3THTA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
336
structure length
302
Chain Sequence
TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVDRRVKHFGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Alkylated DNA repair protein alkB homolog 8
total genus 72
structure length 302
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thtA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thtA01
4CH0S 2DGSA 4OZ1A 5CXTA 2DGQA 1OWXA 1SXLA 4TU9A 3CCRS 1U1OA 3NNAA 2V94A 2F9DA 1VQ7S 2MQPA 2LQ5A 3G6ES 2U2FA 3Q2TC 4WKRA 3TYTA 2JVOA 1BY9A 4PRFA 1M90T 4WFAQ 2MZSA 5LSOA 2HGNA 3MD3A 4P6QA 4RU2A 1D8ZA 1JJ4A 1UW4A 2FPHX 1R8HA 4V19X 3MUTP 3MD1A 1VQPS 2MKSA 4LIRA 2LEBA 2BOPA 2DNQA 2MY7A 3VAHA 3IWNC 1N8RT 2EK6A 2X1AA 1VC0A 2CQ2A 2O3DA 2DNOA 2CPYA 2MKKA 4ERDA 2G4BA 5IQQA 1A9NB 2YTCA 1S72S 1HD1A 5H1SV 1WWHA 2MHNA 1ZH5A 2DNNA 5IFMA 3H2VE 5JVGQ 4LJMA 3ZZYA 3S8SA 2M9KA 3SXLA 2HGLA 1KOOA 2K8GA 3NS5A 1M1KT 5LSLA 1Q7YT 1VQNS 3NMRA 1W2BR 4CQ1A 2MKJA 2ZJPQ 2DGUA 2LMIA 5CA5A 4F25A 4QU6A 3EX7B 2SXLA 2AYMA 2M88A 1XN9A 4W90B 1NU4A 2CQBA 2OSRA 1X4EA 4IOAQ 4IOCQ 3B4DA 1Q82T 1R8PA 2RS2A 3RW6A 3J7ZT 5DDRC 5LXYA 1D9AA 2KVIA 2DNZA 1U1QA 3UWTA 2OSQA 3VAIA 1VQOS 2CPEA 2DGTA 1G2EA 1OO0B 3G96A 1X4HA 1M5VC 2DHAA 2HVZA 1URNA 3TO8A 3UD4P 3VAMA 2RQ4A 3L3CA 1SJRA 1WHWA 2MQQA 2YWKA 1VQ6S 5LJ5Y 1CVJA 5GVQA 3VF0B 2M52A 2XSFA 3BS9A 3J7YU 1DHMA 3CPWR 1U1LA 1U1MA 2MB0B 3G4SS 1WEXA 2FC8A 2KM8C 5ITHA 2AYBA 2VODA 1WF2A 4M5DB 4CH1A 2FY1A 3G9CA 5FJ4A 4QPTA 1DZ5A 2KRRA 2OTLS 1VQ9S 2EK1A 1RKJA 2NLWA 2JVRA 1VBXA 2KHCA 1X4BA 1DBDA 1YIJS 4BS2A 5BJRA 3THTA 3SDEA 3CXCR 2DNMA 2VONA 3P6YC 2AD9A 4PKDB 2A3JA 2HGMA 2ADCA 2RRAA 2CQ1A 1NO8A 3MUMP 1VC6A 1Q81T 4Y00A 4Y0FA 3BO3A 1L3KA 1WI8A 3UE2A 2D3OR 2EVZA 3DLLQ 2Q79A 4IO9Q 2I2YA 1VQ4S 2KXNB 3G8TA 3R1LA 2ERRA 1U1NA 2ZJRQ 1U1KA 2MGZB 3FEXB 1FO1A 1WEYA 3NS6A 2E44A 1P1TA 3H2UB 2RS8A 5GAHU 1U6FA 2M8HA 4F02A 2DK2A 4Z2XA 3VAFA 2F9JA 3DXBA 1A7GE 3EGZA 1H2UX 2MQMA 2LECA 3S6EA 5EN1A 2LA6A 2CQPA 4WCEQ 3UD3P 1X4CA 1HL6A 5LXRA 2DGOA 2VOOA 1FJCA 2X1BA 2RQCA 1SJQA 2MXYA 4WFBQ 1OPIA 4PR6A 2X1GA 2MSSA 3D2WA 1X4AA 1VBYA 2J0QD 1B7FA 2CPIA 3EGNA 2RVJA 3S01A 2XB2D 1OIAA 2KU7A 2KM8B 2D9OA 4QU7A 2GHPA 2KH9A 1WELA 1WG4A 3BO4A 2DH9A 5CYJA 2G0CA 2LCWA 2RNEA 2PEHA 3CF5Q 3NNHA 5HO4A 3RW7A 3CCQS 5DDOC 2XS7A 2MJUA 3LQVA 4YUDA 2CQ3A 4TU8A 2CJKA 4TU7A 3V4MA 3CC7S 1VQLS 2XNQA 2LYVA 4C7QA 2MZJA 2CQ4A 3CUNA 2DHGA 3B4MA 1SJFA 2CQ0A 1YI2S 2E5GA 3R27A 2XS2A 3CTRA 2DIVA 2B0GA 2RRBA 2QEXS 1FJ7A 2KG1A 2HZCA 2L9WA 1FHTA 2CQHA 4YOEA 5DM6Q 1U6BA 2KFYA 4W92B 2L08A 3ZZZA 3THPA 4CIOA 1KC8T 2DNLA 2D9PA 2KG0A 2CQCA 1YITS 1H2TZ 1K8AT 2DGWA 2DNRA 4WFNQ 3BEGB 3CMAS 2M4MA 1X5OA 3VALA 1HD0A 1U1PA 2G1DA 2HYIB 1VQ8S 3CMES 5GAEU 3N9UC 2I38A 2DH8A 2OJ3A 2E5IA 3SDEB 2ADBA 2WBRA 2DO4A 4F26A 3FEYB 1WI6A 3R1HA 1O0PA 2E5HA 3US5A 1H6KX 1M5PC 1F9FA 1WHVA 3HHNB 2DNYA 1KOHA 2CPDA 5MLCV 4YB1P 1QVGR 2MZRA 1FJEB 3CCES 2CPHA 1KD1T 3CCLS 2MZ1A 2N3OA 4EGLA 2N7CA 2DNHA 5DDQC 2KXHA 3UCUP 1VQ5S 1UP1A 1M5KC 2MYFA 2CQDA 2FHOB 1WF0A 3CC2S 1WHXA 2KXFA 5D77A 3HI9A 1QM9A 2XNRA 1JJ2R 4UQTA 4C4WA 1N54B 5DETA 1X5PA 4ZKAA 2JRSA 1K9MT 2M7SA 4U67Q 5LJ3Y 2YH1A 3MI7X 4WIIA 2L41A 2XS5A 2OIHA 2ZJQQ 3CCUS 3P49B 1N52B 2LXUA 1KQSR 3NNCA 1X4GA 2J76E 2F3JA 2DNPA 3U1MA 1YHQS 2QFJA 1ZZNA 1VQMS 2RT3A 2KT5A 2MQNA 1YWXA 3G71S 4LMZA 2MSTA 4TLQA 5DM7Q 2CQGA 2RU3A 2M0GB 2MKIA 3UCGA 2YKAA 4WF9Q 2FC9A 5GADU 2DIUA 2JX2A 3LPYA 1VC5A 2KI2A 1WTBA 2DNGA 4FXWA 3I56S 2DHSA 1RK8A 2N82B 1WEZA 3BO2A 2KYXA 4J5OA 2DH7A 3P5TL 2CPFA 3I55S 1H2VZ 1P27B 2UP1A 2DGVA 4C0OC 3U1LA 2CPXA 3JB9k 2DB1A 3Q2SC 2M70A 2MQOA 5DDPC 2RUGA 2MZQA 1SJ3P 3MURP 3MXHP 4A8XA 2K3KA 2GO9A 3CC4S 1IQTA 1WG1A 1PGZA 2YH0A 5GMKa 2NZ4A 3VAGA 2VOPA 1NJIT 3K0JA 1N88A 2LXIA 2CPJA 3MDFA 3IRWP 2MJNA 3OW2R 2DHXA 3CCJS 3PIPQ 1VQKS 4FXVA 1WG5A 3S7RA 5GAGU 2MKCA 2MPUA 2MGZA 1M5OC 4ED5A 3MOJB 2CPZA 3UCZP 1PO6A 4IUFA 1U2FA 1FXLA 2QA4S 5IM0B 1U1RA 1JJHA 3PIOQ 1WF1A 1K73T 1HA1A 2MY8A 2PE8A 2DNKA 3MUVP 3ULHA 3VAKA 1X4FA 1FT8A 3CCSS 2BZ2A 2LKZA 5JVHQ 4QQBA 2MQLA 2LEAA 2DGXA 1YJNS 2AYEA 2N3LA 5D78A 2MZTA 2M2BA 2J0SD 1UFWA 3SMZA 3G8SA 1X5TA 1WHYA 1YJWS 2J8AA 3VAJA 2X1FA 1VBZA 3CCMS 2DISA 1FNXH 2OTJS 2CQIA 5IM0A 1Q86T 3CCVS 2U1AA 2KRBA 2E5JA 2AYGA 4UY8T 1X0FA 2KN4A 2MMYA 5HL7Q 1QVFR 1UAWA 1ZZFA 1S79A 2LA4A 2JWNA 1YJ9S 1X4DA 2M8DB 1DRZA 2DO0A 3CD6S 3CULA 1JMTA 1X5SA 3P3DA 1SJ4P 1AUDA 4OZ0A 2MKHA 1YTYA 2DITA 3TP2A
chains in the Genus database with same CATH superfamily
