA 2NR0A 2QC3A 3HT1A 4CLSA 1S0NA 1S6QB 1DZQA 1A3KA 3M3QA 2RIJA 4SBVA 4AD6A 1FJGJ 4XABA 5MAOA 2CPIA 3LGNA 4LREA 3SITA 2IUWA 3BTXA 5LRRA 5C8WA 3RAMA 4OZ5A 1ITPA 4KTQA 1O6UA 3IGNA 2GA7A 1EP0A 1I5ZA 4XYXA 1S6QA 2UXBJ 2C28A 5E8AA 3GZEA 3SH5A 4YHHF 1VC6A 1V9OA 5LBCA 5IHRA 1R31A 1UMIA 1ROFA 1NK7A 2XG3A 4D94A 5A1LA 1HI8A 3CLPA 3MW3A 5CAAA 4QHOA 1IPKA 4QWCA 4EWTA 1T11A 1YI2S 2JRSA 3H1WA 3KJVA 1LK5A 2D7FA 4WFNQ 4B9UA 3GB0A 1GZ9A 2LVWA 5B0FA 4XCAA 2LP4A 3HHEA 4NLGA 1NJIT 2MGZB 2IYIA 3W2VB 3EJKA 3KD4A 5T14A 3VZLA 1HBMB 4Z07A 2VZUA 2GJIA 1VIOA 2W25A 3W64A 2F4FA 3I54A 4PG7A 1M06G 2W9CB 3OHBA 2KD7A 2MGZA 2Y34A 3W2VA 5IS2A 3AX4A 4YGEA 5D21A 3JSYA 4DR6F 3RTVA 2PN6A 1AJOA 2JLEA 1LEMA 2ZJPQ 1HBMA 4Q44A 5L9BA 1D0GA 5LT5A 2WWUA 2W9CA 1XMBA 1TMMA 4QDRA 3DGTA 3DRYA 3PFOA 3LWLA 1ACCA 1WNEA 1HD0A 3UWTA 1UPMB 2F4VJ 3MPYA 2YWFA 1W2NA 4B4RA 3NOCA 4LPLA 1SMVA 1JZ2A 3FSXA 5FZLA 3DEMA 2EA7A 3ZXEA 1GP5A 3HDSA 2JEFA 3TVKA 1WC5A 1K42A 2CGOA 2Y6LA 2BR0A 3BOPA 1RSCA 4GJYA 5C5JA 4YW1A 3DXSX 3NP5A 1G7CB 2VU5A 3CZJA 2V4JB 2WVCA 2XQXA 1GX6A 2NXJA 4CUGA 2QQVA 2BKPA 5FUPA 1D8YA 2Q79A 5T41A 1G9FA 1WKYA 4QDQA 4WU3A 4HDGA 3D0JA 4K59A 5I4MA 3U14A 3A3NB 2H3EB 2V4JA 1X9TA 2E5LJ 3BGOP 2CZ4A 4LBPA 2LUWA 1EUUA 1H2VZ 2ERFA 3H50A 4F50A 3P8BB 2ZH3A 3TRSB 2MZSA 2ZEXA 3MD3A 1FWPA 4IDKB 2OVUA 4QD2A 3ZZPA 4K4VA 1HA1A 2ZEZA 3U1MA 1Q8SA 1T6BX 1FF2A 2RQ4A 1VOMA 2CUYA 3P5BA 3W9JA 2BV3A 1UY2A 2Q1FA 1OKQA 3OPTA 3EE3A 4IDKA 3KCCA 2DNYA 2J1VA 1SG3A 2N3LA 3I7DA 4OULA 3LP2B 2G1HA 4CXWA 3OL9A 3KG4A 2DUQA 4AEKA 2ZXQA 1VYAA 3J7HA 3CDUA 4RBVA 2M52A 3MEGB 5FP3A 4MYEA 2WZ1A 4HTJA 5ABJB 2AGPA 2HVDA 3LP2A 1XXNA 4AHXA 1UTAA 2W1UA 3EB7A 5CNAA 3SCIE 3PU8A 2DR5A 2YC2A 2XTJP 3MEGA 2B5JB 1QAJA 1V6OA 1PGL2 3R7BB 5FQ0B 3KSCA 1DFQA 3KCXA 3CC2S 5ABJA 2WB4A 4OYOA 4HMZA 3MR7A 3BN6A 2R2SA 4DV2F 2ZE2B 2L41A 3TBDA 3MOZA 4NXNF 2CJQA 4A6OA 1IN0A 2R16A 4UZCA 1M5VC 2AZ3A 5CG8A 2XNQA 3DLEB 1T02A 1DQ6A 1QNYA 3MAAB 3GBWA 1RAOA 2AGQA 1CSJA 2ZE2A 2E1PA 2MEWA 5HI0A 4CT9A 3BB5A 5H9FJ 1PMIA 1UL3A 4DXRA 5T5LA 3PX6A 3SV4A 1VRH3 3DLEA 2D5HA 2VULA 1OOPB 3MAAA 3JYTB 4M3CA 2E7QA 1C5HA 3OCPA 1UA0A 2H1YA 3BDPA 1LWXA 2J7UA 4R4XA 7AT1B 2FJXA 3N7LA 3CW2C 1LOCA 4D7SA 1AYEA 4CYUB 1JOJA 1OOPA 2CZ9A 3WIVA 3JYTA 1PMJX 3CBNA 5HANA 4I30A 3B9IA 3CJ2A 3F73A 1D9FA 3Q8EA 2A10A 2DIUA 1UW8A 3OVBA 5M2PA 2G2OA 2HWD3 4ZCIA 2IJFA 4B9LA 3VZJA 5L8RC 2R7OA 2TUNA 1S0JA 5FK7A 3IAQA 2HQFA 1MVEA 4GB32 4CYUA 1RISA 4OFZA 4XDPA 5FZMA 2XHWA 1U0AA 5FPLA 5J2MB 3GILA 1B0PA 1YWKA 2Q30A 1LXNA 5FDBA 1I51B 4JI0F 4K20A 3SSRA 4CO5A 3OTOJ 3H4BA 3CEDA 4JGZB 4ZONA 2P6HA 5JXJA 2AF6A 2NLWA 2CQBA 3FFQA 1NCQC 4DR3F 3WDOA 3A3OB 4CT8A 5C6CA 4O0NA 3OEAA 5LM7E 1E5RA 1SC1B 1R0CB 3PXGa 3W9IA 3NNFA 3BU7A 1PHMA 4X65F 4QT6A 1VRH2 3HT3A 1Q8OA 5FFOC 2ADDA 2EXUA 2WYSA 2WW8A 3KHGA 4MMOA 4ZA1A 1DJ0A 5FO7B 1LOAA 3PYGA 1YBTA 3ZNUA 3ZZ0A 1RTZA 3DRPB 2BBVA 2CGPA 2ET7A 3GSDA 3THVA 4N47A 3OBTA 4QPIA 1ACMB 1FDBA 4AQYF 2VA3A 1Z0HA 5BNPA 2C6SA 4DZ6A 4WFZA 1AJKA 1FRLA 3DRPA 4DQSA 2HGLA 2HFZA 4F25A 3PRVA 2CQ0A 5CEHA 2B4KA 3T2TA 2XMWA 3T1LA 5C8CC 4K4WA 5LMNF 5LASA 3B02A 2IWGB 2E9RX 3RZMA 3ASIA 2AWZA 2CQGA 4CEYB 1UPIA 2ZMKA 5EQUA 5JVHQ 1R8PA 1FAYA 1V5IB 4OIXA 4YGDA 1VBE2 4X4OA 2PT0A 2D3PA 2IDEA 4DV4J 2GS8A 3NBPB 4YW2A 3GIMA 1AR73 4CEYA 2HGNA 2QZ3A 1NSAA 4LLOA 3TO8A 4P5YA 4RHV3 2VMDA 3WDUA 2HURA 1OA3A 2VECA 3CD6S 1NK4A 5FYYA 4BXSV 4YFUA 3AD9C 2QO3A 1A34A 2VMFA 3KXDA 4CWBA 3O14A 1TTHB 5GAEI 4ZIWA 5RUBA 4E4ZA 1GMWA 4JCKA 4ER8A 4DRRA 1OMSA 3I3QA 3HNYM 4Q29A 1X5PA 3RW7A 4EGLA 1DYPA 1PGL1 3QFWA 2WA4A 5ETKA 1TUWA 4Q7AA 1LENA 4BE3A 1R083 2DTYA 1PJ5A 5EPAA 3DU5A 4Y5Z0 1TKZA 1S0GA 3VAMA 2FJAB 3C19A 4J9LA 4LIRA 4OYMA 3AXMA 2NPIA 3LP1B 3PNIA 3IDCB 4B3SJ 2K46A 1SKSA 1S0MA 2IVIB 3S6PA 1O3QA 1LWFB 2FHRA 1YQHA 1UY3A 5ETMA 2HLTA 1AR72 1GQEA 2C24A 1JU3A 1XIQA 2QSFA 3UD5A 2E9ZA 1ZZFA 1N32F 2CPFA 1LHVA 3O3LA 4OYAA 1W6MB 1UYYA 5KFHA 3I9ZA 1LWFA 4JV0A 2W3JA 5FV3A 2E9TA 2PLV3 1FXLA 1Q16B 3NNAA 1NY72 5KXBA 1W6MA 3JCIA 1W9WA 1QJU3 1HN0A 2JE8A 2VC9A 1C4RA 5GAEU 3HNBM 3M7VA 4TQRA 4LSLB 2DGOA 3NNJA 1NCLA 4LHLA 3H20A 2P37A 5GZCA 1FYUA 4C3KA 3KLSA 3V64A 3BKTA 1R082 2OUGA 2HFVA 4D69A 1ZOTA 2HFUA 2YFZA 4OX8A 1Q3EA 1GX5A 1ULDA 4P08A 5ETQA 4LSLA 1WA4A 2VBPA 3I31A 2XJUA 2CSGA 4OHWA 5F2SA 4D8MA 3NJVA 4CU9A 3WUCA 2HZCA 2RH3A 5AJ3F 4J9VA 2A6OA 3O1UA 2ZC4A 3EPGA 5HLFB 2M8HA 5A6QA 1JHJA 3K5LA 3BS9A 2HIQA 1VRH1 4P9XA 4NHMA 3EGZA 4YP3A 3HHLB 2UWAA 2Q1LA 1RTHB 4KE5A 4H14A 3JS9A 3VZMA 5HLFA 1H3DA 