3TIWA

Crystal structure of p97n in complex with the c-terminus of gp78
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
160
Chain Sequence
RPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title The Structural and Functional Basis of the p97/Valosin-containing Protein (VCP)-interacting Motif (VIM): MUTUALLY EXCLUSIVE BINDING OF COFACTORS TO THE N-TERMINAL DOMAIN OF p97.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/ligase
total genus 45
structure length 160
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3tiwA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3tiwA02
1CZ4A 1Q16A 1G8JA 2KI8A 3OUGA 1PQHA 4GA6A 1KQGA 3GTJA 2NYAA 1TWGA 4KLNA 1K83A 2EEOB 1SFOA 3TM7B 4KODA 1SIWA 2V45A 4AONB 2NVYA 4RV0A 5B6CA 4KO8A 4KDLA 2E2IA 3HU2A 2JIRA 2JIQA 4KDIA 3FKIA 3O5AA 2DMRA 1E5VA 2JV2A 3IR7A 2Y0SA 3IR6A 1Y5IA 1AA6A 3GTKA 4CRYG 2YU9A 3PLXB 2JA5A 4QIWA 5FTMA 2VPWA 4AAYA 5FTJA 2VUMA 2R92A 1E32A 1EU1A 1PYUB 3QQ7A 3TIWA 3GTPA 2IV2X 1VC3B 1UHDA 1R27A 5FTLA 2E2HA 1E18A 1TMOA 5C1BA 2YUJA 1TWHA 1QDNA 5GLFA 5C18A 3CF2A 3GTQA 2JA7A 2VPXA 1R9TA 1AW8B 1DMRA 5T5ID 1FDIA 2JA6A 3QC8A 1Y1WA 4CS0A 2VPYA 3DMRA 5T5MD 5EPPA 1FDOA 1TWCA 4CRZA 2JIOA 2PMZA 3CQZA 1PQFA 2PJHB 2VPZA 1PT1A 1PT0A 5DYIA 1E61A 3QWZA 1PQEA 1I50A 2R7ZA 3HU3A 1S3SA 3ML1A 1TWAA 4D7ZB 3GTGA 1H5NA 1Y1VA 2WB1A 3IR5A 4C2MA 2B63A 3QQ8A 3GTOA 1KQFA 1R7RA 1UHEA 1Y4ZA 1PYQA 3HKZA 2E7ZA 1G8KA 1PPYA 4GA5A 3HU1A 4AOKB 1DMSA 2NVXA 3GTLA 1WLFA 2R93A 2JIMA 1OGYA 3H0GA 2V3VA 2JIPA 4AYBA 1I3QA 5FTKA 1ZC1A 3GTMA 1QCSA 1CZ5A 1WCMA 4DMRA 1E60A 1IW7D 1CR5A 5DYGA 2NAPA 1H0HA 1YLEA 2WAQA 2C45A 5FTNA 1TWFA 4AZDA
chains in the Genus database with same CATH superfamily
1CZ4A 2PWYA 1Q16A 1G8JA 4AVRA 2KI8A 3ZJUA 1OA7A 1PQHA 1HD5A 3OUGA 4GA6A 2NYAA 1KQGA 3GTJA 5EQJB 1TWGA 4KLNA 1K83A 5D6YA 4FFTA 2A6HD 2EEOB 1ZYRD 1SFOA 3TM7B 4KODA 1SIWA 2V45A 4AONB 3X2OA 1N10A 2Q1CX 5GLYA 4ARCA 2G5DA 2NVYA 4RV0A 2HCZX 4KDLA 4KO8A 3HU2A 2JIRA 5B6CA 1OA9A 2JIQA 2E2IA 2B25A 4JCWA 4KDIA 4NOHA 3FKIA 3O5AA 2DMRA 1E5VA 1BW4A 2JV2A 4L48A 3FPRA 3X2MA 3IR7A 4FG2A 3ZJTA 2Y0SA 3SUKA 2Q18X 3X2IA 4FERA 3IR6A 1Y5IA 1AA6A 2YVLA 3GTKA 4CRYG 2YU9A 4ZM7A 3PLXB 2JA5A 2PICA 4QIWA 2LW6A 2O5JD 1YNJD 4UC4A 1L8FA 5FTMA 2VPWA 4AAYA 5FTJA 5D6WA 2VUMA 2R92A 