1BEV1 2CAUA 2DGSA 3IR7B 3DCQA 3JZVA 4D6QA 5CFDB 4NEZA 1RUC1 2WKKA 5JWPA 4WP3A 1IR2A 3FHAA 2QFIA 1RWWB 1ACMB 2JENA 1EYBA 1H98A 1VBA3 2R7SA 2UWCA 4DSIA 4BA6A 2RD5C 2XUEA 4KT0C 4C9DA 2JDYA 3KK1B 5JVVA 1HW9A 1YQ6A 2YXLA 3QLHB 1V6NA 1RMU2 4XJAA 1EX8A 3B6BA 2GP5A 3I82A 1D8ZA 2W7OA 1SHWB 5JSRA 1GLHA 4IESA 5LM7E 2QQLA 1TMF1 2XJTA 1A78A 3FCHA 2BJ7A 1ZA1B 2A1XA 2K0GA 1V3RA 1Z1ZA 1M06G 1N32F 2MKKA 4PDWA 1Y3JA 2ROGA 1GNYA 1J84A 2J6SA 2GH2A 4M1KA 4CA9A 4FPHA 4BDVB 2QLJB 1W8FA 1Q95G 2FB0A 2ZBIA 3NGKA 4TLGA 1I51B 5F5CA 2D5HA 3FBFA 1R6VA 5CNAA 2ADEA 3K75B 2WVDA 1ZM3A 4O3SA 1PAEX 1HRI3 1R8CA 1VRQC 1NK6A 5IQ6A 2LMIA 3SCKE 2ZGTA 2A1BA 3EXYA 4U7UK 5B08A 4YR3A 3MM8A 3HHKA 4D0QA 4LSZB 4ECZA 3TAPA 3BPZA 4MHRA 4RW8A 1SVDA 2E7XA 1V6LA 4XFBA 4S2GA 1BQNB 3W8GA 3S7EA 3L7PA 3FLTA 1SIZA 2XY7A 1U1QA 2HWE1 1HQEA 2XTJP 3BDPA 3ZZPA 3N3HA 5FKBA 4J91A 3VAMA 2I8EA 2NZ9A 4WWSA 4FXGB 1VMBA 1JUIA 4L74A 2PHDA 3W5YA 2ZWOA 1HBNA 2ZPXA 5LBBA 2ZHKA 4DV2J 5KFWA 4Q5VA 3PRBA 4GQ7A 1HXS3 1ZM2A 2HIQA 2DURA 3ITQA 3H1YA 4ONUA 4Z2AA 5JXSA 4QKDA 3NJZA 3RGBA 4YG3A 4N53C 1O3SA 4CO2A 1DBDA 3HSZA 4YM3A 1GMVA 3VBUC 5BNOA 2DD8S 5J7MA 5AJ3J 3QZ8A 4JI3J 1QUVA 3P6YC 2JFDA 5E6HA 5LY1A 2VBZA 3HHDA 3MZIA 1XNKA 3T6JA 5KG2A 3PYGA 3BU0A 4A6OA 5A7PA 3M30A 3TX0A 3HD1A 1JX4A 3AA8A 4P9XA 5KC5A 2EWHA 4WZMA 2C2ZB 1RUE3 3UR0A 5E2QA 4DR4J 2CV6A 2LRPA 3MFHA 3T1HJ 2W2MP 4Z2XA 4PLOA 4UOHA 1IG3A 5A33B 3HT0A 4PUOA 2L3MA 2P2CB 1BQMA 3PG9A 3B69A 2VQAA 1F1BB 3MECB 2DGOA 3J8F3 4LT6A 1F4HA 2VO5A 4LOSA 3BKFA 4DR7F 5CYQA 3DMJB 1H8TC 3KLSA 4D8MA 1LK5A 4I67A 1B7FA 1ODNA 3ZR5A 3VBFC 3NCPA 1AHSA 2PMZD 2ZX4A 2EICA 3M2RA 4PWUA 4O61A 2ZE2A 4QU7A 4GMP0 2RS31 1Q8IA 3M4FA 3RYPA 5JOYA 3RYRA 1H2KA 4OX9J 1FPN1 4CEWA 3GZEA 5L73A 2EFOA 2ZZQA 4URSA 2FVRA 2RJ2A 2BBVA 4TU7A 4ASLA 1JLEB 4AFBA 2WRAA 1F9KA 3SQGB 4LBKA 2ET7A 1DP0A 1T9TA 1LWCB 3ICLA 2PQSA 5T3NA 1YI2S 1SH3A 2E5GA 2XS2A 1RWMB 4NPOA 1EKSA 2BBEA 5B0GA 5FZGA 2APOA 3J7YI 4MGYE 1A6CA 1OOPB 3VGIA 2JLFA 3QJJA 3OBRA 4NYZA 4Y1UA 2ZCWA 3QLHA 3HWJA 4CP2A 4FPLA 1LOCA 4XACA 2OPSA 3RB3A 3MCMA 3IR6B 1UNBA 3JD71 1US3A 1UMIA 4OJGA 2XONA 1S6UA 1N5SA 4FPEA 5G05L 4UFMA 4KB7A 3THDA 3E01B 5BNOC 2OJ3A 1FE0A 1ZBTA 1NQDA 4UXAA 1U8SA 1O0PA 3E8OA 3MM6B 4WPAA 2D3UA 4NRQA 2NR0A 4O44B 4QIVA 3MIHA 2X8KA 5EWGA 1CZTA 1ZBE1 2IVMA 3MF9A 4I09A 3ZN5A 3VBSC 4DR2J 2R063 3CCLS 3GQCA 4ED3A 2N3OA 3I9V9 1S59A 2J1UA 4XBQA 5IK7A 1GZTA 2BEOA 3MIDA 1A34A 1WF0A 2PFFB 1VE0A 3H7JA 3ZYGA 2JDUA 1K5MC 4XFGA 4CPBD 3GYGA 3HDSA 3U4XA 1CIYA 4E8DA 4AWDA 5DQHA 4ICLA 3SEEA 4WVVA 2VU5A 1FX5A 2Q8OA 4ETZA 3NWKA 4M94A 1RQ0A 3AQPA 3AD8C 1HNXF 4KPCA 2ALZA 4META 5ETPA 2XCAA 2JFKA 4OHZA 2VY0A 4K59A 4KRWA 4HBNA 4IE6A 4XJWA 4JVAA 2VBPA 3RMXA 4GO5X 1EPWA 3BU7A 4JP8A 3M1VA 4J5OA 4QYZJ 2BQUA 1PNFA 1CULA 3WG2A 2V6AA 4LBOA 2FLOA 4KBBA 3O5TB 2PXJA 5CYYA 4FF2A 2IRXA 2YC2A 2YNFB 5K9YA 4E8CA 1FJGF 2IM1A 3NEKA 1U09A 3Q8RB 2HQFA 2OX0A 2ILZA 2FDNA 5IAXA 2Q6CA 4GXLA 3DGPB 5HPOA 5IT4A 1AXYA 3I3DA 1JU4A 5KFUA 2A6VA 3CCJS 1CZSA 4FXVA 2W0XA 3S7RA 1FERA 1MPXA 2GIRA 3GMGA 1HYSB 4OL8A 1QXPA 2XLGA 4XW3A 2MPUA 3FBEA 1MROB 1YK9A 2WNUC 1TVGA 2CPZA 1RT1A 1RAEB 3M8PB 1S1TA 1POV1 2ASLA 3C2PA 1O59A 1H9PA 2BNOA 1O8PA 4XURA 4P7TA 5E8AA 2RF2A 4F4KA 1XWLA 2YX1A 3U75A 2DNKA 3NVCA 5CBLA 4FFHA 1CJTA 1BLZA 2Q3PA 3RTVA 2LDIA 5JVHQ 1ULEA 5AFBA 3K51A 2YY1A 1FRXA 1S6OA 4DJBA 1H1IA 4KPYA 2ENRA 2VD7A 3PJYA 5B0FA 2GQCA 1TMF3 3S5AA 4LBJA 3HOBA 4P9WA 3VB9A 3QT5A 3RRKA 1WHYA 2HVHA 1YC61 1RT5B 3NKYA 3FJSA 2WJSA 5IVVA 2KRBA 3T1MA 1FI2A 4W6YA 3WNPA 5E3PA 3AZWA 4QIFA 4DUWA 5FMOS 2GGPA 1UY2A 1XE0A 3DC2A 2W9BB 2ZBRA 3USSA 1GMMA 3GIRA 4P14A 4OZ0A 1MS4A 5F8PA 1DJ0A 3H25A 2PLV3 5DS7A 2LQBA 3VBOB 4DR7J 2DGQA 4GKXA 1M1HA 2OQ6A 4PBOA 1JZ6A 2V94A 4FBFA 1VQ7S 2J1AA 1ZRIA 2DYCA 3JBG3 3NGSA 4LF6F 4DQAA 2HQ3A 3TANA 1RT7A 1CONA 1KBRA 2HRYA 3H5SA 4CM2A 5C24A 2PAEA 2WZR1 3WV6A 4U8YA 2HURA 2HBTA 2W91A 3T5JA 5H9FK 4JKMA 5EFUA 2FPHX 2R8KA 4HZFA 4CM0A 5F32A 4C8MA 5IV3A 1KQFB 1N34J 2J6UA 2ZEYA 4B3RJ 2WFF1 2BOPA 4DFKA 1COV2 2CDRB 3NCQA 5JI7A 5FP8A 1HN1A 2PFDA 2LP4A 2CRLA 3KNAA 2DNOA 3ACFA 2F4VF 4FPGA 2NCKL 1A9NB 2EIGA 4GKJF 4JDMA 3V0AA 3BCWA 3AMHA 1KHWA 2F8MA 3ISNC 1PMIA 1IQDC 4Q4Y3 4UTGA 3EZUA 2C2NA 2DUOA 4KGMA 2IXJA 2PMWA 1VRTA 1HHSA 3DOLB 4JHTA 4ECRA 3THCA 5HJYA 4H4MB 1X8EA 1W6MB 2DCZA 3W20A 3OJBA 5KFEA 2C1EB 1DQ1A 1GAOA 2VVDA 2JKBA 1MZEA 4ISQA 1NJYA 4I02A 3P3PA 1HNWF 5KT6A 1APSA 2HSEB 2R2SA 4QPGC 4HKLA 1DGWX 4ZITA 1VJ2A 2VCCA 3MBWA 1PILA 1YDLA 1VRH2 4DR2F 3TJ9A 3FX3A 4A45A 2RSQA 1FNYA 2HVZA 4RJVA 4RR3A 1BHNA 2EFGA 4ECWA 3H7YA 2MQQA 2EF6A 4DR1F 2NM1A 4U36A 3LDRA 3RU0A 1PIV2 3LPGA 4BQ4A 4JRLA 2AEMA 4MH8A 3ZFVA 4PQQA 2P9CA 2ZOMA 1NA1A 2KM8C 4JCKA 4NWVA 3C7HA 2QE3A 4H7MA 4LF7J 2GVDA 4ECYA 3OLBA 5EWSA 3MTJA 3SISA 2KRRA 3RZZA 4YW2A 5ETMA 1QJX1 3W9AA 1CWPA 4QCLA 4YW5A 4HHUA 1S9GB 1X9MA 4E4DX 2W47A 4RW9B 4AI0A 3J80Y 4RNNA 3E5UA 4JI2J 5KHHA 2DUPA 4BM8A 3L09A 3VVUA 4L76A 1H8TA 2W1SA 1Q81T 4Q4X2 3BO3A 4BQ2A 5HBMA 2D3OR 5TSWA 1F0XA 4ED0A 4KH0B 4UFKA 3U14A 3N9OA 3LUYA 5IZHA 3GONA 4R0JA 5C2CA 2BJDA 2ROEA 4Y5TA 1KDKA 3LGNA 3WF1A 3PJXA 1S1WB 4DF8A 2QX0A 3NL1A 3WG3A 3ZM8A 3LF7A 4ZY9A 2O0OA 1BK1A 1FYUA 1PJ5A 2JDKA 2HRUA 5D3GB 2OS2A 4NCGB 4J1WA 4QX5A 1X4CA 3VKNA 1UL3A 3JXSA 2X1BA 3A8IA 2F7VA 5J2QA 4X8NA 3PVNA 5FYUA 2MSSA 3D2WA 2RAQA 3C15B 1UA0A 4YVSA 4D7YA 2HQIA 3MGUA 4HVQA 1RVF1 4H3WA 4DL0C 1O51A 4FOWA 3FZ2A 4AXIA 5DZ7A 5LOQA 4LXLA 3BSOA 5AXLA 4F4WA 3BO4A 1DG6A 2HMIB 5CYJA 1SQEA 2LCWA 4OHXA 3NNHA 4DV7F 3DRPB 3RW7A 1AR83 4MYUA 1Y5NB 5F9TA 4O3PA 5GZEA 2DCUB 1RJ7A 1QLNA 1LHNA 2E26A 1NK5A 4J25A 3JQMA 4DXZA 5FZ6A 1CEZA 1RUC2 