1MS5A 3CCLS 3WW1A 4AI2A 5KFPA 2PLV2 5CYYA 4JI5J 2QL7B 3I87A 2I2SA 4K4SA 2LA6A 1RTHA 2PC6A 3EXUA 1QJU2 4NOHA 2VUCA 2Z2SB 2ZTNA 2HWD1 2B4VA 2RRAA 3DUIA 1AXYA 2D6PA 1VBA3 3OPKA 3WXPA 2VICA 3RAXA 4E98A 4JI4J 2AKWB 1H1IA 5JI9A 3VAIA 2U2FA 4P2XA 3H7YA 2ZHOA 3PO4A 3OB8A 4AI3A 3ENWA 3H59A 1ZBA2 2ZEYA 4RS5B 4U8VA 4HR2A 4USJC 5F6KA 3BIEA 3H8XA 2PHLA 2J9DA 3D7SB 3VB9A 2Z30B 4UXAA 3NV4A 1ZZCA 3S30A 1G3OA 1S0EA 1DZRA 2IRUA 1ULCA 4RS5A 4D0QA 2NXEA 5GKAC 1S0CA 1SQGA 2PXJA 3BYPA 3R6GB 4USMA 1YLLA 3KDNA 1U24A 4IQMA 1UCXA 3QWUA 1TP7A 2HHPA 5CQGA 5A1FA 4RGAA 3K5NA 3TUIC 1PYSB 2ZOGA 3V2UC 2B43A 2JIGA 3T30A 3EM1A 2L9WA 3OUIA 1ZBTA 1K1SA 3JQXA 1JU4A 1IWAA 2DNKA 3K51A 4AFAA 1UFLA 2OFGX 4U7UD 1YFWA 4F4WA 5KT6A 2DR6A 1VAKA 2VOWA 1VBA2 5FPXA 4Y1XA 2Z4PA 3J7Z5 2AP6A 2GGPB 1UQXA 3FC0A 2RS53 2BGPA 5KFDA 5BYSA 1Y11A 1OVPA 3T9ZA 2R7EB 3OHAA 5FYCA 2CJKA 2R0FA 3OGGA 1ZM1A 2ERRA 1QSYA 4SLIA 2WCXA 3TEHB 4BQXA 4RSUA 4OUMA 5KFVA 3BB6A 2WQ8A 2JDMA 1UL9A 1OPMA 2C22A 2TEPA 4CDUA 1AR71 3LPYA 5DGAA 4WBFA 1LEDA 4CH1A 3ON7A 4RHV1 2VU9A 2Q8CA 3THPA 4NLUA 2Z0GA 4ZJQA 4TU7A 4RL1A 3ZXAC 3N9LA 3VAKA 1YBUA 5CA6A 3LAGA 3VUOA 2UP1A 2YFUA 2KG1A 3HHKA 3D2WA 3CD7A 4KGVB 5JOZA 2VG7A 3BO4A 2JG9C 3ZNJ1 4W6WA 1NY71 4LTAA 3MUMP 1E5IA 3DCQA 1EIYB 3LIGA 3CB4A 3LKJA 4ELTA 1XNAA 4NLRA 3I4IA 4X4SA 1JH5A 1R081 3FWEA 3KWMA 3G8SA 1N5VA 2RS52 3IKWA 1REVA 2IIHA 3TEZA 1FXRA 1NO8A 3D6FB 4N53B 4TN7A 2HS3A 1YJNS 4QXKA 1JLBB 3AOCA 4NA2A 3LA7A 3FCWA 3JQMA 2WZ8A 2ARAA 2JDYA 4MZUA 4N9IA 4A45A 2XMJA 4IH7A 1U5YA 2E1CA 2W1WA 2MQPA 5BXIA 4MV2A 2YROA 5D0GA 4H7LA 2FC8A 2WSCC 4ELUA 1WGPA 4FO9A 1KHVA 4Z1VA 1X9SA 3W8PA 1OD3A 1YRZA 1JLBA 3BBFA 2XCPA 5L1IA 3KFWX 2B42B 1TMJA 5EYYA 3QRPA 2B7CB 3FDSA 5H9FK 2PLV1 3MR2A 4WU2A 2ZBCA 2BE7D 4RW9B 2MQOA 4CI0B 4X8NA 1U8WA 1SQ4A 5IVCA 1QJU1 2W4CA 2YX1A 4AL7A 2FMDA 1FERA 1PILA 1TK8A 2JG8B 1L3VA 3JAMU 1TNFA 5EJZB 4RW9A 2CQDA 2Z8QA 3SHRA 1LEOA 5E6HA 2UUAJ 4JI8F 4TTGA 1VFJA 5GALA 4QPTA 3PNAA 1XMQF 2EICA 3UJOA 1QXPA 2JG8A 2B9UA 4NL5A 1MROB 4B1MA 1ZA7A 4RGGA 2VW1A 4V2WA 4KG0A 2Y1JA 4EE2A 4IRKA 1ELOA 2G9OA 5CB7A 1SL2A 2ZKTA 5LCWL 1AX1A 5JZGA 2MB0B 3I3DA 4FP2A 1MROA 1EPWA 1JYTA 3P96A 4JI1J 2FY1A 2HWIA 2F4PA 2BOAA 2XWYA 4XO0A 5T5OA 4DL6A 4K6BA 3RI8A 2FVSA 2IZWA 4HLBA 4YARA 2WTFA 2VBXA 3H9AA 5CBLA 2R6QA 3WVJA 5B0AA 4XACA 1N88A 4C8KA 3RZHA 1XU2A 5HQ8A 3HT2A 4OZ3A 1HNWJ 5EWEA 2DBNA 2B0GA 2C4XA 2EEYA 3AM2A 1R7IA 3MFAA 2F9JA 2ZM6F 1K1QA 3ZSJA 3LGHA 1VBA1 1RWPB 2R7XA 1ZZ9A 4NWWA 3DPRC 1UFKA 1W8ZA 4UT5A 5IVBA 3QBQA 1G6BA 5EX0A 3AJ1A 3GV5B 3O5TB 3AT1B 4NX9A 3NWRA 4DUYF 3IDAA 3H7JA 4KGQA 4XXAA 2HWB3 3BGAA 3CF5Q 1GV9A 4JI7J 4Y26A 4EYIB 4NPMA 4XFIA 3WNLA 4MK8A 1ZA4A 3KVBA 3Q8QB 4LUMA 3D1QA 1POV3 1CJDA 1Y5LB 1SL1A 4RWWA 5CISA 1T9XA 1WEZA 1YQCA 3IWXA 1SKWA 3BOWA 5EX3A 1CQ9A 4YB5A 1XNQJ 3O1LA 1IKYB 3A0NA 4UFKA 4ARYA 4L99A 1DHKB 3EUNA 1CVNA 2PAKA 3ACIA 2GN7A 3UGHA 3MFHA 1NK8A 4XK8C 2Q66A 3F2ZA 3OTDA 4FYXB 3IWZA 2ZX4A 4I0AA 2B5HA 3H5SA 1Y7PA 3BPSP 3FBMA 1RWWB 3EXCX 4O4GB 2ZH9A 2MKKA 1LNSA 1W9TA 1YNAA 4R25A 2W2PP 1WSRA 3DMJB 1IKYA 5CD4H 4ED3A 5IZHA 4XDQA 3WQ1A 4EWEA 1H9WA 3NAPC 4I0WB 1W8HA 4JDNA 3AXKA 3V0BB 1KS4A 4LA2A 3HHLD 4O4GA 5F41A 1GQGA 4PQQA 3EZ5A 4B9SA 2RS51 3RS6A 5BJRA 3DMJA 1ZYQA 1RU2A 1K9MT 1S55A 2AEZA 2XWBB 1HFEL 4I0WA 1MNEA 2BERA 1OH3A 2HWB2 3PVEA 3V0BA 3EWGA 2CNLB 3TW0A 3DNCA 2EC0A 1XYPA 2JX2A 3ZYRA 1TZ0A 3WINE 2WKKA 4FXWA 2JE7A 4URGA 1AYN3 1XR7A 3EICA 1CWPA 1FWLA 4YR0A 1LNQA 4QX2A 5KFFA 1U0HA 3VKMA 2XY6A 4EU0A 4FYWB 1YQ5A 1N34J 3NW4A 3M8RA 1BE4A 2DPIA 5KXDA 4Q4Y3 2OW4A 2WNUC 1RWKB 2GNMA 4FBFA 2VBDA 4QPGB 2CG8A 2XCAA 4OYIA 4K0KF 1GWKA 2EBEA 5IT4A 2RDJA 1GU3A 2WBRA 4DF8A 2EVXA 3NRUA 1LKZA 1Y3KA 1RQ0A 4P9JA 1JJHA 4KG8A 1GMUA 5E3PA 4QPGA 2BANB 3R27A 2X53S 2ZX1A 1QIQA 4OJ1A 1IKPA 5H9EJ 3AC0A 2UVVA 2XVKA 2AV5A 3S5QA 1Q81T 5L7OB 2ATLA 2XWXA 3IR6B 4UW3A 1TVGA 4C1XA 3HM9A 3S6EA 5IWAF 4P74A 1W06A 3FLPA 5FLXY 1GZCA 1S9EA 3AMHA 4LFAF 3HP6A 4DL5A 1M5PC 4EYUA 4A8OA 3V4IB 4I64A 3KQ4B 1U6FA 1XEZA 1UZDA 1T9WA 3SCGA 4J9OA 1AYN2 2VQ0A 3GG1A 3ZXLA 3RJRA 1JLEB 1Q7YT 4RX6A 3T1AA 4L3KA 4XTTA 4XMAA 4X4RA 4F3OA 3D0SA 2AW0A 1FI2A 4QIFA 2ZHBA 1T9UA 1J1TA 3PW5A 3V4IA 1TELA 4PLNA 4Q4Y2 1VRQC 1LWCB 4OI2A 1J5EF 4L3NA 1JLEA 4DO0A 3S7IA 4IGPA 1FV2A 4ENOA 2VUDA 1IG3A 3N3HA 4DR5F 5AXNA 3OV7A 2WC2A 4XTPA 3O1TA 1LWCA 3TQEA 1LGBA 1D9AA 3KLGA 4YW4A 1X8DA 5D3GB 1J27A 5DS7A 2IC1A 3MPVA 3HZGA 3MZIA 2E5JA 2RV9A 3LOBA 3ZYIB 2OJ3A 5BYRA 2AH2A 1WEXA 4DWIA 4LKEA 2ZKNA 5ETOA 