3THTA

Crystal structure and rna binding properties of the rrm/alkb domains in human abh8, an enzyme catalyzing trna hypermodification, northeast structural genomics consortium target hr5601b
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
336
structure length
302
Chain Sequence
TLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVVDDLGQKITLYLNFVEKVQWKELRPQALPPGLMVVEEIISSEEEKMLLESVDRRVKHFGGLPDICESFLEKWLRKGYIKHKPDQMTINQYEPGQGIPAHIDTHSAFEDEIVSLSLGSEIVMDFKHPDGIAVPVMLPRRSLLVMTGESRYLWTHGITCRKFDTVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKENLYFQGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylated DNA repair protein alkB homolog 8
publication title Crystal structure and RNA binding properties of the RNA recognition motif (RRM) and AlkB domains in human AlkB homolog 8 (ABH8), an enzyme catalyzing tRNA hypermodification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 72
structure length 302
sequence length 336
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.229: tRNA (carboxymethyluridine(34)-5-O)-methyltransferase.
pdb deposition date 2011-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13532 2OG-FeII_Oxy_2 2OG-Fe(II) oxygenase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1520 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3thtA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3thtA01
2X1GA 1VQMS 1SJFA 2MZSA 4IOCQ 1YWXA 1FJEB 1M5OC 3Q2TC 3HHNB 2DNKA 2FC8A 1X5PA 3B4DA 2CPDA 1RKJA 4F26A 2DNQA 3RW7A 1HA1A 2OTLS 3R27A 2RRBA 1W2BR 2M52A 2M70A 2MQLA 1M5VC 1JJHA 3VAIA 2L9WA 3CCQS 3HI9A 1U1RA 2LECA 2XS5A 4QU7A 1NJIT 2QFJA 3L3CA 2XNQA 1FXLA 3S01A 2KU7A 2DGXA 3IWNC 1WEYA 4P6QA 5DDRC 2DH7A 5DDOC 1FT8A 2RQ4A 3NS6A 2RUGA 2NLWA 3UCGA 3VF0B 2O3DA 1YJNS 3SDEA 5DDQC 3CCUS 2M9KA 1UAWA 1Q82T 3U1LA 1U1LA 2PE8A 1HD1A 3JB9k 1X4DA 3CPWR 2D9OA 1D9AA 2SXLA 3UCZP 1JMTA 2CQBA 2LXIA 2K3KA 1OWXA 2JX2A 1QVGR 3DXBA 2DISA 3CC2S 3EGNA 4LIRA 1VQ8S 3TP2A 3K0JA 1SJ4P 3I55S 4F25A 2B0GA 1VQKS 1WF1A 2LQ5A 1H2TZ 3US5A 3V4MA 5HL7Q 1ZH5A 1G2EA 2LA6A 2DNHA 1K73T 1YIJS 5FJ4A 2EVZA 5DETA 3G71S 3NNCA 3ULHA 3UE2A 1WI6A 5GAEU 1M5KC 3THPA 2M8HA 5GAHU 4IOAQ 1IQTA 2MJNA 2ADBA 4WFNQ 1WHYA 1A9NB 3G4SS 1N88A 4ED5A 2LXUA 2YTCA 2MYFA 5JVGQ 4WF9Q 3S8SA 2MQPA 2G4BA 4Y00A 2N82B 2ZJQQ 2MB0B 1BY9A 2DHXA 1Q81T 1FNXH 5D77A 2KVIA 2DNLA 2J0SD 3BEGB 4RU2A 2VODA 1U1KA 2DNOA 1VC6A 2HVZA 2DNGA 2FHOB 2CPXA 1R8PA 5IM0B 2MKSA 2CQIA 4EGLA 2JRSA 5IFMA 4LJMA 1Q86T 2VONA 1VQ7S 1YITS 2KG1A 4TU8A 2CQHA 1N54B 3CCJS 5CYJA 2N3LA 2DNNA 2VOPA 2KYXA 3G8SA 4Y0FA 3B4MA 2FC9A 2MPUA 2EK6A 1M1KT 2CPFA 1YTYA 2E5JA 3MUVP 2BOPA 5CA5A 2DNMA 2MZ1A 3G96A 2QA4S 3TO8A 2G1DA 3BO4A 2FY1A 2LCWA 4A8XA 1FJCA 2DGSA 2LEBA 2M7SA 1UFWA 4C7QA 4QPTA 3NMRA 2MQNA 1A7GE 3SDEB 4W90B 2DB1A 5IM0A 2DNRA 2GHPA 4OZ1A 1U6FA 2MHNA 2KI2A 2KM8C 2DH8A 2MY7A 2F9JA 3TYTA 4WIIA 2ADCA 1VQ4S 3J7ZT 3P49B 3CTRA 2DGTA 2MKHA 1Q7YT 2DHSA 2MGZB 1WEXA 2LMIA 2KH9A 2MZRA 1NO8A 1VQ5S 3NNAA 4F02A 1URNA 1R8HA 1WHXA 3P6YC 2OSQA 3CCES 2MZJA 3MUMP 1M5PC 2MJUA 3DLLQ 3MXHP 2CQDA 2CPIA 2V94A 3SXLA 3BO2A 3VAFA 1KC8T 2G0CA 4TU9A 2RU3A 2MZTA 3UD4P 1VQOS 1K8AT 1U1MA 2OJ3A 4C4WA 2ERRA 3MD3A 2RS8A 2DGVA 4WFAQ 2E5GA 3MUTP 2MGZA 1X4CA 2XS2A 2N7CA 1H6KX 1KD1T 5GAGU 1P1TA 2RQCA 4OZ0A 2KXHA 3MOJB 2E44A 2MSSA 5EN1A 5DM7Q 3Q2SC 1WEZA 2YH0A 4M5DB 3PIOQ 3RW6A 2MQQA 4Z2XA 4QU6A 5GMKa 1VQLS 1U6BA 1O0PA 2DITA 2DGUA 2KRBA 3P3DA 3UD3P 2MZQA 2MKIA 1SJRA 3SMZA 2XNRA 3CF5Q 2E5IA 3CULA 1N52B 1N8RT 4WFBQ 3NS5A 1H2UX 2X1BA 2YKAA 4J5OA 2MQMA 2CJKA 3G6ES 1OIAA 5GADU 3J7YU 2LEAA 3IRWP 2CQ1A 1ZZNA 2OIHA 1P27B 2MKCA 2RNEA 2J8AA 3BO3A 3UWTA 4W92B 2DHAA 3VAKA 3LQVA 2HGMA 2MQOA 3VAJA 2I2YA 1F9FA 2AYGA 4UY8T 2Q79A 4YOEA 4LMZA 1DHMA 2DIVA 2M2BA 2WBRA 2OTJS 2DNYA 1QVFR 2FPHX 2N3OA 2YWKA 2KN4A 1WG1A 1D8ZA 1JJ4A 2KFYA 2KXNB 5DDPC 1DBDA 4PRFA 3I56S 2JWNA 1SXLA 2ZJPQ 2JVRA 5HO4A 1FO1A 2CPYA 2M8DB 2U1AA 3NNHA 2CPHA 2AYMA 4V19X 2BZ2A 5GVQA 2KHCA 2LKZA 1VQPS 2MMYA 1S72S 1XN9A 2HZCA 4CQ1A 3D2WA 1U1QA 1JJ2R 1X5SA 3CMES 2CPJA 1X4FA 2AYBA 2NZ4A 2UP1A 2AYEA 2CQ4A 2CQ3A 4YUDA 2CQPA 3FEYB 1DRZA 1WWHA 1FHTA 5LJ3Y 1U1OA 4PR6A 2DO0A 3CCLS 1ZZFA 2RS2A 4IUFA 2CPZA 2D3OR 2CQGA 3CD6S 3H2UB 3CC4S 3MI7X 5LJ5Y 2X1FA 1U2FA 3MD1A 2XS7A 3CCVS 3EGZA 1U1PA 1WHVA 3FEXB 1VQ6S 2X1AA 1NU4A 2L41A 2RT3A 1FJ7A 1YI2S 1X4HA 5MLCV 1PGZA 1VC5A 4ERDA 2HYIB 3MURP 1AUDA 2EK1A 2XSFA 1VBZA 2MY8A 1KOOA 2DGQA 2M4MA 2ZJRQ 2D9PA 1HD0A 2DO4A 2DH9A 3U1MA 2DK2A 5H1SV 1X5TA 2K8GA 3N9UC 5BJRA 2CQ0A 5LSLA 5CXTA 2AD9A 1X4EA 2GO9A 2HGLA 5JVHQ 2U2FA 4BS2A 4IO9Q 2RRAA 2A3JA 1X4BA 3LPYA 1KOHA 5ITHA 1X0FA 2MKKA 3UCUP 2DHGA 3G8TA 2KG0A 1HL6A 2KRRA 1CVJA 1X5OA 1H2VZ 3ZZZA 1RK8A 5IQQA 3R1HA 1WELA 1M90T 1WI8A 4CH1A 2KM8B 1PO6A 1S79A 1WTBA 2MSTA 2JVOA 5D78A 2CPEA 2DGWA 4U67Q 3BS9A 3CMAS 2LYVA 2F9DA 4FXVA 3MDFA 2CQCA 2MKJA 1QM9A 4TU7A 3H2VE 2XB2D 5LXRA 2J0QD 3CC7S 1L3KA 3THTA 3CXCR 1X4GA 5DM6Q 3G9CA 4WCEQ 2KT5A 2F3JA 1U1NA 4QQBA 4YB1P 4UQTA 1OPIA 2DIUA 4C0OC 3R1LA 3S7RA 4WKRA 2HGNA 2OSRA 1YJWS 1DZ5A 5LXYA 5LSOA 1X4AA 3ZZYA 1WG5A 1K9MT 2DNPA 2MXYA 2L08A 1B7FA 1OO0B 2DNZA 3VAMA 2CQ2A 4CIOA 1WHWA 2KXFA 2M0GB 3VAHA 1UP1A 3VAGA 1UW4A 2M88A 3CCRS 1WF2A 3CCMS 1WF0A 2RVJA 3PIPQ 4ZKAA 2J76E 2I38A 1VBYA 3CCSS 2QEXS 2YH1A 2VOOA 3OW2R 2LA4A 3P5TL 1VC0A 1VQ9S 1SJ3P 1YHQS 1SJQA 1KQSR 1VBXA 2DGOA 2E5HA 4PKDB 4TLQA 2PEHA 1VQNS 3S6EA 1WG4A 4FXWA 4CH0S 3VALA 3CUNA 1YJ9S 3EX7B
