3TIWA

Crystal structure of p97n in complex with the c-terminus of gp78
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
160
Chain Sequence
RPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural and Functional Basis of the p97/Valosin-containing Protein (VCP)-interacting Motif (VIM): MUTUALLY EXCLUSIVE BINDING OF COFACTORS TO THE N-TERMINAL DOMAIN OF p97.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/ligase
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 45
structure length 160
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3tiwA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3tiwA02
2VPWA 1CZ4A 2DMRA 4GA6A 1DMSA 2PMZA 4QIWA 3GTMA 4AONB 5FTNA 1OGYA 2NAPA 3IR6A 3H0GA 1PQFA 2PJHB 2R92A 4AYBA 4KDIA 1FDIA 5FTJA 2JIRA 4KO8A 2YU9A 2E7ZA 1WCMA 1AA6A 5FTLA 3IR7A 5DYGA 2V3VA 4AAYA 1TWHA 5DYIA 4DMRA 5EPPA 4CS0A 1WLFA 1E60A 4AOKB 3OUGA 5T5MD 1TWGA 2NVYA 2R93A 1E5VA 2EEOB 3O5AA 2JIOA 2JA7A 2E2IA 2KI8A 2IV2X 4CRZA 1Y1WA 1CR5A 4D7ZB 1CZ5A 2JIMA 1R27A 3CQZA 2WAQA 5C18A 1KQFA 1H0HA 1PPYA 1SIWA 1Y4ZA 1FDOA 1PT0A 3HU2A 2Y0SA 3GTOA 3HU1A 1Q16A 1PYUB 1YLEA 5FTKA 3GTLA 2C45A 1R7RA 4AZDA 2B63A 2JA5A 2YUJA 5T5ID 2JIPA 3HU3A 3ML1A 1Y1VA 2VUMA 1AW8B 4KODA 1PT1A 1SFOA 1TMOA 5FTMA 1I50A 1E61A 1PYQA 1QCSA 1TWAA 1VC3B 3QQ7A 1PQHA 1TWFA 3QWZA 2VPZA 4RV0A 1QDNA 3GTQA 3GTJA 3TM7B 4CRYG 1EU1A 4C2MA 2JA6A 3DMRA 2V45A 1UHDA 3PLXB 1H5NA 1G8KA 2E2HA 1ZC1A 2JIQA 3QQ8A 2NVXA 3FKIA 1DMRA 5GLFA 3GTKA 1S3SA 1IW7D 1G8JA 1TWCA 3TIWA 4KDLA 5C1BA 3CF2A 4GA5A 2NYAA 2JV2A 2R7ZA 3HKZA 1Y5IA 4KLNA 1KQGA 1UHEA 1K83A 1E18A 2VPYA 5B6CA 3GTGA 3GTPA 1I3QA 2VPXA 3IR5A 3QC8A 1PQEA 2WB1A 1R9TA 1E32A
chains in the Genus database with same CATH superfamily
2G5DA 4NOHA 2VPWA 1CZ4A 3ZJVA 3ZGZA 2DMRA 2A6ED 1WC2A 4GA6A 1DMSA 2PMZA 2PI8A 4QIWA 1YNND 3SULA 3GTMA 2GAEA 3LHDA 2PICA 4AONB 5FTNA 1OGYA 2A69D 2NAPA 3IR6A 3H0GA 1PQFA 2PJHB 4JS7A 4AYBA 2R92A 2G6GA 4KDIA 1FDIA 3FPTA 4CQNA 5FTJA 2JIRA 3X2PA 1L8FA 4KO8A 2QQRA 2YU9A 2E7ZA 1WCMA 3D30A 4JCWA 1AA6A 5FTLA 3IR7A 3BQBA 5DYGA 2V3VA 4AAYA 1TWHA 5DYIA 4DMRA 5EPPA 4CS0A 1WLFA 1ZYRD 3ZJTA 1E60A 5EQJB 4AOKB 5ERGB 5CCBA 2MM0A 2YVLA 2Q18X 3ZJUA 3OUGA 5T5MD 1TWGA 2PJJA 2NVYA 2R93A 1E5VA 2Q1AX 4ARCA 2EEOB 1HD5A 2GF7A 1BW3A 3O5AA 2JIOA 2JA7A 