2VBZA 1DDLA 1SLBA 5D3GA 1SKRA 2APOA 1S6UA 3OJSA 4OX6A 4NPRA 1WF0A 1U6BA 2Y8YA 5BNOB 3AXDA 2UV8A 2CQ3A 2XL7A 3IIAA 3RBXA 1XE8A 4HANA 3IM9A 4RR3B 3M2VB 4Q5OA 2CWKA 2XMKA 2ZH2A 1X60A 1LFPA 4IR9A 4MGKE 2YX7A 4L75A 1NSKL 4QU2A 5BNOA 1JUHA 2ZX3A 1RHI3 4TYBA 4P9IA 5IFTA 2GFFA 2KZZA 4G3YC 3ZN4A 4RR3A 3M2VA 3RRGA 1DBDA 1FV3A 2GHPA 3WF3A 1I5PA 3PJYA 2WJSA 1SC3B 3POEA 4YHHJ 2WABA 1LOUA 3QSIA 4DQQA 4J37A 2ROPA 4JRLA 4FDFA 1POQA 4K2XA 3AA9A 1GMVA 4F67A 1QWRA 4B17A 5FMBA 2EFNA 4IG3A 4AVAA 2GJ2A 3K58A 4ZU4A 3GZTB 1JHNA 1D3WA 3QSYB 3K3NA 1DQ5A 1SC6A 2RB7A 4NMIA 2HWB1 3CJXA 4ATNA 2WBKA 5IVVA 1UEUA 1N0UA 3I6PA 1N48A 3FJSA 2BFUL 2W95A 5L39A 2XJSA 2ILMA 1WG1A 5DQ0A 1N54B 4WVVA 5A70A 4IE7A 1POV1 1YTYA 2RDNA 1WC1A 4IRCA 2EIEA 3MLLA 5JR2A 5HP1B 3I32A 5AC92 4DR6J 3H5UA 2DVGA 2IBOA 4CLLA 1JW6A 2KM8B 1SJ3P 4DUVA 2P1BA 1L7QA 1IJFB 2ZVSA 1RHI2 2W47A 2XY7A 1S2EA 3O0VA 2VH7A 4FQ4A 3TN91 4KSEB 1RGSA 1DARA 4CM0A 4XOGA 1TQ5A 1ALYA 2B7BB 4CP0A 5KG0A 4BLGA 3LANA 3N5BA 5FZGA 1KD1T 3KLFB 3I97A 5IK4A 1APNA 2R8IA 2IAJB 2V50A 3BQ0A 1D9DA 3AP9A 4ZITA 1OLME 2H5JB 2ZGKA 3IDBB 3M2RB 1FRXA 3NNMA 4NIIA 4O0IA 1IBMF 4BPZA 4UQGA 4NO4A 1VQ4S 3NGTA 3HFKA 1RAGB 4HKLA 1HKAA 2EBGA 2MZJA 2GMPA 3KLFA 4W98A 2V09A 2AR6A 2JXAA 2IAJA 2QUOA 1DF0A 3I5AA 3M2RA 1U2RA 2DITA 4D3WA 2WT0A 2BQPA 4JV2A 1AYN1 3ZYFA 2HZAA 2A75A 1H0BA 4JTOA 3W5NA 1D0HA 2WSUA 2QCSB 5E3CA 4AEDB 2GX8A 4C8NA 1NZCA 2DGXA 2GHVC 1RUI3 1G6NA 2JDPA 4H2AA 5A32B 1PO23 5HMZA 2AZ5A 4Q4Y1 2XBPA 1MS9A 3V5RA 1NUEA 5E0OA 2HHSA 4AEDA 2QLWA 4U7UK 3KK3B 4WZQA 1QH7A 1HB2A 3HIFA 4CRJA 3CDAA 4NRUA 2X29A 2JX9A 4D3HA 1EAYC 1OSDA 1L3JA 4XBNA 2RS13 1RACB 2H51B 2OUJA 4KL1A 2VOPA 4UFLA 2XDVA 3FUQA 3LO3A 3BSOA 3V4MA 5KG5A 4FAGA 5EWSA 5FMOS 1RE1B 4F3JA 3KZ4C 4NROA 1X0PA 1LQ9A 1RT4B 1BLUA 1JN2P 1WLCA 4Y65A 2W1QA 4DEZA 4J9RA 4UBGA 3UGFA 1UYXA 5KFYA 3U1LA 3UNPA 3V0AA 5J2NA 1H1AA 1OSCA 5CCLA 2VQEF 2UUCF 1P1TA 4F4AA 1N5QA 1TMF2 3MGUA 2VG9A 3WF0A 2Y38A 4NXMF 1VQ7S 3AZWA 4ECUA 3PR4A 3FLTA 1RUI2 3KLEB 5FZOA 4BU2A 4DV2J 1FNOA 5A7SA 5FZFA 1SB6A 4TU8A 1PO22 4HTIA 4NXNJ 1LKNA 3LA2A 4L97A 2FZ2A 4PEOA 3GYNA 5KFAA 2V4VA 4ETXA 3KLEA 4ZCKA 4BIFA 3ILOA 3NCQA 3W3SA 5KFNA 5DN2A 3ZC4A 2XYGB 4Z7CA 3LCPA 3CMES 2RS12 4P14A 2DGTA 3ZN6B 3QIPB 4LO7A 3GR1A 3UR3C 3RZGA 2E1MC 3FEXB 1ULEA 1WORA 4LOTA 5KFRA 1RXFA 1FVSA 1A6LA 5CA5A 5DDPC 3MCOA 2BQUA 3W5ZA 1YC61 2HBQB 1TAQA 3MEKA 1DLLA 5C3PA 3C66A 3V81B 5I8YA 3ZN6A 3QIPA 4AK3A 3B54A 3SLIA 3PIOQ 4PIZA 4YVSB 3CJQA 4AL5A 2LYVA 4OZXA 4NUBA 3LDRA 3T41A 3C8XA 3UO0A 4M5NA 2BE9B 3ULHA 1LGNA 4DR1F 3V81A 4F83A 2GQCA 3ZR5A 4IE4A 2D1CA 1PX4A 3KV4A 2NN8A 2OTLS 3AMPA 5FZ9A 3M6WA 4JI0J 4W6YA 1KEXA 2WVFA 3VKLA 2BW8A 1WDTA 5B0CA 4KH9A 1WHVA 3ZXWA 4LRFA 4X4NA 4DR3J 4TY8B 4HBNA 3I2FA 3UNYA 4BHQA 4FQZA 1NMEB 2P9GA 2A3WA 3W2WB 2DH8A 1HV1A 4JQRA 1JZ3A 3WD5A 1RTDB 4UW2A 1RBLA 4X65J 1OY9A 4HHHA 3DN7A 1VJWA 1Y3TA 2DNGA 4M1KA 4FPLA 4TY8A 4LLFA 1CAWB 3BPSA 5FYBA 2ABYA 3C7HA 4LT6A 5ETPA 4CLFA 4LHSA 2QRRA 2XS2A 1U49A 4LBHA 4XUNA 2E7TA 3LEIA 3T2OA 1QU0A 3ECQA 3FN9A 4IEZA 2AJ0A 1XJWB 4M5IA 5CVRA 4YRDA 5D0RA 1CAWA 3N9UC 2BPA2 3VBRB 2LDIA 2YBSA 3T2PA 2GU9A 1Y7BA 2VR4A 2DT9A 4GH4A 3FBEA 2CWSA 1SH2A 4CO0A 4QWDA 3ZIXA 3E3XA 3LQCA 4BZ4A 3O1OA 2XSJB 1CX1A 5LMNJ 5F39A 2DDUA 2DU1A 3VBRA 1JLAB 1VBC3 2JDNA 4PCRA 3VBUB 3CO0P 3D6TB 4U8YA 1WKKA 1YX2A 3V6KA 4Y2AA 3OTBA 3LD8A 3EXYA 2R073 4WK3A 3PVOA 2VXJA 3QRQA 4XTMA 4KH1B 2XSJA 3FKBA 4F8RA 2CPXA 3BUCA 4MHUA 1S72S 4RW7B 3QRRA 2QJVA 2LKZA 4CU7A 4IRDA 1JLAA 1ZRCA 3KYLA 3VBUA 3X1LB 4B3MJ 5KHHA 4RO0A 2GC0A 1VMBA 3LFIA 4ECYA 2WO2A 4LF9F 1GP6A 2WO7A 3USUB 4IETA 4RW7A 2YB7A 1FXDA 3GHMA 1ZS6A 2W2OP 5C33A 5ABJC 1U1MA 4Q26A 1YDLA 4DEQA 5IVJA 1JZ4A 1PO6A 3HKZD 4RW4B 3W9AA 1FJEB 1RC6A 3RBEA 4UUXA 2QDRA 3KV6A 3ZYBA 3QZ8A 5JMOA 5H9EK 3PJXA 4ZLNA 4EJRA 4AT1B 1HNIB 3C16B 2Q43A 1Q86T 1B35B 2DVAA 3RJMB 3KDOA 3J81Y 4Y28C 4DMIA 4RW4A 1RUI1 3L7PA 4QJVA 5I8SA 2CDRB 2B8PA 4LT5A 3Q86A 3Q8FA 2IC3B 2X5IB 1PO21 1W6OB 3BEGB 3KHLA 2UXCF 3C16A 3VV1A 4HHUA 4PHZA 3IAM9 1U1LA 4ZVQB 1B35A 1VBC2 3T19A 2GNBA 5L9RA 4W6XA 2HQ3A 5GAHI 4JV1A 2R072 1MR5A 1YJ9S 1TK5A 1Q7LB 2IC3A 3VVTA 2X5IA 2GC3A 5IV4A 1KLMB 1RT1B 2VZ9A 3ZZUA 2KHDA 1M5HA 4HK8A 2A18A 2RS11 4AGGA 5DDQC 4FXGB 1OOPC 2VNGA 3J9SA 1N32J 2JWPA 2KYXA 2AGSA 4AL9A 3SMHA 3ZYJB 3R5AA 2HRYA 3MM5B 4ILLA 4YB7A 1KLMA 1ZRDA 1RT1A 1WF1A 4TLQA 5CKQA 3W61A 2HWF2 1KN6A 1VAVA 4OI4A 2V94A 4LF5F 2QVSB 1CPMA 5CCMA 2K8GA 4NZ6A 1VIWB 2HHVA 1NA1A 4Z82A 1X4AA 2GNKA 1LU2A 4OYUA 