chains in the Genus database with same CATH superfamily
2MEWA 4B1LA 1TZOA 3UR3C 1C1LA 2CL2A 1EKRA 2EFQA 3KLEB 5FZDA 2NYIA 4RBVA 3AC0A 4JV5F 1UY2A 4RW8B 5FPVA 1LOEA 3KHCA 1NK0A 3K4AA 1C0TA 3E97A 4HN1A 2RS33 1POV3 3EWGA 2ZM6J 2XS5A 5FP3A 3GFZA 5LRRA 4X8NA 1UPPA 3Q89A 1CAXB 2Z2YB 3ACFA 1DBNA 4LBNA 3V81A 1MZFA 3WIUA 4GH4B 1K5MC 5DDOC 3K2YA 2IXLA 2O3DA 4DRRA 4B7KA 4ZVPB 3ZXAC 1QAXA 2WLPA 1QE1B 1RT4B 3JB9k 3VBOA 1WWYA 2CKWA 1XYPA 3A8EA 4OZ3A 2O66A 4AFAA 2D44A 1LNQA 4LBMA 2R8KA 2C0ZA 2C2OB 2VICA 5T50A 5A8KA 4MAKA 2ABYA 4IG0A 3O1UA 2OFHX 4FFFA 2NN8A 2F17A 4RFT0 5D0EA 2E7VA 2A18A 3JYTB 1AYN3 4LVNP 3Q83A 5FPBA 4QMAA 3FHQA 4H4OA 1OSCA 3D8CA 2DNHA 3FX3A 1ST8A 3JBG3 2B9WA 5ACA1 2QGFB 2V8HA 2HHHF 5F5AA 2K2PA 2P9EA 2PHUA 2RS11 3SCJE 5DABA 3TA1A 2POKA 2MJNA 4P9IA 3O5TB 4YN3B 4JDMA 2JDZA 4JI6J 3LQCA 1TNRA 3T9ZA 3NRUA 5KFUA 3N0VA 3BJYA 1YDLA 1EYBA 4KPYA 4QGMA 2W08A 3POYA 1W99A 5D77A 4FOYA 1RTJB 2DNLA 2J0SD 3NMAA 1XQNA 1TKXA 4JGYB 4JI0J 3PYEA 3NGKA 1EIYB 2XI3A 3T4VA 1ELOA 4DPYA 1QXJA 1WACA 2PLV3 3F41A 2YBSA 2WJSA 2JKXA 2JIJA 5FY1A 3D6HB 2VONA 2OPKA 2GC0A 2AR6A 2FVCA 1YITS 3OCPA 3ILRA 5KFFA 2GV1A 1VR6A 2CQHA 2JLFA 5F9TA 3B01A 3VL9A 4WZCA 2J42A 3VBFB 1FRMA 1RT7B 3ECQA 3GYDA 4I3GA 1PO11 1C4AA 4LIUA 1BC6A 3WP6A 1PC5A 1BMV2 3K5LA 1X50A 3R5DA 4QQ2A 2VJUA 1UZHA 2ASYA 1JU4A 5A7SA 4I02A 4JRAA 2UUAF 2Y8WA 1US3A 5B0CA 4RNFA 4JI7J 1YNAA 4FPEA 4U8YA 2DHSA 1NKGA 4WYWA 3HFKA 4U8VA 1BMQB 1LHWA 4ZCIA 1GV9A 3MCNA 3S57A 4DSKA 4A6OA 4L3NA 4C1XA 3I59A 4AQYJ 1DYKA 2HFZA 2ILZA 2ZKTA 4AEMA 2HQ3A 5BYSA 3DLLQ 4FTEA 2R041 2V5DA 3DXTA 1OVPA 3B02A 2YKMA 1IJEB 3UD4P 3RZHA 4I56A 1U1MA 3KFWX 2CUYA 1ASJ1 2WLQA 2RS8A 1ZZ7A 3WD5A 3CJIB 2A73B 4X62J 4BQ4A 4ITCA 3TN92 4DSJA 1H6KX 3TANA 4YB7A 1PBUA 1D1UA 1DGRA 2OMLA 5CZXA 4OZ0A 3RYRA 2KXHA 4E4ZA 3WR0A 3IG1A 1HBUB 3SISA 4RLEA 4DWIA 4ONUA 1IR1A 3MF6A 3KLFA 4QQPA 2RIJA 4XK8C 4HBNA 4BLJA 5FZ0A 4N43B 4NLUA 3O12A 4XQDA 1DYOA 3MR5A 4IEUA 2DCYA 1WTFA 1A34A 3D6MB 1O5JA 4ATNA 4Q4Y2 1CAVA 2JL9A 3ILLA 4OV1A 3H3LA 4HMZA 1QJU1 3BCWA 2FLOA 4AD6A 3PW4A 2Q30A 5I3PA 2D3UA 5CAAA 4U96A 2V50A 4D7YA 3ILIA 2UV8A 3HX9A 2EVXA 2VQAA 3I54A 4NIGA 3P4UB 1T2XA 1F2NA 5BY5A 2ZGKA 5LEJA 4OJHA 2IFRA 5FO7B 2QDRA 2BKOA 2PD1A 3ZYFA 3VD7A 3AFKA 1WNEA 1PGW2 2EF6A 4NWVA 4MGSA 4H7LA 5A8RB 4TNOA 4PRFA 5DJBA 4D8MA 3FSXA 2WO2A 3I2KA 5I0UA 4XJZA 5F8IA 5CKQA 4K3UA 1Q8IA 1VBA2 1FDAA 2QT7A 3IM8A 1HWIA 2HEYF 4E8UA 1ZBA3 1LGNA 1N56A 3TVYA 4CDUB 3F44A 5FYYA 2Y1RI 4N9HA 5LK5A 3LPFA 3WNKA 1H2KA 1PX3A 1UYYA 3GYNA 4IUFA 1EKSA 3LDKA 2ZAAA 3W5MA 1VRTA 2BJ9A 2CQGA 2ZBIA 4AQTA 3ITHB 5ETNA 3V5RA 2IC3B 3QCWA 3S30A 1U2FA 3MD1A 5A80A 3FEXB 3VGIA 5K20B 4LBQA 2L41A 4GAZA 2XR4A 5KOWA 3KLVA 2V5YA 1NCLA 1VC5A 4KTQA 2W8LA 3U4SA 1SI9A 1ZM3A 2YC0A 3G8QA 3T2TA 1VBZA 3TX0A 1J1TA 4AOCA 3MOZA 4GKXA 3PR4A 2B51A 4Q8EA 3SYZA 3MYXA 2RMU1 3N9PA 5C3SA 1HD0A 5JXJA 1U45A 1EQ0A 3RSJA 5T41A 1RTIA 2K1RB 5EDWA 2JKBA 4PBOA 3GZUC 1X4EA 1HW9A 1OMSA 4Y6IA 1SLLA 4PDWC 3PO5A 1RHMB 3BU0A 3AZWA 4XUOA 5CG9A 3J7A1 3KLHA 1VBD2 5KHJA 1IKYB 5K14B 1HNZJ 3MM6A 1CVJA 4JGZA 2ZHMA 1EJ7L 3RU0A 2XC9A 3R1HA 1GXUA 3C46A 4B9NA 1LESA 4Q5VA 3FBMA 4ES8A 4TTGA 4QW9A 3TEYA 5THWA 4NMXA 2H6CA 4IGQA 2J1SA 5BXXA 4JV4A 4QWDA 2X8KA 4OFZA 4CP9B 5EX0A 4CLKA 2GVZB 3HD8B 1W26A 3CU7A 3JU9A 4OYZA 3TEZA 1EV12 1NAEA 1PMJX 4W65A 3CC7S 2D5HA 1VRUA 3ZSKA 1IKXB 2BMBA 2BUNA 2HKXA 3WP3A 4A8SA 4ZITA 3CIHA 3H5XA 2YC4A 1VBC2 2IJFA 3MUZ1 2XY6A 1WMFA 1RT5B 1W9FA 2HPUA 1ULFA 3LGRA 1WHWA 1GOHA 1AR91 1W6PA 4Q4Y3 4C97A 2BANB 2R9LA 2OPPB 1W6MB 2QQNA 1JIHA 3U75A 1RB8G 2IMOA 3GV5B 2PHRA 2OKQA 2NUUG 2J0WA 2RQKA 2QLBB 5D4PA 1FEEA 3WC0A 3PR5B 4ED6A 1SLTA 2MTLA 3RRGA 4N56A 3VZKA 2RSQA 3KJFB 2VC9A 3RJRA 4XJAA 3JS9A 3QWUA 3K5NA 4GWMA 1UY4A 4DV0F 4F67A 4IFVB 4A45A 1HNWF 3UDVA 3D67A 3BBCA 3M6XA 2UY9A 2VCCA 3IAPA 1RHUB 2RS52 3LP2A 3ES4A 4H2AA 3GZTB 1LWCA 3MPWA 3DM2B 2EBGA 1TFYA 1X5PA 3ILNA 3B4DA 2HNYB 2EFPA 3EXUA 2OTLS 1W8OA 3R27A 4LFCJ 2ILMA 1VBA3 4ECQA 1U5YA 5CFCC 4LSNB 1RWUA 4B4RA 1N3OA 2IXIA 2KU7A 4OHVA 3MGUA 4LNVA 5FFOC 2NLWA 2QQJA 3PX4A 1ENXA 3NKGA 1F5AA 4EYHB 4XXPA 1S1UA 1JKHA 4EUVA 1KVJA 2XPJA 1S5ZA 3KHGA 3HHLA 2Q43A 2XKOA 3FRYA 4QDSA 3CDUA 5IUQA 2XTJP 4IE4A 3CGIA 4XHBA 3Q8PB 3PTRB 1RT6B 3AVRA 3R6SA 3ZPOA 5CAZA 4TY8A 4EBEA 1H2TZ 4IFYA 4PEOA 3VBUA 1FX2A 4ER8A 2KTQA 1C1CB 4KWKA 1PNFA 2GC2A 1VISA 5DETA 4NZ6A 2P6CA 4CEWA 3U4XA 4INDA 2JNJA 1JOPA 2WOMA 1CZTA 5ABJB 2XUMA 2M8HA 3PJWA 2WQ4A 3D82A 2YTCA 4WF9Q 2N82B 1VBD3 5EUHA 3UN3A 2VZ1A 4KH0B 5CYYA 2WHOA 2B9XA 4FBUA 1YJLA 1WD4A 3KT4A 2KXLA 3ONQA 4NRTA 2ZNYA 1RL3A 4ZHRB 2CRLA 1HIYA 2VL4A 3QAEA 3U1XA 3HHKA 4N8NA 5FK8A 1V6HA 4CPBD 4AQ6A 1H8TC 2CQIA 4DUXA 4LMFA 1MROB 1VQ7S 1WLWA 1C57A 1G3OA 4MHRA 4BJ0A 3C14B 1FOD3 4Y22B 1EV13 2WQZC 1FDBA 2W01A 4HLBA 3WQPA 2UWCA 1I5ZA 2E66A 3I0SA 2BZDA 2ASDA 2GNDA 4FOVA 2IM3A 2QRRA 2KM2A 5E2QA 2VASA 3CT9A 4OZOA 3WUDA 5FZOA 2NMNA 2NR0A 1VBC3 5L9VA 4C7QA 3LGMA 2DVFA 