5GLXA 4FG4A 5GLYA 4FIBA 2E2IA 2KI8A 4AVRA 2IV2X 4CRZA 1YNJD 1Y1WA 2PWYA 1CR5A 4D7ZB 3X2LA 1CZ5A 2JIMA 1R27A 3CQZA 3X2IA 1O54A 2WAQA 3SUMA 3X2KA 5C18A 1KQFA 2LW6A 2MM2A 1H0HA 1PPYA 1SMYD 3X2HA 1SIWA 1Y4ZA 4JP7A 1FDOA 2A68D 1PT0A 3HU2A 2Y0SA 4JP6A 3GTOA 3HU1A 2O5JD 3X2NA 1Q16A 4FERA 1PYUB 1YLEA 5FTKA 3GTLA 2C45A 1R7RA 4AZDA 2B63A 2BE5D 3SUKA 2JA5A 2YUJA 5T5ID 2JIPA 2BH0A 3HU3A 4AS1A 3ML1A 1BW4A 1Y1VA 1I9GA 2Q19X 2VUMA 1AW8B 2ENGA 1PT1A 4KODA 1SFOA 1TMOA 5FTMA 1I50A 1E61A 1PYQA 1QCSA 1TWAA 5D6YA 3X2MA 1VC3B 5D6XA 1OA9A 4L48A 2KY9A 5GM9A 3QQ7A 5H4UA 2KQAA 1PQHA 1TWFA 3QWZA 2VPZA 4RV0A 1QDNA 3FPUA 3GTQA 3ENGA 3GTJA 3SUJA 3TM7B 4CRYG 1EU1A 4C2MA 2CW0D 2JA6A 2V45A 3DMRA 2A6HD 1UHDA 2XDPA 3PLXB 1H5NA 1G8KA 3FPRA 1OA7A 3M3GA 1N10A 4ENGA 2E2HA 2QQSA 5CCXA 1ZC1A 2JIQA 3QQ8A 2NVXA 3MB5A 3FKIA 1DMRA 2HCZX 5GLFA 3GTKA 1S3SA 2Q1DX 1IW7D 4UC4A 1G8JA 1TWCA 3TIWA 4KDLA 5C1BA 3CF2A 4GA5A 2NYAA 5CD1A 2AE0X 2JV2A 2R7ZA 3HKZA 4AQ7A 5D6WA 1Y5IA 4KLNA 2B25A 1KQGA 1UHEA 4ZM7A 1K83A 1E18A 4ARIA 2VPYA 3X2GA 5B6CA 3X2OA 3GTGA 3GTPA 1I3QA 2VPXA 3IR5A 3QC8A 4JJOA 3LGAA 3CZBA 1PQEA 2WB1A 4FFTA 1R9TA 2Q1CX 2PNWA 3X2JA 2GFAA 1E32A 4FG2A
chains in the Genus database with same CATH topology
2G5DA 4NOHA 2VPWA 1CZ4A 3ZJVA 3ZGZA 2DMRA 2A6ED 4GA6A 1DMSA 2PMZA 2PI8A 4QIWA 1YNND 3GTMA 2GAEA 3LHDA 2PICA 4AONB 5FTNA 1OGYA 2A69D 2NAPA 3IR6A 3H0GA 1PQFA 2PJHB 2R92A 4AYBA 3FPTA 2G6GA 4KDIA 1FDIA 4CQNA 5FTJA 2JIRA 4KO8A 2QQRA 2YU9A 2E7ZA 1WCMA 3BQBA 1AA6A 5FTLA 3IR7A 5DYGA 2V3VA 4AAYA 1TWHA 5DYIA 4DMRA 5EPPA 4CS0A 1WLFA 1ZYRD 3ZJTA 1E60A 5EQJB 4AOKB 5ERGB 5CCBA 2MM0A 2YVLA 2Q18X 3ZJUA 3OUGA 5T5MD 1TWGA 2PJJA 2NVYA 2R93A 1E5VA 2Q1AX 4ARCA 2EEOB 2GF7A 3O5AA 2JIOA 2JA7A 4FIBA 2E2IA 2KI8A 2IV2X 4CRZA 1YNJD 1Y1WA 2PWYA 1CR5A 4D7ZB 1CZ5A 2JIMA 1R27A 3CQZA 1O54A 2WAQA 5C18A 1KQFA 2LW6A 2MM2A 1H0HA 1PPYA 1SMYD 1SIWA 1Y4ZA 1FDOA 2A68D 1PT0A 3HU2A 2Y0SA 3GTOA 3HU1A 2O5JD 1Q16A 1PYUB 1YLEA 5FTKA 3GTLA 2C45A 1R7RA 4AZDA 2B63A 2BE5D 2JA5A 2YUJA 5T5ID 2JIPA 3HU3A 4AS1A 3ML1A 1Y1VA 1I9GA 2Q19X 2VUMA 1AW8B 4KODA 1PT1A 1SFOA 1TMOA 5FTMA 1I50A 1E61A 1PYQA 1QCSA 1TWAA 5D6YA 1VC3B 5D6XA 2KY9A 3QQ7A 1PQHA 1TWFA 3QWZA 2VPZA 4RV0A 1QDNA 3FPUA 3GTQA 3GTJA 3TM7B 4CRYG 1EU1A 4C2MA 2CW0D 2JA6A 2V45A 3DMRA 2A6HD 1UHDA 2XDPA 3PLXB 