3BKFA 2KZMA 5JSPA 1VI7A 4C8MA 2VPZB 2XHKA 1X5SA 1RCXB 5A7WB 3NCPA 4G1QB 4RL7A 1SUQB 4Q45A 3CC7S 4LR7A 4YUDA 4JKLA 1SCSA 4OYWA 3VZIA 3NGDA 2YKMB 3C7OA 3R5CA 4UQTA 2DH9A 4F02A 3OT9A 1UAIA 1S1AA 3RAQA 4LMZA 2A6YA 4XPCA 1UEKA 5HATA 2QQWA 1NXMA 2VV5A 4Y0FA 2WSVA 5A7WA 4G1QA 4B3TF 1SUQA 4XIOA 4AXIA 3D54A 2EXHA 3GM8A 1HX6A 1R6YA 5AJ3J 5L1JA 3PW2A 2JIJA 4WVMA 2YKMA 1LECA 3ETMA 4NZ0A 1TU0B 1JYVA 1VC5A 1RHKB 1BQPA 4E4HA 5DZ6A 2SXLA 1KR4A 2VFSA 2MTLA 2YBPA 2YNFB 1RAJA 1ULPA 2UVRA 2XHNA 5BNPC 4EN7B 4P2MA 3PDNA 1YJKA 2X1BA 3L9JT 3UI3A 3MOJB 2VZSA 2B6AB 4TYAA 5HL7Q 1SACA 4J6GA 1R8HA 1P6TA 3V6DB 3HPOA 4QOTA 3BI3A 4JX0A 5LSLA 2A6MA 4RJVA 2VONA 3DLKA 3O7OA 2W7OA 1QLNA 3M1HA 4E8UA 1N36F 2XMMA 5AVPA 2XNRA 1DQ8A 5CH7B 3RRKA 2DY9A 2B6AA 3Q0AA 2VBBA 5K9YA 3ISND 1FXZA 1LXJA 3DF0A 1RUG3 3V6DA 3PHMA 2EFPA 4BHPA 2OZ6A 2BEOA 4P9YA 1F5AA 3HJVA 4NLXA 3CJTA 5KT4A 4QM9A 2GHWA 5BNNA 4N90A 1YGYA 3U1XA 4L8QA 2VB6A 2ILZA 3BTYA 2X3GA 1OPZA 4CEYC 1W8TA 4JV4A 2N7GA 4KO0B 5IJRA 1N5YB 2V5YA 4RFT0 4MYUA 1N5TA 2IFWA 2M5YA 4KWLA 1Q5VA 1G9BA 3FJ2A 2HIYA 5F3CA 3JTOA 2JKXA 3OEBA 5J2PB 2DCZA 4PXBA 2KVIA 3GU0A 3OD0A 4JAAA 3RU0A 1N5YA 2GSYA 1OLQA 1NDKA 2W94A 4IESA 3TZZA 2NZ4A 1VP6A 3HBKA 3D3BJ 1TKDA 4YVWB 2OS2A 3M9NB 5JDBA 1LODA 4GULA 5J2PA 5KFXA 3GV8B 2RQCA 4NYZA 4C0BA 3IGVA 3K2OA 5FY5A 4OYBA 4Y2CA 5JUMA 3C15B 2RVAA 4PDWB 4YVWA 4YEAA 3NGRA 1HRV3 1LHNA 5AT1B 2K9ZA 3D67A 1N4LA 1REGX 4RU9A 5A3NA 4I7FB 4C8YA 4CLKA 2YBKA 4IERA 1OKOA 1J1LA 4H4KA 2AC1A 4RKUC 3OBAA 1B7FA 1TUGB 5FOBB 1H1MA 1RUG2 1JYCA 3NKGA 2EFQA 3C15A 5EJ1B 2X1AA 4PDWA 4XFFA 2CAJA 2YC4A 3LDKA 4USWA 2QGFB 2X8KA 4I7FA 4WXOA 3HNMA 4G3IA 5A76A 3HSGA 3U02A 2E7WA 4QR0A 3AKPA 1UU6A 5FZAA 3VN4A 1UPSA 4PG4A 3M6UA 2R071 3WT3A 2XGXA 2IHR1 4MKAA 4I6AA 1LTEA 1PYTA 4GKJF 3Q8RB 4NR1A 3CCJS 4RNOA 2W1SA 3MHZA 2DHAA 4QX8A 1UAWA 5A8RB 1FRHA 4DPUA 4ECTA 4DL3A 1GOFA 1TK0A 2OAUA 2DV9A 4OLPA 1P8GA 5C8CB 1VHFA 4KRWA 2IRXA 3TAYA 2D5FA 1S57A 1SCRA 5FY8A 3Q8PB 4KBBA 1FNMA 2BJSA 4J9UE 1V6HA 4YZ2A 1Z78A 5A8RA 1NXIA 3MD1A 2RDSA 5ADZA 5F8IA 4CTEA 3L2YA 4A8FA 4C4WA 3VWSA 2PA7A 3CUNA 2KN4A 4YY3F 2B46X 1LOGA 1W39A 3LIHA 3H1MA 2EI5A 2HAFA 1NUKA 1HRV2 4QXBA 5J1PA 2WN3A 1R1ZA 4PXEA 5LEJA 3TEWA 5LA2A 2AJFE 2GVDB 3V6JA 4LRAA 3R4UA 1V6NA 2A6ZA 2WAOA 4Q0VA 2DRBA 2G1MA 2VL4A 3MR6A 2UWBA 1C0TB 2UXDF 5F37A 3H2UB 5D6GA 2QA4G 2BWCA 1DTTB 3L09A 3R1LA 2VOOA 2GAHC 2SLIA 2GVDA 4Q4X2 1NSPA 1OQ6A 2QT7A 3RYPA 1VQYA 2V8GA 4PABA 2M9KA 4XVHA 2O1QA 3T1MA 3RGIA 2RAQA 3EGNA 3NRBA 3H98A 2VVEA 4G9SB 2E6VA 2RJKA 1UY0A 4PBOA 2RHPA 2DF7A 1DTTA 1T9VA 3A4TA 4N7UA 1UN1A 1S0IA 1WMEA 3OL8A 1NKEA 4GVLA 1CAXB 4E8CA 4AI8A 4FKYA 1KOOA 2Q5TA 5KG7A 4LBQB 1VR6A 1HW9A 1MQTB 2DGWA 2VKRA 4K8RB 5KHKA 3ES1A 3OGJA 3ZFGB 1HV0A 2K2PA 1CAXA 3DRRB 1ASJ3 1IBLF 5FYIA 4FS1A 2ZBJA 2OA2A 3UKNA 4LBQA 1HI0P 5HQMA 1MQTA 5JOWA 4ARXA 3N9PA 1A0OB 2XGQA 4K8RA 1DYOA 3VDAA 3ZFGA 1BY9A 2PA8D 1NCRB 3DRRA 3HF5A 4JI8J 3WG3A 1UKUA 1QM9A 1HBOB 2C2NA 2HAIA 4RS5C 3I2DA 4DV1F 4YW3A 2EG2A 1MMDA 1G86A 4WP8A 1WLWA 1NCRA 1D4VB 2PHTA 4OZNA 4CPBA 2GIQA 2OD4A 1LRHA 5KFEA 2P6TA 2G0JA 3U10A 4DMZA 1HHTP 4AYUA 1CZTA 2BRLA 2MHEA 3CC4S 1JXVA 4XEZA 1AR93 2UV8G 2A2CA 3WDTA 4GQ7A 2OPRB 3B9CA 1AX2A 5ANQA 1PSDA 3OTOF 2KXLA 2GZOA 3ZXDA 3N6LA 2R8KA 1VQKS 2VG6A 4RNNA 1IS5A 3NNLA 3T5HA 2D3SA 3LA3A 1U0SA 2B9XA 4L11A 5ACA2 2HFOA 4KGMA 1ZM3A 2QMXA 2W24A 2ZABA 2J9CA 3NV3A 2OPRA 4LRCA 2YU2A 4CYDA 1ASJ2 3POTB 3B00A 4NLOA 4CRQA 3PM9A 2XONA 1CQNA 3VGSA 4C8LA 1DG6A 2CDPA 3FGVA 1RUG1 1B4SA 2PQQA 2LMIA 2ZM6J 3NQHA 4XHXA 4RPFA 1U26A 1YXWA 5C42B 2VUJA 2X1FA 2ZZMA 4ATEA 3POTA 3HN1A 2BVBA 5HV0A 5K20B 1MMLA 4GA9A 1KFXL 5LZ6A 4DUYJ 3SZ2A 1KHWA 2FMYA 1JX4A 3T4VA 1H7XA 4F2SA 5D0HA 2E5GA 1COV2 2VFRA 4OJHA 5C42A 5A80A 5D8AB 3FQKA 1SJ1A 2V73A 2L9LA 4Y34A 1DQ4A 4DIQA 1AR92 5C4WA 2ZACA 3WHIA 1FA0A 1S77D 4TVAB 1OQ1A 1YRUA 1S79A 1CJVB 3CMAS 3THDA 2DRAA 1X4FA 5D8AA 5FBJA 1A9NB 2B9WA 4FAHA 2CQ4A 4DL7A 3K46A 2BEFA 1ZNPA 2M2BA 2D98A 1GZWB 3OFGA 4A7ZA 1NK9A 4WJBA 6FDRA 1HRV1 4FFIA 1CJVA 2R4FA 2DCJA 4J9KA 3K4ZA 2CJYB 2IXCA 3UN3A 1NK6A 1ENXA 1R1A3 1GZWA 2D3ZA 1W2IA 3HHDA 1J58A 2AJQA 1ZZ7A 4XAEA 1U09A 2OX0A 2W4DA 2OQ7A 4JV5F 4OZJA 5HBMB 1GNYA 2AEFA 4QWAA 3OQ2A 5CYJA 4G4FA 4QM8A 4UW5A 4P7VA 1BGXT 1T3OA 4PXDA 3O6QA 4BC9A 2EWHA 5JJBA 1LB2A 3WC0A 3M2UB 2W7AA 1DGRA 3TARA 1NKCA 3TJAA 4QX0A 2O1PA 2LROA 2VZVA 4MIAA 2RU3A 3K8VA 1U5ZA 4U95A 5B2GB 3HPNA 4F04B 3MEDA 3K5OA 6AT1B 4TN2A 3ZZRA 2OMLA 3M1VB 3M2UA 4EBEA 5A3MA 3OSNA 2C2MB 