1W39A 2LU2A 1NK9A 2CQHA 2WA3A 1RHMB 3KNGA 3CWJA 2KFNA 4W92B 4OYUA 1N5YB 4X4TA 3THPA 4HKQA 5JAXA 4CLPA 4AEDA 4Q8FA 2Z8QA 3RRDA 3IM0A 2VA3A 2FDJA 1J27A 4MJKA 2ZH8A 3MIGA 1K8AT 2VVFA 3ISZA 5EWFA 2G9GA 1XNRJ 3AFGA 3JD73 3HT1A 2YVSA 4N41A 1SB6A 3ES4A 4ZCIA 2RDNA 3QD6A 3FE5A 2GGPB 3T4VA 3WP6A 5A6QA 3CW2C 2ZDOA 4JI5J 3ACHA 2CDOA 1CPNA 3AL5A 4XIKA 2RUSA 3HSDA 3AMNA 5ACA1 3KXDA 3KK2A 1M5PC 5L9VA 5DUUA 4D7TA 5ETOA 4F3QA 2QQPA 1VGYA 5CU1A 3KVBA 1R8AA 1P9YA 1OSGA 2TNFA 4P74A 3BSAA 3HX9A 2CAVA 2R8IA 3T0DA 3R4UA 1JZ7A 4IRDA 1TR0A 4EGLA 2VMGA 5HMXA 2XM3A 5A1LA 4LBIA 3GCWA 3NRUA 5A2QY 3KHGA 1U0HA 3NXZA 4EE2A 4F36A 1X8MA 1RYRA 2XLFA 3VDAA 1S2EA 3GB0A 3ILOA 3MMCB 3OY8A 2I0XA 3WNMA 2Q8CA 2C2MB 3CIMA 2XS5A 5LCWL 3TZYA 3V2UC 2R071 3FJ2A 2OMOA 2OEMA 4IG3A 1LEMA 2XULA 4RWXA 5KFKA 4A3XA 4IFVA 5ETSA 1OQEA 3OSPA 5DLFA 1GZWB 4W8JA 5I8YA 2RT3A 3E5XA 4NPRA 4RZRA 1XYOA 3Q8CA 3H5XA 4AFDA 1I94F 3TVYA 3U1NA 2XY5A 3M05A 4WF9Q 4M5MA 2JX2A 5LSRA 1S0OA 4KGQA 5J09A 3RAQA 4HT1T 2FLLA 5C8CA 4LLFA 2VM9A 1H3DA 1GTEA 1GWMA 2YC0A 4MK7A 3DGVA 1D4VB 2J0WA 4JGZA 5A6YA 3J81j 4Q0VA 4K7QA 3MXHP 4YNIA 1XNCA 3WG1A 1QJU2 3VQSA 2YH0A 2F40A 2YPDA 4N8OA 5C7GA 1ZTTA 2RDRA 2CPJA 3NCRA 2GSYA 5DPNA 2MJNA 3PIPQ 1H8TB 1C5HA 1JYTA 1N32J 2BDPA 4N43A 2V9WA 1FXLA 1COV1 2Z2SB 4OLOA 3MV11 5AC92 4I0WA 4MAKA 2VCAA 1TP7A 3C7GA 1RMU1 4S0MA 1WCDJ 1YJLA 1HQLA 4DX8H 4ZVFA 1PZ8A 4QQBA 4CDQC 3RZKA 4OUEA 2AYEA 3U1XA 2RF2B 5AE3A 3PW5A 4QX8A 2WZR2 5HP1A 2OMLA 1CQNA 3OQ2A 1QJHA 2C2DA 4EO8A 2YKNA 4LA2A 1YJWS 1ND2B 4ZU4A 3M2UA 3ACIA 3RG0A 3V81A 1VLNA 3RR7A 1ZZ8A 3WLUA 1C1LA 1PO13 4B4RA 4XDQA 2CZ4A 4G1IA 2DHHA 2VU9A 3M3CA 3W66A 2JE7A 3MWBA 5KFVA 2KR2A 2A3YA 4HMZA 3FEZA 5F8GA 1UZ0A 4PQ9A 3Q8PB 5LRSA 1T6GC 3PJQA 4P73A 1AL21 2V8PA 3KZ4C 1QSYA 3CNAA 1S2KA 2M3DA 3LP1A 2QDRA 4KKOA 1Z2LA 4ZONA 4SBVA 3MM5A 5EZWA 1YTYA 1BBT2 4AQ2A 1RAIB 1B0VA 4ZVEA 5FY8A 1SXLA 3TX8A 2B39A 1WUUA 3NAHA 4LVNP 2OT7A 3LIHA 1HKDA 2F9DA 1W05A 3LAMA 4A8WA 3NG8A 3M6XA 3AOCA 4ES1A 2BRKA 4FP3A 3CJQA 4BDPA 3KM5A 1SKUB 1OLQA 2GJ2A 3HHLB 2WNOA 2C3PA 4X4OA 2YBPA 2HBRB 3HLUA 3BV8A 1FJGJ 2F17A 4V19X 1C1BB 1CR7A 5A3MA 4AGVA 3CJIA 2LEBA 5SV8A 3BYRA 2WSCC 3GBGA 5CKQA 1W26A 3TYJA 1C0UB 1JLCB 1UO9A 1GFF2 5FYTA 3OR1B 2A6YA 2BANA 3O12A 5HK4A 1Q5YA 1ULGA 1SCSA 3FBYA 3PFOA 1AR71 3LOIA 1OURA 1C28A 4USTA 3CO0P 2CY6A 2GIQA 2GH8A 4LKEA 4PQAA 2WC2A 4AR2A 4NHLA 2O66A 1Q7YT 1B35C 1HI1A 2ATFA 1JK9B 5KFHA 4LBHA 4JKKA 2C26A 1ZOTA 1RUC3 3AA9A 5JSOA 2ATCB 3D0GE 2YROA 2JICA 3BOPA 4I2QA 2RIJA 3NNGA 2BRLA 3Q8YA 4KG0A 1PO22 5FBZA 1RMU3 2RVAA 4P9JA 3UWTA 5K8MA 1URXA 4BK5A 2CPEA 1G2EA 1BWEA 1OI6A 2FJXA 1Q79A 3AJYA 3LEMA 3CD5A 2YBSA 3JTOA 2YQ0A 5LRRA 1NXMA 2DTYA 4OX7A 3CQOA 1DGRN 4OV1A 3POJA 3J7YU 1EP0A 4GMP3 4U2AA 1DHMA 2GVDB 3B78A 1BQXA 5IT6A 1G3OA 4ECTA 3GZUC 2GQQA 1JTZX 2WTFA 4O4RA 5B2GB 3A13A 1LNQA 2UV8A 3PY8A 4Y1YA 4KI5M 3UDVA 3MLKA 3ZFEC 3S57A 2ZGPA 4Y28C 1EPZA 5U47A 3DGPA 2KHCA 3G6JB 3EMTA 4ZS6A 2YPZA 4AVBA 1MMLA 1S1UB 4ZVUB 2Z2LA 4BQXA 2DNMA 1JKHA 4USIA 2MLYA 1CQMA 2HGMA 1UYXA 4CDXA 4F04B 4KIAA 3PNIA 4KE5A 2AREA 1HRI1 5EJ3A 1OFSA 1PVC1 1EQMA 1REEA 1Z4UA 1HN0A 4LBPA 1RUF3 5FKCA 3MFIA 2RR12 3Q8AA 4NVPA 2PHXA 2ZJRQ 2ARCA 1PGW1 2V5HG 5J2NA 2R7OA 3IRXA 1OS5A 2KB2A 4RW6A 4RHV1 4B9VA 4PF1A 3FGVA 2VF3A 4OX6A 2UVWA 2MQMA 2F5GA 3ZMNA 1S5ZA 4DPNA 4MTPA 1F5AA 3IMQJ 3ILRA 2D44A 1NEEA 1BCXA 1NXIA 3ETOA 3WT3A 1UL9A 2VUGA 2J0QD 4PAAA 1TL3A 3V81B 5HROA 1F35A 1JYVA 1IS3A 3RZLA 4OZ2A 2AJ4A 1LWCA 5F3EA 2LQ8A 3MEEA 5DAVA 1RVF3 1S6QA 2A6OA 1F3FA 1WG4A 1B70B 2E33A 3DRPA 2IXHA 5F41A 4TYAA 4O9EA 4N7IA 2PEHA 2ASDA 1LEDA 2HWE2 5DDOC 2CKWA 2GN7A 3NSTA 5ACA2 4Q0BB 2CHHA 4NRUA 4TZDA 1T9UA 5FPVA 1NY72 5CG8A 1ICEB 2QA4G 1KTQA 3D6FB 2DHGA 5C5UA 1FKOB 2XMMA 4NA2A 4FBUA 4UBHA 2GU9A 1IKPA 3R27A 4E4SA 3H1MA 1HQ2A 5FUPA 4QX1A 1RUE1 1RGSA 1CAXB 2EEYA 1UVJA 4P9LA 3FRYA 2Y1IA 4URQU 4CXWA 1GXLA 2ILMA 1UTAA 1EV13 2ZGNA 3ZXDA 2XMUA 4DFSA 3PX4A 1MLAA 3U02A 2K2SA 3KHHA 1U1PA 4JI8F 2K06A 4AEDB 3RSJA 4ZK7M 2WAAA 1IKYB 4DFPA 3N9UC 1N1VA 2VJXA 3A23A 4ED7A 4NMXA 2MKYA 3T9ZA 4W4ZA 4UI9L 2SLIA 2LW8A 4OYMA 1U0SA 2EBEA 3R6SA 4YZ1A 5J2PB 4NLGA 1X31C 2W92A 3I0SB 2Z2ZA 1N3OA 4NLQA 1LWEA 2BVZA 3ZFGA 2FCUA 4OZXA 3NAIA 2UXCF 1PYOB 4ZXKA 2B8MA 3OPWA 5EX0A 5KOXA 1UMHA 2UU9F 1MWZA 2P37A 3VBSB 1QM9A 3D6EA 1SZBA 3EBRA 5DETA 3PIJA 4BMEA 2BWAA 5DG9A 2B9VA 5LJ3Y 1Y00A 3RJ2X 4BK4A 3DFEA 4OUMA 3T5HA 1O3TA 1AYM1 1DURA 5HMZA 4MGZE 3UFCX 4GB31 3U1MA 2R7UA 2F6BA 5F8LA 2OFHX 4H7LA 1W6NA 4GZ9A 2YKAA 4IEYA 2W2PP 1VC5A 5DG7A 1Y9GA 2OPRA 3JU9A 5KG3A 2YXSA 3BGFA 3POTA 2BANB 3BBCA 1HPZB 2BJ3A 1WMEA 3R3TA 4Y24A 1TL5A 2F8EX 2C3YA 3KV4A 1P27B 1IS5A 3VZMA 5D4OA 1WD4A 5GALA 5IFTA 1NK8A 1W3XA 2GCFA 3P5BA 1KS5A 3FKBA 2DU1A 1T9XA 2VG7B 2BQRA 2Q8EA 2GMEA 1RWPB 1WC6A 3UDLA 1FT9A 5L46A 2GNDA 3K5MA 2B9XA 4QWNA 4IQPA 4KV8A 1OPOA 3ZTRA 1L3TA 5JUMA 3E2EA 3EM1A 2R9LA 2MGZA 5T5OA 3ZO0B 1GP4A 3HXMA 2AJ1A 1KWMA 3U07A 4KGZB 5CQGA 5B0EA 3KHLA 2MY8A 3NBPB 1LFWA 4D94A 3MUVP 4KTQA 3CCSS 1HLCA 1QKQA 3KHBA 3ZXGA 1TKZA 4AEKA 4RUBA 4X6QB 5J1XA 4AVAA 4RNOA 