2KQAA 3SULA 2A68D 1E32A 1EU1A 1PYUB 3QQ7A 3TIWA 3GTPA 2IV2X 1VC3B 2Q1AX 1UHDA 1R27A 5FTLA 2E2HA 1E18A 5CD1A 4CQNA 1TMOA 2YUJA 5C1BA 1TWHA 1QDNA 5GLFA 3X2NA 5C18A 1SMYD 2Q19X 2PNWA 2PI8A 2GAEA 3CF2A 3GTQA 2VPXA 3X2KA 1R9TA 2JA7A 2Q1DX 1AW8B 1DMRA 4JJOA 5T5ID 3X2JA 1FDIA 2JA6A 2QQRA 3QC8A 1Y1WA 4CS0A 2VPYA 3DMRA 5T5MD 2GFAA 5EPPA 1FDOA 3CZBA 1TWCA 2A6ED 3X2PA 1O54A 2KY9A 5ERGB 5GM9A 2G6GA 4CRZA 2JIOA 2PMZA 4JP6A 3CQZA 3SUJA 4AS1A 1PQFA 1YNND 2QQSA 2PJHB 2VPZA 5D6XA 1PT1A 3MB5A 1PT0A 2MM2A 5DYIA 3M3GA 2XDPA 3SUMA 1E61A 2PJJA 3QWZA 1PQEA 1I50A 2R7ZA 3LGAA 3HU3A 1S3SA 1WC2A 3ML1A 1TWAA 4D7ZB 3GTGA 3D30A 1H5NA 1Y1VA 5CCBA 2WB1A 3IR5A 4C2MA 2B63A 3QQ8A 3GTOA 4ENGA 1KQFA 1R7RA 1UHEA 4FIBA 1Y4ZA 1BW3A 1PYQA 2GF7A 3HKZA 3FPUA 2A69D 2E7ZA 5H4UA 1G8KA 5CCXA 1PPYA 4FG4A 4GA5A 3HU1A 3ENGA 3X2GA 4AOKB 1DMSA 4ARIA 3X2LA 4AQ7A 3LHDA 3FPTA 2ENGA 2MM0A 2NVXA 1I9GA 3GTLA 2AE0X 1WLFA 5GLXA 2JIMA 2R93A 1OGYA 3H0GA 3BQBA 2V3VA 3ZGZA 2CW0D 2JIPA 4AYBA 1I3QA 1ZC1A 5FTKA 3GTMA 1QCSA 2BE5D 1WCMA 4DMRA 1CZ5A 1E60A 3X2HA 1IW7D 1CR5A 5DYGA 2NAPA 4JS7A 4JP7A 1H0HA 1YLEA 2BH0A 2C45A 2WAQA 5FTNA 1TWFA 3ZJVA 4AZDA
chains in the Genus database with same CATH topology
1CZ4A 2PWYA 1Q16A 1G8JA 2KI8A 3ZJUA 3OUGA 1PQHA 4GA6A 1KQGA 3GTJA 2NYAA 5EQJB 1TWGA 4KLNA 1K83A 5D6YA 2A6HD 2EEOB 1ZYRD 1SFOA 3TM7B 4KODA 1SIWA 2V45A 4AONB 2Q1CX 4ARCA 2G5DA 2NVYA 4RV0A 4KO8A 4KDLA 5B6CA 3HU2A 2JIRA 2E2IA 2JIQA 2B25A 4KDIA 4NOHA 3FKIA 3O5AA 2DMRA 1E5VA 2JV2A 3FPRA 3IR7A 3ZJTA 2Y0SA 2Q18X 3IR6A 1Y5IA 1AA6A 2YVLA 3GTKA 4CRYG 2YU9A 2LW6A 3PLXB 2JA5A 2PICA 4QIWA 2O5JD 1YNJD 4UC4A 5FTMA 2VPWA 4AAYA 5FTJA 5D6WA 2VUMA 2R92A 2A68D 1E32A 1EU1A 1PYUB 3QQ7A 3TIWA 3GTPA 2IV2X 1VC3B 2Q1AX 1UHDA 1R27A 5FTLA 2E2HA 1E18A 5CD1A 4CQNA 1TMOA 2YUJA 5C1BA 1TWHA 1QDNA 5GLFA 5C18A 1SMYD 2Q19X 2PNWA 2PI8A 2GAEA 3CF2A 3GTQA 2VPXA 1R9TA 2JA7A 2Q1DX 1AW8B 1DMRA 5T5ID 1FDIA 2JA6A 2QQRA 3QC8A 1Y1WA 4CS0A 2VPYA 3DMRA 5T5MD 2GFAA 5EPPA 1FDOA 3CZBA 1TWCA 2A6ED 1O54A 2KY9A 5ERGB 4CRZA 2G6GA 2JIOA 2PMZA 3CQZA 4AS1A 1PQFA 1YNND 2QQSA 2PJHB 2VPZA 5D6XA 1PT1A 3MB5A 1PT0A 2MM2A 5DYIA 2XDPA 1E61A 2PJJA 3QWZA 1PQEA 1I50A 2R7ZA 3LGAA 3HU3A 1S3SA 3ML1A 1TWAA 4D7ZB 3GTGA 1H5NA 1Y1VA 5CCBA 2WB1A 3IR5A 4C2MA 2B63A 3QQ8A 3GTOA 1KQFA 1R7RA 1UHEA 