2AMCB 4HH0A 3RPQA 1BYHA 4XDCA 2JL9A 2GZWA 2BM0A 1U1QA 5DDRC 2BUNA 5L9NA 3GJSB 5DZ7A 1NH8A 2VMCA 2XJRA 4K5SA 4QYRA 4UW6A 2JG8C 1RBAA 4Y20B 5C24B 4YB6A 4LUBA 1R1A2 4B9TA 2QLXA 3HEIA 1RBOB 1W8WA 3INAA 4IEOA 1C4CA 3PHEA 1YFUA 3BPZA 1VGYA 4S0MA 4NIDA 4A41A 2R7RA 5K0UB 1UMHA 4NWVA 3RB0A 3IPVB 3S1TA 4KBIA 4DX7A 5SZTA 1F8VA 4NEZA 4Y20A 5C24A 1H6YA 5IWAJ 1QTMA 1B0TA 1S12A 2P3YA 3UV9A 4Y33A 1RA6A 3K17A 3RZJA 2NMNA 4ZXKA 3VBHB 1UA1A 4LFAJ 1KJRA 4K5RA 3VZOA 2YTCA 5K0UA 3NAHA 3I8TA 1H4HA 2HKEA 1QKQA 5IT9U 3QACA 3EDQB 3NS7B 9ATCB 1NQJA 2PDAA 5A6YA 4IW3A 3PW0A 4LKDA 4FPHA 3VBHA 1V6LA 4QKFA 5DM6Q 4HVRA 4WM8B 1XNRF 4QKNA 4HPKB 4EZHA 1J5EJ 1ZA2B 2RMU3 4XFAA 4UOHA 1V3SA 4Y2IA 3WZ0A 1ASJ1 4WVZA 5T7LA 4DDFA 4Y22B 3BODA 1I6JA 4R0EA 4WBBA 2JENA 5EP9A 5FZ3A 4S2HA 5C70A 4DR5J 4A8SA 5KFIA 3S8SA 4WM8A 2OI2A 1JK9B 4HPKA 2FZKB 1OD5A 2EK6A 1PGSA 1OA4A 1H0HB 3FFZA 3FMBA 4Y22A 3AY0A 4IO1A 3QNWB 2QLBB 1UO9A 4ZOSA 2AX0A 5CZVA 4RUAA 1NB7A 2K2SA 3J26N 1BQNB 2C2OB 5JIUA 3KF5A 3H42A 5B4NA 1NHUA 4BOWA 5FUNA 1SJRA 1MACA 3LAKA 3M8LA 5FD1A 1GK8A 5GLVA 1WOPA 5D4NA 1PAEX 5FUIA 2EVZA 2P17A 1T9TA 4ZVUB 1AR91 4F36A 4ZVTB 2DO0A 1FTCA 1IBKF 2NCKL 2KRBA 4PWWA 3ILJA 2CYYA 1REEA 3WF2A 2JJ4D 3DV8A 4BB3A 2PMWA 1PNGA 1C28A 4I6YA 5EGYA 2Y6FA 4I2PB 3RZLA 1OO0B 3A7QA 1X8EA 4XIUA 2HHUA 2XKOA 5D15A 4CLUA 1Y9QA 2RS2A 4ZY9A 2QDNA 3DGPB 5T50A 5J1NA 3SCHA 4ES3A 2RMU2 4EN0A 2LW8A 3D0IE 2MLXA 4FSJA 3PRDA 3RWKX 1JYIA 1EY2A 2LEBA 3D3AA 3T5KA 4XF4A 4JZRA 4P10A 4YG0A 1KWMA 2VC1A 3UGGA 2HYXA 1TL7B 2OKQA 4O61A 2BQ3A 2UVUA 2PEBA 3DGPA 2JLFA 3G6JB 2B8QA 2PTMA 4ASMB 1BCXA 4PPDA 3AAWB 4KYZA 5K5MA 4AFFA 4LF7F 4ZVEA 4LBQD 9RUBA 3RG6A 1GOGA 4LRDA 3KQRA 5FPZA 4CNZA 5E33A 1TL7A 4HSLA 1VQPS 2Y6JA 1U6ZA 2BTVC 1NPPA 3VBOB 1JOPA 3IC1A 3ZYHA 4WIIA 2M0GB 5FZEA 4WV8A 3TEYA 3NL0A 5IQQA 4YM0A 1F1BB 3LPGA 3CL1A 1BQXA 2UUTA 3I2GA 3CJ3A 4OMDA 3IBWA 3QD6A 3VBOA 4N8NA 1S1XB 4QWBA 1ZRFA 1VJQA 4QIVA 2CAUA 2WQZC 4DR2F 4QPGC 4DX6A 4YNIA 1MU2B 2AYHA 3IN9A 1HBUB 2XLGA 3IM0A 1IZ3A 3R6LB 4DBQA 3T1YF 3PDQA 1PO12 1S1XA 4DXLA 4GRSA 3MF6A 1EARA 5CU1A 4C3MA 1SLCA 1LW2B 4RLEA 1RYRA 4URSA 2AT1B 5KXCA 1R1A1 4HL9A 1Q8QA 3UESA 4OI6A 4XJAA 3ZFFA 1MU2A 1HBUA 3A3PB 4YMEA 5L7OC 1IBMJ 1U1KA 5BYQA 1LW2A 3CJ5A 4XF1A 4PQAA 4K4XA 5DAVA 4C7QA 1R0BG 2MQNA 4AR2A 2AYEA 5KG6A 2GQ2A 1S1TB 3F56A 3TP2A 4AEMA 2VZ1A 3CIMA 1B7YB 2QQUA 2V8DA 3P5TL 3KNAA 1W0OA 3VGIA 4J1WA 4M8LA 2A3YA 2UYAA 4QDSA 4FT8A 1S1TA 1L3UA 4E2QA 4CLZA 3WDXA 5CYQB 4A8QA 2ACYA 2ROGA 3NWGA 1FX4A 1XOYA 2DNRA 1T05B 4OZ2A 2IRYA 3ACHA 2V34A 4QGMA 3MEEB 3PYEA 2VODA 1RITA 5FDLB 3UR0A 2QJ3A 4M3CF 2QQOA 2PGCA 1GFF2 4ANEA 1U4BA 5CYQA 1N6QB 4DCOB 2DHSA 4ES1A 2FQQB 1T05A 1RB0A 2WONB 3P5BP 5FPBA 4XUPA 1GT8A 3MEEA 3VAJA 2ZJQQ 2W8KA 5FDLA 2CQCA 2GIRA 3TZYA 5LSRA 1N6QA 1U1RA 3AZVA 4YDDB 1HB4A 4QXCA 2DXFA 2WONA 2X7IA 1CPNA 5A3TA 5B4XA 2J8SA 4OMCA 3GIJA 3O0WA 2FHMA 1WKJA 2VG5B 5FKCA 3ZKUA 5J37A 4NMLA 2VQEJ 3AYAA 5BNOC 1SQEA 4GWIA 4IEXA 1HN1A 1BMQB 2BJ8A 1QJX3 5DLFA 1CGPA 4NLPA 4RR3C 2YY3A 4LHNA 2VBWA 4NXMJ 1U47A 4FPJA 3M8PB 1JYWA 2AENA 4IKAA 4ANDA 3LF0A 4DZDA 4NA3A 3A13A 1T7PA 1DHMA 1HWKA 3GALA 4AEJA 1O8BA 4NRTA 1WDDA 3M8PA 2RMU1 3TJ8A 1HQWA 3POWA 5H9QA 2KR2A 4MFBB 4BQ1A 3UDEA 3H8UA 2E9QA 3TQ1A 3PUHA 2X1GA 1YYNA 4DJBA 3O1VA 1IKVA 2WB1D 2YKNB 1UMJA 4MFBA 4XUTA 4B4QA 2ZZNA 1PVC1 4KWKA 1REFA 2WIIB 4W8JA 3ZO7A 4RWXA 2M88A 2BU9A 2HNDA 5E7OB 2YKNA 1VRBA 2H6BA 3OFEA 3MIDA 4ZPCA 2DUPA 1C1BB 4EK2A 4RQPB 3PYDA 2YG0A 1QJX2 2MXYA 3ET6B 2KTQA 3OJBA 4N41A 3J81U 5D0EA 2RUSA 3MUVP 3PU3A 4DR1J 2NXNA 2V4QA 3V65A 4GMP1 4YOEA 4AGRA 2KM8C 4CCHA 1C1BA 2ZPXA 4RQPA 4QX1A 4XCBA 5HK4A 5GLUA 4MVTA 2FDIA 1R6VA 4KPCA 4G6VB 3VLBB 3GZ7A 5KG2A 3OSDA 3QAUA 1DIWA 4LVNP 1NOVA 3OBRA 4PJYA 1QY4A 1UJ4A 3EVMA 2ZX2A 1SC4B 1UPPA 4LBJA 1KQFB 2AUYA 2MY7A 2Y64A 1TKTB 1AUYA 2AJ1A 1ZM9A 1BHNA 3U75A 4W92B 3VD7A 1KC8T 3T3YA 4KHPF 3MZHA 1YIFA 1Z4UA 2E5IA 4Y1ZA 4Q0UA 4K4TA 2V5DA 4U6PA 1W9YA 1MWQA 3OLBA 1ZTWA 5IM0B 2A1BA 1TKTA 3DYAB 3VR1A 2GALA 3FHIB 5A3WA 3ILIA 5AE3A 4AEDC 3GONA 3RYLA 1EUTA 4KHRA 2MQ8A 2OIHA 1RXOB 1WKLA 1NZAA 2JVOA 5IM0A 5T52A 3DYAA 3BN4A 3WG4A 2D9PA 4QWEA 2XLFA 1YO8A 2OEJA 4DB5A 5GZDA 1WTBA 4TLFA 4FPGA 2XMLA 4NVPA 3MCSA 3ISNC 1I1EA 2UU9J 2NLRA 2P34A 2ZBRA 4C97A 4KAIA 1RYSA 1ENRA 3QQCD 1URNA 4AHYA 4FPIA 4MGSA 1RDRA 5B08A 1SBDA 4LF9J 3BO3A 3NMBA 3TUJC 4RW6B 5JXHA 2LU1A 4FTBA 1IKWB 3H8OA 1WHWA 1HWJA 5JR7B 4HHJA 3FZ2A 2VOTA 3G6XA 4UT4A 2UYBA 3FZBA 1U12A 1BWVA 3C14A 2HWC2 2E66A 1AX0A 