1A7GE 2CNAA 3NEKA 1CQ9A 3NOCA 2JDNA 5IM0A 2DCJA 1VBKA 5KG2A 1U6FA 1NA1A 3QIPA 5FDBA 3ROUA 3E3XA 5JZGB 4I1TA 4MKVA 3CMGA 1FWKA 4CO1A 1D9FA 1XK8A 4KWUA 2EEYA 4K5RA 4AVAA 2EA7A 5DZ6A 1PJ5A 1TL1B 5DZEA 1Q7YT 1ODNA 4Q5OA 1LWFB 1B7YB 4OX6A 5IVEA 5GADI 2WA4A 1UY3A 3TOJA 1XE7A 3HPNA 2PXJA 2WN3A 1NDKA 2ARXA 1HBOB 5KXDA 1KC8T 1SL0A 4LT6A 2YWHA 2CJBA 4NMIA 4QPGC 4NEYA 2OJ3A 4MUVA 3OGJA 3LPEA 4YR3A 3ON7A 3DDKA 1BXNA 1M5SA 2A3YA 2R1BA 2RS53 3MUTP 1Z2LA 1OUSA 4M5MA 1FNOA 2PA8D 3ET6A 1C4RA 1TVRA 1WC5A 3ZFGB 1FAYA 4NRPA 3V6DB 1JHJA 3OLBA 1RUC1 5FMCA 2BRTA 4BDPA 3PURA 1J59A 2C3OA 1YUDA 1U6BA 1O0PA 4DI6A 4B02A 2OZJA 5A1AA 4B3TJ 3KT1A 4YLZA 2OPRA 3CULA 1N8RT 2YFZA 2HQCA 3K4DA 4KHPF 2XWBB 4Q0VA 5HCAA 4N76A 5DAPA 4YNIA 4ZU4A 5J98B 2FVPA 4Q0BA 3F95A 4RGKA 5T5LA 3UGFA 3VZIA 2J8AA 2B43A 2HAIA 1AX1A 2F63A 3K2OA 5FJKA 1ZTWA 1CWPA 3R5CA 4HDGA 2VMIA 2Z5WA 3IB3A 1NE6A 3VBSA 5I0DA 1H9PA 3EDRB 4P75A 2PQQA 2OTJS 2J7UA 3HO1A 1LOBA 2BOAA 3HJRA 3RZKA 2NM1A 4AYBD 3EGVA 3W65A 2WZPP 2JC0A 4U7UK 2JHEA 4OYBA 2XBPA 5L38A 2GZWA 2ZNZA 1AR82 1FO1A 4XOGA 1R092 4JRLA 2R7VA 2F6BA 1K5MA 1DARA 4W6XA 3I9V9 4RNOA 2MMYA 1H74A 1UKUA 2AZ3A 1JJ2R 3PKMA 2BACA 2W68A 1X5SA 3VKOA 3LP1A 4NXMJ 1HBNB 4FXGB 4LUKA 2FDFA 2UYBA 2K7JA 5L73A 2RDJA 4DX8H 4GA9A 4NWWA 4ECYA 3N7JA 3T6BA 2QL5B 4C8OA 2DCZA 4LLFA 3FFIA 3JSBA 1GZCA 4PXDA 1FRIA 1T3NA 3SH3A 2VFRA 1JYNA 3BBBA 1U47A 1BD6A 2XI2A 1UA0A 4RYDA 1NEEA 2BVZA 4IH6A 1LECA 1VMJA 2DURA 3I31A 2V34A 2V73A 4LO6B 1MEC3 3FBEA 5J2MA 3ZN4A 2DJWA 4KI5M 5HROB 4GIQA 3CJRA 3DHXA 2MY8A 1KOOA 2Y6LA 3SXWA 4GC6A 2D9PA 3TUZC 2QQUA 4XJ8A 3DYAA 5FZAA 2ADDA 3M6VA 5BJRA 3N9UC 3R5BA 2ZVSA 4LTAA 1F31A 1PO21 4EV0A 4M3CB 4QKNA 2U2FA 4IO9Q 2ZAHA 4LO4B 1X4BA 5L7OA 1Y7BA 4ED7A 2R8IA 1X0FA 3EXYA 2BQUA 1S0VA 3RAXA 2C3PA 2HBRB 4YR2A 2FD8A 1S76D 2BEFA 5K9FA 3J81Y 2IRYA 1H2LA 2HFVA 1NRKA 3H98A 3R4SA 3INAA 2ZBQA 3T1YF 1RHKB 2WO7A 3OVAA 3BPSP 2QSFA 4KB7A 4BQWA 1QM9A 3WOGA 1LXJA 5M0TA 3OPKA 1L3SA 1DDLA 5A1FA 3N9OA 2GDFA 1ZS6A 2FVSA 2MEV2 1PM4A 1YBAA 2GMPA 2PA7A 4KR0B 5DM6Q 4Y26A 3TNQA 1U1NA 3GGLA 2B9EA 2IM2A 4IEWA 1RAJA 3K3OA 1GBGA 3WX8A 3M8ZA 3HVTA 5KFRA 4LIWA 1URRA 4I6WA 1ZBA1 4MFBA 5HV4A 3Q8BA 4A8OA 4ANDA 4MK9A 3AODA 2W7OA 4Q45A 4C3LA 1V6NA 3UGGA 3VHNA 2XLJA 4IV3A 1UOGA 3OW2R 3B5LB 3W63A 3TWIA 1S48A 4ED1A 3MM7B 2R7TA 3Q24A 1JXVA 3IBFB 2HQIA 4FFHA 5EP9A 2HNZA 1WG4A 4P00B 3SSRA 4LHNA 4OHZA 4WTOB 1OT5A 1AR71 2QZ3A 3CNQP 4O9GA 4XPCA 3OYWA 3CO9A 1AR83 1MWYA 2BV4A 1WC0A 4DL0C 4QPIB 3NAPB 4UAPA 5C4WB 1NZAA 3O8WA 3N7LA 1XRUA 4LK6A 4AEDB 4MADA 3PVBB 5I42B 3TZXA 4QU7A 4ZJOA 1FXLA 3MIHA 4DSEA 5FLJA 3CJKB 1DQ6A 3P3PA 2GFFA 3MM5A 4UBHA 4EEYA 3FBCA 3WNNA 1S0OA 5F2SA 3VDBA 1CJUA 3RPQA 3K51A 4F7ZA 1F5BA 1UY0A 3VVTA 5KXCA 4DL5A 3VHPA 4XVHA 1YLLA 4FKXA 1LFPA 1UVJA 2G9ZA 1IR2A 3HQXA 3OBTA 4I0WB 4DUWA 3DOKB 3HNBM 2H5IB 2C42A 2JX2A 2JG9A 4A8MP 4EZ4A 2QQPA 4KGZB 4ELTA 3KG0A 4ES3A 3NWRA 4R52A 1U2RA 5CIRA 5DUVA 4Q8LA 3M9OB 4A42A 2YPJA 4HN0A 4UFLA 4XTMA 2ZWPA 4BISA 5FY4A 1NHUA 5K8NA 2EIGA 4CCEA 1IWGA 3OFHA 5D3GA 1ZPWX 2JEFA 3BALA 2Y9HA 1A8DA 1IQTA 3RBXA 4LF7F 3T0DA 2Y60A 3G4SS 2DBNA 4DJBA 3KV9A 2LQJA 2QA1A 2OVUA 2MB0B 3QMQA 1S0IA 2H54B 5A76A 1HHTP 3S0MA 2ZZNA 1OMIA 3M1HA 4M01A 5JWPA 3PM9A 2QCSB 5E6HA 3BEGB 5F37A 4Y3CA 4DV4J 3HNYM 1QOTA 1VAMA 2ZITA 1XNDA 2RHPA 2VH9A 4YRDA 4O44A 3H7HB 1SEFA 2WRAA 2Y64A 4XTTA 5AJ3F 3AM2A 4YB5A 1RXOB 4N53B 1JLEA 1S4FA 2ZKLA 2VQFJ 1RBAA 2Q3PA 5D8AC 2MEV3 4RQPB 2PI5A 2W9AA 3AL6A 2WTFA 1DG6A 1UMJA 3T1MA 3A21A 3LWLA 2G1DA 3VQSA 3GILA 2ASJA 3M8YA 2LEBA 4DHVA 3L7UA 1NCRB 2DFBA 4B08A 5A6QA 3W66A 2XG3A 1KD7A 3PW7A 1IVZA 5FXXA 4AFBA 4DV7J 1RWKB 2V72A 4NCAA 2CJYB 3JSYA 5AE2A 1P6TA 2XWJB 5FBZA 2MGZB 4P72A 3Q8VA 3NNAA 4LQ3A 3KHHA 2GH8A 2V67A 1H2NA 4O7XA 1FMD1 4C2MA 4IEOA 3NBPB 1H6YA 3M2UB 5FYUA 5IXUA 3LE0A 4DQQA 1S0FA 4LO8A 3UQSA 4KT0C 4YG6A 1KJLA 1T6GC 1S0GA 4CZSA 3NNJA 2ERRA 3MD3A 5EX3A 2D3ZA 2KO1A 4USKA 3BTYA 2Y3YA 3BQ0A 2W9XA 2FHMA 2FZ1A 1O59A 3EBRA 4AEJA 1IQZA 3BPSA 3T08A 3C8YA 3HJFA 1LK5A 3OOXA 1FEHA 5HBMB 1QQP2 2XOMA 3KS7A 4AXJA 4PLMA 3QBCA 3PIOQ 3AHPA 3A1YG 4CLUA 4CDXC 3NCPA 5C24B 3WF3A 1E5HA 1UFLA 3FNNA 2RV9A 1WZXA 2I5JA 3EXCX 4LSLB 4MZUA 3TUIC 5AXMA 3PO4A 3DRRB 4MKAA 3BR8A 2B5HA 1RGSA 2CJQA 2CNNB 4G9SB 1H73A 4FPFA 3IRWP 3ABZA 2P6HA 5J1XA 3GJQB 2WS92 4EJRA 4XJWA 1FOD1 3CL1A 5I0RA 1RU2A 2HGMA 4RW4B 4MG2A 5B0GA 2YNHB 3H90A 1UD1A 1PAUB 3P5BP 4Z92B 3KK3B 4Y24A 1SDDB 4X4PA 3AD7C 2VG9A 2VW2A 1J3QA 1WUVA 3EVMA 4HH0A 2XMTA 2OFGX 1NDPA 3JQJA 2CPYA 1C2PA 5GVQA 5F41A 3WF2A 4E0DA 4NR1A 2ZKNA 1M1GA 1BEV1 5FJHA 1IWAA 1SH3A 2WAAA 4K4ZA 1ZAXA 1W2NA 4TVAB 2K06A 3Q0AA 1NB2A 4X4QA 2YB7A 5LOQA 2D97A 2GC8A 1LODA 4XFIA 4AQ2A 3I6PA 4OYOA 3GG1A 1Q8VA 2RRNA 5JUVA 4F4AA 2ZH6A 2VMGA 2JD4A 3ASIA 1F5FA 1DQ1A 5FY0A 5LY2A 3WP4A 4OULA 1VHIA 5C33A 4ID5A 4F4ZA 4EBCA 1JX4A 1UPIA 1KTQA 3T0BA 1FJ7A 1LGBA 4OYXA 2HRTA 2W9BB 3DDNA 2BM1A 3MIBA 4DSIA 3PYDA 5A8WA 4C11A 2ZJRQ 4DNYA 2K3IA 3C7HA 4ICLA 4GC7A 3WDWA 2XVKA 4B8EA 5A6WA 4ZONA 4P9GA 1LWEA 5DAVA 2UURA 2BBVA 3QT6A 3UJOA 2J8SA 2XMVA 1N33F 2N4DA 5E1RA 2A10A 2BPA2 4P5HA 4OQ8A 5GALA 2BE7D 4F36A 1GNZA 1RK8A 2JEIA 3MR3A 1M90T 1WI8A 2CV6A 1OOPB 4PYAA 2MSTA 1S10A 4NCGB 