1H5NA 1G8KA 3FPRA 2E2HA 2QQSA 5CCXA 1ZC1A 2JIQA 3QQ8A 2NVXA 3MB5A 3FKIA 1DMRA 5GLFA 3GTKA 1S3SA 2Q1DX 1IW7D 4UC4A 1G8JA 1TWCA 3TIWA 4KDLA 5C1BA 3CF2A 4GA5A 2NYAA 5CD1A 2AE0X 2JV2A 2R7ZA 3HKZA 4AQ7A 5D6WA 1Y5IA 4KLNA 2B25A 1KQGA 1UHEA 1K83A 1E18A 4ARIA 2VPYA 5B6CA 3GTGA 3GTPA 1I3QA 2VPXA 3IR5A 3QC8A 3LGAA 3CZBA 1PQEA 2WB1A 1R9TA 2Q1CX 2PNWA 2GFAA 1E32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VPW A;  1CZ4 A;  2DMR A;  4GA6 A;  1DMS A;  2PMZ A;  4QIW A;  3GTM A;  4AON B;  5FTN A;  1OGY A;  2NAP A;  3IR6 A;  3H0G A;  1PQF A;  2PJH B;  2R92 A;  4AYB A;  4KDI A;  1FDI A;  5FTJ A;  2JIR A;  4KO8 A;  2YU9 A;  2E7Z A;  1WCM A;  1AA6 A;  5FTL A;  3IR7 A;  5DYG A;  2V3V A;  4AAY A;  1TWH A;  5DYI A;  4DMR A;  5EPP A;  4CS0 A;  1WLF A;  1E60 A;  4AOK B;  3OUG A;  5T5M D;  1TWG A;  2NVY A;  2R93 A;  1E5V A;  2EEO B;  3O5A A;  2JIO A;  2JA7 A;  2E2I A;  2KI8 A;  2IV2 X;  4CRZ A;  1Y1W A;  1CR5 A;  4D7Z B;  1CZ5 A;  2JIM A;  1R27 A;  3CQZ A;  2WAQ A;  5C18 A;  1KQF A;  1H0H A;  1PPY A;  1SIW A;  1Y4Z A;  1FDO A;  1PT0 A;  3HU2 A;  2Y0S A;  3GTO A;  3HU1 A;  1Q16 A;  1PYU B;  1YLE A;  5FTK A;  3GTL A;  2C45 A;  1R7R A;  4AZD A;  2B63 A;  2JA5 A;  2YUJ A;  5T5I D;  2JIP A;  3HU3 A;  3ML1 A;  1Y1V A;  2VUM A;  1AW8 B;  4KOD A;  1PT1 A;  1SFO A;  1TMO A;  5FTM A;  1I50 A;  1E61 A;  1PYQ A;  1QCS A;  1TWA A;  1VC3 B;  3QQ7 A;  1PQH A;  1TWF A;  3QWZ A;  2VPZ A;  4RV0 A;  1QDN A;  3GTQ A;  3GTJ A;  3TM7 B;  4CRY G;  1EU1 A;  4C2M A;  2JA6 A;  3DMR A;  2V45 A;  1UHD A;  3PLX B;  1H5N A;  1G8K A;  2E2H A;  1ZC1 A;  2JIQ A;  3QQ8 A;  2NVX A;  3FKI A;  1DMR A;  5GLF A;  3GTK A;  1S3S A;  1IW7 D;  1G8J A;  1TWC A;  3TIW A;  4KDL A;  5C1B A;  3CF2 A;  4GA5 A;  2NYA A;  2JV2 A;  2R7Z A;  3HKZ A;  1Y5I A;  4KLN A;  1KQG A;  1UHE A;  1K83 A;  1E18 A;  2VPY A;  5B6C A;  3GTG A;  3GTP A;  1I3Q A;  2VPX A;  3IR5 A;  3QC8 A;  1PQE A;  2WB1 A;  1R9T A;  1E32 A; 
#chains in the Genus database with same CATH topology
