3TICA

Crystal structure of 1957 pandemic h2n2 neuraminidase complexed with zanamivir
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
388
structure length
388
Chain Sequence
VEYRNWSKPQCQITGFAPFSKDNSIRLSAGGDIWVTREPYVSCDPGKCYQFALGQGTTLDNKHSNDTVHDRIPHRTLLMNELGVPFHLGTRQVCIAWSSSSCHDGKAWLHVCITGDDKNATASFIYDGRLVDSIGSWSQNILRTQESECVCINGTCTVVMTDGSASGRADTRILFIEEGKIVHISPLSGSAQHIEECSCYPRYPGVRCICRDNWKGSNRPVVDINMEDYSIDSSYVCSGLVGDTPRNDDSSSNSNCRNPNNERGTQGVKGWAFDNGNDLWMGRTISKESRSGYETFKVIGGWSTPNSKSQVNRQVIVDNNNWSGYSGIFSVEGKSCINRCFYVELIRGRPQETRVWWTSNSIVVFCGTSGTYGTGSWPDGANINFMPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of laninamivir and its octanoate prodrug reveals group specific mechanisms for influenza NA inhibition
pubmed doi rcsb
source organism Influenza a virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Neuraminidase
total genus 106
structure length 388
sequence length 388
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 3ticA00
1MR5A 1MS5A 4WEGA 4FPEA 2VK7A 1INYA 2YDPA 4QNPA 1DIMA 1V0EA 4GZSA 2HT7A 4GZXA 1L7FA 2C4AA 2YA6A 3K36A 1XOEA 1EUUA 2QWFA 4FOQA 3PJQA 4FP3A 4XIKA 4YZ5A 1IVFA 1MS3A 4CPZA 3TI5A 1B9TA 1INGA 2F24A 5JYYA 1SLLA 4XJWA 1E8TA 1IVGA 1A4QA 2YA4A 4XE9A 4CPOA 1V0ZA 4YW2A 4Q6KA 1B9VA 2HT8A 4NCSA 4WA4A 1L7GA 4YZ3A 4D8SA 1MZ5A 4YZ1A 2HT5A 3CKZA 4GZQA 4MWXA 4CPLA 2HTYA 2QWJA 3TIAA 2X9MA 1N1VA 4X4AA 4GJTA 2VW0A 2BERA 1NCAN 2AH2A 1NSDA 3T1EA 2VSKA 1Z4XA 1F8EA 2ZB5A 4XJ9A 1N1YA 1A4GA 1S0JA 3TI6A 1INWA 2W5NA 4FVKA 4FOWA 1W21A 1W8NA 4H52A 4MWUA 4M4UA 4FQ4A 4K1KA 4FPFA 3GVLA 3A71A 2HTVA 2VVZA 4FPLA 1NCCN 2HTQA 2YDTA 4GZPA 3SILA 2FHRA 2QWGA 3GVKA 4XHXA 5HX0A 4FPCA 2BF6A 2QWEA 1DILA 1NNAA 1WCSA 4MWQA 4GZWA 1W20A 2ZB6A 2JKBA 2F26A 2QWHA 1NMAN 4MWWA 1Z4WA 4FPKA 1V3CA 4WA3A 1NMCA 3A72A 4XIOA 4CPYA 4NC5A 4FPJA 2XZKA 2VSMA 1MS9A 4MZEA 4YZ2A 1MS4A 1W1XA 2BATA 2AGSA 2HTWA 2F29A 4XYXA 4FPGA 1NCBN 4XJAA 3TIBA 4UF7A 7NN9A 3OPZA 1V3DA 1SLIA 4JF7A 4MC7A 3TI4A 4FP2A 2W5OA 2VW1A 5NN9A 2HU0A 5B2CA 4I00A 4KS3A 3TICA 3B7EA 1W0PA 2F25A 3K39A 3NN9A 4B7QA 4H53A 4M4VA 1INVA 1WCQA 4KS5A 1USRA 1F8CA 4MZAA 2F12A 5HUGA 4J9TA 4HIZA 4FOYA 4QN6A 3H6JA 1E8UA 4QN3A 4WEFA 3BEQA 2YA7A 4HZVA 1EURA 2A75A 4XILA 2QWKA 2F28A 2XZJA 1Z4ZA 2HU4A 1KITA 4XJQA 4HZZA 1MWEA 2W20A 4XHBA 4B7NA 1INHA 1F8DA 4HZWA 6NN9A 1SO7A 4MWVA 4GZTA 4XOGA 2F10A 4B7JA 1N1TA 1INXA 1NCDN 4QN5A 4XJRA 2VK6A 3CL2A 1A14N 1S0IA 1F8BA 2AEPA 4MWRA 4FJ6A 2F27A 4FPOB 4B7RA 3W09A 4MJUA 3H72A 4SLIA 3CYEA 4GEZA 1NSBA 5HUNA 3K38A 4M3MA 1V0FA 5HUMA 4GB1A 3TI8A 2VW2A 4XMIA 1IVDA 1NNCA 4FZHA 4NN9A 4XJ8A 4MWLA 4XMAA 1W8OA 3ALWA 3K3AA 4MWYA 1L7HA 1Z4VA 4KS4A 3NSSA 2HTUA 4CPMA 4YW1A 2QWCA 3ALXA 4M4NA 4MX0A 1IVBA 2QWAA 4XJUA 2C4LA 5F9TA 1INFA 4K1JA 4XJZA 2RKCA 2B8HA 1VCUA 1E8VA 3CL0A 2QWIA 