3H4BA 2CZ9A 2M2BA 2UXCJ 4BYYA 2Z4FA 2FCTA 5IM0A 4COVA 1YI9A 4HR2A 3QPIA 1VHFA 2POKA 3F56A 2D3SA 2HNZA 3CJ3A 4DUYJ 4XAEA 4NLXA 3VZOA 2E5LF 4RUCA 1YJ9S 1X4DA 2GAGC 2AV5A 3ABZA 5I91A 4ZPBA 1FK9A 3CD6S 4KBZA 4A44A 4NZ6A 5KFYA 4LF4F 2HK3A 2YDEA 4KC5A 1PZ7A 3MZHA 3OTDA 5B09A 3WQ1A 4CDXB 3TP2A 1FXRA 5CXTA 4BB3A 1OWXA 2QL9B 5CFCA 1I94J 3OSDA 4EJRA 3TQEA 1RYSA 1TEIA 2Q0AA 3T4HB 2D6PA 5G0RA 3FK4A 3Q2TC 4WKRA 3W61A 1ZTWA 1M90T 1QU0A 2HWF1 3IZOA 5ETLA 4K1YA 4DR4F 4PIYA 1EP4A 3EGVA 5L8RC 2ROPA 2ARXA 1R081 3WQ0A 1QJFA 5EP9A 5FK7A 1VQPS 5I0TA 3N01A 3BQ0A 5B0DA 3GJTB 2VFUA 3CB4A 2BKPA 1UAIA 1LEOA 4DMIA 3K2YA 2B9YA 3SMHA 4XZPA 5J98B 5CKNA 4UF0B 1SKRA 4HH1A 2YTCA 2NZCA 4DX7A 2DFCA 1BEV3 1JLAB 2G1HA 3MAAB 4MMOA 4RWWA 2PT0A 1I6JA 2Q5TA 4JGYB 4K2JA 3KLEA 2VZQA 4XFIA 4YFZA 3C66A 3CJKA 5K20B 4Y26A 4ZLPA 4ED1A 2GVZA 1OD5A 2OKQA 2ZZTA 4YW7A 4LBLA 2BE9B 3FFIA 5CB7A 2RDDA 2PLV1 2W87A 2IVJA 3MEKA 2ZACA 3UNYA 4B9UA 3HJRA 5E1RA 1XC6A 4YZ5A 1T8EA 1V3SA 2CNNB 3WUDA 4UF4A 4QPIB 3W58A 2CQBA 4Y2IA 1GFWB 4A8FA 3AYEA 5D1IA 1WOPA 1D4M3 4O0IA 3RW6A 1UYYA 2J6TA 5DAQA 3HPOA 3VVTA 1XBFA 4IQXA 3T2TA 1M5SA 2HHPA 4COUA 3ES1A 2DHAA 5L19A 1WLTA 1TVRB 4DSKA 2RHSB 5FZDA 2HNYB 3ILIA 5J1EB 2H0VA 2VMEA 3NV4A 5JZGB 5GVQA 3BN6A 1RAJA 2BWCA 3DDIA 1Q5OA 3CPWR 2XGQA 1NDPA 2AIRB 2XSJA 1S9FA 2FLPA 3MW2A 5BNPC 4JI7J 4LORA 1V3ZA 4A7YA 4PG7A 3I4HX 3M3OA 1YJUA 2EIBA 4NR1A 3BPSA 2RR13 1RKJA 4ATFA 4FFIA 3ENWA 2N7GA 1AW0A 4Z92B 2RS12 4Q4Y1 4KG8A 1VBE1 1VIWB 3ZXJA 4Y4RA 5AC91 4H4KC 4KGKA 3J7A1 2EFVA 2VZVA 3GBFA 2XGXA 4XJ8A 4IDZA 3LP0A 1FCAA 2EXKA 3W9JA 3PTYA 4RL1A 3I2OA 1VRUA 1WI8A 5E3RA 2ZKNA 1YUDA 5C8CC 2YBKA 1S6PB 1WSRA 4I01A 2RHPA 3VZLA 4ZP7A 3RZGA 1RTJB 4DB5A 1SKWA 1RINA 3FCVA 1SL0A 5LA2A 1X9SA 1LKZA 3MF6A 4JV2A 3SV4A 2WBKA 2Y60A 1R0CB 1U6FA 1R083 2VQ0A 4YWAA 5JCTA 4JV5J 1ODMA 2P5BA 1VBB2 3K4ZA 1F2NA 2Q1FA 4GD4A 3M32B 1WDDA 4OZNA 2QV6A 4R52A 5FY0A 3WZ0A 2XPJA 1SJQA 4JV0A 3VDDC 1NYWA 4TSVA 2WRMA 4J9OA 2WAQD 3CJ2A 3U10A 2RVJA 2XBO3 2ZS6B 3KLFB 1OIAA 1S1VB 2CUYA 1W8NA 2D9OA 5IWAJ 1VS3A 4CZCA 2GJIA 4LREA 5CISA 3A8JA 3I0SA 4M4PA 2VAUA 3G6VA 2C3OA 1OUXA 2SBAA 1DY3A 1HQUB 4M5GA 4NXNJ 1RTIA 3WCRA 5K9FA 2E9ZA 4Y20A 2BQPA 1UYZA 3U7JA 2V63A 2ZEJA 2V4JB 5IHRA 3VKMA 1R7IA 4ZU5A 2OPSB 5DM6Q 1PAUB 5I42A 4G1QA 3ZFFB 5AJ3F 2KFYA 3ZZZA 4LULA 2V2ZA 5IJRA 5M2UA 1W2AX 2KG0A 2D6OX 4QXHA 2JD9A 1OMSA 5DQGA 4Z82A 4I2PA 4LF5J 1CGPA 1N5VA 3GZ7A 5HVFA 1OFNA 5A8RB 2OQ7A 3CMES 4Q1RA 2ZMLA 4YMEA 3MUZ1 3TEXA 3DPRA 5FR3A 4FTBA 3LGMA 1M0SA 3MHYA 4KMQA 4WZQA 2WABA 1JN2P 3GV7B 3FCWA 1OLRA 3NJVA 4A8KA 2XYHB 1JQGA 3HF5A 4Q4Y2 2AGSA 2CJXB 4RQPB 2H51B 4WBFA 1NLSA 3MPVA 1RWVB 3QYYA 4WV8A 4CU8A 2JDAA 3TZWA 5FZCA 1GICA 2WUHA 2ZH9A 2YFUA 2HEVF 3RS6A 1OJ4A 3GFYA 6AT1B 2AX1A 4UQTA 4F67A 1VBB3 3NV1A 3N4MA 1LOEA 1K0VA 3O1SA 3TW0A 1PIV3 3DI6B 1N0VC 4LFBF 3IM9A 3UKVA 4TVAB 1S12A 5KFOA 2F3JA 3KF5A 4X66J 2RS51 3PHTA 2QFJA 1VQMS 1VRH3 2XHCA 2J1EA 1W2IA 1X9PA 2FY8A 3MPWA 5KFQA 1C57A 3OXLA 3IWLA 1CULB 3D0JA 2X53S 4HXCA 2VG6B 2ZC4A 2QFEA 4RLEA 2QQIA 3P5TL 2HNDB 1NMEB 2PLV2 1JLAA 5AT1B 3VHQA 2XJRA 1VAVA 4JGYA 3BM7A 3L4BC 3I2GA 3SQGA 3NKTA 1UJ6A 3DLBA 1IQTA 4FOQA 1RHJB 2XQCA 2AP6A 4RL7A 3WSOA 3VD9A 1AFIA 4U9RA 1RAHB 3BR9A 4CEWB 1XSQA 2YWHA 3LA3A 3AVSA 1M1GA 1IG0A 4DUXA 4MKYA 2DHXA 1RUG3 2RE1A 2VC1A 2HS4A 4E98A 2WONB 2R072 2RMU2 3O44A 1FI4A 1MVEA 1WCSA 1LHWA 1ND2A 1C0TA 3OUJA 1JJHA 3O1LA 3QT8A 1DGRA 3HQUA 3NW4A 4WM7B 4PXDA 2KZZA 2IC3A 1S7IA 2RDSA 2V68A 1JLFA 1Y9OA 2J7KA 2WS92 4UOJA 1X4FA 2HQDA 3HBZA 3VR1A 3M2RB 5F9NA 4AL7A 2BP6A 2X5IA 1RIRA 4LQ9A 5F3ZA 3SMZA 4LE3A 1FNMA 1GANA 1NM2A 2V5DA 4FQ4A 2IJRA 3CCMS 2OTJS 2CQIA 3CCVS 3WNLA 1QIQA 1ULCA 4NCGA 1S6QB 4FKYA 5FP7A 1UAWA 2IFRA 3MIEA 1QJY2 2WL1A 4KU7A 2YV8A 4B02A 5GAEI 2Q30A 3ZFGC 3TA0A 2Z2MA 4AEDC 1IGOA 2OELA 2W9CA 1O4TA 1T9WA 3P3DA 4C6AA 3HP6A 3N6MA 4OV6A 3H2LA 1L3UA 2O1PA 1HDKA 1RAFB 4D69A 2ZAAA 2JC1A 4MV2A 1N1TA 1N5TA 1U1OA 2WVEA 4DV1F 3DRXA 3N6LA 2DXFA 4K4ZA 3F0NA 4QXBA 4CEYC 1W8UA 1XC9A 4A42A 4WFAQ 3O0XA 3RR8A 3MPBA 1JLCA 5D0HA 2HVDA 3H5UA 4P52A 3M8QB 1YRUA 1H4GA 1BUXA 2FIUA 2E7WA 5JIUA 1A6LA 3K8WA 3H5YA 3OLAA 1RAGB 2MEV1 4NXMF 1SBRA 4HHJA 4NRTA 4FPYA 1H7WA 2IRUA 3DYAA 3E1F1 4HDHA 3J80U 2XR4A 4DUVA 4DR1J 1N8RT 4O7XA 4HVOA 2PHLA 5IVCA 3HULA 2DPJA 1B35B 2IVIB 5D4NA 1HBMA 1Q8OA 4XF4A 3WNKA 3UL2A 4C91A 5FZ8A 4P10A 4PWWA 5IQQA 3KLFA 1U7LA 1AVBA 1JOBA 1UXXX 3W5ZA 1BEV2 5FCCA 2M9KA 2BM1A 3KK3A 5A0YA 3TEZA 3E51A 3EVMA 1PG5B 4R9AA 1JLBB 2BUKA 3NNJA 1WUVA 5FP9A 5HMYA 4IQMA 3BTXA 4OYPA 3GM8A 4GC6A 1X60A 4CQ1A 3T09A 2ZJPQ 2WSFC 2Y6LA 3V6DA 2E66A 4DO0A 4ZPDA 2P17A 2XLIA 4W90B 2W01A 1GX5A 2ZH3A 4M01A 3SNMA 1BKZA 4EN0A 1PHMA 5GLUA 4DL5A 3B00A 2RS2A 1ZZCA 2XI2A 2FZGB 2AGQA 4ED2A 2QL5B 3C2UA 4QPGA 4CLSA 3IG1B 3FC0A 2V4QA 3P96A 4XIUA 2QA2A 1PMHX 3OCPA 1LOGA 1IPSA 4USVA 4TYSA 1FESA 1YGYA 4F2SA 1XEZA 3RZJA 4I1TA 4NLPA 3GU0A 1P6TA 2YX7A 2DVIA 2DVDA 4USMA 1U47A 4CP0A 4Y22A 4EZ6A 2CJAA 4CYUB 4DOZA 3ZZRA 1QY7A 3OL6A 5FZ4A 4ZIVA 3L9JT 5FRAA 5MAOA 1HXS1 4KV8B 2AH2A 4BS2A 3DLKA 3P45B 5EYYA 1RADB 