3CD0A 2X5IB 2FQQB 2ZH1A 2APOA 1JYCA 2LYVA 5KT7A 4DL7A 5C7GA 4Q0SA 2WW8A 3H2VE 2ZZQA 5ETVA 4X4RA 4QKDA 4OYIA 3I97A 4JI5J 5JZGC 1YEWA 1Q5YA 1QQP3 2YGMA 2JDUA 3CW2C 2XONA 2P3KA 4RUBA 1S1XA 4KRWA 1XYNA 1VBE2 2ZX0A 2LP4A 2Q8OA 3AP6A 1QDOA 3IS9A 4Q0QA 1IBMF 4E2FB 5FQ0B 1WGPA 2BYCA 1B7FA 1BCXA 1RHI1 1VGYA 2M0GB 5ETKA 3UL2A 3PUSA 2VQTA 2UY8A 1KS5A 3IT8A 1D0EA 1HN1A 3P6BA 1E5RA 4E2GA 1X31C 1TUGB 4IE7A 4CCDA 2WS93 4QPGA 5A6YA 1KFDA 3AZYA 2NLRA 3UN2A 1NK7A 1QWRA 4IV1B 2PHTA 3RBZA 2R0FA 1RUH2 2WAQD 1KQSR 4Z1VA 4BH9A 2HEWF 2XGPA 1MEC1 3J80U 2KZMA 4FXWA 1OYEA 4Y1UA 4R25A 1VRH2 2RU9A 3D4JA 4K2JA 5SUHA 2IAJB 2X1GA 5IC4B 1GNHA 1JXNA 1I94J 3DPRB 5FYBA 2WT1A 1AROP 4EWDA 2DNKA 1MQTA 2VG6A 2WNUB 3FUYA 1KBRA 1DTQB 5GAEI 3I3BA 4PABA 2ZFHA 1BWVA 3Q8QB 1B0TA 1Y5NB 2I45A 3AMPA 3N9NA 1K47A 5C42A 3L9ZA 1YWKA 4BHQA 3KLIB 3U7JA 2PO4A 5GZGA 1W8NA 4AAPA 4UFMA 2R8HA 1DZRA 3SI8A 1R7IA 4PG8A 1U1LA 1S2EA 4DLEA 1AHSA 2OEKA 5EYXA 3CPWR 2MHFA 3KLEA 3HP6A 4RR5A 2HZAA 4LKFA 2HFOA 1KVKA 1HQUB 2A1XA 2E51A 4TKTA 1QVGR 4LIRA 3ZIXA 3TP2A 2GN7A 2GN3A 2DU1A 4FTSA 2XY7A 4QXBA 4W4MA 1UA1A 5K7PA 1S1VB 3WQ1A 3PW2A 4GH4A 1JOBA 3DLGB 1N3PA 1UYXA 4UFHA 4LRDA 2GJIA 2QDNA 4IEPA 4J9OA 3HHDA 1FKOB 3ZTPA 3NNCA 3FMWA 2IYGA 1QE1A 2AX0A 4G4FA 1RT4A 1UF2C 5HJXA 4ZXKA 4ZVQB 2ZH3A 1RUG1 3DOMB 4DSFA 4UWDA 2CDQA 3E8OA 1Q5OA 1PZ7A 2Y6FA 2NZ9A 5JOZA 1QH7A 1TUVA 5F8JA 2MYFA 3Q22A 1T94A 2G4BA 2W2IA 1OQ6A 1BVP1 1SL1A 3M30A 3RB3A 1BY9A 3JYTA 3NKTA 4ISQA 3ZXJA 1XR5A 1FX4A 1OVSA 3ZYJB 4KG8A 1TQLA 1MWZA 4DR4J 1ZZCA 3RRHA 3LUYA 5LBEA 4P52A 2Y0BB 5BNOB 5JSPA 2HAFA 3FZ3A 3RDIA 1RHRB 1NE4A 2KG1A 2IDEA 4TU8A 3QJJA 5FZKA 1VCTA 1T02A 1MS0A 3M3EA 4V2WA 4A3XA 2A2CA 3CJ5A 2FC9A 3NS7B 2YY1A 1AZSB 3UI3A 1YYNA 3L7OA 1RTJA 3HXMA 4XUQA 4JGYA 3ZDVA 4XHXA 2OT7A 5T54A 4I69A 1GP4A 1VBE3 3MW4A 4B4PA 4A8XA 3MAAA 3KHLA 1RIRA 3AXEA 3NMRA 3N3HA 4QM8A 3POTB 1AB8A 3DU5A 4D3HA 4UOGA 5H9SA 2ZHLA 2VOWA 5J2QB 3LA2A 3BYPA 2F9JA 3P49B 1N1VA 5IVYA 5DDJ1 3KMQA 2P6TA 4XJUA 2SLIA 3VBFA 1RT7A 3PYFA 1WLCA 1WEXA 4I6AA 3ZZUA 1YI7A 1Q16B 3C7EA 5BR8F 1A8MA 1IUJA 1DGLA 1RUH3 4NLTA 1SLIA 2FMDA 3P1IA 3BO2A 3VAFA 1NSPA 4JTOA 1Z1ZA 1AXKA 1VQOS 1VRH3 3K17A 5HVFA 2R7RA 1FK9A 3QH6A 1DLOB 2XO7A 1DF0A 1GP6A 2J7MA 1LEOA 3D3AA 1BKZA 3DEMA 2GNMA 1TME2 4Y28C 2B8QA 3DKDA 1R1A2 3VZNA 5T3NA 2YH0A 4QGNA 4LF4J 2DGUA 2H48B 1YIFA 1WSVA 3T6JA 2JXAA 3VDCA 1X8DA 2XNRA 3T5KA 2E5IA 5IVCA 1LKNA 1S2BA 3CJIA 4FF3A 4H3WA 4QR0A 3ZKUA 3OUHA 5GADU 4C8LA 1P27B 3KHBA 1HBUA 2F4VJ 1O6UA 3BO3A 3K59A 2HK3A 1RT1B 2G19A 3VAKA 3R2DJ 5HI0A 1KXGA 5FYMA 2NXEA 4DUYJ 2C9KA 4N43A 4RGAA 3NAPC 5C4WC 4WU2A 4UFIA 3DGPB 3BSOA 2X3GA 5DAXA 1YJKA 3L09A 2FYXA 1UXZA 4O0NA 5LT5A 3BYRA 2ACYA 1DBDA 4EU0A 2Z57B 4B9LA 2VY0A 4BPZA 4C8DA 1DCSA 1NOVA 1VP6A 1JLQB 3LSDA 2Y6KA 3ICLA 2EWHA 1PX4A 2Q66A 4CCOA 2VBDA 4MKYA 1FV3A 1RUD2 2HHPA 2UUTA 1WMEA 5KFPA 2R062 5FPUA 2NZ4A 3MMAB 2ZOMA 5DUUA 2Q8EA 1BJQA 5F0WA 2FDHA 2C4XA 1JNRB 5A8RA 1AW0A 1YKWA 1R89A 3EE3A 1KDMA 3WNMA 3MI8A 4ELVA 5LJ5Y 3O1RA 1EX8A 4Q4X1 1O3TA 4Y1VA 2HBTA 2VZPA 1D4M2 1AL22 1XMQF 2VW1A 3IPVB 2WO3A 3A13A 3ZXGA 2YC2A 5I8SA 2IXCA 3QQCD 1YSJA 4NIIA 2MLXA 3KT7A 2XEXA 1UO9A 4CDUA 2J1UA 5EXOA 1E5IA 4ZDNA 1RU1A 5GKAC 3JB8A 3O1LA 2XYPB 2FVRA 2CTVA 4OZXA 1SIZA 3D0IE 1VAKA 3DI6A 4ZHNA 3VB9A 5CXTA 3ITHA 1HQ2A 2IC3A 2XJRA 5FKBA 5FYVA 4AVVA 1PNGA 5I8YA 5EIYB 3FFQA 2IZWA 4DRVA 4CM2A 1B4SA 4JV5J 3ETMA 4PWWA 4IRDA 2EFVA 1AXYA 1FESA 1KOHA 1K0VA 1I6JA 3CLPA 2BW7A 3KNAA 1KQGB 2EXIA 3UCUP 2XL7A 4QYZJ 2VNRA 1HQLA 3V6HA 1TFWA 2ZGMA 4LE4A 2DGWA 5F5IA 1FRXA 2K1RA 5DQGA 4XILA 3CMAS 4ORFA 4JKMA 2BR0A 1C1BB 4Y5Z0 3UR0A 2V5HG 2WO1A 2W47A 4QCLA 1NCRC 2BV3A 1IKYA 1KEXA 3BU7A 1RUE1 2BJ8A 4DPXA 1TME3 4AGGA 5K14A 3IR5B 1QUPA 4NLXA 4Y20B 1AYM1 3ZNUA 1R1A3 1REEA 2DUOA 3FQKA 4ATEA 2HLTA 2JDMA 3NCQA 3LDBA 3GJAA 4A47A 1T3OA 4FF1A 1CJVB 3ZLIA 1SLAA 2LUWA 1X4AA 3ZZYA 4Q8KA 5BYRA 3RG6A 2HHHJ 2GVZA 2JX9A 5FYCA 2WVFA 3GPAA 3MECB 4YFWA 4ZIVA 3LA3A 3CCRS 2BU9A 1IQAA 2G9GA 1IKXA 1BK1A 1B70B 2WZ8A 1TKZB 4CA9A 3P3NA 1OPMA 4WZMA 1NM2A 1BGXT 4QU2A 3BODA 4CVUA 4BA6A 3IWLA 2XZDB 2DBBA 5FPXA 4Y2AA 1EPWA 1DZTA 2RE9A 4TXWA 5D0RA 5K0UB 1R27B 4QAWA 2ORXA 2CWKA 2D6MA 1H7XA 3VLBB 5BNNB 2E7WA 2RVAA 5JXGA 2OPPA 4DN0A 3BIWE 2I07B 1R081 1LW0B 1SV5B 4PIYA 4G65A 4DX5A 5FP4A 2P9GA 3RG0A 4D6QA 3ADAC 2LECA 1HHQA 1KWMA 4S2GA 3L3CA 1RUD3 3V56A 3S01A 2D98A 2NSBA 3IWNC 1SC4B 1VJWA 2HBUA 4CO3A 4HSLA 2R063 1S55A 4IFVA 3KVBA 1Y9OA 1F5CA 2CGNA 3CD5A 2FHKA 1RT3B 1IN0A 1APNA 2AMCB 1HD1A 1T11A 3DM2A 2WZR1 2HNYA 3BGRB 3NGTA 5KTQA 1D9AA 3ELNA 4PCRA 5FRAA 1PVC2 2WR9A 3OJBA 3VWSA 1SZBA 4E27A 4LSNA 5DN2A 4DQAA 4XF9A 4S2FA 3US5A 2HWTA 5F8HA 1O8PA 2R7QA 2YPDA 2YNFB 1ZVFA 3G6JB 2IHR1 1LHOA 4AHZA 1BQPA 1RINA 5IJRA 4HANA 4NMLA 2EVZA 2JE7A 1FFSB 4ZPDA 1M5KC 4LFBF 1R8AA 6FD1A 5HXVA 1S6QA 3RZAA 5A70A 3TEHB 1BUXA 2ZHNA 4GULA 3OHBA 4I67A 2HWIA 2WNVA 1RT6A 2HWC3 4Q44A 2VL1A 4OUMA 5HP1B 4GKKF 1UMZA 2BW2A 1OI6A 1C1FA 2JSXA 2B7YA 4XC9A 5JI7A 3QJPA 3TR5A 2VNVA 3PZPA 4RU2A 1C1CA 3AJ2A 1U1KA 2JDKA 1FTRA 1WBLA 4DR6F 2IM1A 4PWDA 3HKZD 3W9HA 5ABJA 3J7Z5 2J9DA 3H8XA 4ED3A 4ZLLA 5IFMA 4D3WA 3GJBA 1B35A 4I2QB 2FDJA 5T7LB 1CD3G 5IW0A 4C3KA 4M4PA 2V2ZA 