4RU2A 2TNFA 2XYPB 1J5OB 1EP4B 2EF6A 4RW6A 2YWGA 1T0TV 1RA7A 4J90A 4DV6F 1HNXF 3VHQA 3D66A 3W9HA 5F8NA 4MH8A 4K7QA 3M3EA 3RRDA 3LWMA 1JNRB 2JC1A 3DXBA 1U1NA 3MCMA 1J5OA 1EP4A 4CP9B 2OFHX 1F2NA 4ZPIA 1XR6A 3JB8A 2DYCA 3WSOA 4QX3A 3CKHA 3WX8A 3EO6A 4XPEA 2ZBPA 5F5IA 3C3LA 1NZIA 3M4XA 3I5BA 4A4JA 1RXGA 2YHJA 5J3UA 4XILA 4CP9A 4QIEA 4PPZA 2YC0A 1YITS 1XSQA 2QZ8A 4OZLA 4YGBA 3DDNA 3IS9B 2XUEA 4QZVB 2AHOB 4ZP8A 1JZ8A 3BBBA 1NK5A 1SVDA 4UY8T 3OY8B 2V8VA 3TJ9A 2GNDA 4FFHA 1Y10A 3DLHA 2XH6A 5A7OA 3P45B 4TQSA 2C2EA 4XDOA 1UXXX 3RGBA 4ASLA 5J09A 4P2FA 3PKMA 3IS9A 2VMIA 2BACA 3RBDA 1DQ0A 2DPJA 4LF5J 5FWEA 3T08A 5A33B 3K7RA 3HD1A 3OY8A 2VIHA 3SEPA 4R52A 1JZ6A 2H4WB 2VQTA 2XB2D 2QL9B 2EG1A 1QJX1 4A6SA 1RAFB 2Y60A 4Z2AA 2J7MA 3NAIA 1C57A 1VLYA 3BQ2A 3SV3A 3I3EA 5A33A 2WUHA 3HBZA 3CJ0A 2DY1A 3SFGA 4C8ZA 1FD8A 2CIMA 3D68A 1JI6A 2D9OA 4XW3A 4ZN3A 2Q8EA 1O8PA 2YNIB 4UZBA 3QWPA 4NE9A 4B3TJ 4K50A 4P9WA 1D09B 4M4RA 2DNNA 4UFIA 3SNMA 3L4BC 3NG8A 1NT0A 3R7SB 1V9U3 2K7KA 4ITSA 4ZVOB 2YNIA 5E41A 1F3VA 4NHXA 4F4ZA 3KT4A 4ZS6A 1L3SA 4IE0A 2JSXA 3LE0A 4EQVA 1SI9A 2CQIA 1UD1A 2VNVA 4J9NA 4PZVA 3R2DJ 4COYA 1IM6A 5E2QA 2FLOA 4I0BA 3KG1A 4MIBA 2UUBF 3X3UA 3V6HA 2YPYA 1QEXA 2B8MA 1GLHA 3LDBA 3OPWA 1SH3A 4WFAQ 3B01A 1G9AA 3KJVB 1IM4A 4HN1A 2BP6A 4ZU7A 5ETVA 1OLMA 3VBRC 1N36J 1UZWA 5FZKA 2DYAA 3U78A 4QQ2A 1XK8A 1ONAA 2CRLA 1ZRIA 2HBUA 2LRPA 1Y5IB 5BYNA 2WAAA 2K06A 3LPFA 4FXKB 2BKNA 1RAAB 2XLIA 2VQFJ 4TSVA 2IJNA 1SPPA 1WG5A 4P73A 1I94F 3M3CA 3VBUC 3D0HE 5A7QA 3MV01 5D4PA 2ADEA 5KWRA 3GNEA 1ZAXA 2I9SA 5A2QU 4O3QA 4XPVA 2QMWA 3EX7B 3M2MA 1WG4A 4EYHB 3HFZB 5C2CA 4X64F 2YUEA 4K21A 1MVQA 2XLKA 3MYXA 1TG7A 2R7SA 3NNGA 1FDNA 3GMGA 3Q24A 4QKDA 4AXOA 2XJPA 4FPKA 4Q0QA 5EYXA 4OZ1A 2RDRA 4O9GA 3IWNC 1V9U2 1L7LA 4ICLB 4U96A 4LUKA 1MZ5A 4ES2A 3D0GE 3I5CA 4CQ1A 4ZZ8A 1SFPA 1T94A 2BM1A 3PIGA 4ED8A 3DYOA 4ZHNA 4ICLA 4C9DA 2R2UA 1G9CA 5JMNA 3IBMA 1ICEB 5FY7A 1AT1B 2LQJA 3IO1A 1B35C 4NAOA 2MKCA 3KV5A 1JJ4A 3TUPA 2MDAA 2YVSA 2RU9A 2J9DE 2HEWF 3C3VA 4N43B 4HFSA 4B3NA 3FUYA 4CA9A 5GZGA 3K0JA 2X5IC 2OLWA 3AVSA 3I2HA 1L3TA 3C46A 1NKBA 1YIJS 5B0DA 2DNOA 3M8ZA 4FF1A 4UFHA 2I74A 4A3ZA 4N43A 3J8F2 1YFXA 5FR3A 3SMZA 4GKJJ 2Y0IA 5IK7A 3OFHA 3G87A 2FHJA 4Q2MA 1NJZA 3KHRA 1YSJA 3FBBA 3B78A 4ES9A 4NCGB 4BCAA 3EBRA 1RTIA 4EBCA 2DUOA 3IA0A 3ST7A 1NA1C 3MLKA 1D4M3 3WF1A 4KGZB 1H2MA 5FYTA 3BSAA 3K8WA 1RUOA 5K8OA 2XGPA 4CZCA 5LXRA 5C25B 1IQDC 3ZPOA 3NV1A 2DNMA 4KMQA 4C2MA 4NCGA 1FPN3 2YQ0A 3VCDA 3HR9A 3LEGA 4ZKTB 2Z2ZA 1FE4A 3Q8YA 1HPZB 4YY3J 4IR1A 3KUEA 1QSSA 3MMCA 1A78A 4LBIA 5M2UA 2OZJA 2ZNYA 4S2FA 3WNPA 2XJQA 3WW2A 4QHBA 1OHFA 3VL9A 1U8SA 5C25A 4PT6A 4FFGA 5HROB 2ZUGA 3CIZA 4ZIVA 5IOLA 1HPZA 4IYQA 4XFCA 3VAFA 1W6NB 2K1RB 1HIXA 4CCLA 2RILA 2UXDJ 2FDGA 4HEA9 4AVCA 2WLPA 2GN3A 5IK5A 5HROA 2CPEA 1N8RT 3BH6B 2Z69A 4NHYA 2BVZA 2XO7A 1W6NA 3FUOA 2K1RA 4OL8A 4GB33 5DGBA 1YUDA 5B0BA 4QPWA 1CPZA 5JPMB 5F9NA 5FJHA 4LSZB 4ZVGA 2XBO2 1N56A 3P4UB 1CJUB 1RU1A 1B3TA 2YNHB 1D4M2 2A73B 4IFVB 4JBCA 3IMMA 4IL7A 4RD7A 4ZPBA 3VHNA 4UBHA 2C3MA 3VZHA 2F8MA 1T6GC 2Z57B 2PHWA 4M3CB 2HBTA 1ZZ8A 5DUXA 1FPN2 3PMEA 4NIGA 3J4UH 1IBLJ 1SZBA 5A6WA 3Q8BA 1CJUA 2YNHA 4Y4YA 3ONQA 2R2RA 3J7A1 4IFVA 5IAXA 3O2IA 2P6CA 2SBAA 1JZ7A 3TEXA 2DR9A 5KC5A 3B7MA 5CKMA 2B4PA 1HLCA 1SBRA 3ZZOA 1GR3A 4CDQB 1QY7A 2OPWA 4IEYA 5C71A 2PD1A 4YZ1A 3QT6A 4NWBA 5F8JA 1S2KA 2J0QD 3I3BA 1PM7A 3BSNA 1W04A 1CZSA 1NHVA 1UKGA 4DV1J 1JWWA 2R7TA 2JOQA 1VRTB 3U1NA 3RWNA 3T3FA 4CDQA 1UETA 3A8EA 3EZOA 3VHRA 3H0PA 1Z2ZA 4UY85 4WKRA 4AFBA 1AW0A 1W2OA 1V9U1 4YVWC 1ND2A 1VRTA 3PEHA 3KOAA 2MLZA 2VUAA 4YWAA 3R97A 3G6VA 4HONA 3SCFA 1RMU3 2H0VA 4CTAB 4LXLA 4H4KC 1SLAA 1VBE3 4QWNA 3MPPG 2BJ9A 1YLXA 2LU2A 1RUJ2 5L1KA 4PDWC 1YHQS 3CO9A 3RBZA 4H7MA 1RB8G 2XMUA 3W7BA 1VQSA 4CTAA 5DRKA 3AD8C 2HHQA 2OTJS 2R1BA 3QBCA 3ZLIA 4N7TA 2BE2A 2V69A 1V6IA 5EHHA 2MSSA 3UD4P 4PYAA 4IO9Q 1J3RA 4QPIB 4F4YA 5BNPB 1F60B 3MIFA 4Y4RA 2NZ9A 4Y6IA 1OA2A 4PG5A 2H4YB 1IXKA 3NWKA 3NNHA 1FE0A 3G86A 1F9KA 4P9GA 2AQ4A 1QJHA 2C26A 1DU3D 1TFYA 4EN6B 3X29B 3HXMA 5I0RA 3LPEA 4LFBF 3GSIA 3CVKA 1UWWA 1OVSA 1O8SA 1YZ7A 3T1HF 2Q6BA 5DLGA 4KQ7A 2IXJA 3U7JA 2O8QA 1JIHA 1KJLA 2GIFA 2BVVA 2A3JA 3PKYA 3PJWA 1H2NA 2BDPA 3UJQA 2G4BA 1SLTA 1M1GA 1RMU2 2ZEWA 1Y4ZB 3N35A 3TYJA 3L7OA 3QCWA 5L19A 2GMMA 4LIWA 2YQ1A 2BX6A 3BR9A 1CC7A 4B3MF 2P5VA 4BISA 2VQUA 3MGJA 3DYMA 2HQIA 1I3HA 7FD1A 2K0GA 2YKQA 3BGRB 3GFXA 4FF3A 2H48B 4KIAA 3DCAA 3EQEA 1ZYBA 3F0NA 2ZWPA 2PHXA 1X7VA 4H4OB 