4N76A 2VONA 3MR5A 1DGWA 3AAWB 4UW2A 2D98A 5LL6d 4B9NA 4R9BA 2R16A 3LFMA 5AC93 4TLRA 4JGZB 2FD2A 3K5OA 3T2QA 2QMXA 3B7MA 3O1UA 1PGW2 1H0BA 4OI1A 1KR4A 2I2YA 4J9RA 1XMBA 5DG8A 4J90A 2KXNB 1NOVA 2Y0OA 4L99A 5M0TA 1V6JA 4LQ3A 4YZ3A 4MGSA 4FP2A 2ZBJA 1HV0A 4C11B 1WEYA 1NCQC 3DU6A 2E44A 2QYGA 3BF4A 3R6GB 2XXZA 1TL7B 3DLEA 3IM8A 3GYNA 2UWAA 3W2WA 1RCOB 1RUE2 2ERFA 1R6YA 3UGGA 5EN1A 2I45A 2RMU3 3DN7A 4Y33A 3OTBA 4ED8A 2GMPA 4A48A 1W9WA 3K7RA 2F4LA 1FDBA 4IKAA 3ZMOA 4YW4A 1WCKA 1K5MA 5CZVA 1NH7A 3HSJA 2IFWA 2CPIA 4AFFA 2ZABA 3O1MA 1IBMJ 3T41A 1FVSA 2EAKA 2VA2A 2C2RA 1HQEB 2XBO1 3J8F2 1K42A 2RHQB 3VBSA 1DLOB 1TUVA 3SFGA 4X4NA 1NPRA 1D2QA 1LRHA 2PHFA 3NRBA 2RM21 2I07B 3K77A 3I6PA 2QVSB 1S9EA 5FIXA 2NXEA 4C8YA 3GG1A 1ZRFA 4CO5A 2XNQA 3I2IA 4X84A 1FEEA 4NPLA 2E7TA 3LA2A 2ZUAA 1Q5VA 5FY7A 3Q89A 4TY9A 3BGLA 3N0VA 1PBUA 1RISA 4INDA 4IOBA 4H4KA 1FTRA 1NRKA 4PPZA 1FX2A 2IM2A 3IS9A 2NXNA 5KXDA 2LXFA 2WVFA 5KFIA 5EIYB 1RDRA 1UMZA 3HAGA 2AR6A 4CCJA 3B9IA 4CPBA 2VECA 1RUSA 3EPGA 3EPIA 1YLXA 4SLIA 1TL1A 3HD2A 1TE1B 5BXIA 1PK6C 2XO7A 2ADBA 1WI6A 5KFSA 2PMHA 3P8BB 2JIGA 3E5QA 4HKWA 4DOUA 1NKGA 2WINB 2QBXA 2CJBA 3MMAB 2QO3A 2LTNA 1JWWA 1MROA 2MZ1A 5KG6A 2HFVA 5JXGA 2ZMNA 5DDQC 5A32B 3IAQA 3MLLA 3CE8A 3M8PA 1M5KC 2H4WB 2N4DA 1RU1A 2BDRA 3IWZA 3GIKA 2KXFA 4MFBA 3HI9A 1KJLA 3HK2A 3ROUA 5A8WA 3JSBA 4ZKAA 2VNVA 1JU3A 4CDWA 4WE1B 3MI7X 3BPDA 3N9NA 3FZ3A 3GZTB 2J1VA 2ZTNA 3F2ZA 2WQ8A 3M30B 1VB2A 2I6WA 2MQNA 2BW8A 2VG7A 3NGDA 3WDVA 5DXDA 2RS53 2MKIA 4LFAF 5C8CB 1KRPA 4QDRA 1D3WA 3LPYA 4CCHA 4KYZA 1ELOA 3AMQA 5C25B 2B9UA 1S57A 3I56S 1IPJA 2N82B 4ECVA 3K5NA 1RUJ1 3GFXA 4FS2A 1RTHB 5F5IA 3GBWA 2CPFA 3KFWX 1VB4A 3HVTB 2H3EB 3AD9C 4K8RB 5DDPC 2L9LA 1SLTA 1SJ3P 3MURP 3RZMA 3AB2B 2CGOA 2ZGSA 3MMBA 5HLFB 2W08A 1MU2A 1MMDA 3N5BA 1S49A 5GLTA 5FO8B 1ENQA 1HWUA 3C6TB 1TNFA 3PHEA 2V9KA 3L7OA 3QSIA 1I5ZA 4C8ZA 1R89A 3MDFA 4AAPA 1IQZA 5H9EK 4BISA 1ZRDA 5KFTA 5GAGU 1C1FA 1G6NA 4UW6A 1LU2A 3W8PA 2QE5A 4NA1A 2WBMA 3TARA 2JJ4D 4YYOA 1E5SA 4P9SA 1X0PA 4I56A 4JGZC 3ZSEA 1DLCA 3GF6A 1K73T 1P8JA 4ECSA 5HP1B 2R4FA 3SLIA 1NCQA 5LB6A 1XR7A 4FFGA 2VCMA 4DV6F 4XEZA 3OUIA 3UT0A 4PQUB 3DEMA 1E5IA 4M3CB 2HBQB 1SPBP 3Q8BA 3BN4A 2IXCA 1CS4B 3RBZA 1UZVA 1WLWA 3HVAA 2QQNA 2GALA 1NLRA 5GZCA 1YRXA 2Q1LA 2VL4A 4CCKA 4PG5A 4DQIA 3VBFA 3M9NB 1DTTB 1WMXA 1F2GA 3CJ0A 5D8AB 2W7AA 4P2SA 2ZVIA 2VUJA 1UOJA 2GAHC 2EIEA 3Q8SB 5HVGA 1OY8A 4MX3A 5BNPB 4K40A 3SCIE 4DINB 4DMZA 4OQJA 2F1FA 3UO0A 3DECA 1KQKA 1ND3A 3CD0A 3JYTB 5FY5A 1U5XA 2GNMA 4NI2A 3HZGA 2Y6KA 5IK4A 2QG9B 2J7WA 4YGEA 2E9TA 4NMIA 2YC4A 5IXUA 4NWBA 1CN1A 3I2HA 4Q4W1 2NSCA 5BR8F 3A4UA 2HJIA 2HS3A 1UEVA 4XJ9A 5FZOA 4ITCA 1CIWA 2CQ2A 2TBVA 2O3DA 1RU2A 2AWZA 1AR93 3MOZA 1QHDA 2J22A 1W99A 1NXD1 1RA7A 1ZH5A 1J83A 3WNXA 4XQDA 2WK4A 3UN2A 4P71A 1NHVA 3Q8QB 3SXLA 2DCTA 1L7QA 1SFPA 2V8DA 3QQCD 1XNRF 2E63A 3WDWA 4ATNA 4QWCA 2YQ1A 4GWMA 4Q7AA 3HBKA 5L9XA 1NHKL 2BEFA 5ANNA 4F25A 1HFEL 3NGUA 1QXRA 3U0ZA 3VHPA 1BWVA 2QMWA 3MW4A 1D4M1 2M88A 1XN9A 5LMUF 6FDRA 3PX0A 4CUGA 3V6DB 3C7OA 4LF5F 4C2MA 3HD8B 5KFBA 1VP6A 4JC1A 4BJ0A 3I31A 4QT6A 5KFLA 3PXGa 1UY3A 4R0EA 4Q0QA 2CADA 1VLOA 3SYZA 1SJRA 1WHWA 1VPHA 2Y6JA 4ANDA 2P4EA 4DXSA 4FNHA 5DQIA 2ZFHA 2MB0B 1WC4A 4Q0SA 1WEXA 1LOAA 4G9SB 4HFSA 3ET6B 4CH1A 4MT1A 1DZ5A 1Q4RA 1RT6A 2OO4A 1T03B 1TAUA 2NSBA 4DV2F 5A1AA 2A6XA 2KDOA 5A8KA 2BTVC 4RGKA 1U49A 4YS2A 2ET1A 2A2DA 2C9KA 1NSKL 2BERA 1E6YA 2AD9A 1N6QB 2I74A 2RRAA 1XMQJ 3ZO7A 3IXQA 1N47A 4CLUA 1ITPA 3AYCA 1X33A 3G8TA 3JAMU 1N5YA 1U1NA 5IW0A 1JZ8A 3ITHB 4UW4A 3M8WA 3NS6A 1BVVA 4Q4X3 4Q27A 4NJ4A 4AG4A 4PUOB 3C7FA 1VCTA 4ILMA 4AHXA 4B17A 3LAGA 1VR3A 4XF3A 3VAFA 1HWJA 3DCAA 4ORFA 4LIUA 1VQSA 3S6EA 4XCAA 1OC1A 1T02A 4BZ4A 4YDDB 2DR6A 4J9NA 2WWJA 3PEHA 5BYSA 1BMQB 4B1MA 2P3JA 5I3QA 3U78A 4CWBA 3ILJA 4ANEA 3AP7A 1DYKA 1JXLA 3VDDB 2VKRA 4YRDA 2G4IA 4J9KA 2J9DE 1W3VA 2NMOA 4A8SA 3WVJA 4X4SA 3FLPA 1FKAF 1Z7S2 2G0CA 3B93A 2HVIA 2H4YB 5HV0A 3V6HA 1NJZA 2CXEA 2MJUA 4YUDA 3GWCA 5BUVA 3ELNA 2WA4A 1DLOA 2G0IA 1UXZA 1HI0P 2WNVC 3R4DB 3OFFA 4JYAJ 5APAA 3ZLIA 3KKFA 2WNUA 5C4WB 2W4DA 1SLIA 4IFYB 1GV9A 1NZAA 3AK0A 4LR4A 4RHV3 2BE2B 2DIVA 1WDTA 1CJVB 3D0SA 2NPFA 1RAAB 4D3HA 2FHMA 2YU1A 2BFUL 4GALA 5C9AC 3O3LA 1KN6A 3RI8A 3AFKA 4CIOA 3WQBA 2P34A 3QH7A 3OL8A 3OXGA 4NL5A 1AR63 5FZ9A 2P6HA 2V2QA 4USHA 4D6SA 2QZ8A 3ZFEA 3QRQA 2M4MA 3OJUA 3PTRB 4RNFA 2ZNYA 3AZXA 1W25A 3CDBA 4JI0J 2I38A 2YY3A 5HCFA 4JHZA 2DY1A 3SDEB 2JG8C 2B7CB 4XUNA 2WBRA 5IVYA 2OYZA 4J7CA 3B01A 2ZHNA 4UFIA 3FSIA 5IT9Y 2WT2A 4I0AA 3TN91 2X3DA 2GC8A 3UV9A 1U2RA 1KOHA 5C71A 3RUBL 3LP2B 4PABA 4B7KA 1EAH1 5L36A 2KT3A 1WKYA 2G19A 2OZ6A 3TNPB 1QTMA 1RT2B 1N36J 3UI3A 3P1IA 3GCWP 4EZ9A 1R1A2 1UP1A 2CQDA 2FHOB 2B4OA 2VFSA 1W9SA 2FZKB 1EV12 4FAHA 3PZPA 2DBNA 3IDCB 2YNGB 2COLA 4KQ7A 4R25A 1G4CA 2D40A 1KQSR 2DKOB 2AW0A 4HK8A 4E0DA 4MG2A 1Y9MA 2BR0A 3DMJA 2AKWB 1SBFA 3LE0A 2VD3A 1PMJX 5CFDA 4LUBA 4DPUA 2FC9A 1JODA 4DL2A 4XQWA 4IV3C 5CZKA 3TN93 5FQ0B 4I68A 1MSWD 4GWIA 5CADA 3BO2A 1ZS6A 4QZVB 2W39A 4HSJA 4EN6B 4YQWA 4Y2KA 2FCVA 5FV3A 