2XCYA 4YW3A 1VCJA 1V3EA 1USXA 4BBWA 4KS2A 4MWJA 4X49A 1IVEA 4QN7A 4K1HA 4X47A 4YZ4A 1Z4YA 4K3YA 4GDIA 5M1ZA 2QWDA 1N1SA 3O9KA 1V3BA 1Z50A 3B69A 4FPYA 2XZIA 1SNTA 3O9JA 2F11A 4QN4A 4K1IA 4DGRA 4FOVA 2YA5A 2QWBA 2F0ZA 3GVJA 1NSCA 5HUKA 2BZDA 3SLIA 3TI3A 4CPNA 4KS1A 4GZOA 5B2DA 1MZ6A 2HTRA 2SIMA 3H71A 1NNBA 3D11A 2VK5A 2YA8A 1IVCA 1MS0A 3INBA 2F13A 4HZYA 1NN2A 1W0OA 4HZXA 1MS1A 2AEQA 2VWDA 1NMBN 4X6KA 1B9SA 4MJVA 3K37A 4B7MA 4WA5A 4GDJA 1XOGA 3SALA 1BJIA 3D12A 1MS8A 4YW4A 2SILA 3H73A 2W38A 1EUSA 4YW5A 3SANA 1V2IA 1EUTA 2SLIA 3JU4A 2CMLA 4FPHA
chains in the Genus database with same CATH superfamily
3AMRA 1MR5A 1MS5A 2WOZA 4WEGA 4FPEA 2VK7A 1INYA 2YDPA 4QNPA 1DIMA 3LI5A 1V0EA 4GZSA 2HT7A 4GZXA 1L7FA 2C4AA 2YA6A 3K36A 1XOEA 1EUUA 2QWFA 1RWIA 3S8ZA 3SOBB 4IN4A 4FOQA 3PJQA 4FP3A 4Q1UA 4XIKA 4YZ5A 1IVFA 1MS3A 4CPZA 2V91A 3TI5A 1B9TA 1INGA 2F24A 2GVUA 3HLHA 5JYYA 4L7DA 1N7DA 1SLLA 4HHOA 4L7CA 4XJWA 1E8TA 1IVGA 1A4QA 4CHBA 2YA4A 4XE9A 1K32A 4CPOA 1V0ZA 1H6LA 4YW2A 4Q6KA 1B9VA 2HT8A 2H2UA 4NCSA 1PJXA 4GN7A 4WA4A 2HQSA 3SOVA 4DG6A 4IFNX 1L7GA 4YZ3A 4D8SA 4GNCA 1MZ5A 3ADEA 4YZ1A 2HT5A 1V04A 3CKZA 4GZQA 4MWXA 3V64C 5D9BA 4CPLA 2HTYA 2QWJA 3TIAA 2X9MA 4IFJA 2OJHA 1N1VA 4X4AA 2IATA 3P5BL 2VW0A 4GJTA 3V65B 5EX7A 2BERA 1NCAN 2AH2A 1NSDA 2Z32A 3II7A 3T1EA 2VSKA 4ZLRA 1Z4XA 1F8EA 2ZB5A 4XJ9A 1N1YA 1A4GA 2ZW9A 4CH9A 1S0JA 2VAQA 3TI6A 1INWA 3WW9A 4AHAA 2W5NA 4FVKA 4FOWA 1W21A 1RWLA 1POOA 1W8NA 4H52A 4MWUA 2FLUX 4M4UA 4FQ4A 4K1KA 1ZI0A 5D9CA 3KGGA 4FPFA 2IAOA 3GVLA 4JMLA 4XMBA 3A71A 2HTVA 2VVZA 3ZGDA 4FPLA 1NCCN 1X2RA 3NO0A 5FNRA 2HTQA 2YDTA 3O4PA 1NPEA 4GZPA 3SILA 2FHRA 2QWGA 3GVKA 3A9GA 4XHXA 5HX0A 4FPCA 2BF6A 4GN9A 1C5KA 2QWEA 3V1SA 2IASA 1DILA 1NNAA 1WCSA 4MWQA 4GZWA 1C9UA 1W20A 2ZB6A 2JKBA 2F26A 2QWHA 5GTQA 3BYCA 1NMAN 4MWWA 2IAWA 3SRGA 1Z4WA 3FVZA 4FPKA 1V3CA 1X2JA 4WA3A 1NMCA 3A72A 4O5TA 4XIOA 2FP8A 4AGIA 3G4HA 4CPYA 5CGJA 2FPBA 4NC5A 3DASA 4FPJA 3E5ZA 4A0PA 2XZKA 2VSMA 3HRPA 1MS9A 4MZEA 4YZ2A 1MS4A 1W1XA 2BATA 2POOA 2GVWA 2AGSA 3KYAA 2HTWA 2F29A 4XYXA 4FPGA 1S18A 1NCBN 5EO8A 4XJAA 3TIBA 4UF7A 4L7BA 7NN9A 3OPZA 1V3DA 4C1YB 1SLIA 4JF7A 4MC7A 3TI4A 4FP2A 4PWZA 2W5OA 2VW1A 5NN9A 2HU0A 3S8VA 5B2CA 3LI4A 4I00A 4KS3A 3TICA 1SUUA 3B7EA 1W0PA 2F25A 3K39A 3NN9A 4B7QA 4H53A 4M4VA 1INVA 1CRUA 1WCQA 3UC1A 4KS5A 1USRA 4D52C 1F8CA 4MZAA 4C1YA 2F12A 5HUGA 4J9TA 4HIZA 3S2KA 4FOYA 4QN6A 3I1CA 3H6JA 1IUBA 3VNHA 3VNGA 4GN8A 3ZGCA 5FWWA 1E8UA 4QN3A 4WEFA 4N1BA 3BEQA 2YA7A 2VPJA 4HZVA 3AMSA 3DR2A 1EURA 2A75A 4XILA 4CSDA 2QWKA 2F28A 2XZJA 1Z4ZA 2HU4A 1N6EA 2DG1A 1KITA 1OFZA 3SREA 4XJQA 4HZZA 3Q6TA 1MWEA 2W8BB 2QE8A 2W20A 4XHBA 4B7NA 1INHA 4HW6A 1F8DA 1IJQA 4HZWA 6NN9A 1E1AA 1U6DX 1SO7A 4MWVA 4GZTA 3WN7A 4XOGA 3A9HA 2F10A 5FZNA 4YY8A 4B7JA 1N1TA 1INXA 1NCDN 4QN5A 