3AZZA 4B4QA 3DLKB 4A8FA 5HBAA 5KG6A 5KG7A 1ULPA 1ND3A 4G6VB 2IBOA 2G1HA 4XPVA 4P14A 2GH2A 3J7HA 4AQSA 2Z69A 4A8KA 4CDQB 2LCWA 4OV6A 4Q26A 4ZHRA 5JPMB 3ZOIA 5KT6A 4OI2A 1DQAA 2DRAA 4B3OA 5ETRA 4QIEA 3Q8AA 2IVIB 2DNRA 3OTCA 1MROA 3C14A 5E3QA 3W61A 2HBQB 4Y22A 1OOPC 2AUYA 2ZA9A 4IW3A 2X5IC 1B3TA 3GCWP 1L7LA 1QKQA 3RRDA 3A22A 2LMIA 1S6PA 4Z82A 2NXNA 3E5UA 1RUI2 1NLSA 5GMEA 4BWMA 4QHBA 2D74B 4XQ4A 3L9JT 4BQ1A 2C24A 3MUMP 3V0BB 2JG8A 1HYSA 4W6WA 3H9AA 3BDPA 2CQDA 3BVCA 2V94A 1RTDB 1CEZA 2DCKA 3GJSB 2VAUA 3TA0A 4C4WA 1NLQA 1T95A 1WOOA 4M63A 5FZCA 3ZVXA 1KFSA 1TL1A 4QR1A 1LWFA 1S4CA 4ID8A 4O0IA 4BMEA 4JVAA 1JQGA 4Y1ZA 1UVKA 1AFIA 1HI1A 1C5IA 1LOUA 3MM8A 4JAAA 5FZFA 1Y3JA 2IYIA 3WHTA 1ACCA 4UYBA 1HXS3 1KHVA 1UEUA 1DGRN 4A7ZA 3BBFA 2EIDA 3NJXA 1NK5A 4N77A 4QU6A 4Q2MA 1VQLS 5FREA 1HBOA 4MH0E 3ZYPA 3WW2A 4J1WA 2ZWOA 4IV1C 3KCXA 3H8RA 2ZH7A 5DQ0A 4ZXEA 4BM8A 4DMIA 4DFSA 1WC1A 3K7RA 1PMHX 2CAVA 4ZVEA 1NCQC 4HVRA 3BN4A 2CJKA 2ARBA 5T5PA 1U7LA 4OYPA 5AC92 3ZFGA 3V6DA 5KC5A 3ZN6B 1PVC3 3W2WB 4ALZA 4RN5A 4M5LA 2Q6CA 2PEBA 4Z7YA 2R42A 1IBKF 4R9AA 3NOGA 1X9WA 4YGEA 5ETTA 1RACB 2HWD2 1OLME 4NHKA 2QLJB 1WCUA 4GMP0 3B6BA 4YFZA 2M2BA 3LAKA 1AVBA 1L7RA 2FPHX 2UXBF 2EBEA 2N3OA 4Y34A 1N0UA 1D8ZA 3RI8A 3KWVA 5CKMA 1NDLA 1W6NB 1W8WA 1YCIA 4LF8F 2WNOA 1RKIA 4USIA 4YW1A 2JWNA 4GB32 3NCRA 4CP1A 4YVWB 4AI9A 4CI0B 4FPYA 1VQPS 1NHVA 1S72S 1YIPA 3OQ2A 2WB4A 1W7WA 5J3UA 1VIXA 2B4VA 1LEMA 4MX3A 2JJ6A 2DHHA 2UUWA 4QIFA 4BC9A 2BOIA 2BXJA 5L1KA 3VDDB 1AR62 2JD9A 1YG0A 5JI9A 1FRKA 2D6PA 1TV6B 4QWAA 4J90A 3J26N 1MWQA 4DF8A 2X1FA 5C5JA 4FPGA 2KB2A 1WSRA 2BOJA 1UN1A 2UUCF 1U0HB 1D0GA 4NLGA 4X6QB 2GO8A 1H38A 4Q0PA 4FVCA 1RUF1 3MURP 5KFQA 2XVGA 4ED8A 4U95A 2VTXJ 4DV0J 2AJ2A 5CQGA 4FXDA 4L73A 2FD2A 1BQNA 2WT0A 2K8GA 5HMYA 2IBKA 3BI3A 1FXZA 3PU3A 2FDGA 5HV0A 1TMMA 2A3JA 3QIDA 4YZ2A 1P9QC 5BNOC 5IVFA 4WM8C 5AVAA 3PMSA 4QX1A 5HROA 1RB0A 2C3UA 2XCPA 3W62A 1RUI3 3I0RB 2H3EB 4RW9B 1GNYA 2D6LX 1LCLA 1H72C 2BGPA 4TXSA 1PO6A 2PELA 4QOTA 3UO0A 3NO8A 1NY72 4U67Q 2YU1A 1T9WA 4CEYC 2R4FA 4M3CA 3R97A 1HRV1 1SKUB 3WW4A 3SKJE 3SFUA 4E8DA 2PHXA 1GUIA 1TELA 2GJFA 5FZ8A 5LXRA 4AL9A 2AGPA 1IOAA 3CXCR 3B00A 3O0WA 5A2QU 3T4HB 2IA6A 1UX6A 3LP0A 4JV0A 3FBFA 3P8BB 2VQEF 4YW2A 2D6KA 1IS3A 3FJSA 5A7NA 2ET1A 4LFAF 3TARA 5LXYA 1YRUA 5FXZA 2GNKA 4GMP3 1F60B 5LBFA 3SH5A 2CYFA 1R3NA 4PI0A 1CZVA 1NK4A 3M1VA 2X10A 1Y7PA 4UW2A 1IS4A 3X1LB 1GANA 2Y33A 5AC93 2P34A 4R5PB 1S4EA 2ADEA 3ZR5A 1SHWB 2X53S 4PIZA 4LKDA 2BBAA 3A0KA 3ZYIB 4HK9A 1SBFA 2XCAA 3AD8C 4QX8A 5B7WA 2PYTA 3U27A 2HWD3 1GAOA 4CCLA 3LF0A 5G4DA 2HEVF 4YPJA 1U5ZA 3VBHB 3ZFFC 4KPCA 2VDHA 4TWTA 4RHV1 2E7QA 2E9QA 2EALA 4OFGA 3OD2A 1OFNA 2Z2ZA 2VUCA 4GB33 3ENQA 1QTMA 4PG7A 1BWEA 4R9DA 3CHXA 1VBB1 2W1WA 2ZUGA 3MM7A 3W3SA 2CU5A 4R9CA 5BYQA 2LW8A 1GFWB 1UJ4A 3W5ZA 5FDLB 3U0ZA 1C0UB 4DEVA 1AR63 3N6NA 1CIWA 2M9KA 3SITA 1UAWA 3AA9A 4USUA 3GDBA 3N9QA 4WVMB 1NAQA 3R7BB 2Z30B 1MW7A 2RB7A 4QPIA 3NAPA 5C4WA 2B9VA 1IGOA 3EB7A 4XACA 4AEDA 1GMVA 5I42A 4FO9A 4K8FA 2BVBA 4NA2A 1WF1A 3CJKA 1X82A 2LQ5A 1XEZA 2Z79A 3G6XA 4MXWB 2R7EB 2Z0GA 2GU9A 4ASKA 3AAWB 5ACA2 1ZH5A 1QY7A 2LA6A 1M1HA 4O3OA 1TL5A 2RS12 5IS2A 4D0QA 4J1XA 3AYDA 5C3OA 5GAEU 1Q95G 4PCQA 2BGCA 3AP7A 2OPQA 1ZZ6A 4PXCA 2EC0A 4I0WA 2WVDA 3DOKA 4ED5A 4Q8FA 4P9LA 2VZUA 3S8SA 2VVDA 4X64F 4DQRA 2ZJQQ 3TRSB 2IM0A 4J25A 3GWCA 5M2PA 1Q8BA 2DHXA 2RJLA 3LB9A 2QLFB 1FNXH 4YARA 3HAGA 3GFYA 4NYZA 2ZH8A 2VODA 4M5DA 1XR7A 3R2CJ 4C91A 4BE3A 2DNOA 4AHWA 3FCHA 4GO7X 3IP0A 5F8GA 4RW6B 2VUDA 3H8OA 3OBRA 3VZOA 3LOUA 1XTZA 4NLDA 1E6YB 4ZCLA 4KHPJ 2HWHA 2FJBB 5B0DA 1W04A 4EGLA 1OKQA 4RO0A 3CF6E 4NROA 1WCQA 5DZFA 4C0HA 4AI0A 4N41A 4C0BA 3I2OA 4KC5A 1PO12 4JQRA 1JYVA 5CA5A 1RWNB 2OAUA 3GBWA 2FDNA 5DQHA 2YKPA 4XUNA 3OXFA 4CO5A 2OUGA 1F1BB 2ZMLA 4OZ1A 2ZCWA 4YVSB 2VFUA 4NYPA 2LEPA 3NNGA 4N53A 2VPWB 2AGOA 3WZ0A 1GKBA 2VZ3A 2UVWA 3DV8A 5D4OA 2ZMKA 4AGRA 1MS1A 4LREA 3P96A 4RQPA 3HN1A 3VBRC 1QJHA 4CCCA 3VD4A 4UW5A 3B8HA 4KE5A 4IUGA 4KV8B 4OQJA 4BB3A 3D9BA 2R042 5KHGA 2MHEA 1LR5A 1PVXA 3ELHA 3J81U 4DSLA 2Y34A 1ASJ2 3SHRA 2R49A 4NE9A 3ZZOA 3PHEA 2MGZA 3WW3A 3SSQA 2YX7A 2YGLA 3SQGB 4B3NA 4ZS6A 4E2QA 3NL1A 1WEZA 2UVVA 5LMUF 3M2UA 5FYHA 1GNKA 2HWC1 4Z2XA 5A33B 1NMEB 4XDPA 3LANA 1L3JA 1W9TA 3KLGB 5DG1A 3WCRA 2FLLA 1H7WA 2Q6BA 4E4SA 5KFAA 1NSAA 4YGBA 4CTEA 1I1EA 3UDEA 4I3PA 1IKVB 1QJU2 2WSVA 3PY8A 4N7IA 2V69A 4IGOA 4ZVUB 1RUOA 1BHGA 2E9RX 3EYPA 3SQOP 4LO5B 5K0UC 5LA0A 3KD4A 4XDCA 2WFF1 4GWIA 1FI4A 1SH0A 3I3QA 2VCMA 2VG5B 5CVRA 3N5BA 2CAUA 5C24A 3K46A 1VR3A 1U8SA 4J91A 3BKZA 1C4CA 3R4UA 2WBRA 5ACA3 3MF5A 2CWSA 2R7UA 5KFBA 3T1YJ 1DQ4A 2M3DA 4LSLA 1MS4A 3TAPA 1QXRA 2FMYA 1OY8A 3DRRA 3LAGA 4ZVOB 1XSRA 4Q2LA 3TBDA 2OZ6A 3ZXLA 3KYLA 2CPHA 4BIOA 1HNVB 1GU3A 2CWXA 1HNIA 1FXDA 4RW4A 3DGVA 2YNHA 2AWZA 4PYDA 2C2EA 9ATCB 3D2WA 2W1BA 4E9KA 3KK3A 4LKEA 3USUB 2RILA 2UP1A 1K12A 1WBFA 2XULA 3A23A 3UT0A 5EGYA 2YBPA 2ZUAA 1AXZA 1T9UA 1DQ8A 2RS2A 2V8DA 5FYZA 3RTVA 1YJ7A 1R0AB 4Z37A 5F6KA 4Q29A 1JLBA 2AEZA 5BNQA 2C9AA 4JQTA 5LB6A 1PO13 3HKWA 1KSPA 4ISRA 1Y00A 3TEXA 1WCSA 1S12A 3VKNA 2RDSA 2RMU2 4IEVA 2VDIA 1S9GB 3HWJA 3OJSA 5ISLA 1HXS1 3BIEA 5A7PA 5IT9U 3M4XA 4G1PA 