3JSYA 7AT1B 2BW2A 2D74B 4Y6IA 1HRI2 2CPXA 2D1CA 2EA7A 2GDFA 1UEUA 5I4MA 1GQEA 3Q23A 2D7FA 1TQLA 3IGVA 2OUHA 3D8CA 1HHQA 5A7WA 3N9LA 4F0MA 1PGZA 2HHSA 3T2PA 1NJIT 5FPBA 1C4CA 2JE9A 1DQ8A 3VHRA 1KGYA 1C8M2 1XIQA 4F4XA 1HNVB 2R8HA 3QBQA 1FPN2 2QMUB 1VBE2 4IUFA 2AEJA 2C22A 4GC7A 4EFAC 4I4BA 1C1BA 3E6DA 1U24A 5FLXU 1IJEB 4D6RA 5DUWA 1SBEA 1N36F 3OTOJ 2E9QA 3IN9A 5D78A 1UPMB 2YB7A 3PEJA 1J1LA 1SC4B 5DAWA 3POWA 4F7ZA 3N7MA 1L3SA 1E6VB 1Q86T 3VHNA 2BZDA 5J1PA 1R3NA 1NK7A 2WNEA 1ZZFA 4OHYA 3OGSA 2DT9A 1DF0A 4M0NA 1DRZA 3R7SB 4NRPA 4XYXA 5HAOA 2RS11 4FKXA 3BYPA 5BNPA 5F7UA 2HWB2 1A3KA 1VQNS 5D2AA 3H0OA 1EAH2 1DQ9A 1CVNA 3PR5B 1E5HA 2XKOA 2OEKA 1W6MA 4OX8A 3BSNA 4DUYF 2U2FA 1HBUA 1W7WA 4HEA9 2HZAA 3TRGA 1YIPA 5C8WA 1NPKA 1YXWA 1SC6A 3B9CA 1REDA 4XILA 2HZVA 1FMD2 3NNMA 2D97A 4HDGA 2JE8A 1VBC2 2O14A 5E0OA 2QLWA 2BW7A 5F8NA 4FXKB 4NI2B 3V6KA 4RPFA 5GZDA 1GQGA 1LWFB 2IBKA 5F0UA 4FOVA 1QUPA 3JSMA 2ZGMA 5F8IA 3MM7A 3WHIA 1WC5A 3FN9A 4AVSA 3KK3B 3WG4A 3SEOA 1VISA 1TKDA 2KJVA 1QF3A 3FNNA 3I3QA 1QE1A 1UCXA 2VBWA 4KY3A 4CLFA 2X1AA 4ZVTB 5ABJA 1T6BX 2W3JA 4ERDA 3SEPA 3TJ8A 1S0MA 2R30A 3THVA 3EVWA 4LJMA 2PHWA 2OUGA 2DPIA 3OOXA 4B9TA 2XUMA 3UNPA 1K1SA 2YNIB 2VE1A 2HGLA 2HEWF 2K8GA 5KFFA 1SI9A 1M1KT 2KA3A 5JR2A 5GM0A 1YBUA 2BJ1A 5F5QA 1W2BR 1R43A 4FCAA 4CTEA 2OH2A 4EWEA 1WZXA 4GB32 2PFWA 4FFFA 5KG0A 2MPFA 2AEZA 3EX7B 5DGAA 1RWKB 1AX1A 1AYM2 4OCTA 1RXGA 4F83A 2UXBF 2ZGUA 2VQEJ 2XMJA 3HFZB 3B4DA 3KV6A 2HQGA 2Y1LB 5F2WA 4ZN1A 5H9RA 1SKSA 3J7ZT 3PDQA 3IAM9 4MGKE 3ZSLA 4IH6A 1VQOS 3JQKA 4BBYA 2QQMA 2FQQB 1JLQB 2HFSA 2VZ9A 3KG4A 1OQDA 3AKPA 2CL2A 3VZHA 1SC3B 2VW0A 1FWLA 1HRV2 2EXIA 3BKZA 5B4NA 4NLDA 1J5OA 2HLUA 1ND3C 3L2HA 2BVVA 1EZZB 2HBZB 2VODA 5LMNJ 4AXOA 5T5JA 2PGCA 3TVZA 1Q56A 4QPTA 1I5OB 1UU5A 3W21A 3QFHA 4N47A 4CCDA 4RW9A 3N28A 4LF1A 3SCGA 1NCRA 5IOLA 2WAOA 3ETPA 2VG6A 1NDKA 2Y0SD 1X4BA 3OGVA 3SCHA 3THTA 4AQYF 4KGGA 4DLGA 4FYDA 1RJ8A 1RT6B 4K4YA 4XUQA 4Z7YA 1VIOA 1Z78A 4IV1B 4C3LA 3PW2A 3SI8A 4XUTA 2LU1A 4DR3F 1D9DA 2EVZA 2EG2A 1VBA1 2XJVA 2Q79A 3PW0A 4AFMA 1OSCA 3W59A 1DIWA 3IS9B 2D6LX 3POYA 2IBOA 4ES8A 1UOGA 3MIBA 3M32A 5DMYA 5KWRA 1IKXB 1Y11A 3DKQA 1XR5A 2C24A 3A3PB 1MQTB 2EAAA 1KLMA 4Q4X1 4YHHJ 3PRVA 1MS5A 2XHNA 4Y5Z0 4RR5A 1QAYA 4F3MA 2LA6A 3VQTA 2X10A 3V0BA 2R8JA 2RQCA 3VTIA 3ZTQA 2WO3A 4MUVA 2P6SA 4NX9A 3KMHA 2GVZB 3ZYHA 2B51A 3WR0A 1IKQA 1WLCA 4QQPA 1PX3A 3DLJA 1SMVA 3DOMA 4E8UA 2BVBA 2A73B 1ZBA3 1KFUL 2QJ3A 2DH9A 3RI9A 1T9VA 1C8M3 1UY1A 7FDRA 2P8IA 2H65B 3NJXA 4FF1A 3MTKA 1RT2A 5FLHA 1UWBA 3WUCA 5LT5A 3R97A 2HBYB 4ASKA 4JQRA 2HHHJ 1UVNA 1KVIA 4YM1A 4QHBA 5CG9A 1QOSA 4BQWA 3SH5A 4G1QB 4WM7C 1UZYA 4LF7F 2CDQA 1UFLA 3DRRB 2KG1A 3CU7A 3IFEA 1FHTA 3BGUA 1U6BA 2AUYA 4X4RA 3TVKA 2G2OA 4NE9A 3S6PA 3R5DA 1UVKA 4LBNA 1EUUA 1YITS 3K5LA 1H2TZ 5EPAA 4QIGA 4LR7A 2PEBA 3VALA 1Y3TA 1JH5A 1FWPA 2G1DA 1SH0A 4N90A 1EJ7L 3P3NA 2L9NA 2RILA 1X9TA 1PC5A 4C3MA 1G8WA 4QAWA 1IBLJ 1R093 4M3CE 1PCAA 2VPWB 1RUH2 3KLEB 1PJ7A 2E5HA 2B4PA 4D7SA 1KJRA 3I5AA 4QU2A 4DX6A 4XCBA 4DV7J 3RBDA 2WQ4A 4XIOA 5HBMB 1U5YA 4MVTA 2IIHA 3AXMA 4LR8A 2UUTA 1J5EF 4KU8A 2N7CA 4YEAA 2DNHA 5BYRA 2X51A 2MYFA 4ZJOA 3KLGB 4NXNF 5ABJC 2FUG9 3LP2A 2GMMA 1I3HA 8RUCA 3ORJA 4OYIA 4CNZA 2FVSA 3IAS9 4FN5A 1JJ2R 2JDPA 4GJZA 5FLIA 3N9PA 4CCNA 3KJFB 3EGWB 2QZ3A 2HK2A 2XJQA 2EKNA 1V5VA 3POEA 2QC3A 1DYOA 4K0KF 1H73A 4KR0B 2QSFA 3BTAA 2J76E 2FZCB 1B64A 4ZPCA 4A7ZA 1C4AA 2JL9A 4B9LA 1ZBA2 2MSTA 2VW2A 2E7QA 2CQGA 3S5QA 1FAYA 2WO1A 3SCFA 3KJNB 4YY3F 3HQXA 3ZYRA 1VBC1 1MWQA 1WTBA 3WW1A 5IS2A 1GNZA 3D4KA 3H50A 2DHSA 1AT1B 1RK8A 5BXXA 3FZBA 1W8ZA 1XSRA 2V8GA 3GLJA 2HWC3 1VJQA 3B94A 4XHBA 1AR72 4QGMA 2DCKA 3CMQA 5FPUA 2CVIA 2EXJA 3DYPA 2XMKA 2ZHOA 4MSVA 1W9YA 1TMJA 2VASA 4XE9A 4EBEA 2WT0A 4BLIA 1OOPA 4LA3A 3Q24A 1AXZA 3O7OA 2NLRA 5DDJ1 4QW8A 4IDKA 2WO7A 3I0RA 5EQUA 1Q8QA 4A41A 3DXTA 3TWIA 1YJ7A 4L8QA 4N43B 3H8UA 1JLFB 3ZDSA 3PUQA 1DTQB 5LK7B 5FDLB 3A4TA 3DLGA 2VZTA 4Q2MA 4EBDA 2AHOB 3N7LA 2VQTA 3OVBA 2J1RA 2VL1A 4Y2MA 4EUVA 3ULHA 1T11A 2ETEA 5HV4A 5M2RA 2JHEA 3T1YJ 1NSAA 4EYHB 2HWTA 1RTDA 2N3LA 4GVBA 4QKFA 3RPQA 3CBNA 3SH3A 3BKTA 1X5TA 1Z2ZA 2X1FA 1K12A 4ZCLA 4QB6A 3CLPA 1YFWA 2DCLA 2WO2A 4CO3A 4LSNA 2OHDA 4CZSA 2KN4A 1GNKA 4MH0E 2AJ2A 4CLLA 1LECA 3DM2B 2ZC3A 2VDIA 1IBLF 3M1HA 5FUNA 1LGNA 1IJFB 2ZZMA 2DO0A 4JI1F 1R8BA 4ICLB 3KCYA 1X5SA 2VOWA 3WIUA 1JNZB 2ZDPA 4UYBA 2VXRA 2DITA 5KG5A 1NK4A 4TKTA 5A3NA 4B9MA 4ZVSB 3K4AA 5A7SA 3GDBA 5A3OA 1S99A 4ZVGA 1F5JA 3BDEA 4K4WA 1GMWD 5L1IA 2LQ5A 4QXKA 3MI8A 4IYQA 2W95A 1RB8G 3L2YA 4V1Ak 3WCSA 4IR1A 3PU3A 1W0NA 3KHRA 4GH4C 1CJKB 5J1NA 5GADI 3VD4A 1ULPA 2VBDA 1JJ4A 2R7QA 4AF9A 2JEGA 4N5SA 4NZ7A 3OG2A 2YKQA 2GZWA 5FMDA 4CUCA 2ZX1A 2D6KA 1KHVA 2DNQA 3IWNC 3F95A 2QQWA 3WDOA 1BQMB 1UY4A 5F5AA 2V4RA 1RCXB 4LRBA 4N7UA 3E6BA 1S72S 1RT1B 1JZ2A 4ECUA 3LAKA 5D0GA 1WWHA 4NYOA 5CYQB 4LKSA 5CVRA 2B9EA 1V00A 1YRZA 1ULRA 3H40A 1KOOA 1LXNA 3K58A 5FYHA 3PKYA 1NG0A 1XNQF 2RB7A 3I2JA 1ZA2B 1OMIA 3KLHB 3ELHA 3VUOA 4UFLA 2BU9A 2BGCA 3OHAA 3TNVA 3ZTSA 3T30A 3GJRB 2OW4A 2LQJA 4AI8A 