4XJRA 1CVMA 4UOUA 2VK6A 3CL2A 1A14N 1S0IA 1F8BA 2AEPA 4MWRA 4FJ6A 2F27A 2GVVA 4IFLX 2W8BA 4AGTA 4D52B 4FPOB 4B7RA 2IARA 3W09A 4MJUA 3H72A 4SLIA 3CYEA 4GEZA 1NSBA 5HUNA 3K38A 4M3MA 3SOQA 5H47A 1V0FA 2GHSA 5HUMA 4GB1A 3TI8A 2VW2A 4XMIA 1IVDA 1NNCA 4FZHA 4NN9A 4XJ8A 4MWLA 4IQKA 1N6DA 4XMAA 1W8OA 3ALWA 5D9DA 3K3AA 4MWYA 4ZY3A 1IUCA 1L7HA 1Z4VA 4D52A 4KS4A 3NSSA 2IVZA 2DSOA 2HTUA 4HHQA 4CPMA 4YW1A 2QWCA 3ALXA 4M4NA 4MX0A 1IVBA 2QWAA 4XJUA 2C4LA 5F9TA 1INFA 4K1JA 4XJZA 2RKCA 5FNTA 2B8HA 1VCUA 1QBIA 1E8VA 3CL0A 2QWIA 2XCYA 4YW3A 1VCJA 1V3EA 3S94A 3LI3A 1USXA 4BBWA 1CQ1A 2IAUA 3Q6PA 4KS2A 4MWJA 4X49A 3WDZA 1WP5A 1IVEA 4QN7A 2FP9A 4K1HA 4X47A 4YZ4A 1Z4YA 4K3YA 5EO7A 3IAXA 4GDIA 3WWAA 4GNBA 1QLGA 5M1ZA 2QWDA 1N1SA 3O9KA 4ASCA 2G8SA 2H2NA 2IAQA 1V3BA 5F72C 1Z50A 1ZGKA 3B69A 4FPYA 4G3NA 2XZIA 4AH4A 3L6VA 1SNTA 3O9JA 1S1DA 3Q6KA 2F11A 4QN4A 4K1IA 3HLIA 4DGRA 4FOVA 2YA5A 2QWBA 2F0ZA 3GVJA 1NSCA 5HUKA 2BZDA 3SLIA 3TI3A 4CPNA 5FZJA 4ZGCA 4KS1A 4GZOA 5B2DA 5FNUA 1MZ6A 2HTRA 2SIMA 5GX2A 4O5SA 2XN4A 1Q7FA 1NNBA 3H71A 5FNSA 3G4EA 3D11A 2IAPA 2VK5A 2YA8A 2FPCA 1IVCA 2IAVA 4R40A 2P4OA 5GX1A 2ZZKA 1MS0A 3INBA 2F13A 4HZYA 3FW0A 3U0SA 1NN2A 1W0OA 2ZWAA 4HZXA 1MS1A 5GX3A 2DYHA 2AEQA 2VWDA 4D4UA 2GVXA 1NMBN 2IAXA 4IYGA 4X6KA 2ISMA 4GNAA 1B9SA 1CRZA 1N6FA 4MJVA 3K37A 2DG0A 4B7MA 5FNQA 4WA5A 4GDJA 1XOGA 3SALA 1BJIA 3D12A 3TC9A 1MS8A 2SILA 4YW4A 3H73A 2W38A 1EUSA 4YW5A 3SANA 1V2IA 1EUTA 2SLIA 3JU4A 5GX5A 4IMBA 2CMLA 5GX4A 4FPHA
chains in the Genus database with same CATH topology
1MR5A 1MS5A 4WEGA 4FPEA 2VK7A 1INYA 2YDPA 4QNPA 1DIMA 1V0EA 4GZSA 2HT7A 4GZXA 1L7FA 2C4AA 2YA6A 3K36A 1XOEA 1EUUA 2QWFA 4FOQA 3PJQA 4FP3A 4XIKA 4YZ5A 1IVFA 1MS3A 4CPZA 3TI5A 1B9TA 1INGA 2F24A 5JYYA 1SLLA 4XJWA 1E8TA 1IVGA 1A4QA 2YA4A 4XE9A 4CPOA 1V0ZA 4YW2A 4Q6KA 1B9VA 2HT8A 2H2UA 4NCSA 4WA4A 1L7GA 4YZ3A 4D8SA 1MZ5A 4YZ1A 2HT5A 3CKZA 4GZQA 4MWXA 4CPLA 2HTYA 2QWJA 3TIAA 2X9MA 1N1VA 4X4AA 4GJTA 2VW0A 2BERA 1NCAN 2AH2A 1NSDA 3T1EA 2VSKA 1Z4XA 1F8EA 2ZB5A 4XJ9A 1N1YA 1A4GA 1S0JA 3TI6A 1INWA 2W5NA 4FVKA 4FOWA 1W21A 1W8NA 4H52A 4MWUA 4M4UA 4FQ4A 4K1KA 4FPFA 3GVLA 3A71A 2HTVA 2VVZA 4FPLA 1NCCN 2HTQA 2YDTA 4GZPA 3SILA 2FHRA 2QWGA 3GVKA 4XHXA 5HX0A 4FPCA 2BF6A 2QWEA 1DILA 1NNAA 1WCSA 4MWQA 4GZWA 1W20A 2ZB6A 2JKBA 2F26A 2QWHA 1NMAN 4MWWA 1Z4WA 4FPKA 1V3CA 4WA3A 1NMCA 3A72A 4XIOA 4CPYA 4NC5A 4FPJA 2XZKA 2VSMA 1MS9A 4MZEA 4YZ2A 1MS4A 1W1XA 2BATA 2AGSA 2HTWA 4XYXA 2F29A 4FPGA 1S18A 1NCBN 4XJAA 3TIBA 4UF7A 7NN9A 3OPZA 1V3DA 1SLIA 4JF7A 4MC7A 3TI4A 4FP2A 2W5OA 2VW1A 5NN9A 2HU0A 5B2CA 4I00A 4KS3A 3TICA 3B7EA 1W0PA 2F25A 3K39A 3NN9A 4B7QA 4H53A 4M4VA 1INVA 1WCQA 4KS5A 1USRA 1F8CA 4MZAA 2F12A 5HUGA 4J9TA 4HIZA 4FOYA 4QN6A 3H6JA 1E8UA 4QN3A 4WEFA 3BEQA 2YA7A 4HZVA 1EURA 2A75A 4XILA 2QWKA 