 2G5D A;  4NOH A;  2VPW A;  1CZ4 A;  3ZJV A;  3ZGZ A;  2DMR A;  2A6E D;  1WC2 A;  4GA6 A;  1DMS A;  2PMZ A;  2PI8 A;  4QIW A;  1YNN D;  3SUL A;  3GTM A;  2GAE A;  3LHD A;  2PIC A;  4AON B;  5FTN A;  1OGY A;  2A69 D;  2NAP A;  3IR6 A;  3H0G A;  1PQF A;  2PJH B;  4JS7 A;  4AYB A;  2R92 A;  2G6G A;  4KDI A;  1FDI A;  3FPT A;  4CQN A;  5FTJ A;  2JIR A;  3X2P A;  1L8F A;  4KO8 A;  2QQR A;  2YU9 A;  2E7Z A;  1WCM A;  3D30 A;  4JCW A;  1AA6 A;  5FTL A;  3IR7 A;  3BQB A;  5DYG A;  2V3V A;  4AAY A;  1TWH A;  5DYI A;  4DMR A;  5EPP A;  4CS0 A;  1WLF A;  1ZYR D;  3ZJT A;  1E60 A;  5EQJ B;  4AOK B;  5ERG B;  5CCB A;  2MM0 A;  2YVL A;  2Q18 X;  3ZJU A;  3OUG A;  5T5M D;  1TWG A;  2PJJ A;  2NVY A;  2R93 A;  1E5V A;  2Q1A X;  4ARC A;  2EEO B;  1HD5 A;  2GF7 A;  1BW3 A;  3O5A A;  2JIO A;  2JA7 A;  5GLX A;  4FG4 A;  5GLY A;  4FIB A;  2E2I A;  2KI8 A;  4AVR A;  2IV2 X;  4CRZ A;  1YNJ D;  1Y1W A;  2PWY A;  1CR5 A;  4D7Z B;  3X2L A;  1CZ5 A;  2JIM A;  1R27 A;  3CQZ A;  3X2I A;  1O54 A;  2WAQ A;  3SUM A;  3X2K A;  5C18 A;  1KQF A;  2LW6 A;  2MM2 A;  1H0H A;  1PPY A;  1SMY D;  3X2H A;  1SIW A;  1Y4Z A;  4JP7 A;  1FDO A;  2A68 D;  1PT0 A;  3HU2 A;  2Y0S A;  4JP6 A;  3GTO A;  3HU1 A;  2O5J D;  3X2N A;  1Q16 A;  4FER A;  1PYU B;  1YLE A;  5FTK A;  3GTL A;  2C45 A;  1R7R A;  4AZD A;  2B63 A;  2BE5 D;  3SUK A;  2JA5 A;  2YUJ A;  5T5I D;  2JIP A;  2BH0 A;  3HU3 A;  4AS1 A;  3ML1 A;  1BW4 A;  1Y1V A;  1I9G A;  2Q19 X;  2VUM A;  1AW8 B;  2ENG A;  1PT1 A;  4KOD A;  1SFO A;  1TMO A;  5FTM A;  1I50 A;  1E61 A;  1PYQ A;  1QCS A;  1TWA A;  5D6Y A;  3X2M A;  1VC3 B;  5D6X A;  1OA9 A;  4L48 A;  2KY9 A;  5GM9 A;  3QQ7 A;  5H4U A;  2KQA A;  1PQH A;  1TWF A;  3QWZ A;  2VPZ A;  4RV0 A;  1QDN A;  3FPU A;  3GTQ A;  3ENG A;  3GTJ A;  3SUJ A;  3TM7 B;  4CRY G;  1EU1 A;  4C2M A;  2CW0 D;  2JA6 A;  2V45 A;  3DMR A;  2A6H D;  1UHD A;  2XDP A;  3PLX B;  1H5N A;  1G8K A;  3FPR A;  1OA7 A;  3M3G A;  1N10 A;  4ENG A;  2E2H A;  2QQS A;  5CCX A;  1ZC1 A;  2JIQ A;  3QQ8 A;  2NVX A;  3MB5 A;  3FKI A;  1DMR A;  2HCZ X;  5GLF A;  3GTK A;  1S3S A;  2Q1D X;  1IW7 D;  4UC4 A;  1G8J A;  1TWC A;  3TIW A;  4KDL A;  5C1B A;  3CF2 A;  4GA5 A;  2NYA A;  5CD1 A;  2AE0 X;  2JV2 A;  2R7Z A;  3HKZ A;  4AQ7 A;  5D6W A;  1Y5I A;  4KLN A;  2B25 A;  1KQG A;  1UHE A;  4ZM7 A;  1K83 A;  1E18 A;  4ARI A;  2VPY A;  3X2G A;  5B6C A;  3X2O A;  3GTG A;  3GTP A;  1I3Q A;  2VPX A;  3IR5 A;  3QC8 A;  4JJO A;  3LGA A;  3CZB A;  1PQE A;  2WB1 A;  4FFT A;  1R9T A;  2Q1C X;  2PNW A;  3X2J A;  2GFA A;  1E32 A;  4FG2 A; 