3M3QA 2DDUA 5LZ6A 3O14A 1MN9A 3DRXA 2GO9A 5E3RA 3MV01 4ECTA 3WZ1A 2XXZA 1YFWA 2PGCA 1FKPB 4FFGA 2VC0A 4LBKA 1IKWB 4PG6A 2ILYA 2W9BA 4O65A 3UKVA 1ZAVA 3TZWA 5L9NA 1X5OA 3VTIA 4QYZK 1T03B 3BN6A 2D93A 1GZ9A 2D3PA 3HPOA 3IM0A 1J5EF 4YSFA 3ENWA 3EVWA 1OQEA 2GMLA 2VF3A 2A3XA 1S1TB 1IKQA 1UMIA 4AVCA 1ASJ3 2E29A 2YQ1A 1KS4A 4CLTA 3ETPA 5J96B 2PDAA 1HIXA 2ARAA 3HMYA 3RZGA 3AL5A 1TEIA 4EWTA 3GJRB 3O1VA 4DX7A 3KK2B 5D1IA 3PIGA 2KHDA 3B82A 4XQWA 1RUJ1 3AQOA 4C6AA 5EHHA 1ITPA 1NZIA 1OOPA 2AJFE 4ANCA 1N1SA 4NCGA 2E9TA 2X5IA 4ZLNA 3T09A 4NA3A 1YJWS 4AVTA 2A75A 3TB0A 4JI2F 4LPLA 4NOHA 4DV5F 2L08A 4PDWB 1AR92 1C8NA 4CIOA 1N5VA 4LF7J 1H0HB 2MLYA 4QWEA 1QJU3 1N5SA 1Y43B 2HHQA 4C48A 3OGSA 1UVMA 4YGCA 1GICA 3LEMA 4P9JA 5E7OB 1WF0A 2C1FA 1E6VA 4FVMA 3H0PA 1V6OA 2B5JA 3S7IA 4J6GA 4Y2IA 1RXFA 2VOXA 3EQEA 2BRKA 2MQ8A 3PUIA 1PC4A 1P8GA 3MEKA 1XNRF 2E5HA 4YDXA 5FQ0A 1HDKA 3GONA 4DU7A 5JIAA 1IZ3A 1OA4A 1L3TA 2TUNA 4DR2F 1X9MA 5AJ3J 5ETSA 1JLAB 1CVNA 2YU2A 4YWAA 3K58A 3ZKYA 4ZY9A 1EUUA 2JFDA 3DOLA 4XZUG 5EYYA 3QATA 1B09A 5DMYA 5E89A 3NAIA 4NL5A 2M52A 1N6QB 1NYWA 4IV1A 1JJHA 4LXLA 4DPOA 1U1RA 3RFRA 2C2ZB 1A3KA 1W8FA 2OMOA 4Q0UA 1VJQA 2QFJA 4CO4A 3A8JA 3Q8EA 1FD8A 4LHLA 4UF0B 3MLKA 2ZH4A 4P6QA 4EN9B 1H2MA 2RUGA 1UVLA 2IAJA 3LCPA 3G87A 1KGYA 5J2NB 1VRBA 1REGX 3DPRA 1A6CA 5FZBA 2D3O1 4LE3A 3MF9A 1Q56A 1YVFA 2KYZA 1CIYA 3MPBA 3R6LB 1F4HA 2WNUA 2X09A 2EPIA 4NJ4A 2DD8S 1DTQA 4A3ZA 5F3TA 3LWMA 3CC2S 2VUJA 2XLIA 4RZRA 4LF5F 1YFYA 2B4PA 5C9AB 3KVAA 3SQOA 2QQLA 2NZCA 3AKTA 4YVWC 4WYLA 3TWZA 1L7QA 2RMU3 1KLMB 3HVAA 4A6SA 2V4RA 5DGAA 2VOVA 1PHMA 1YIJS 1Y4WA 3WINE 4FKYA 4RBTA 4G1IA 3OBZA 1QDCA 2DTJA 2JEJA 3EZ5A 3DL3A 1WCKA 3R4DB 1HQUA 1N88A 3VDDC 4NPLA 2NP0A 3MHZA 3BM7A 4LRCA 1JHNA 1ZRIA 3OT9A 2JE8A 2MQPA 1S1VA 1JH5A 2OD4A 3LGNA 5FXWA 1RITA 3EICA 2OIIA 3DKWA 3KSCA 1G9DA 2ZOGA 5KAKA 2ES3A 4XF0A 3K5OA 4ZS3A 3M70A 2VG7B 2HVZA 4G3YC 1NLRA 2ZBCA 3DLEB 3DOMA 3HT3A 4W98A 3WV6A 3FBBA 3RZLA 3KTQA 5A7QA 5FZLA 1Q86T 2DYCA 4DY5A 2L9LA 4LUMA 3ZSMA 1M5HA 2HWB1 1A6LA 4RNMA 4U2AA 3SCHA 3PG9A 2TNFA 1C0TB 3G8SA 4XF3A 1XB9A 3LPGA 4PJYA 3BR9A 2EK6A 4U7CA 1RA6A 4PXEA 5JMCA 2GAGC 3NP5A 2OXBA 3LSEA 5IFTA 4YP3A 3G96A 2CGPA 1UU6A 3VGSA 5GAGI 1FJCA 1HPZA 2G0JA 4KSEB 2C26A 1NH8A 2IWGB 2DV9A 3GSDA 2CZVC 2HFNA 2WK4A 4MIWA 3OXLA 4I7FB 1FJGF 2AIRB 3O6QA 2KI2A 1AR93 4KWJA 1GSLA 2HVDA 2QLWA 3THDA 2DH8A 2PAEA 1CONA 1TG7A 3N9MA 2W7AA 3C15B 3CTRA 5F9NA 5T55A 1GMUA 1AZSA 4IEXA 3TA2A 3ILOA 5C3PA 1BE4A 1T7PA 4QDRA 4ECVA 4NHXA 3P6YC 1STMA 3HZGA 4L74A 1AJKA 2QQVA 3C8XA 4ZN1A 1RWPB 2IFWA 3BF4A 3S6PA 3POTA 5GJ6A 4DUTA 1NJYA 1CG2A 3DLBA 5G05L 2VBBA 3MWBA 3POJA 4Q27A 4L8QA 4CP5A 5J2QA 1NPKA 3HFZB 2O01C 1GTEA 1OKOA 3ZXWA 3HBKA 1JZ8A 2DGVA 2QFEA 3VKMA 3V2UC 4OYAA 2DR7A 3KDNA 1RUC2 2DUPA 2NXJA 3CJ3A 2HYXA 5LMNF 4WFXA 4DOZA 2E1AA 3H2LA 1UNBA 1UZZA 4O61A 5KFJA 3U10A 2BWAA 3O1PA 1YFXA 2XHKA 4IH7A 5HSPA 2FHRA 1FTCA 1DLOA 1UCXA 5CZVA 2Z2LA 4WFBQ 2RDRA 4RS5C 3F73A 2F1FA 3HJVA 3OFFA 1FCAA 1W90A 3H5YA 1N33J 5A32B 1CX1A 2FUG9 1PZ9A 3LEKA 5CYQA 3F2ZA 2ATLA 2XO6A 1KNZA 3DCQA 3RZMA 2RH3A 2ZDOA 3M32B 3AJ1A 3HCXA 1FX5A 4DR5F 2DHAA 3UDCA 1J5OB 5FLXY 2MQOA 2FY8A 4ZJLA 4J9VA 4FPJA 2DEJA 3LIHA 3WW1A 5FMOS 3RGBA 3ZYRA 2GP5A 2P2CB 3MBWA 2AF6A 1SKRA 4COZA 3MTKA 1UU5A 1JJ4A 3TNVA 3OUIA 1Z0HA 5FYSA 2GS8A 4ZPCA 1S57A 2JVRA 4TYSA 4JB8B 5GLWA 3VUOA 4K4VA 4QR2A 3I2JA 5KFOA 5F39A 1RT1A 2LROA 4D3GA 4H7MA 3QSYB 2DXDA 2HZCA 2B56A 2YVSA 4I68A 4CQ1A 3CCWA 4I0BA 2C2MB 3DGPA 1IBMJ 2CQ3A 5I0SA 3UDLA 5IK8A 3R5JB 1BK0A 4PR6A 3CCLS 2K9ZA 4DQSA 3OR2B 1QSLA 4I01A 1MU2B 2Y1LB 4YY3F 1G7YA 1JLQA 1UYZA 2IFXA 1U1PA 2XYGB 2PN6A 5A6ZA 4B9SA 1S0EA 4BWOA 4QU1A 1W8TA 3BGUA 4YYOA 5FWEA 1W8UA 3MMAA 5F3ZA 1K1QA 4ZPTR 1TMJA 4MLOA 5CCMA 2WQ8A 1D9DA 3NGUA 2W8KA 3I82A 3H40A 4ELUA 1PIV3 3IDEA 4WBBA 2G2ZA 1HKAA 3ZTSA 5H1SV 1PO22 2ZH2A 2XHCA 2CQ0A 3M2MA 2ZGUA 3AJDA 5SV5A 2YWFA 1WW4A 1JTZX 1NJZA 4DQPA 1S2KA 1FRLA 4ZP9A 3BQ1A 2JH3A 4F4XA 3MW3A 2AEMA 1H2VZ 5IQQA 2A7AA 4KGXB 1VMBA 1GQPA 4Z2AA 1S79A 1S77D 1X60A 2ZHBA 2VKRA 2PT0A 3D4KA 1PIEA 2ZZMA 1SCRA 5GLUA 1S6OA 1ENSA 1QJFA 3IBWA 4YVSC 1RISA 2QQOA 1VK8A 4ECRA 5CNAA 1RUC3 4YZ5A 4ARYA 2ROGA 5FLIA 4NOTA 2FGCA 2CWMA 3HLUA 4YZ3A 2F3JA 5M2RA 1Y9GA 5FO8B 4D94A 3SV3A 2ZOFA 4F3OA 4YB1P 4KBIA 4UQTA 2XMMA 4PG5A 3PNAA 4C0OC 2VMFA 3L4BC 3S7RA 4K0KF 1TKDA 1ZBA2 4M5HA 4PLOA 5C71A 2DNPA 4HG6B 4XFBA 1C1BA 3OTDA 2EAAA 2R16A 3AYEA 2NMOA 2DNZA 2DUQA 2VE1A 4MGIE 2KJWA 2DR8A 3WBZA 1VLOA 4HHUA 4BCUA 3I4HX 4ZPIA 3CCMS 4ECWA 4Y20A 4ED2A 4HYKA 1FRHA 2V9WA 3BH6B 3LO3A 4ZLPA 5JMNA 3AQPA 4NZ7A 1RADB 5IZHA 2QV6A 3Q86A 3G6VA 1FWLA 5HJYA 5J36A 1JXLA 1YX2A 1VC0A 1CJVA 4XETA 1K42A 2DCTA 3M2RB 4F4YA 3SSSA 3WNOA 1BZWA 1JI6A 3Q9OA 4DL6A 1WA6X 1O8SA 1AR72 3KF5A 4KY3A 4X66F 3H7YA 3AP5A 3MECA 1C8M1 2QVSB 1BQMB 4CYUA 3AY0A 4BHPA 5KXEA 1E57A 4Q1PA 4GVBB 1TKZA 3CVKA 5K8MA 1UZVA 1HA1A 2YQ0A 4DPWA 2ZD1A 2UUBF 1QD1A 1DHKB 1W2BR 5D2AA 3V0AB 5GAHI 3RBDA 2G1MA 2FB0A 3KKFA 4P2SA 1RAAB 2H65B 2JB4A 4AT1B 2KVQE 4AAXA 5FY8A 1OSGA 4JTNA 1DLCA 4UZCA 1FT8A 2QJVA 1DAXA 3H1YA 1YJNS 5DDQC 2R3VA 1Q82T 5BNNA 4PQAA 1R64A 2HWF3 3ATGA 1CS4B 5A3TA 1JYIA 4LBHA 4ED4A 1LW0A 1SV5A 2FTRA 2D9OA 