4FIBA 1Y4ZA 1PYQA 2GF7A 3HKZA 3FPUA 2A69D 2E7ZA 1G8KA 5CCXA 1PPYA 4GA5A 3HU1A 4AOKB 1DMSA 4ARIA 4AQ7A 3LHDA 3FPTA 2MM0A 2NVXA 1I9GA 3GTLA 2AE0X 1WLFA 2R93A 2JIMA 1OGYA 3H0GA 3BQBA 2V3VA 3ZGZA 2CW0D 2JIPA 4AYBA 1I3QA 1ZC1A 5FTKA 3GTMA 1QCSA 2BE5D 1WCMA 4DMRA 1CZ5A 1E60A 1IW7D 1CR5A 5DYGA 2NAPA 3ZJVA 1H0HA 1YLEA 2WAQA 2C45A 5FTNA 1TWFA 4AZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZ4 A;  1Q16 A;  1G8J A;  2KI8 A;  3OUG A;  1PQH A;  4GA6 A;  1KQG A;  3GTJ A;  2NYA A;  1TWG A;  4KLN A;  1K83 A;  2EEO B;  1SFO A;  3TM7 B;  4KOD A;  1SIW A;  2V45 A;  4AON B;  2NVY A;  4RV0 A;  5B6C A;  4KO8 A;  4KDL A;  2E2I A;  3HU2 A;  2JIR A;  2JIQ A;  4KDI A;  3FKI A;  3O5A A;  2DMR A;  1E5V A;  2JV2 A;  3IR7 A;  2Y0S A;  3IR6 A;  1Y5I A;  1AA6 A;  3GTK A;  4CRY G;  2YU9 A;  3PLX B;  2JA5 A;  4QIW A;  5FTM A;  2VPW A;  4AAY A;  5FTJ A;  2VUM A;  2R92 A;  1E32 A;  1EU1 A;  1PYU B;  3QQ7 A;  3TIW A;  3GTP A;  2IV2 X;  1VC3 B;  1UHD A;  1R27 A;  5FTL A;  2E2H A;  1E18 A;  1TMO A;  5C1B A;  2YUJ A;  1TWH A;  1QDN A;  5GLF A;  5C18 A;  3CF2 A;  3GTQ A;  2JA7 A;  2VPX A;  1R9T A;  1AW8 B;  1DMR A;  5T5I D;  1FDI A;  2JA6 A;  3QC8 A;  1Y1W A;  4CS0 A;  2VPY A;  3DMR A;  5T5M D;  5EPP A;  1FDO A;  1TWC A;  4CRZ A;  2JIO A;  2PMZ A;  3CQZ A;  1PQF A;  2PJH B;  2VPZ A;  1PT1 A;  1PT0 A;  5DYI A;  1E61 A;  3QWZ A;  1PQE A;  1I50 A;  2R7Z A;  3HU3 A;  1S3S A;  3ML1 A;  1TWA A;  4D7Z B;  3GTG A;  1H5N A;  1Y1V A;  2WB1 A;  3IR5 A;  4C2M A;  2B63 A;  3QQ8 A;  3GTO A;  1KQF A;  1R7R A;  1UHE A;  1Y4Z A;  1PYQ A;  3HKZ A;  2E7Z A;  1G8K A;  1PPY A;  4GA5 A;  3HU1 A;  4AOK B;  1DMS A;  2NVX A;  3GTL A;  1WLF A;  2R93 A;  2JIM A;  1OGY A;  3H0G A;  2V3V A;  2JIP A;  4AYB A;  1I3Q A;  5FTK A;  1ZC1 A;  3GTM A;  1QCS A;  1CZ5 A;  1WCM A;  4DMR A;  1E60 A;  1IW7 D;  1CR5 A;  5DYG A;  2NAP A;  1H0H A;  1YLE A;  2WAQ A;  2C45 A;  5FTN A;  1TWF A;  4AZD A; 
#chains in the Genus database with same CATH topology