#chains in the Genus database with same CATH homology
 2G5D A;  4NOH A;  2VPW A;  1CZ4 A;  3ZJV A;  3ZGZ A;  2DMR A;  2A6E D;  4GA6 A;  1DMS A;  2PMZ A;  2PI8 A;  4QIW A;  1YNN D;  3GTM A;  2GAE A;  3LHD A;  2PIC A;  4AON B;  5FTN A;  1OGY A;  2A69 D;  2NAP A;  3IR6 A;  3H0G A;  1PQF A;  2PJH B;  2R92 A;  4AYB A;  3FPT A;  2G6G A;  4KDI A;  1FDI A;  4CQN A;  5FTJ A;  2JIR A;  4KO8 A;  2QQR A;  2YU9 A;  2E7Z A;  1WCM A;  3BQB A;  1AA6 A;  5FTL A;  3IR7 A;  5DYG A;  2V3V A;  4AAY A;  1TWH A;  5DYI A;  4DMR A;  5EPP A;  4CS0 A;  1WLF A;  1ZYR D;  3ZJT A;  1E60 A;  5EQJ B;  4AOK B;  5ERG B;  5CCB A;  2MM0 A;  2YVL A;  2Q18 X;  3ZJU A;  3OUG A;  5T5M D;  1TWG A;  2PJJ A;  2NVY A;  2R93 A;  1E5V A;  2Q1A X;  4ARC A;  2EEO B;  2GF7 A;  3O5A A;  2JIO A;  2JA7 A;  4FIB A;  2E2I A;  2KI8 A;  2IV2 X;  4CRZ A;  1YNJ D;  1Y1W A;  2PWY A;  1CR5 A;  4D7Z B;  1CZ5 A;  2JIM A;  1R27 A;  3CQZ A;  1O54 A;  2WAQ A;  5C18 A;  1KQF A;  2LW6 A;  2MM2 A;  1H0H A;  1PPY A;  1SMY D;  1SIW A;  1Y4Z A;  1FDO A;  2A68 D;  1PT0 A;  3HU2 A;  2Y0S A;  3GTO A;  3HU1 A;  2O5J D;  1Q16 A;  1PYU B;  1YLE A;  5FTK A;  3GTL A;  2C45 A;  1R7R A;  4AZD A;  2B63 A;  2BE5 D;  2JA5 A;  2YUJ A;  5T5I D;  2JIP A;  3HU3 A;  4AS1 A;  3ML1 A;  1Y1V A;  1I9G A;  2Q19 X;  2VUM A;  1AW8 B;  4KOD A;  1PT1 A;  1SFO A;  1TMO A;  5FTM A;  1I50 A;  1E61 A;  1PYQ A;  1QCS A;  1TWA A;  5D6Y A;  1VC3 B;  5D6X A;  2KY9 A;  3QQ7 A;  1PQH A;  1TWF A;  3QWZ A;  2VPZ A;  4RV0 A;  1QDN A;  3FPU A;  3GTQ A;  3GTJ A;  3TM7 B;  4CRY G;  1EU1 A;  4C2M A;  2CW0 D;  2JA6 A;  2V45 A;  3DMR A;  2A6H D;  1UHD A;  2XDP A;  3PLX B;  1H5N A;  1G8K A;  3FPR A;  2E2H A;  2QQS A;  5CCX A;  1ZC1 A;  2JIQ A;  3QQ8 A;  2NVX A;  3MB5 A;  3FKI A;  1DMR A;  5GLF A;  3GTK A;  1S3S A;  2Q1D X;  1IW7 D;  4UC4 A;  1G8J A;  1TWC A;  3TIW A;  4KDL A;  5C1B A;  3CF2 A;  4GA5 A;  2NYA A;  5CD1 A;  2AE0 X;  2JV2 A;  2R7Z A;  3HKZ A;  4AQ7 A;  5D6W A;  1Y5I A;  4KLN A;  2B25 A;  1KQG A;  1UHE A;  1K83 A;  1E18 A;  4ARI A;  2VPY A;  5B6C A;  3GTG A;  3GTP A;  1I3Q A;  2VPX A;  3IR5 A;  3QC8 A;  3LGA A;  3CZB A;  1PQE A;  2WB1 A;  1R9T A;  2Q1C X;  2PNW A;  2GFA A;  1E32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...