2QJ3A 2LXIA 1W9SA 4JV1A 5BR8J 4HT1T 1BBT1 2B0GA 3MAHA 4HI2A 3OL7A 2BEOA 4CLYA 5FUNA 3LW5C 2DVAA 4XXAA 5D15A 2BJDA 1TL7B 3SC7X 1ND2C 1NXD1 1ZM4A 2A0FB 1G2EA 1VAVA 2DVDA 1LOFC 3NAHA 3WDOA 1RT3A 3KK1B 2VO5A 1PO23 4IE0A 5GZFA 1W6PB 1REDA 3N7MA 3ZR6A 3BGRA 3SCKE 2BABA 1IM6A 2NS1B 3D3BJ 1IS5A 3A7QA 1V00A 2ZH5A 2BYVE 5JVGQ 2VFTA 4FSJA 2D3SA 1MLAA 1QJY1 2ARCA 3IN5A 2ZX2A 4IQXA 3H5UA 2YNFA 4ZIWA 1F6TA 4CUAA 1QNWA 2OPSB 5FR3A 4J9RA 3ZTOA 5A7OA 2ZVIA 4XE9A 2R071 5HLFB 3T3YA 4IDKB 4P73A 1RLDA 3U07A 5KFZA 1S0JA 4HACB 2Y6GA 3UNGC 1CPMA 2R2UA 3IDAA 3PVXA 4PUOB 1ULGA 4DQIA 1W2UA 1NQJA 5F3EA 2H5JB 2VXJA 4BXFA 3SFGA 3AD9C 1CULB 1D2QA 2J22A 2MZ1A 2QA4S 2IVJA 3TRGA 4IETA 4F2RA 3IA0A 3I2DA 3ST7A 1PK6A 1VB2A 3GCXP 4XDQA 4A8YA 1K1SA 2GHPA 2QSWA 5ETMA 2ZEWA 5G04L 1V9U1 2UU9F 2XY5A 4I2QA 2HS0A 4DU8A 4WIIA 3DLKA 3NY0A 5LBBA 3C19A 1J84A 3MEEB 1S0BA 1S1WB 4M0HA 1IR0A 5FKCA 1X9TA 2IRXA 3ORJA 4ZZ5A 2JFKA 2VZVA 1EPZA 2YNIA 1R8HA 4I6YA 4S0MA 3RYLA 1FMD2 1SCSA 5DG2A 5HQMA 4CDQA 4CYDA 3D7SB 3TOQA 5CG8A 4DUZF 4MYUA 4A4AA 2MZJA 4QZVB 3SNMA 1YQ2A 1OS5A 1HQEB 4BK5A 4KIAA 1JUIA 1AR73 1UEKA 4RBUA 3M4FA 4EZ6A 1HR0F 3ZMNA 2PSZA 3HT0A 5D8AB 4EZ9A 2Z42A 4QIWD 1XMQJ 2WWUA 1U26A 2VFVA 2RQCA 3I2FA 3KJNB 5FO9B 4GZ9A 2G4IA 5KFDA 1XR6A 3FGVA 4HKWA 2CJXB 5EWGA 1SPPB 1RXGA 4XBNA 3V0BA 3QGGA 2HHXA 3ETQA 2ZEYA 2GGPB 4OCTA 4KGVB 1RTDA 3UD3P 3O5SA 5FY5A 2R30A 1SJRA 2VPZB 3QYYA 2B42B 5D4LA 2W4DA 1W28A 2LS6A 3T5LA 2MQMA 2A6YA 5A7WB 3I0SB 3CJQA 4CDWC 3BYWA 2XLAA 4NA1A 4AL5A 1FOD2 2JB8A 3NMBA 3RB6A 1BYHA 4AL7A 1VPHA 3EZOA 1F9FA 1VMFA 3ZPYA 4ZJQA 1JZ5A 3MEPA 4H14A 2HEKA 1OJ4A 4XAKA 1NA1B 2NPIA 4FZVA 4PXBA 4JI8F 4CRQA 2C2RA 5DO2A 1HN0A 4ZPBA 4GKYA 5F32A 1SXLA 4RUCA 1B64A 2W0XA 1WKJA 3ZN6A 3W2WA 4MJKA 1BEV2 4JP8A 1H1IA 2H9ZA 4KGGA 2UXCF 3MIDA 2CADA 4PAAA 1IHMA 1XC6A 4CDXB 4USVA 1U4BA 2CG4A 1ZM2A 2YNGB 1YBTA 2VU9A 2AYBA 4X4VA 2G13A 5H9RA 4EROA 2JE9A 5ETOA 5FP9A 1YQ5A 3FEYB 3MIFA 1BVVA 5C9AC 2HQDA 1W6NA 2D3OR 1U0SA 4RJVA 4OJGA 2HNDB 4B17A 4MK7A 3T2OA 1TVRB 1LW2A 1IS6A 4XIUA 4HHJA 2V6AA 3C3LA 4OI4A 2RT3A 1CJDA 2VQUA 2NXCA 5J48A 4OZJA 2Q8DA 3HR9A 3MW2A 4HETA 3HSGA 4LHSA 2KFZA 4EI2A 2NQPA 3GLJA 4D7SA 3VDDA 4UOFA 3I4IA 2M4MA 2A6WA 5KC6A 1Y10A 4RR3C 1UMHA 3MPVA 3EYZA 1TV6A 1LWXA 2ZGOA 1WA4A 2OS2A 3J4UH 2XLKA 4RW7B 1FATA 3MPYA 2DWRA 1U0HA 2RE1A 5JOYA 3KCYA 5CABA 1TMF1 1U2CA 4K50A 4N8MA 1FMD3 1YXWA 4JX0A 1RHJB 1WELA 3BREA 2DVIA 2V8PA 3FZ2A 4NZ0A 3HK2A 3W2VB 3E6BA 1YK9A 3ME2A 3AP9A 2JVOA 2QYGA 2HKEA 3TW0A 1GXLA 2WUHA 3K5PA 1FV2A 2XUEA 3MUY1 2D69A 3UV9A 3QT8A 1RJ7A 3TVKA 4N90A 3T19A 3OY8B 1VFJA 5IVVA 1Q5VA 3NWGA 2ZE2B 2B8PA 1S1AA 3ACHA 3J81j 3BPDA 3AH6A 3QZ7A 3UYJA 2BFUL 4USJC 3PX0A 3GV7B 4P5YA 4DR1F 3VBOC 3MZIA 2V2QA 4ZU7A 3I0RA 4HXCA 2KT5A 1C28A 3LP1B 2ACMA 4RW9A 2E63A 2V0NA 2DIUA 4AK3A 2G2OA 2OSRA 4CNYA 1DZ5A 3B78A 3BTXA 1PM7A 3IDCB 1K5JA 1RHI2 4DIQA 1EY2A 4LFBJ 4I2OA 3GCXA 4O4RA 4UOHA 4ZVFA 1JYXA 3T5JA 3GP9A 3IWZA 4WFZA 5B09A 3CDEA 4MGYE 2CDRB 1OC1A 3EGWB 1QTNB 5IQ6A 1WORA 3MM9B 3MIGA 2FDKA 2EXUA 2I38A 4GKKJ 2GC1A 2RM21 2PHFA 5A2QY 1SJ3P 1MEC2 4DR3F 3I5BA 4DR6J 1ULRA 5E0OA 2P6SA 2JLEA 4ECUA 5IV3A 2QX0A 4GO5X 1LK7A 4JI4F 3B54A 3DKQA 1HB2A 4L72B 4BQYA 1FFGB 2FZGB 1MMNA 4JKLA 1SJFA 4MO3M 1YRTA 1UW8A 1PIV1 4R5PA 2QLXA 5J1EB 2CPDA 2YUEA 3ZM8A 3JB4C 1BEV3 1ZOTA 4YW4A 1N3QA 1ONAA 3D1QA 1XNQF 3JZVA 4AUKA 4USMA 5LK7B 4RA0A 2C22A 4BOWA 3GSIA 5AE3A 3IGVA 2K2SA 2DPJA 4YHHF 1B0VA 4V1Ak 3PUAA 3VBHA 3AOCA 4TLRA 3PW5A 4OIXA 2WSFC 4OZ5A 2PE8A 5H9PA 5JXIA 1QDUB 4F0HA 4K9SA 4HH1A 4FYWB 2CQBA 3JQWA 4P2FA 1LHUA 2FBEA 3W5XA 1QOOA 1URXA 3K8WA 2EG2A 3MR7A 2IY5B 1LULA 2VBPA 4RL7A 1OD5A 5EZWA 4DXZA 5CFDB 1EB0A 1HNXF 1ROFA 4AXIA 1C0UA 1RE1B 4C8ZA 2QTWA 3I3EA 4WVVA 4GD4A 2GQQA 1RUG2 4Y4YA 4WVMA 3CDBA 4WFNQ 7FD1A 1HV0A 3FRZA 4O3QA 1V6KA 1RGVA 4MYTA 2HHVA 4CTAB 1VDHA 3BSCA 3A3PB 4P71A 4Q43A 1Z7S1 1XOYA 3HMJG 1AUYA 4EFAC 4MXWA 3C6UB 3SZ2A 4B9UA 3VDAA 4RUAA 2ALYB 4OI1A 4F2SA 4USTA 3C16B 3FQLA 4WKYA 1ULEA 3SBMA 4HKQA 3KG1A 1VC6A 3PUHA 2YMZA 4B9TA 5ANQA 1VIOA 3WLUA 2W1QA 1R8PA 4K7QA 4YW3A 5JPNB 1MMLA 1R43A 2HW3A 4Q2FA 3WQBA 4J9KA 2ID4A 4LJMA 4H55A 3OYWB 4XABA 3H0OA 4UT5A 1UVNA 2J1AA 1LV5A 2RKIB 5FZ9A 1TKTA 1H4GA 1JLGB 3IC1A 3FHAA 1NPRA 4RGGA 1IBKJ 4DEQA 2FY1A 3W64A 3VZLA 4RW6A 4XDOA 4MK8A 2UXBJ 5C5TA 1TE1B 4X4TA 5HVHA 1SC1B 2ENRA 1YRXA 2MHNA 1M06G 1K0TA 2V4AA 1RHI3 3OBAA 4LF8J 2WYFA 2RDDA 5DDJ2 5FPLA 1D3WA 1VQYA 1HBMB 2DCUB 3TYTA 2ADCA 5GLZA 2A6VA 2WIIB 4AGVA 1Q4RA 3KUEA 1W6QB 2HWF1 2WVBA 3PMEA 4M5IA 4UOCA 1URNA 3ENAA 3H8YA 1GTHA 3AK0A 4P9WA 3J7YI 1PZ8A 2DTWA 5F3IA 1SCJB 3IRXB 3IMMA 3MXHP 2V8GA 4TU9A 2AZ5A 2R1DA 4DN9A 1QNYA 4CXWA 5F6LB 2VZRA 2LU1A 5KG4A 2GQ2A 3FMGA 2VD7A 1W8HA 1Q8PA 5KHIA 1KD1T 2RJZA 2UUCJ 2E6VA 5GAGU 3T5HA 3MOJB 2LFVA 2LXFA 1COV1 3E5QA 2HWE3 2LM3A 2UV8G 2XVLA 3A0NA 4CWBA 2E5LF 3K8VA 1EAH1 4JDNA 4QT6A 4DUVA 2VCBA 4MGTA 1ZETA 4Q1RA 4FOWA 3W60A 2HMIB 3ILJA 4K1YA 2MQQA 3W5YA 2O67A 2BWCA 4J9QA 1VALA 1KVIA 3NNFA 2AU0A 5H9EJ 5LASA 3W8GA 3KWMA 3GZEA 2XJVA 2X1BA 1SBDA 2YKAA 1O6XA 4AFFA 1WKKA 4HFSA 3SQGA 5FZIA 2EG1A 2WSCC 3UFCX 1H9WA 3UWTA 4W92B 3ZXEA 3LQVA 5A33A 2EAKA 3KLGA 4C1WA 4PIXA 4YDDB 3TAYA 1GK8A 2GNTA 4K1ZA 