2F28A 2XZJA 1Z4ZA 2HU4A 1KITA 4XJQA 4HZZA 1MWEA 2W20A 4XHBA 4B7NA 1INHA 1F8DA 4HZWA 6NN9A 1SO7A 4MWVA 4GZTA 4XOGA 2F10A 4B7JA 1N1TA 1INXA 1NCDN 4QN5A 4XJRA 2VK6A 3CL2A 1A14N 1S0IA 1F8BA 2AEPA 4MWRA 4FJ6A 2F27A 4FPOB 4B7RA 3W09A 4MJUA 3H72A 4SLIA 3CYEA 4GEZA 1NSBA 5HUNA 3K38A 4M3MA 1V0FA 5HUMA 4GB1A 3TI8A 2VW2A 4XMIA 1IVDA 1NNCA 4FZHA 4NN9A 4XJ8A 4MWLA 4XMAA 1W8OA 3ALWA 3K3AA 4MWYA 1L7HA 1Z4VA 4KS4A 3NSSA 2HTUA 4CPMA 4YW1A 2QWCA 3ALXA 4M4NA 4MX0A 1IVBA 2QWAA 4XJUA 2C4LA 5F9TA 1INFA 4K1JA 4XJZA 2RKCA 2B8HA 1VCUA 1E8VA 3CL0A 2QWIA 2XCYA 4YW3A 1VCJA 1V3EA 1USXA 4BBWA 4KS2A 4MWJA 4X49A 1IVEA 4QN7A 4K1HA 4X47A 4YZ4A 1Z4YA 4K3YA 4GDIA 5M1ZA 2QWDA 1N1SA 3O9KA 2H2NA 1V3BA 1Z50A 3B69A 4FPYA 2XZIA 1SNTA 3O9JA 1S1DA 2F11A 4QN4A 4K1IA 4DGRA 4FOVA 2YA5A 2QWBA 2F0ZA 3GVJA 1NSCA 5HUKA 2BZDA 3SLIA 3TI3A 4CPNA 4KS1A 4GZOA 5B2DA 1MZ6A 2HTRA 2SIMA 3H71A 1NNBA 3D11A 2VK5A 2YA8A 1IVCA 1MS0A 3INBA 2F13A 4HZYA 1NN2A 1W0OA 4HZXA 1MS1A 2AEQA 2VWDA 1NMBN 4X6KA 1B9SA 4MJVA 3K37A 4B7MA 4WA5A 4GDJA 1XOGA 3SALA 1BJIA 3D12A 1MS8A 4YW4A 2SILA 3H73A 2W38A 1EUSA 4YW5A 3SANA 1V2IA 1EUTA 2SLIA 3JU4A 2CMLA 4FPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR5 A;  1MS5 A;  4WEG A;  4FPE A;  2VK7 A;  1INY A;  2YDP A;  4QNP A;  1DIM A;  1V0E A;  4GZS A;  2HT7 A;  4GZX A;  1L7F A;  2C4A A;  2YA6 A;  3K36 A;  1XOE A;  1EUU A;  2QWF A;  4FOQ A;  3PJQ A;  4FP3 A;  4XIK A;  4YZ5 A;  1IVF A;  1MS3 A;  4CPZ A;  3TI5 A;  1B9T A;  1ING A;  2F24 A;  5JYY A;  1SLL A;  4XJW A;  1E8T A;  1IVG A;  1A4Q A;  2YA4 A;  4XE9 A;  4CPO A;  1V0Z A;  4YW2 A;  4Q6K A;  1B9V A;  2HT8 A;  4NCS A;  4WA4 A;  1L7G A;  4YZ3 A;  4D8S A;  1MZ5 A;  4YZ1 A;  2HT5 A;  3CKZ A;  4GZQ A;  4MWX A;  4CPL A;  2HTY A;  2QWJ A;  3TIA A;  2X9M A;  1N1V A;  4X4A A;  4GJT A;  2VW0 A;  2BER A;  1NCA N;  2AH2 A;  1NSD A;  3T1E A;  2VSK A;  1Z4X A;  1F8E A;  2ZB5 A;  4XJ9 A;  1N1Y A;  1A4G A;  1S0J A;  3TI6 A;  1INW A;  2W5N A;  4FVK A;  4FOW A;  1W21 A;  1W8N A;  4H52 A;  4MWU A;  4M4U A;  4FQ4 A;  4K1K A;  4FPF A;  3GVL A;  3A71 A;  2HTV A;  2VVZ A;  4FPL A;  1NCC N;  2HTQ A;  2YDT A;  4GZP A;  3SIL A;  2FHR A;  2QWG A;  3GVK A;  4XHX A;  5HX0 A;  4FPC A;  2BF6 A;  2QWE A;  1DIL A;  1NNA A;  1WCS A;  4MWQ A;  4GZW A;  1W20 A;  2ZB6 A;  2JKB A;  2F26 A;  2QWH A;  1NMA N;  4MWW A;  1Z4W A;  4FPK A;  1V3C A;  4WA3 A;  1NMC A;  3A72 A;  4XIO A;  4CPY A;  4NC5 A;  4FPJ A;  2XZK A;  2VSM A;  1MS9 A;  4MZE A;  4YZ2 A;  1MS4 A;  1W1X A;  2BAT A;  2AGS A;  2HTW A;  2F29 A;  4XYX A;  4FPG A;  1NCB N;  4XJA A;  3TIB A;  4UF7 A;  7NN9 A;  3OPZ A;  1V3D A;  1SLI A;  4JF7 A;  4MC7 A;  3TI4 A;  4FP2 A;  2W5O A;  2VW1 A;  5NN9 A;  2HU0 A;  5B2C A;  4I00 A;  4KS3 A;  3TIC A;  3B7E A;  1W0P A;  2F25 A;  3K39 A;  3NN9 A;  