1RUI1 1LV5A 2DU0A 3V64A 9RUBA 1XBWA 3FHIB 3M7AA 2ZKLA 3T3FA 3LOBA 5K8PA 2DNZA 3AL6A 2C6SA 3HVDA 4JDNA 4WVWA 5A6WA 1GWLA 4CCEA 3V0AB 3UD4P 1JYWA 4WE1A 2ZEZA 1B0PA 3L3CA 1SV5A 4F3JA 1RLCL 1N0UA 1J5OB 2RJKA 5KT2A 3VF0B 1RP5A 2M52A 4I0BA 3MF5A 3BGRB 3T6BA 4DU8A 2X7IA 3G4SS 3W7BA 2HHWA 5D15A 2B46X 4IV3B 2G2ZA 4ZJLA 3HIFA 4Y4YA 1WC3A 5KT3A 2OFGX 4QD2A 4G6VB 3JQWA 2OTLS 3CL1A 4W65A 4EZ4A 1VBXA 2ZKTA 1S4EA 4NE9C 1H74A 3U27A 3A3OB 3LPFA 3EQEA 4OZ5A 1SACA 1FF2A 2Z30B 3MEDB 4BCAA 1MACA 3NV3A 5KT4A 1URRA 4I3GA 3MCOA 4K8FA 1LTEA 1XNDA 4LT5A 4JI6F 3ZR6A 1FK9B 2NXCA 3K2OA 3FRZA 1IKXA 3PUAA 3QMQA 4BMBA 3ZTPA 1P1TA 5DJBA 3HJVA 1Q7LB 1RHUB 5K8OA 3QSYB 1A7GE 4KNCA 1HJFA 2LECA 3OT9A 4ZXEA 1FJCA 1N33J 3I5CA 3R7NB 2JG8B 4NLSA 1YWKA 1CAUA 1RL3A 2VBXA 4MKAA 4NROA 2R7RA 3EGNA 2V50A 2KM8B 2VTXJ 2LLZA 2WZ8A 5FMBA 1HMVA 4RFRB 1U0HB 1XE8A 3BBFA 3KMSA 4U8VA 1S9EB 1H4HA 1KEXA 2R043 4JUZA 2DUQA 3M6VA 5J1EA 4X64J 4BHPA 1IKWA 1HNIB 4XMAA 3CCQS 2YNFA 1IWAA 4CEYA 1ST8A 3OBTA 4QPGB 3PVXA 4RFT0 1DLLA 3A0NA 4CDIA 2MZJA 4LPLA 4XDPA 1VAMA 2K1RA 1H72C 2B5JB 2JC0A 4L92A 4XF9A 4H4OA 2B56A 4QR2A 4CDUC 2D5FA 5FPXA 2B6AB 1ND3B 4QWDA 2YBVA 5IWFA 3H42A 1WSVA 3EXUA 5CYMA 3MCSA 3D6HB 1QQP3 3X1LB 3VBUA 4KWLA 3D66A 2OKXA 1JNRB 2ACYA 4K4VA 4TQRA 3UQSA 1G9AA 2XKPA 4BOWA 1RHRB 3CMAS 1RT3B 1UW9A 1PX4A 3MMJA 3MPUB 2BJ8A 2VZ1A 1BJQA 4EN7B 1NAQA 4LSNB 4JBCA 3D4JA 2Y1JA 4DXLA 4NUBA 4DX5A 4QPXA 3WX8A 3D6MB 2VZSA 5HQ8A 2GV1A 3OEBA 4DPWA 1UPIA 2EFPA 1NSPA 4A6SA 5F8JA 3OUHA 4XDOA 2CG8A 4FTEA 1MS3A 4IEWA 1KXGA 5HQLA 2GC0A 1S1XA 1QVGR 3EE3A 4B3MF 4KWJA 4I6WA 5KFDA 1G9DA 3M8SA 4J9LA 5JPNB 1OYDA 4F0KA 4TXWA 1XERA 4XFHA 1ZZ7A 3M2VB 1RBOB 3LWCA 3U4SA 3VZNA 1MG7A 4Q8EA 4CEWC 1MNEA 5ETVA 3OD2A 1S48A 4YGDA 1TME3 2VZRA 3OYWA 3LDKA 4EWTA 4YVSB 4ZPVR 1K9MT 2WLQA 4EWDA 3VBOC 1I1GA 1ZAXA 4HSLA 3BGAA 4DIQA 3M3QA 4OJ3A 4MK8A 5J48A 3UCGA 4X62F 4A46A 3R5BA 1UOFA 3UGHA 2WS91 3TRSB 1Y7PA 3ZKUA 2KI2A 4AE5A 1SIWB 2F63A 4JZRA 4QM8A 4MIWA 2N7YA 3I55S 3K46A 3F41A 4ZPIA 3WINE 4DV0F 1RHKB 5E5NA 2VOTA 3T9NA 2HYXA 4A8OA 2M70A 4IV1A 1H38A 2MLZA 1F9EB 5ETTA 3AP5A 5KFRA 2VQFF 1WG1A 3H8XA 2Z56B 3VAGA 4Z2WA 1L5UA 1F31A 1LODA 4C0HA 2PIIA 2B9WA 1WKLA 3NAPA 4AEMA 2V67A 2UXBJ 1Q8VA 3GALA 2I2SA 3UCZP 3ZZ0A 2VULA 1JLGA 3QIPB 2ZOEB 4MOAA 3VBHB 5BYNA 2IMOA 2DWRA 1MZ6A 1CJKA 5FO9B 1U0AA 3VAKA 3WF0A 1ROFA 3AOBA 2A71A 4JI4F 2LKZA 2DR7A 1RJJA 1FATA 4ZVHA 5HXVA 2UXDF 2VB6A 5IC4B 4LOTA 3UGFA 2PYTA 3S0MA 4QIWD 1OLME 2J0SD 4NLWA 4S2FA 3MUY1 3ILNA 2DISA 4RR3B 2HHTA 2V72A 1FD8A 2HWB1 5ETNA 4DR6J 3AM2A 5H9EJ 3IBMA 2HHXA 5FUIA 1P8GA 4WXOA 5K8NA 2QJVA 3SQOA 4B3NA 4FYXB 1V9OA 2Y8WA 2Q8DA 4DEZA 2AZ1A 4CCOA 1VAKA 3ZXEA 1ZM9A 3ALQA 2IDEA 4URAA 4BQ3A 3TNQA 1OO0B 5KFCA 4WVZA 1I1EA 3M3IA 4B7EA 2L9DA 4DCPB 1IS6A 4X4QA 4DR3J 3GILA 2HWC2 4QPIC 3ZYBA 2PI5A 5KXCA 4LHSA 3G6ES 2XY6A 3ENAA 1ENXA 2JVOA 2ZVSA 3NMAA 3OD4A 1RGVA 1SG3A 5CH7B 1WBFA 1SDDB 3PACA 2OD4A 2QYCA 4W6WA 4RW4B 3TUPA 4L73A 1TMF2 5F3CA 2PHTA 3QNWB 4FBTA 1CAWB 5EGYA 3MM6A 4OZ3A 3MUTP 1SH2A 1S55A 2VDHA 3N9QA 3R2DJ 2ZX0A 1O6XA 2FBEA 5CA6A 4RS5C 4C8OA 4HYKA 4CYDA 4WM8C 1RA6A 4AD6A 4A4JA 1TU0B 4X6RB 4IL7A 3UPFA 1JXNA 4EROA 4LO5B 1IN0A 2JH3A 2H48B 1LQ9A 3SC7X 4HETA 4CU9A 2QRRA 2YNHB 3QLQA 4R9DA 3VBRC 2Y64A 4OYXA 4L0PA 4QX3A 5ISLA 4Q0PA 1X7VA 4PF5A 4R9CA 3R6LB 3S8SA 3NS5A 1KQGB 1D1UA 2ZAHA 4Q4V1 3IRXB 2DGUA 1PK6A 1GXUA 4UZBA 1AX0A 4BLJA 4YB7A 4A8QA 3ZPOA 3HZEA 1TKXB 3GJQB 4IH7A 2AYMA 2FHJA 5ERLA 1RAOA 2TUNA 4K4XA 2QLFB 4QM9A 4AYBD 4LLOA 4IOAQ 1AZSA 1Q82T 1TL7A 3MR6A 5FLJA 1R8PA 3M6WA 2E1AA 4DUZF 4ZN3A 1RUI3 1ZM1A 5FXZA 4CSWA 1H30A 4J9QA 4KAIA 1G7YA 1RYYA 4RA0A 4BIFA 2IC1A 1LHVA 4Q4V2 3SBMA 1URNA 3FUYA 2WCXA 1BD6A 5DZGA 3QCWA 2A5ZA 3M7VA 1JKHB 4RKUC 1CVJA 1SQ4A 3MPPG 4LRAA 1U1MA 1OPMA 2E7VA 2VFVA 1YQ8A 4F7VA 2FC8A 4D3WA 2VNOA 2RM22 3BH7B 2AYBA 5K8SA 1WF2A 4C90A 3SSQA 1K45A 3D3CJ 1N3PA 1E6YB 1F9HA 2EXUA 3GSDA 4AT1B 4G65A 5FXWA 1Z7S3 1RTZA 4XBLA 3FBMA 3C6TA 3GCXP 4A47A 1S1XB 4TNOA 1S0EA 4UOFA 4LO6B 2JEIA 1W6OB 2A3JA 1XNQJ 2KHDA 2IPOB 1N48A 2ZX2A 1LOFC 2J9EA 2B8PA 2QA1A 1X36A 5HROB 4CUBA 4LIVA 2PA7A 4OI6A 3TUJC 2OD6A 1WD6A 4CTAB 3A3NB 2H1YA 1JOJA 2XMAA 1NX9A 2XB6C 2PN6A 1XYNA 3W64A 2Y8KA 1Q8BA 1U1KA 1VDHA 5FREA 3IDEA 4MADA 3NGTA 2QSWA 4NMLA 5GAHU 4HTJA 3JXOA 3T1AA 4AL5A 4K21A 2HWE3 4BXFA 2EC0A 1FRHA 1CS4A 1PYSB 1YJRA 4FQZA 3FFQA 5LXRA 2UY8A 4IG0B 3NQHA 4LHNA 2MXYA 3VV1A 2G9FA 3RZAA 2X1GA 2BOAA 1CPMA 5KG1A 3RAXA 3U37A 5FP3A 2R7VA 2CGPA 1UKGA 3DU5A 2WB4A 3MCNA 2WYSA 3CZUA 5FYYA 1WA4A 5IT0A 4MIBA 4ES2A 1WCQA 3OBIA 3PR4A 3PUIA 1LHOA 4RQPC 4QWEA 4J1XA 1BK0A 3SV3A 1DFDA 2GIFA 2R042 2RJLA 1FMD3 1HLWA 4UFHA 2G13A 3CF5Q 1ZRRA 3DXUA 5T14A 3CIZA 4PI0A 5KFZA 2BRTA 2EXHA 3LQVA 3J9SA 1S97A 3NOCA 2UUCJ 4B9SA 1OA2A 3ON7A 5FZKA 4YR0A 2XWYA 1U6ZA 2W4CA 4IERA 1VHIA 3A12A 2ARAA 1S2BA 4R4XA 1QH6A 1W9TA 4DUTA 1GTHA 4E9KA 1QJY3 1JW6A 4UW3A 1NZCA 3TN92 4BQ5A 1YG0A 4DN9A 1V5IB 1IM6A 2LUWA 3CDZB 2DNRA 1XJWB 3GXUA 4JYAF 3I4PA 4TTGA 4GO7X 1YQ2A 2P9GA 1UEKA 1Q3EA 5FZIA 1H8VA 3J7LA 4JI6J 4KWUA 4DS5A 2F4PA 4DL7A 