2WABA 5FIIA 4QWBA 2Q79A 1CQMA 4OZNA 1UIKA 2DNYA 4JGZC 5I91A 2XZWA 1RUG3 4KO0A 2KN4A 1LAJA 4F0MA 4CCHA 4UW3A 1IKVA 4C8NA 2KXNB 4ZVTB 4OL8A 1MZ6A 3FN9A 1GH8A 3I56S 1TP7A 1G1XA 3AB2B 3MDPA 2ASLA 1YI9A 2MKYA 3PCOB 2BZ2A 1Q0NA 2R2TA 1Q7LB 2H4YB 4DV3F 4FI9A 3IMNA 4L92A 3GR0A 2A6MA 1SC3B 2VG5A 1Q8KA 1P9YA 1ZA2B 2G2YA 4C98A 5KG5A 2VQEJ 4JI3F 1RCOB 5BNPB 3MTJA 3NGDA 4LFAJ 1DGWA 3G6YA 3GQCA 4J9LA 3PRBA 4MGKE 1XE0A 3MLJA 3OTOF 5LJ3Y 5FMBA 2DO0A 1H3DA 4ZU5A 4Q4X2 2Y26A 3MI7X 2RHSB 3OF1A 1HNVA 4IEZA 3HULA 4YR0A 2X1AA 2D1CA 1APSA 1ZYQA 3ZDSA 4ARXA 5MLCV 4YM0A 4FPRA 1R1ZA 2HYIB 1O8BA 2W7PA 3MGJA 1AJOA 1DTTB 1UW9A 2ZHAA 2P3IA 3K48A 2EW9A 1H1MA 4KH9A 1OQ1A 5F8PA 5FP7A 2LQBA 4CLFA 2ZS6B 1F9KA 3LA0A 4TY9A 4AVSA 3UNYA 3U1MA 1MVEA 1SFNA 2HSEB 3BN7A 3JTNA 2A2DA 2ROEA 3TAMB 1ZA4A 2WZEA 4CT9A 4AEKA 4K4YA 2OQ7A 5DDJ3 5LA2A 1QOSA 2KL8A 1Q3EA 1QH6A 4BS2A 1UPMB 3VD5A 2QO3A 3SEPA 2J6UA 1U12A 3AKSA 2W5FA 2MKKA 4MSVA 3ZXFA 4U6PA 3FHIB 4BBYA 5TSWA 2FQPA 1S9GA 3KQRA 1RT2A 1LHVA 1YC61 2KA3A 3IM9A 1KTVA 5CYMA 3ZZPA 2WONB 2NXUA 2QMWA 3WEZA 3RUBL 3TAQA 1SBRA 1QGLA 4UI9L 3MDFA 2ZMNA 2I2SA 5IT9Y 4AYUA 4IRKA 1FKPA 1RUE2 2ATFA 3FUOA 2ROPA 4JUZA 3SCFA 1IKWA 3PVNA 3THTA 1AYM2 2VXRA 5KOXA 5KHKA 2OW4A 1T03A 4OX9F 2QA2A 4XMIA 1FYUA 4YZ1A 5C8CB 1SQ4A 2V4QA 2EC2A 3UESA 5KFHA 3PL0A 1O3RA 5DG9A 3FFZA 3BV8A 4O4GB 1L3UA 5I3UA 4USWA 3B9IA 3VBUC 1Q78A 4CM0A 1DYPA 1NQDA 2KXFA 3VQTA 1VI7A 1UP1A 3KK2A 1UW4A 4B3RF 4CEWC 1UL9A 4X64J 1CX4A 5A0YB 4WE1B 3MFHA 3CDAA 3D68A 2VA3A 1PGL1 3QACA 4CNZA 4NEZA 4IG3B 2VTXA 2CHHA 1YHQS 2QQWA 2H0VA 2J7WA 3MPDA 1NUKA 4BYYA 2BW8A 4PDWA 1FVQA 4A41A 4M00A 2LALA 5F5CA 3CDWA 1ZZ8A 2MZSA 1YWXA 1UZ0A 3Q2TC 1YQCA 1R082 1L3VA 4C8MA 1GWMA 1JZ4A 3UN5A 1UWBB 3MFCA 4XF1A 1JLFA 1QIQA 4FOQA 1QU0A 1SUQB 5HXMA 3CSKA 2VA2A 4NPMA 5B4NA 5F9LA 2VOKA 3TEGA 2WRMA 3ACIA 1IQDC 2RQ4A 2BP6A 5FWJA 1KRIA 3SDEA 3BSNA 5FPZA 3OVSA 1JLAA 3CWJA 4JI1F 2K46A 3CJ8A 2WZR2 2YG0A 2ZEXA 4NLSA 1X4DA 4Q4X3 5DQIA 5IWAF 1YFUA 4IR1A 1HJFA 1FRJA 1NA1C 4ES9A 3UCZP 1W6OB 1N6QA 3BPZA 2QN6B 1RJJA 3FLRA 1O51A 4XFHA 4ZS2A 3RQ0A 3UVJB 2Z4PA 4UF0A 3AA8A 3V4MA 2HJIA 3I87A 4RD7A 4S2HA 1RLCL 3BDEA 1XU1A 5IT0A 5J2NA 2X3DA 2SBAA 3UE2A 2AGQA 1UZDA 4AE5A 3SCIE 4FAGA 2I8EA 1HWJA 5GAHU 1FE0A 1VHFA 1FERA 5JSOA 3FSIA 3QH7A 3I4PA 5C9AA 3ES1A 3GG0A 2HLUA 5LMUJ 1R8CA 1TK5A 2KVIA 3DMJB 2HHSA 2Y0OA 3DFEA 1GWLA 3X3UA 1I3OB 1HQWA 3O7OA 5IAXA 3JTPA 4LA3A 1N5TA 2CPXA 1O3QA 2WW4A 3ISND 1QXPA 4N5SA 2E7XA 1V3SA 3C7FA 4V2VA 3JXSA 4Y5SA 5CFCA 1RUE3 4B3SF 4URGA 3A3NB 4XJ9A 1AYM3 4JKKA 3MMCB 5J2PA 3OR1A 1J1LA 3PEJA 2CPFA 3MUVP 3H59A 3TNPB 1IG3A 3EDQB 3NGRA 3K75B 2CXEA 2NYYA 1V5VA 1ZRFA 5E33A 1NUEA 1JLCB 1JOJA 2VG7A 4OMCA 3CCTA 3RRKA 2D40A 3DLEA 4W90B 1KLNA 3LOIA 2BTVC 1RABB 2ZC4A 4URQU 1RYYA 3MO4A 2ATCB 4OYUA 3VBSC 6AT1B 2Q5TA 1W8ZA 1PKUA 2H0BA 4Y33A 3N5FA 2XYHB 3D28A 1IPJA 2AEFA 4LR4A 1D2SA 2DGTA 2MKHA 3IR6B 3OD4A 4C90A 1Y4ZB 2ZX4A 3I3DA 3POSA 2GMHA 1M0SA 2BM0A 3FCWA 3VHRA 1O4TA 2YKNA 1XJWB 4WJBA 4XMAA 1XQIA 1YGYA 3MMJA 3CEWA 2W4PA 4I7FA 4KAIA 2P1BA 1HMVA 3CEDA 4WZQA 4GXLA 3C15A 2Q1FA 3HOBA 5E5NA 4WFAQ 2ZGQA 1R083 4KFBB 2IUWA 3M30B 2JDAA 3BGFA 3ZZ0A 5EN1A 5JVVA 2RF2B 2V68A 4K5SA 1RMU1 1UY1A 4FP2A 3WDVA 4CXXA 1TL3B 5SV8A 2ZBPA 5E3PA 2O8OA 1GFF2 4W4ZA 4X4OA 1H8TA 3IAQA 2J5AA 4NXNF 2MZQA 2IIHA 1HJGA 3ZFEB 1F2GA 1H8VA 3QO9B 5FOBB 1HWKA 1N52B 4XIKA 3S5QA 2WZR3 2K0GA 3MR2A 3RVHA 2BJ7A 3JAMY 4IL7A 3W1YC 4LUBA 2P8IA 2Y8YA 5KHHA 3OUYB 1N5YB 3CDZB 3MAAB 3VAJA 5L7OC 1J5EJ 4CLPA 3KCCA 1WC3A 2R0HA 1XYOA 1FNZA 1TUWA 1S7IA 4SBVA 3CJ4A 3U11A 4J9MA 5A32A 5DDPC 4DV6F 5F3GA 3OVBA 4L6V3 4Z7CA 2HRUA 2O1QA 5L36A 3M32A 1J5OA 4QPWA 1WMDA 1ZA1B 3D0JA 1GEHA 3WNLA 2Y1JA 2IJRA 5LY1A 3I8TA 2R8JA 3IIAA 2XHWA 5EFUA 2CPJA 1KRPA 5CISA 1WW6A 4G3IA 4JI2J 4LR7A 4XEZA 3R9LA 4DV5J 1FK9B 1M4WA 5BXIA 1NCQB 3Q8UA 1O5LA 3MEDB 3H1MA 1TNFA 5CFDC 5L8RC 2W91A 3CC4S 3OXGA 3CIMA 4AZZA 5GZEA 3HSJA 3NXZA 5HAOA 1RCXB 2UXDF 1SB6A 1UETA 3PX6A 4NI2B 4IKAA 4EK2A 4NAMA 2YHJA 1RUF2 4E8CA 3RB0A 4XFGA 4SLIA 3RYPA 1XNRJ 2UWBA 5E16A 3CD7A 4CCJA 3MEGB 2HWE1 1ZA7A 1JXEA 4IV3C 2CNKB 2DH9A 4LBPA 3OR2A 4DR2J 5AXLA 4OQ9A 1MU2A 5LSLA 2PMHA 3D54A 1P1LA 2BKPA 2PQSA 4CH7A 4UY85 4KMQA 4LIVA 3VGVA 5HCFA 1G9AA 3H1WA 3I2GA 4FPKA 2DHGA 4RW8A 3NV2A 3EJKA 3H7JA 4I2PB 2XGQA 4ECXA 4DS4A 5C8WA 1RVF1 2JDYA 3W58A 1CAXA 3J8F1 5D78A 1TU0B 3K57A 3BQ2A 1HRV2 3GTYX 4NASA 2ZBJA 4EE2A 4WBFA 3P5BA 1LKZA 1RWOB 2AH2A 4ENOA 3KV6A 4TN7A 2DCLA 1KP6A 4XPEA 3M8LA 2GC3A 4FDFA 3I49A 1K45A 1WKLA 4LF5J 3DN7A 1VS3A 1G8WA 4LSZB 8ATCB 4YFUA 4WV8A 1OPIA 2JG9C 4M8LA 4PBPA 2R7SA 2HH9A 5L1JA 3SCGA 2B4OA 3R7NB 1QJX1 1WD6A 3M8PB 1X8EA 1D0HA 4K4TA 3WHUA 4R0JA 5C25B 1HW8A 1XJAA 3GBFA 1CC7A 4WM8B 5L9XA 4KYZA 2CG8A 3GF6A 2XHNA 1XMOF 1NKBA 3BUCA 4WP9A 1DQ0A 5FYTA 1ZM1A 1I1GA 2YH1A 2BJEA 4OHWA 1RZMA 2BBEA 2C3MA 2ORZA 4P10A 1MR5A 2XBO1 2DGOA 3H4BA 3ZSLA 4F8AA 4CEYB 4TLQA 3DI6B 4RHV2 4NLVA 1AXQA 3HVDA 1T9XA 2BE9B 4ECSA 4OHYA 5JUMA 3I7DA 3DXSX 4FN5A 4XIOA 3O1MA 4MGQA 3GIRA 3H5SA 1X9SA 3BOWA 2OHDA 2DRBA 2HYKA 1VBB2 2W1SA 3PIJA 4ET7A 3GJTB 4Q4V1 4EO6A 5J37A 4IDZA 2Q1ZB 5A3PA 6FDRA 4A48A 1JMUB 2WNEA 3HI9A 4M1KA 4HKLA 4B7EA 2RAQA 3M2RA 2LTNA 1ZRCA </