4B7Q A;  4H53 A;  4M4V A;  1INV A;  1WCQ A;  4KS5 A;  1USR A;  1F8C A;  4MZA A;  2F12 A;  5HUG A;  4J9T A;  4HIZ A;  4FOY A;  4QN6 A;  3H6J A;  1E8U A;  4QN3 A;  4WEF A;  3BEQ A;  2YA7 A;  4HZV A;  1EUR A;  2A75 A;  4XIL A;  2QWK A;  2F28 A;  2XZJ A;  1Z4Z A;  2HU4 A;  1KIT A;  4XJQ A;  4HZZ A;  1MWE A;  2W20 A;  4XHB A;  4B7N A;  1INH A;  1F8D A;  4HZW A;  6NN9 A;  1SO7 A;  4MWV A;  4GZT A;  4XOG A;  2F10 A;  4B7J A;  1N1T A;  1INX A;  1NCD N;  4QN5 A;  4XJR A;  2VK6 A;  3CL2 A;  1A14 N;  1S0I A;  1F8B A;  2AEP A;  4MWR A;  4FJ6 A;  2F27 A;  4FPO B;  4B7R A;  3W09 A;  4MJU A;  3H72 A;  4SLI A;  3CYE A;  4GEZ A;  1NSB A;  5HUN A;  3K38 A;  4M3M A;  1V0F A;  5HUM A;  4GB1 A;  3TI8 A;  2VW2 A;  4XMI A;  1IVD A;  1NNC A;  4FZH A;  4NN9 A;  4XJ8 A;  4MWL A;  4XMA A;  1W8O A;  3ALW A;  3K3A A;  4MWY A;  1L7H A;  1Z4V A;  4KS4 A;  3NSS A;  2HTU A;  4CPM A;  4YW1 A;  2QWC A;  3ALX A;  4M4N A;  4MX0 A;  1IVB A;  2QWA A;  4XJU A;  2C4L A;  5F9T A;  1INF A;  4K1J A;  4XJZ A;  2RKC A;  2B8H A;  1VCU A;  1E8V A;  3CL0 A;  2QWI A;  2XCY A;  4YW3 A;  1VCJ A;  1V3E A;  1USX A;  4BBW A;  4KS2 A;  4MWJ A;  4X49 A;  1IVE A;  4QN7 A;  4K1H A;  4X47 A;  4YZ4 A;  1Z4Y A;  4K3Y A;  4GDI A;  5M1Z A;  2QWD A;  1N1S A;  3O9K A;  1V3B A;  1Z50 A;  3B69 A;  4FPY A;  2XZI A;  1SNT A;  3O9J A;  2F11 A;  4QN4 A;  4K1I A;  4DGR A;  4FOV A;  2YA5 A;  2QWB A;  2F0Z A;  3GVJ A;  1NSC A;  5HUK A;  2BZD A;  3SLI A;  3TI3 A;  4CPN A;  4KS1 A;  4GZO A;  5B2D A;  1MZ6 A;  2HTR A;  2SIM A;  3H71 A;  1NNB A;  3D11 A;  2VK5 A;  2YA8 A;  1IVC A;  1MS0 A;  3INB A;  2F13 A;  4HZY A;  1NN2 A;  1W0O A;  4HZX A;  1MS1 A;  2AEQ A;  2VWD A;  1NMB N;  4X6K A;  1B9S A;  4MJV A;  3K37 A;  4B7M A;  4WA5 A;  4GDJ A;  1XOG A;  3SAL A;  1BJI A;  3D12 A;  1MS8 A;  4YW4 A;  2SIL A;  3H73 A;  2W38 A;  1EUS A;  4YW5 A;  3SAN A;  1V2I A;  1EUT A;  2SLI A;  3JU4 A;  2CML A;  4FPH A; 
#chains in the Genus database with same CATH topology
 3AMR A;  1MR5 A;  1MS5 A;  2WOZ A;  4WEG A;  4FPE A;  2VK7 A;  1INY A;  2YDP A;  4QNP A;  1DIM A;  3LI5 A;  1V0E A;  4GZS A;  2HT7 A;  4GZX A;  1L7F A;  2C4A A;  2YA6 A;  3K36 A;  1XOE A;  1EUU A;  2QWF A;  1RWI A;  3S8Z A;  3SOB B;  4IN4 A;  4FOQ A;  3PJQ A;  4FP3 A;  4Q1U A;  4XIK A;  4YZ5 A;  1IVF A;  1MS3 A;  4CPZ A;  2V91 A;  3TI5 A;  1B9T A;  1ING A;  2F24 A;  2GVU A;  3HLH A;  5JYY A;  4L7D A;  1N7D A;  1SLL A;  4HHO A;  4L7C A;  4XJW A;  1E8T A;  1IVG A;  1A4Q A;  4CHB A;  2YA4 A;  4XE9 A;  1K32 A;  4CPO A;  1V0Z A;  1H6L A;  4YW2 A;  4Q6K A;  1B9V A;  2HT8 A;  2H2U A;  4NCS A;  1PJX A;  4GN7 A;  4WA4 A;  2HQS A;  3SOV A;  4DG6 A;  4IFN X;  1L7G A;  4YZ3 A;  4D8S A;  4GNC A;  1MZ5 A;  3ADE A;  4YZ1 A;  2HT5 A;  1V04 A;  3CKZ A;  4GZQ A;  4MWX