3G6YA 3FHQA 1NK0A 2JE9A 4JV5J 3VGUA 4H55A 4P7TA 4V1PA 3D4KA 1FT8A 2MQQA 3LF7A 3HVAA 3W20A 4CO1A 3BGRA 4HVZA 3HZEA 3Q23A 1WMXA 1N52B 2BA9A 4ED7A 2KG0A 1TKZB 1Q78A 3NGUA 3UNGC 5EWGA 4LK6A 3MI8A 1RUF3 4H4OA 3WUDA 3TA0A 4X62F 3L3CA 2VMGA 3OFFA 2CPYA 3F44A 2NMOA 1XB9A 5I3UB 3SKJE 1ULRA 3AOAA 2GMLA 2V2VA 5K4LA 4IE5A 3Q2SC 3ILNA 1E57A 3SYZA 3CDWA 4DL4A 3I49A 1CC8A 4FTSA 3W63A 3KT1A 1D4M1 2XXZA 1JLQB 3BV8A 4USIA 1MQTC 5DAXA 2AYBA 4Z7YA 2XPJA 4DV7F 4ECRA 2OHDA 5I3UA 1HYSA 4R9CA 2FY8A 1W8OA 3ZFGC 3H3ZA 1FPN1 1K0TA 2HEKA 4J5OA 5H9SA 3CT9A 2VE1A 2ZH8A 2Y8KA 3MW4A 2RVJA 2GW8A 4QW8A 3CSKA 4M5DA 2ZNZA 2C3UA 1JODA 1JLQA 1BKZA 3GBFA 2W91A 5DUWA 4B4PA 4HACB 3FCHA 5FREA 1VAMA 1JYXA 1NCRC 8RUCA 4Y1UA 4JQTA 2X3DA 1UVIA 2OT7A 4BA6A 2VKZG 3POYA 2YWKA 5JXGA 1AF9A 4G1PA 3P1IA 5L9XA 4QGNA 2QLFB 4AF9A 2A7AA 1QXRA 2DNQA 4HACA 4KY3A 2MPUA 5J98B 3SH4A 2NUUG 4KGXB 4E0DA 2P9CA 2VO5A 4E2GA 3MM9B 1K8AT 2QYGA 3UDLA 4Q43A 1C3HA 1WF2A 4I67A 1KQGB 1VLNA 1RUF2 5L1LA 2JEIA 2M70A 2XUMA 1GQHA 4GB31 4F26A 5EV7A 3C6UA 1NDPA 2HFNA 2KA3A 1M90T 3N7MA 2HEYF 4OUSA 3MM9A 2MQLA 2FJDB 4E27A 3JXSA 4IOBA 2XQCA 2O5DA 1ZBA3 2OO4A 4NIAA 3FVYA 2D3RA 1GQPA 2FHJD 5A0YB 4LA3A 1ENQA 4LBLA 3WNOA 2DXEA 2W68A 3U11A 3KK1B 1TNRA 5L9VA 3VVUA 1XNRJ 2Y6KA 3PX4A 5A6PA 4PI2A 2VCAA 3CPWR 2QQJA 4MK7A 3Q22A 3UQSA 2ET1A 1S7IA 2V63A 5A0YA 4DFKA 3GJTB 2PN5A 5FMOL 1O91A 1IUJA 5U47A 3KK1A 2V68A 4NYPA 2W2NP 3UDVA 1W3XA 2ZOEB 4ASKA 4ZXEA 1WI8A 4PG8A 2NP0A 3ZSMA 4RA0A 3ZR6A 3M6VA 2FDHA 2DR8A 4WFYA 1QD1A 2P2CB 1OY6A 3UYJA 1S1WB 5FPUA 1PC4A 2VDHA 5F7UA 4USKA 1S1UB 3AZZA 2VVDA 1P8JA 4DRVA 2VJXA 1BEV3 5D8AC 4FVVA 1MG7A 2G9FA 6FD1A 3B4DA 1R0AB 3VAHA 3CCSS 4FOVA 1TE1B 3SQGB 1HDKA 1S1WA 2FGOA 5ETLA 2PELA 1MZEA 2A6VA 3FRYA 1S1UA 4HN0A 2YWHA 1IBKJ 1FFWB 1RVF3 2DJWA 2F1FA 2G0IA 1RMU1 1H74A 1AXKA 3M3OA 1VBE1 1R0AA 1PC5A 1AZSB 2E31A 3CGIA 1J59A 2DR7A 3SQGA 3O12A 4BQ2A 2VW0A 2HHTA 2FJVA 4CE8A 2J1RA 3M70A 1REDA 3WEZA 2PE8A 4I09A 4B9NA 1Z7S3 2C1FA 1AZSA 1GNZA 4A48A 1P9QC 4WM7A 2J0XA 2V9KA 5G0RB 2DCYA 1IPJA 2P3IA 2J1EA 3IT8A 2DO4A 4UUWA 5KT2A 1R8CA 4FI9A 1RHQB 5IXUA 4L73A 4UF0A 5K8NA 1GWMA 2A70A 4LBMA 3KLHA 3CEWA 2I8EA 3WP6A 1DY3A 4LF7J 1F0XA 4O3RA 5IC6B 5G0RA 4AQ2A 4OV6A 3T6BA 4WPAA 3GP9A 1D7PM 5CFCB 2D43A 1S0DA 5A6ZA 3J7YI 4ZMMA 5DUUA 5FZ4A 3P3PA 1BEV2 4XJWA 2GMEA 1WACA 3BJYA 3USSA 3I55S 1R43A 4NLSA 2CYFA 4N8MA 1BK1A 3CJ4A 4ZDNA 2F65A 4TNOA 1YRXA 1MZ6A 5CFCA 4RUBA 4LORA 1VHIA 5CZXA 4LO5B 4OQ9A 4CDUB 2BW7A 1RVF2 4IQPA 3QO9A 3ROUA 1K12A 3DKQA 2VM9A 3WX5A 2D6MA 2DNLA 2YXLA 4DR2J 2WNOA 1NAQA 4CXXA 4IH5A 4O9EA 2L3MA 2WRAA 4XQWA 1JLFB 2R1DA 3T1YJ 4Y00A 3POIA 2HNZB 5LJ5Y 3NCRA 2VG7B 2FJEB 3W66A 3P6BA 2J6SA 1Q53A 2C2KB 1Z7S2 3FBCA 2CJBA 2GMHA 5I3QA 4B9MA 1NKGA 3ZVXA 1BD6A 2CADA 1NJWA 4ED1A 3J7AN 5JUVA 2N3OA 3LALA 1JLFA 1H2LA 1AR62 5KG1A 4IV1A 2HNZA 3CJ8A 5JCTA 4PR6A 3J80U 5K0UC 3ACFA 4GC7A 1KQRA 1HXS3 1VBD3 4YYOA 4OZ0A 3G7DA 3AH6A 2RHSB 3HI9A 3PY8A 1MEC3 4Q27A 1CAVB 3ZMOA 5B09A 5IATA 1REVB 2P6SA 4RBUA 1RUF1 4CEWB 3VBHC 1XSRA 2O0OA 4TKTA 1AVBA 1Q8VA 4IGOA 3E6BA 3AOBA 3OYWB 2C2ZB 1MZFA 3E5UA 3BKZA 3J7YU 3RZKA 3MPBA 1A8DA 1CAVA 3KUGA 3MWBA 4CEWA 2KB2A 4PBPA 3ZOIA 2BDRA 2G9ZA 2ZCWA 2Y6GA 4WM8C 2B45X 2OEKA 3VQTA 3OYWA 3AL5A 3QT8A 1H98A 3EYPA 2OEMA 3TANA 2N82B 2NQYA 2VF3A 1F5JA 1V70A 2RM23 5JOXA 2OH2A 5F5CA 3KMHA 4RFRB 3MPWA 3HMYA 2R063 3LEMA 3ORJA 4JDMA 3FCVA 3K59A 1BVP1 2HW3A 1N3PA 1IS6A 2CV6A 3PUAA 1EHWA 3BDEA 2GP5A 3QLHA 1VCTA 3A22A 2EKNA 4GC6A 3ZTPA 4ECSA 4K7JA 3SKVA 2CG4A 3IM8A 5GZFA 2UU8A 5F6LB 3AK0A 3A8IA 3H1YA 2FCVA 3P6YC 3OUJA 5LMUF 4ZPWR 1ODMA 5FJKA 2HBZB 1WELA 1HXS2 2DH7A 4USTA 1VBD2 4DFMA 1A6CA 4IGQA 2R7UA 1MEC2 1EB0A 4LQ3A 3TZWA 1O7FA 3AKTA 4KV8B 5JXSA 2DBBA 5AXMA 4HI1A 5AE2A 3NKTA 3BU0A 2CXEA 1GMWD 4NLTA 4KWJA 2BMBA 2WDBA 4W50A 3VQSA 1LWEA 1OUXA 1VIXA 5I0SA 3FRZA 4OHVA 2KDOA 3AFGA 1ZBA1 5JZGB 2HLUA 4KV8A 1IS4A 1YQ8A 2CHHA 2G9GA 3R05A 4V19J 5GLWA 5D8HB 2PFDA 3KJQB 3CU7A 2RM22 3THCA 3CCRS 3VKOA 3UETA 5KT5A 2ARCA 3AJYA 2PAEA 2R062 2HRTA 3KHHA 3D82A 3AMMA 2RJLA 2ZHAA 2HVHA 5G05L 2PHUA 3AXEA 5DG9A 3FL7A 2RR13 1H8TB 2EXJA 3CXCR 3CDZB 1E6YB 2VZTA 2DNHA 4HT1T 1TVRB 3L2HA 5KC6A 3O8WA 2QL5B 2MSTA 3TA1A 1H9PA 1DGWA 3RVHA 2D97A 3HFVA 3IAS9 3MURP 5EJ3A 2OQ6A 3VBOC 1H8TA 2M7SA 2ZBQA 1BEV1 4GWMA 4BQ5A 3GYDA 1E6YA 1GAOA 1TVRA 4ONUA 2FD2A 4PUOB 1M5OC 4H54A 3EPIA 2O3DA 1KVJA 2J1SA 2F5GA 2C3YA 1TL5A 2L9NA 3W5MA 1RVF1 3C2UA 1D2QA 5E5NA 2JJ6A 1VLOA 3ME2A 1K3IA 3ZDVA 2HYIB 4PUOA 3WHTA 