3M2UB 1V6HA 4N7TA 2PQQA 1OA3A 4O3QA 3I4IA 1WHVA 4OX9F 2V34A 2RRNA 4IEUA 1WNEA 5A8KB 2QLXA 1BE4A 2WW4A 2J1SA 5FPLA 3W5NA 1FPN3 5F9LA 5EX3A 4HL9A 4GKKJ 3FWEA 1CAXA 3ENRA 2VC9A 3R5CA 2YKMB 2ZH6A 4L3NA 4AL6A 3D6TB 1F8VA 4LBQA 3WX4A 5LY2A 5BYQA 4LF9F 2OLWA 4I30A 2IAJB 2I5JB 1FEHA 2B3TB 4FYVB 3O1TA 1RUH3 2JOQA 2VH7A 2RE9A 1AROP 3BH6B 5IWAF 3NNCA 2O5DA 2GC1A 2DRBA 1CBKA 5JMCA 1UN1A 4KO0B 3POIA 5IFPA 1NKEA 2VBBA 1T95A 3TZXA 1HR0J 2R073 1RUD2 2X09A 2VMCA 3BALA 2A3WA 4XVHA 4IE4A 3LF0A 1D4M2 5GADU 2DIUA 4FYYB 2ZNZA 3UJQA 5FWJA 1U26A 4A7KA 2LQ9A 2HWC1 2DNGA 2CJQA 4LO7A 5E33A 1Y0HA 3G7DA 2WS93 4Q2LA 1HB4A 3F44A 1N5QA 1JMUB 3O6QA 3C8XA 3C8YA 4DL6A 3VBRA 3ZXKA 3MV01 4Y2CA 3E01A 2Y33A 2MZQA 2ZUGA 1LCLA 1RTIB 1W0OA 2Y34A 3CC4S 3NBPA 2XMVA 4Q43A 4JI4J 2VOPA 2HG4A 2CDPA 3NP5A 1WBLA 2ZGKA 1YX2A 1GNHA 4ED5A 3NJYA 3C14B 3FQLA 4DDFA 5IM0B 3PYDA 2BE2A 4USWA 1BLUA 3EXCX 2BBAA 3FDSA 4LMFA 4UY85 1ZRCA 4QHZA 4C1WA 4KBIA 3GYDA 4DCOB 2XZDB 3O0VA 3DOKA 4XABA 1GOHA 5FXXA 4A3ZA 2WQZC 4LO8A 1NDLA 3KK2B 1LESA 3IC1A 2WN2A 1RE1B 2BABA 3C16A 1KLMB 1PJ6A 1F5BA 2XC9A 5GLVA 4X65J 4UFJA 5HL7Q 2ADDA 5KAKA 2IA0A 3VDDA 1K5JA 1Q43A 3HNBM 3FSYA 2JWNA 4DEQA 1XU2A 2JSXA 3QATA 1QJU3 4BCUA 5BNNB 2GNKA 1MS0A 2P3KA 5FJKA 3D5MA 3TOJA 5L9NA 2R49A 1TG7A 4LR9A 2DV9A 2YNGA 4M0HA 3CCRS 2DCJA 2NMNA 2IFXA 4KH1B 1YRTA 4M5JA 4V2WA 3WP5A 1XQNA 2VW1A 2V8HA 3CDUA 3OVSA 2W2OP 3H3ZA 1WC0A 3SZ2A 4E4HA 3M1VB 4R8UA 2B7YA 4GKYA 3W62A 2P6CA 4LQRA 1OVPA 1OUSA 1WC1A 1QDUB 3ETMA 1HB1A 5GAGI 4FPFA 1K3IA 3WW4A 4W98A 4M63A 2DY9A 3T19A 4L72B 1NZ8A 3MD1A 1QDCA 4JTNA 4LF8J 3VZKA 1GQPA 3I2FA 4I2OA 5KFPA 1QAJA 5HBAA 1U45A 3ILFA 1CX4A 4G4FA 4ZZ5A 5CIRA 4MXWB 2G4BA 4CLKA 5H1SV 1N1YA 4IGOA 5KHIA 4KHPJ 2VNRA 5T54A 3H2VE 2WVCA 4AOCA 5AE1A 1DQ6A 5A3LA 2PHUA 1TAQA 1S0BA 3UETA 2Q66A 2RKIA 5FJHA 4YW3A 4DV0J 4C97A 1U02A 3AX4A 2YWEA 1S1WA 1RUD1 1Z0HA 4A2UA 4FDFA 3JBG1 4RS5A 4FTSA 2OSRA 2W24A 4FP9A 2VTXA 5GLWA 2XMLA 1XJAA 1RHI3 4B3OB 5DAXA 5B7WA 3LP0B 3VAIA 4LRDA 4R5PA 4OHVA 3G96A 2JXAA 3H3LA 3LOUA 3T5KA 4CVUA 1NY71 5KC6A 4Q4W2 1KRIA 5C5JA 2XSFA 1OSDA 1G6BA 1TUWA 4Y22B 3RMYA 3MAQA 1NAEA 1CJTB 4XFCA 1NCQB 1GP6A 4WK3A 5C24B 5C6CA 5ETRA 5FY4A 4GJYA 1SL2A 4KJIA 2V4AA 2G9ZA 3M9OB 3JS9A 3AP9A 1HBUB 2J9CA 1UOBA 1Y9QA 3KCCA 4EQVA 4C98A 5FLXY 5J96B 2MQ8A 4BIOA 1VC6A 1VBD1 1JS9A 4X2BA 4FAGA 3MEGB 3KK1A 1XMOF 1HWKA 1S1AA 4DS4A 4IDKB 3LA0A 1F2HA 4H4MA 1U5IA 2WNVB 3ZYFA 5H9FJ 2YYOA 4CDUA 3R05A 4ES3A 1HNZJ 4ANCA 2A7AA 2K7JA 3W2WB 1GXTA 2QZ2A 4DHVA 1K1QA 4NIAA 4KSEB 4Z7CA 4O0NA 4NAOA 2BM0A 2ACMA 4DQSA 4E2QA 3AQOA 3TWZA 3KS7A 2C5DA 2M5YA 4P75A 2IUWA 4ZHRB 2X29A 4AQSA 2VG5A 1JI6A 5LA9A 1BBT3 2VMDA 1V6KA 3M6UA 1RUJ2 4FVMA 1FXZA 1SLBA 4A8YA 2CFXA 1PO21 1B99A 3RWNA 3G87A 4GVBB 3QT6A 4LKDA 1VRUB 2W25A 1L7LA 2ZGRA 2XB2D 5DUVA 2HYKA 2AT1B 2NYHA 2E31A 5JOZA 2CU5A 1ULDA 4UOCA 4OHWA 3CNQP 5FK8A 4AUKA 1N3QA 1Y3KA 4CP1A 5M2PA 1AYN3 2FJEB 1AXKA 4N9IA 2CYYA 3OB8A 1F5FA 2V5YA 3CDAA 2ALYB 3QIDA 2MLXA 1TKTA 3KT7A 2CQ0A 3X3UA 3MM9A 3RAMA 3Q8UA 1YQHA 2L9WA 4YOEA 2C3UA 4M5HA 1FXDA 4Q29A 5KG4A 1MS9A 3UR3C 4QDQA 3AOAA 3JTNA 3OHBA 3ZVXA 5IVFA 4WFNQ 5T7LB 2ID4A 3ME2A 4CU6A 1YSJA 3C16B 1J3RA 4Q26A 1UY0A 2JDZA 1RWUA 4ZPAA 1S6PA 4ZU7A 3MEPA 2FVCA 2C9AA 2W52A 2DO4A 3R1HA 2FJDB 2A10A 3N79A 2D3O1 1C8M1 3KUGA 2JG9C 2ZH2A 3OYWB 3A8EA 2UY9A 3KLGA 4YB1P 4C48A 2YZ4A 1V9U2 1FFWB 2HVEA 1FRIA 5THWA 2UUBJ 2CPHA 2Z5WA 3OFEA 4U7UD 1LW2B 2A18A 3I59A 1HNVA 1NBEB 1EAH3 4ELTA 1DU3D 1ULOA 3VWSA 1LENA 4WZCA 5C4WC 2XEXA 4DQPA 2BYCA 1Q8PA 1EB0A 5GZFA 4GH4B 5LBEA 1R0AA 1X7NA 1OOPC 3LEIA 5FMCA 2CAJA 4UWDA 4P02B 1XTZA 5ANQA 4NCAA 1RWXB 1N52B 1VYAA 2LXUA 4PXCA 2W9CB 2CVEA 3VGSA 3TEYA 4PYDA 3QGIA 2XG8A 4NN0A 3OSNA 4NLRA 4OVEA 2EIDA 4LMZA 1GU3A 2HWD2 2M0GB 1BBT1 3AB0A 1IBCB 2UUAF 3NNFA 4ZJQA 1UD1A 1PO11 1G9BA 4CT8A 2XL9A 1JYCA 4IEXA 3D1HA 3BTYA 3IN5A 4KL1A 3UNGC 2ZBPA 1ZX5A 2XH6A 4HN0A 1H2VZ 1ZBA1 2Y6HA 4H54A 2KFZA 1L3VA 2UP1A 1Q0NA 2XHWA 3Q2SC 3KWMA 4ZMMA 4DFMA 3T0AA 4XOGA 2JDJA 1OH4A 3NY0A 4PBPA 4K50A 5LA0A 3LW5C 3ENQA 4QU1A 2LXIA 2KD7A 5AXNA 3CJIB 4K0KJ 2FZ2A 2K46A 3OR2A 1WG5A 1R0BG 3G6YA 4O4GA 2FJVA 4V2VA 4IETA 1MS1A 3PVOA 3JQJA 3LPEA 4LF6J 3KWVA 1PO6A 5A6XA 1U2CA 3I7DA 5IYYA 2HAIA 2YU2A 3RGIA 4HOOA 3SSRA 5F3IA 4QGLA 3J7AN 1N56A 1B4SA 2FHRA 4HN1A 5DN2A 3DDKA 3MM7B 3UKTA 4ID5A 3ZSKA 2CWSA 3RZHA 3MICA 1TTHB 1O3RA 2UUCF 2DGXA 1VI7A 3GG0A 3BB5A 4B29A 1GBGA 1WTFA 4DG1A 4GVLA 2B4VA 4QWAA 4GKKF 4O65A 2J1TA 3M8ZA 4QDSA 3VAJA 1GOFA 5C9AB 3JCIA 3KDNA 1JZ4A 2U1AA 1V9U3 3ZXWA 1X0FA 3KJVB 3JTPA 4BE3A 2RDJA 4JV1A 4M5NA 4IR9A 5DDJ3 3VBFB 4YB5A 3GR0A 2RQMA 1FV3A 1PYTA 4FF3A 3DRRA 1TK0A 1QXJA 4OI2A 5J2NB 2MKHA 1UVLA 2E1PA 3KD4A 4CH0S 4QW9A 4Q2FA 5G04L 3V5RA 4TU9A 4HTIA 2OUJA 3W3SA 1LFPA 3PHMA 1SFYA 4OZLA 5E41A 3HSGA 5FQ0A 1QOOA 2YWWA 2YG0A 1GMUA 4WYWA 4RS5B 3IAPA 3H8YA 2BXJA 3ZTOA 1RBAA 5K5MA 3SSSA 5FZ0A 4YSFA 5J2MA 2DBBA 4AI9A 4R8UB 1QSSA 4H4OB 3FBCA 1UW4A 2ZA9A 1SUQB 1QQP2 1FD2A 4CYUA 1NUKA 3I2KA 3OTFA 2ABYA 1AFJA 2V73A 4W6XA 4GMP1 2ZHMA 3H8OA 2OGUA 5B0CA 5FPZA 1O3QA 3ETQA 2Y1RI 2WONA