A;  3V64 C;  5D9B A;  4CPL A;  2HTY A;  2QWJ A;  3TIA A;  2X9M A;  4IFJ A;  2OJH A;  1N1V A;  4X4A A;  2IAT A;  3P5B L;  2VW0 A;  4GJT A;  3V65 B;  5EX7 A;  2BER A;  1NCA N;  2AH2 A;  1NSD A;  2Z32 A;  3II7 A;  3T1E A;  2VSK A;  4ZLR A;  1Z4X A;  1F8E A;  2ZB5 A;  4XJ9 A;  1N1Y A;  1A4G A;  2ZW9 A;  4CH9 A;  1S0J A;  2VAQ A;  3TI6 A;  1INW A;  3WW9 A;  4AHA A;  2W5N A;  4FVK A;  4FOW A;  1W21 A;  1RWL A;  1POO A;  1W8N A;  4H52 A;  4MWU A;  2FLU X;  4M4U A;  4FQ4 A;  4K1K A;  1ZI0 A;  5D9C A;  3KGG A;  4FPF A;  2IAO A;  3GVL A;  4JML A;  4XMB A;  3A71 A;  2HTV A;  2VVZ A;  3ZGD A;  4FPL A;  1NCC N;  1X2R A;  3NO0 A;  5FNR A;  2HTQ A;  2YDT A;  3O4P A;  1NPE A;  4GZP A;  3SIL A;  2FHR A;  2QWG A;  3GVK A;  3A9G A;  4XHX A;  5HX0 A;  4FPC A;  2BF6 A;  4GN9 A;  1C5K A;  2QWE A;  3V1S A;  2IAS A;  1DIL A;  1NNA A;  1WCS A;  4MWQ A;  4GZW A;  1C9U A;  1W20 A;  2ZB6 A;  2JKB A;  2F26 A;  2QWH A;  5GTQ A;  3BYC A;  1NMA N;  4MWW A;  2IAW A;  3SRG A;  1Z4W A;  3FVZ A;  4FPK A;  1V3C A;  1X2J A;  4WA3 A;  1NMC A;  3A72 A;  4O5T A;  4XIO A;  2FP8 A;  4AGI A;  3G4H A;  4CPY A;  5CGJ A;  2FPB A;  4NC5 A;  3DAS A;  4FPJ A;  3E5Z A;  4A0P A;  2XZK A;  2VSM A;  3HRP A;  1MS9 A;  4MZE A;  4YZ2 A;  1MS4 A;  1W1X A;  2BAT A;  2POO A;  2GVW A;  2AGS A;  3KYA A;  2HTW A;  2F29 A;  4XYX A;  4FPG A;  1S18 A;  1NCB N;  5EO8 A;  4XJA A;  3TIB A;  4UF7 A;  4L7B A;  7NN9 A;  3OPZ A;  1V3D A;  4C1Y B;  1SLI A;  4JF7 A;  4MC7 A;  3TI4 A;  4FP2 A;  4PWZ A;  2W5O A;  2VW1 A;  5NN9 A;  2HU0 A;  3S8V A;  5B2C A;  3LI4 A;  4I00 A;  4KS3 A;  3TIC A;  1SUU A;  3B7E A;  1W0P A;  2F25 A;  3K39 A;  3NN9 A;  4B7Q A;  4H53 A;  4M4V A;  1INV A;  1CRU A;  1WCQ A;  3UC1 A;  4KS5 A;  1USR A;  4D52 C;  1F8C A;  4MZA A;  4C1Y A;  2F12 A;  5HUG A;  4J9T A;  4HIZ A;  3S2K A;  4FOY A;  4QN6 A;  3I1C A;  3H6J A;  1IUB A;  3VNH A;  3VNG A;  4GN8 A;  3ZGC A;  5FWW A;  1E8U A;  4QN3 A;  4WEF A;  4N1B A;  3BEQ A;  2YA7 A;  2VPJ A;  4HZV A;  3AMS A;  3DR2 A;  1EUR A;  2A75 A;  4XIL A;  4CSD A;  2QWK A;  2F28 A;  2XZJ A;  1Z4Z A;  2HU4 A;  1N6E A;  2DG1 A;  1KIT A;  1OFZ A;  3SRE A;  4XJQ A;  4HZZ A;  3Q6T A;  1MWE A;  2W8B B;  2QE8 A;  2W20 A;  4XHB A;  4B7N A;  1INH A;  4HW6 A;  1F8D A;  1IJQ A;  4HZW A;  6NN9 A;  1E1A A;  1U6D X;  1SO7 A;  4MWV A;  4GZT A;  3WN7 A;  4XOG A;  3A9H A;  2F10 A;  5FZN A;  4YY8 A;  4B7J A;  1N1T A;  1INX A;  1NCD N;  4QN5 A;  4XJR A;  1CVM A;  4UOU A;  2VK6 A;  3CL2 A;  1A14 N;  1S0I A;  1F8B A;  2AEP A;  4MWR A;  4FJ6 A;  2F27 A;  2GVV A;  4IFL X;  2W8B A;  4AGT A;  4D52 B;  4FPO B;  4B7R A;  2IAR A;  3W09 A;  4MJU A;  3H72 A;  4SLI A;  3CYE A;  4GEZ A;  1NSB A;  5HUN A;  3K38 A;  4M3M A;  3SOQ A;  5H47 A;  1V0F A;  2GHS A;  5HUM A;  4GB1 A;  