4ZS2A 4UAPA 4CUCA 2CVEA 3ZFFC 1UXZA 4E4DX 5D4OA 2YKOA 3JXOA 1FRKA 4O23A 2OGUA 3K5PA 5LEKA 1OQ3A 3H2LA 4U2AA 1Z7S1 1RHRB 4DHVA 1W0NA 3NVCA 4IEQA 4S2DA 3SFUA 2A1XA 4DR7F 3ZZYA 5BUVA 4WIQA 2HPUA 2XHCA 2E29A 3JAMY 2DCLA 3VBSA 5GLTA 3UD3P 2OYZA 3WX4A 2RR12 2NQPA 2JD4A 3KLIB 1S48A 1APSA 4P75A 4KU7A 3ZSLA 3NNCA 4OUEA 2FLLA 5APAA 1XNDA 4PIYA 2BKOA 4KHPJ 3G82B 1H72C 2CNOB 4IH6A 4WXWA 3TOJA 2B9VA 2HKXA 4B1LA 4FBTA 4BBYA 1WCUA 5IWFA 3KLIA 1S0FA 1UZ0A 4AWDA 3JQJA 2B3TB 2HRUA 1M5SA 2OSQA 2HEVF 4BM8A 3ZTOA 2HGMA 4MTPA 1VR3A 1T9YA 2E51A 3WW4A 4DLEA 1CIYA 5C9AB 3G82A 2IDLA 1B09A 2KFYA 2ALZA 1VE0A 3GTYX 2Y6HA 4QMAA 3PTRB 1NHKL 4FF2A 1C1FA 1U0HB 2VOVA 2VXRA 4KGGA 5FYHA 1FJ7A 3R5DA 4BYYA 5HN0A 2D6LX 1HI1A 5C9AA 1TZOA 4YR3A 2WNVB 1S97A 4BJ0A 3LB9A 2QKDA 1BLZA 4ED5A 5GVQA 1WWYA 4C98A 2ASYA 4HI2A 5FKBA 1O5JA 1SJ4P 2WNVA 4LR9A 4BWMA 2AEMA 2RUGA 3DLJA 1OF4A 1QXJA 1OH4A 1OS5A 3D6MB 1HXS1 1VBD1 1H4GA 2RRBA 4N5SA 5K9FA 3E6DA 4BQ4A 3MHYA 1MEC1 4LJMA 2FDFA 1WW4A 1G8WA 2XSFA 1G2EA 4LE4A 1WC3A 3BZQA 2IM0A 1JMUB 2KO1A 1CJKB 4DV6J 2ACMA 1HNXJ 4QX7A 4NRMA 3ZIWA 3MMJA 1ENSA 1S9EB 3L9ZA 4RUHA 1WD3A 2ZJRQ 1SFYA 5FZIA 1VDHA 4A8KA 4EZ6A 1O59A 2FYXA 2OP5A 1CJKA 4CM2A 4LF4J 4COZA 3AKQA 4ZVHA 1XPWA 4ETZA 3AJDA 3R0RA 1W9FA 2RM21 4NIHA 4Z2XA 2BGOA 3ZFEB 1SL0A 3N28A 2R061 2ZS6B 4Z8BA 3I2OA 1Y9OA 1XYOA 4P5HA 3SBMA 3LW5C 4XJZA 3AQOA 4YQWA 1URXA 4ANCA 4BK4A 5D1IA 1LOBA 3ELNA 3M32A 2RHQB 4JI2F 4CIOA 1NB2A 1GP4A 1WJ9A 2V2QA 2AACA 2GNTA 3ZFEA 1GFWB 1OQEA 1HB1A 4QPYA 3KLGB 1S59A 1DQ1A 4CP2A 5HVGA 3PX0A 3KUHA 5EIYB 3HJFA 4KFBB 3UN2A 2YH0A 4AFDA 1IR0A 1FFSB 4AQTA 2JWNA 5FPAA 5F3GA 1H2TZ 2RSQA 3SEOA 4A47A 2KFNA 2F7VA 4RQPC 1W28A 4P9LA 4USUA 7FDRA 2NS1B 4AVSA 2EIGA 5KFZA 1LESA 5E1RA 1ZPVA 1VQNS 2RNEA 2HJIA 4YZ5A 4KFBA 4YW5A 3WCSA 4N7IA 5JMCA 3Q9OA 2N4CA 1CJTB 4J9SA 1RADB 2OUHA 5FCCA 2ZMNA 3BF4A 2P9EA 1FDAA 2AJ2A 4EEYA 1I5OB 1SEFA 5BV6A 2ZH7A 5KFSA 2BZ2A 4F4XA 4HT5A 5EZWA 2E63A 3Q8VA 2CWMA 2YXSA 3EHKA 3I2KA 2XZTB 1OYEA 1B0VA 2VH9A 3US5A 1CJTA 2WLQA 3HLUA 5HI7A 3KMSA 4QQBA 2WSFC 2Z42A 1KTVA 2ZC3A 3CDBA 1KD7A 3TR5A 1YZ6A 2EPIA 5KT3A 1HQLA 4W90B 5AC93 5LSOA 1VQLS 4LF6F 1YJRA 3E6CC 2RR11 2ASJA 5L38A 2YNGB 4UOGA 4TXWA 5M2RA 4DPWA 5F5QA 4F3QA 3FQLA 1UFWA 3H5XA 3MEPA 2FIUA 2UUBJ 1D8ZA 5HCHA 2ZEJA 5JIAA 2ZKUA 3ACLA 4IG3B 4GALA 2ASLA 3V56A 2LALA 1Y0HA 2YNGA 4OFGA 4NEYA 1TL3B 4LKFA 5HMWA 3PO5A 5ETRA 4PYDA 1N47A 1FNZA 3B8HA 2DVDA 1T2XA 2R32A 1JYNA 2EFOA 2JHEA 2XMAA 5DQIA 5C3RA 1OF3A 3E5XA 1UOJA 2N7YA 4M0HA 2KXHA 5A7NA 4DU8A 1DP0A 1UY4A 1PJ7A 4FP3A 4NLYA 4COVA 4LSNB 4OX7A 3C6TB 1TL3A 3CD5A 2RKIB 1TUVA 1I94J 2B56A 2DRDA 4FF4A 1LULA 2CA9A 1YJLA 3WNXA 4IDZA 1RHJB 4X64J 4I6WA 4LSNA 3C6TA 2JEMA 2PA3A 1GANA 2RKIA 2CU5A 3OL7A 5A1AA 5KG3A 1ULGA 2VAUA 2VZPA 4PIXA 3EYZA 3TOQA 2E32A 4CDXB 4AFMA 3OOXA 3NV2A 2I38A 3FNNA 2W46A 1YK9A 5K8MA 5FZDA 3JD73 2A0FB 2VFUA 4OHXA 5D2AA 4C0HA 3BBCA 5HCBA 2CJ9A 2RQMA 3HX9A 1H2UX 5KFKA 3TVYA 2C5DA 4DUTA 5HCAA 4CDXA 1QUVA 4U7CA 1RKIA 4G65A 1MS0A 4DOZA 4BMBA 2GDFA 4E2SA 4CNYA 3TWIA 4AFCA 2D3O1 1DLCA 1UZHA 1SLIA 1ULOA 4M5JA 4CCJA 4ECWA 4CH7A 3WZ1A 1RUSA 3AB0A 5KFUA 4NRPA 2BBEA 4RBTA 2V8PA 2V8HA 3VDDB 1OBNA 2FQPA 2LA4A 2Z2MA 3Q83A 4NA1A 3MUTP 1GICA 1W0PA 1TMF3 3BH7B 4CZSA 3HVWA 2WO1A 2R8GA 3Q89A 2EXIA 3VDDA 3BREA 4DSLA 3ZZZA 1RK8A 1S6PB 5A3PA 1F9FA 2PMZD 1WOOA 1Y3JA 2PHDA 4YM1A 3KS7A 5AXKA 4X8PA 3OBIA 3E1F1 3U37A 3JD72 4J9MA 1S6PA 1GH8A 3SXLA 1M4WA 2JFKA 3CJIB 4R8UB 1F15A 2IBKA 5DZEA 1LW0B 2H65B 2Z56B 3FBFA 5GADI 3RR7A 2LLZA 4GKYA 4O7XA 3LOIA 3MIHA 4META 2FCTA 3V0AB 1ZA1B 1IGOA 4DSKA 5J2NB 4NE9C 4R8UA 4Q1RA 3CJIA 4LO6B 2WAQD 3CCVS 1LW0A 1EETB 1HQUB 3I4PA 3OJUA 4Q8KA 4E9KA 4KU8A 3D6HB 1RINA 5T3NA 2IXHA 4UYBA 3ZN5A 3LWCA 4V19X 2W92A 4PI0A 4ISQA 2B5JA 4F3MA 4XUOA 5I93A 5F3IA 5FQ0A 1Q95G 5FZOB 5CFDB 1YWXA 5FMCA 1EETA 4WP3A 4QPXA 1HQUA 5HSPA 5IVEA 3JQWA 4Y1YA 2YPJA 5E88A 3RZAA 4YFWA 1F5BA 1RAIB 4IUGA 4QB6A 2JKBA 3KM5A 3ENVA 1C1CB 4K1YA 4M5MA 1GEHA 2GH2A 5CFDA 2DBIA 1KFUL 1FRIA 1K47A 4ZJLA 1KRPA 4Q8LA 4UI9L 4J25A 2LXFA 2W87A 3ATGA 1RJ7A 4H4MB 2CNKB 3S7EA 4B29A 3D1OA 3RJ2X 1C1CA 5DG7A 1WA6X 2BJ1A 5FP9A 4AAXA 1WW5A 1SXLA 2R2TA 3OPZA 3EMTA 3A0KA 1W9SA 2DISA 3A23A 2NSBA 5GADU 1MWYA 4H4MA 1QAXA 1QAIA 4D6SA 3IDEA 1U5XA 5FZ6A 2GJFA 2PHFA 2XG8A 1QDOA 4XAAA 2QFJA 3NY0A 1PYOB 4O44B 1XQIA 1XN9A 3APBA 1HKDA 1UJ6A 4DS0A 2Q8DA 2H9ZA 3J7ZT 4CSWA 5G4DA 2JDUA 3WCRA 3WV6A 1NRKA 3FFIB 4MIWA 3OGRA 4NLWA 2V5HG 3CD0A 3SQOP 4JGYB 3QFHA 5EN1A 4O44A </