 1CZ4 A;  2PWY A;  1Q16 A;  1G8J A;  4AVR A;  2KI8 A;  3ZJU A;  1OA7 A;  1PQH A;  1HD5 A;  3OUG A;  4GA6 A;  2NYA A;  1KQG A;  3GTJ A;  5EQJ B;  1TWG A;  4KLN A;  1K83 A;  5D6Y A;  4FFT A;  2A6H D;  2EEO B;  1ZYR D;  1SFO A;  3TM7 B;  4KOD A;  1SIW A;  2V45 A;  4AON B;  3X2O A;  1N10 A;  2Q1C X;  5GLY A;  4ARC A;  2G5D A;  2NVY A;  4RV0 A;  2HCZ X;  4KDL A;  4KO8 A;  3HU2 A;  2JIR A;  5B6C A;  1OA9 A;  2JIQ A;  2E2I A;  2B25 A;  4JCW A;  4KDI A;  4NOH A;  3FKI A;  3O5A A;  2DMR A;  1E5V A;  1BW4 A;  2JV2 A;  4L48 A;  3FPR A;  3X2M A;  3IR7 A;  4FG2 A;  3ZJT A;  2Y0S A;  3SUK A;  2Q18 X;  3X2I A;  4FER A;  3IR6 A;  1Y5I A;  1AA6 A;  2YVL A;  3GTK A;  4CRY G;  2YU9 A;  4ZM7 A;  3PLX B;  2JA5 A;  2PIC A;  4QIW A;  2LW6 A;  2O5J D;  1YNJ D;  4UC4 A;  1L8F A;  5FTM A;  2VPW A;  4AAY A;  5FTJ A;  5D6W A;  2VUM A;  2R92 A;  2KQA A;  3SUL A;  2A68 D;  1E32 A;  1EU1 A;  1PYU B;  3QQ7 A;  3TIW A;  3GTP A;  2IV2 X;  1VC3 B;  2Q1A X;  1UHD A;  1R27 A;  5FTL A;  2E2H A;  1E18 A;  5CD1 A;  4CQN A;  1TMO A;  2YUJ A;  5C1B A;  1TWH A;  1QDN A;  5GLF A;  3X2N A;  5C18 A;  1SMY D;  2Q19 X;  2PNW A;  2PI8 A;  2GAE A;  3CF2 A;  3GTQ A;  2VPX A;  3X2K A;  1R9T A;  2JA7 A;  2Q1D X;  1AW8 B;  1DMR A;  4JJO A;  5T5I D;  3X2J A;  1FDI A;  2JA6 A;  2QQR A;  3QC8 A;  1Y1W A;  4CS0 A;  2VPY A;  3DMR A;  5T5M D;  2GFA A;  5EPP A;  1FDO A;  3CZB A;  1TWC A;  2A6E D;  3X2P A;  1O54 A;  2KY9 A;  5ERG B;  5GM9 A;  2G6G A;  4CRZ A;  2JIO A;  2PMZ A;  4JP6 A;  3CQZ A;  3SUJ A;  4AS1 A;  1PQF A;  1YNN D;  2QQS A;  2PJH B;  2VPZ A;  5D6X A;  1PT1 A;  3MB5 A;  1PT0 A;  2MM2 A;  5DYI A;  3M3G A;  2XDP A;  3SUM A;  1E61 A;  2PJJ A;  3QWZ A;  1PQE A;  1I50 A;  2R7Z A;  3LGA A;  3HU3 A;  1S3S A;  1WC2 A;  3ML1 A;  1TWA A;  4D7Z B;  3GTG A;  3D30 A;  1H5N A;  1Y1V A;  5CCB A;  2WB1 A;  3IR5 A;  4C2M A;  2B63 A;  3QQ8 A;  3GTO A;  4ENG A;  1KQF A;  1R7R A;  1UHE A;  4FIB A;  1Y4Z A;  1BW3 A;  1PYQ A;  2GF7 A;  3HKZ A;  3FPU A;  2A69 D;  2E7Z A;  5H4U A;  1G8K A;  5CCX A;  1PPY A;  4FG4 A;  4GA5 A;  3HU1 A;  3ENG A;  3X2G A;  4AOK B;  1DMS A;  4ARI A;  3X2L A;  4AQ7 A;  3LHD A;  3FPT A;  2ENG A;  2MM0 A;  2NVX A;  1I9G A;  3GTL A;  2AE0 X;  1WLF A;  5GLX A;  2JIM A;  2R93 A;  1OGY A;  3H0G A;  3BQB A;  2V3V A;  3ZGZ A;  2CW0 D;  2JIP A;  4AYB A;  1I3Q A;  1ZC1 A;  5FTK A;  3GTM A;  1QCS A;  2BE5 D;  1WCM A;  4DMR A;  1CZ5 A;  1E60 A;  3X2H A;  1IW7 D;  1CR5 A;  5DYG A;  2NAP A;  4JS7 A;  4JP7 A;  1H0H A;  1YLE A;  2BH0 A;  2C45 A;  2WAQ A;  5FTN A;  1TWF A;  3ZJV A;  4AZD A; 