3TI8 A;  2VW2 A;  4XMI A;  1IVD A;  1NNC A;  4FZH A;  4NN9 A;  4XJ8 A;  4MWL A;  4IQK A;  1N6D A;  4XMA A;  1W8O A;  3ALW A;  5D9D A;  3K3A A;  4MWY A;  4ZY3 A;  1IUC A;  1L7H A;  1Z4V A;  4D52 A;  4KS4 A;  3NSS A;  2IVZ A;  2DSO A;  2HTU A;  4HHQ A;  4CPM A;  4YW1 A;  2QWC A;  3ALX A;  4M4N A;  4MX0 A;  1IVB A;  2QWA A;  4XJU A;  2C4L A;  5F9T A;  1INF A;  4K1J A;  4XJZ A;  2RKC A;  5FNT A;  2B8H A;  1VCU A;  1QBI A;  1E8V A;  3CL0 A;  2QWI A;  2XCY A;  4YW3 A;  1VCJ A;  1V3E A;  3S94 A;  3LI3 A;  1USX A;  4BBW A;  1CQ1 A;  2IAU A;  3Q6P A;  4KS2 A;  4MWJ A;  4X49 A;  3WDZ A;  1WP5 A;  1IVE A;  4QN7 A;  2FP9 A;  4K1H A;  4X47 A;  4YZ4 A;  1Z4Y A;  4K3Y A;  5EO7 A;  3IAX A;  4GDI A;  3WWA A;  4GNB A;  1QLG A;  5M1Z A;  2QWD A;  1N1S A;  3O9K A;  4ASC A;  2G8S A;  2H2N A;  2IAQ A;  1V3B A;  5F72 C;  1Z50 A;  1ZGK A;  3B69 A;  4FPY A;  4G3N A;  2XZI A;  4AH4 A;  3L6V A;  1SNT A;  3O9J A;  1S1D A;  3Q6K A;  2F11 A;  4QN4 A;  4K1I A;  3HLI A;  4DGR A;  4FOV A;  2YA5 A;  2QWB A;  2F0Z A;  3GVJ A;  1NSC A;  5HUK A;  2BZD A;  3SLI A;  3TI3 A;  4CPN A;  5FZJ A;  4ZGC A;  4KS1 A;  4GZO A;  5B2D A;  5FNU A;  1MZ6 A;  2HTR A;  2SIM A;  5GX2 A;  4O5S A;  2XN4 A;  1Q7F A;  1NNB A;  3H71 A;  5FNS A;  3G4E A;  3D11 A;  2IAP A;  2VK5 A;  2YA8 A;  2FPC A;  1IVC A;  2IAV A;  4R40 A;  2P4O A;  5GX1 A;  2ZZK A;  1MS0 A;  3INB A;  2F13 A;  4HZY A;  3FW0 A;  3U0S A;  1NN2 A;  1W0O A;  2ZWA A;  4HZX A;  1MS1 A;  5GX3 A;  2DYH A;  2AEQ A;  2VWD A;  4D4U A;  2GVX A;  1NMB N;  2IAX A;  4IYG A;  4X6K A;  2ISM A;  4GNA A;  1B9S A;  1CRZ A;  1N6F A;  4MJV A;  3K37 A;  2DG0 A;  4B7M A;  5FNQ A;  4WA5 A;  4GDJ A;  1XOG A;  3SAL A;  1BJI A;  3D12 A;  3TC9 A;  1MS8 A;  2SIL A;  4YW4 A;  3H73 A;  2W38 A;  1EUS A;  4YW5 A;  3SAN A;  1V2I A;  1EUT A;  2SLI A;  3JU4 A;  5GX5 A;  4IMB A;  2CML A;  5GX4 A;  4FPH A; 
#chains in the Genus database with same CATH homology
 1MR5 A;  1MS5 A;  4WEG A;  4FPE A;  2VK7 A;  1INY A;  2YDP A;  4QNP A;  1DIM A;  1V0E A;  4GZS A;  2HT7 A;  4GZX A;  1L7F A;  2C4A A;  2YA6 A;  3K36 A;  1XOE A;  1EUU A;  2QWF A;  4FOQ A;  3PJQ A;  4FP3 A;  4XIK A;  4YZ5 A;  1IVF A;  1MS3 A;  4CPZ A;  3TI5 A;  1B9T A;  1ING A;  2F24 A;  5JYY A;  1SLL A;  4XJW A;  1E8T A;  1IVG A;  1A4Q A;  2YA4 A;  4XE9 A;  4CPO A;  1V0Z A;  4YW2 A;  4Q6K A;  1B9V A;  2HT8 A;  2H2U A;  4NCS A;  4WA4 A;  1L7G A;  4YZ3 A;  4D8S A;  1MZ5 A;  4YZ1 A;  2HT5 A;  3CKZ A;  4GZQ A;  4MWX A;  4CPL A;  2HTY A;  2QWJ A;  3TIA A;  2X9M A;  1N1V A;  4X4A A;  4GJT A;  2VW0 A;  2BER A;  1NCA N;  2AH2 A;  1NSD A;  3T1E A;  2VSK A;  1Z4X A;  1F8E A;  2ZB5 A;  4XJ9 A;  1N1Y A;  1A4G A;  1S0J A;  3TI6 A;  1INW A;  2W5N A;  4FVK A;  4FOW A;  1W21 A;  1W8N A;  4H52 A;  4MWU A;  4M4U A;  4FQ4 A;  4K1K A;  4FPF A;  3GVL A;  3A71 A;  2HTV A;  2VVZ A;  4FPL A;  1NCC N;  2HTQ A;  2YDT A;  4GZP A;  3SIL A;  2FHR A;  2QWG A;  3GVK A;  4XHX A;  5HX0 A;  4FPC A;  2BF6 A;  2QWE A;  1DIL A;  1NNA A;  1WCS A;  4MWQ A;  4GZW A;  1W20 A;  2ZB6 A;  2JKB A;  2F26 A;  2QWH A;  1NMA N;  4MWW A;  1Z4W A;  4FPK A;  1V3C A;  4WA3 A;  1NMC A;  3A72 A;  4XIO A;  4CPY A;  4NC5 A;  4FPJ A;  2XZK A;  2VSM A;  1MS9 A;  4MZE A;  4YZ2 A;  1MS4 A;  1W1X A;  2BAT A;  2AGS A;  2HTW A;  4XYX A;  2F29 A;  4FPG A;  1S18 A;  1NCB N;  4XJA A;  3TIB A;  4UF7 A;  7NN9 A;  3OPZ A;  1V3D A;  1SLI A;  4JF7 A;  4MC7 A;  3TI4 A;  4FP2 A;  2W5O A;  2VW1 A;  5NN9 A;  2HU0 A;  5B2C A;  4I00 A;  4KS3 A;  3TIC A;  3B7E A;  1W0P A;  2F25 A;  3K39 A;  3NN9 A;  4B7Q A;  4H53 A;  4M4V A;  1INV A;  1WCQ A;  4KS5 A;  1USR A;  1F8C A;  4MZA A;  2F12 A;  5HUG A;  4J9T A;  4HIZ A;  4FOY A;  4QN6 A;  3H6J A;  1E8U A;  4QN3 A;  4WEF A;  3BEQ A;  2YA7 A;  4HZV A;  1EUR A;  2A75 A;  4XIL A;  2QWK A;  2F28 A;  2XZJ A;  1Z4Z A;  2HU4 A;  1KIT A;  4XJQ A;  4HZZ A;  1MWE A;  2W20 A;  4XHB A;  4B7N A;  1INH A;  1F8D A;  4HZW A;  6NN9 A;  1SO7 A;  4MWV A;  4GZT A;  4XOG A;  2F10 A;  4B7J A;  1N1T A;  1INX A;  1NCD N;  4QN5 A;  4XJR A;  2VK6 A;  3CL2 A;  1A14 N;  1S0I A;  1F8B A;  2AEP A;  4MWR A;  4FJ6 A;  2F27 A;  4FPO B;  4B7R A;  3W09 A;  4MJU A;  3H72 A;  4SLI A;  3CYE A;  4GEZ A;  1NSB A;  5HUN A;  3K38 A;  4M3M A;  1V0F A;  5HUM A;  4GB1 A;  3TI8 A;  2VW2 A;  4XMI A;  1IVD A;  1NNC A;  4FZH A;  4NN9 A;  4XJ8 A;  4MWL A;  4XMA A;  1W8O A;  3ALW A;  3K3A A;  4MWY A;  1L7H A;  1Z4V A;  4KS4 A;  3NSS A;  2HTU A;  4CPM A;  4YW1 A;  2QWC A;  3ALX A;  4M4N A;  4MX0 A;  1IVB A;  2QWA A;  4XJU A;  2C4L A;  5F9T A;  1INF A;  4K1J A;  4XJZ A;  2RKC A;  2B8H A;  1VCU A;  1E8V A;  3CL0 A;  2QWI A;  2XCY A;  4YW3 A;  1VCJ A;  1V3E A;  1USX A;  4BBW A;  4KS2 A;  4MWJ A;  4X49 A;  1IVE A;  4QN7 A;  4K1H A;  4X47 A;  4YZ4 A;  1Z4Y A;  4K3Y A;  4GDI A;  5M1Z A;  2QWD A;  1N1S A;  3O9K A;  2H2N A;  1V3B A;  1Z50 A;  3B69 A;  4FPY A;  2XZI A;  1SNT A;  3O9J A;  1S1D A;  2F11 A;  4QN4 A;  4K1I A;  4DGR A;  4FOV A;  2YA5 A;  2QWB A;  2F0Z A;  3GVJ A;  1NSC A;  5HUK A;  2BZD A;  3SLI A;  3TI3 A;  4CPN A;  4KS1 A;  4GZO A;  5B2D A;  1MZ6 A;  2HTR A;  2SIM A;  3H71 A;  1NNB A;  3D11 A;  2VK5 A;  2YA8 A;  1IVC A;  1MS0 A;  3INB A;  2F13 A;  4HZY A;  1NN2 A;  1W0O A;  4HZX A;  1MS1 A;  2AEQ A;  2VWD A;  1NMB N;  4X6K A;  1B9S A;  4MJV A;  3K37 A;  4B7M A;  4WA5 A;  4GDJ A;  1XOG A;  3SAL A;  1BJI A;  3D12 A;  1MS8 A;  4YW4 A;  2SIL A;  3H73 A;  2W38 A;  1EUS A;  4YW5 A;  3SAN A;  1V2I A;  1EUT A;  2SLI A;  3JU4 A;  2CML A;  4FPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...