#chains in the Genus database with same CATH homology
 1CZ4 A;  2PWY A;  1Q16 A;  1G8J A;  2KI8 A;  3ZJU A;  3OUG A;  1PQH A;  4GA6 A;  1KQG A;  3GTJ A;  2NYA A;  5EQJ B;  1TWG A;  4KLN A;  1K83 A;  5D6Y A;  2A6H D;  2EEO B;  1ZYR D;  1SFO A;  3TM7 B;  4KOD A;  1SIW A;  2V45 A;  4AON B;  2Q1C X;  4ARC A;  2G5D A;  2NVY A;  4RV0 A;  4KO8 A;  4KDL A;  5B6C A;  3HU2 A;  2JIR A;  2E2I A;  2JIQ A;  2B25 A;  4KDI A;  4NOH A;  3FKI A;  3O5A A;  2DMR A;  1E5V A;  2JV2 A;  3FPR A;  3IR7 A;  3ZJT A;  2Y0S A;  2Q18 X;  3IR6 A;  1Y5I A;  1AA6 A;  2YVL A;  3GTK A;  4CRY G;  2YU9 A;  2LW6 A;  3PLX B;  2JA5 A;  2PIC A;  4QIW A;  2O5J D;  1YNJ D;  4UC4 A;  5FTM A;  2VPW A;  4AAY A;  5FTJ A;  5D6W A;  2VUM A;  2R92 A;  2A68 D;  1E32 A;  1EU1 A;  1PYU B;  3QQ7 A;  3TIW A;  3GTP A;  2IV2 X;  1VC3 B;  2Q1A X;  1UHD A;  1R27 A;  5FTL A;  2E2H A;  1E18 A;  5CD1 A;  4CQN A;  1TMO A;  2YUJ A;  5C1B A;  1TWH A;  1QDN A;  5GLF A;  5C18 A;  1SMY D;  2Q19 X;  2PNW A;  2PI8 A;  2GAE A;  3CF2 A;  3GTQ A;  2VPX A;  1R9T A;  2JA7 A;  2Q1D X;  1AW8 B;  1DMR A;  5T5I D;  1FDI A;  2JA6 A;  2QQR A;  3QC8 A;  1Y1W A;  4CS0 A;  2VPY A;  3DMR A;  5T5M D;  2GFA A;  5EPP A;  1FDO A;  3CZB A;  1TWC A;  2A6E D;  1O54 A;  2KY9 A;  5ERG B;  4CRZ A;  2G6G A;  2JIO A;  2PMZ A;  3CQZ A;  4AS1 A;  1PQF A;  1YNN D;  2QQS A;  2PJH B;  2VPZ A;  5D6X A;  1PT1 A;  3MB5 A;  1PT0 A;  2MM2 A;  5DYI A;  2XDP A;  1E61 A;  2PJJ A;  3QWZ A;  1PQE A;  1I50 A;  2R7Z A;  3LGA A;  3HU3 A;  1S3S A;  3ML1 A;  1TWA A;  4D7Z B;  3GTG A;  1H5N A;  1Y1V A;  5CCB A;  2WB1 A;  3IR5 A;  4C2M A;  2B63 A;  3QQ8 A;  3GTO A;  1KQF A;  1R7R A;  1UHE A;  4FIB A;  1Y4Z A;  1PYQ A;  2GF7 A;  3HKZ A;  3FPU A;  2A69 D;  2E7Z A;  1G8K A;  5CCX A;  1PPY A;  4GA5 A;  3HU1 A;  4AOK B;  1DMS A;  4ARI A;  4AQ7 A;  3LHD A;  3FPT A;  2MM0 A;  2NVX A;  1I9G A;  3GTL A;  2AE0 X;  1WLF A;  2R93 A;  2JIM A;  1OGY A;  3H0G A;  3BQB A;  2V3V A;  3ZGZ A;  2CW0 D;  2JIP A;  4AYB A;  1I3Q A;  1ZC1 A;  5FTK A;  3GTM A;  1QCS A;  2BE5 D;  1WCM A;  4DMR A;  1CZ5 A;  1E60 A;  1IW7 D;  1CR5 A;  5DYG A;  2NAP A;  3ZJV A;  1H0H A;  1YLE A;  2WAQ A;  2C45 A;  5FTN A;  1TWF A;  4AZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...