3TIWA

Crystal structure of p97n in complex with the c-terminus of gp78
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
160
Chain Sequence
RPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural and Functional Basis of the p97/Valosin-containing Protein (VCP)-interacting Motif (VIM): MUTUALLY EXCLUSIVE BINDING OF COFACTORS TO THE N-TERMINAL DOMAIN OF p97.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/ligase
molecule keywords Transitional endoplasmic reticulum ATPase
total genus 45
structure length 160
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3tiwA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3tiwA02
1SIWA 1TMOA 1CZ5A 2NVXA 2JIQA 4KDIA 1G8KA 2R93A 2JA7A 1DMRA 2V3VA 1E18A 5EPPA 1E60A 1E61A 1PQFA 2E2IA 2R7ZA 4KDLA 1OGYA 1QCSA 3H0GA 1CZ4A 3ML1A 1TWAA 3HU1A 1Y4ZA 1TWCA 4GA5A 3HKZA 1Q16A 3QQ7A 4AONB 1QDNA 1SFOA 2NVYA 1PQHA 1R27A 2YU9A 3QC8A 3GTLA 4AZDA 2E2HA 4KODA 1G8JA 2VPZA 2V45A 5C1BA 1WCMA 1EU1A 1Y1WA 2C45A 1H5NA 5FTLA 2NAPA 1ZC1A 3IR7A 5DYIA 3IR6A 4QIWA 3HU3A 2JIOA 1R7RA 2DMRA 5T5ID 2PMZA 1PT1A 4DMRA 1KQFA 1TWFA 2R92A 1TWHA 4KLNA 4CRYG 4D7ZB 1UHDA 2VPWA 1UHEA 2JIPA 2JIRA 3IR5A 2WB1A 5C18A 3FKIA 5DYGA 4KO8A 5FTJA 5FTNA 1E5VA 5GLFA 1PYQA 2JA6A 3GTJA 5B6CA 3GTMA 1K83A 3TIWA 3QWZA 1Y5IA 2PJHB 2EEOB 3GTQA 4AAYA 3CF2A 1FDOA 1IW7D 1R9TA 2KI8A 1I3QA 1I50A 3GTKA 2E7ZA 2VUMA 5FTMA 2IV2X 1H0HA 3GTOA 2JA5A 2JV2A 1DMSA 3HU2A 2VPXA 2Y0SA 1PT0A 3DMRA 1WLFA 2JIMA 3GTPA 1VC3B 3CQZA 3OUGA 5FTKA 4GA6A 4AOKB 3O5AA 1TWGA 1CR5A 3PLXB 1Y1VA 1PPYA 3GTGA 2B63A 1AW8B 4CS0A 3QQ8A 4C2MA 3TM7B 5T5MD 1KQGA 1S3SA 1FDIA 4RV0A 2YUJA 1PQEA 4CRZA 2NYAA 1AA6A 1YLEA 2VPYA 1PYUB 1E32A 4AYBA 2WAQA
chains in the Genus database with same CATH superfamily
2PJJA 1SIWA 1TMOA 4JJOA 2B25A 1CZ5A 2NVXA 2JIQA 4KDIA 3X2LA 3X2MA 1G8KA 2R93A 2JA7A 4AS1A 4UC4A 1DMRA 2V3VA 2Q18X 1E18A 5EPPA 1E60A 1OA9A 2G6GA 3M3GA 1E61A 1HD5A 3X2HA 1PQFA 2E2IA 2R7ZA 4KDLA 1OGYA 1QCSA 3H0GA 1CZ4A 1N10A 3ML1A 3X2NA 1TWAA 2GAEA 3HU1A 2LW6A 1Y4ZA 1TWCA 4GA5A 3X2JA 2QQRA 3HKZA 1Q16A 2AE0X 3QQ7A 4AONB 1QDNA 1SFOA 2NVYA 2A6ED 1PQHA 5D6XA 1R27A 2YU9A 5EQJB 2XDPA 3QC8A 3GTLA 4AZDA 2PI8A 2E2HA 3X2IA 4KODA 1BW4A 1G8JA 2VPZA 2V45A 3SUJA 5C1BA 2GF7A 1YNND 1EU1A 1WCMA 2KQAA 1Y1WA 2C45A 1H5NA 4ARIA 2A6HD 5FTLA 1ZC1A 2NAPA 3ZJTA 4NOHA 5H4UA 3IR7A 2GFAA 5CD1A 4FG2A 5DYIA 5GLXA 3ENGA 3IR6A 4QIWA 1OA7A 3HU3A 2JIOA 1R7RA 2DMRA 5T5ID 2PMZA 1PT1A 4DMRA 1KQFA 1TWFA 2R92A 1TWHA 4KLNA 3ZJVA 2BE5D 4CRYG 4D7ZB 4JP6A 1UHDA 2A68D 3ZJUA 2VPWA 3FPRA 1UHEA 2JIPA 2JIRA 2WB1A 3IR5A 2HCZX 5C18A 2Q19X 4CQNA 3X2GA 3FKIA 5DYGA 4KO8A 5FTJA 5FTNA 2Q1AX 3ZGZA 4JCWA 1E5VA 5GLFA 1PYQA 2JA6A 2MM0A 3GTJA 2QQSA 4L48A 4JP7A 5B6CA 3GTMA 1YNJD 2YVLA 4FG4A 3X2OA 3LGAA 1K83A 3TIWA 3QWZA 1Y5IA 2PJHB 2BH0A 2EEOB 3GTQA 3LHDA 1ZYRD 3CF2A 1FDOA 1IW7D 2CW0D 4AAYA 1R9TA 5D6WA 3SUMA 2KI8A 1I3QA 1I50A 3GTKA 4ZM7A 2E7ZA 2VUMA 3CZBA 5FTMA 1BW3A 5CCXA 2IV2X 4ARCA 2PWYA 1H0HA 1O54A 2Q1DX 4FFTA 3X2KA 2A69D 3GTOA 2JA5A 4AVRA 1DMSA 3HU2A 2O5JD 2JV2A 2VPXA 2MM2A 2Y0SA 4FERA 1PT0A 4JS7A 3DMRA 1WLFA 3SUKA 2JIMA 3GTPA 4AQ7A 2Q1CX 5ERGB 1VC3B 3CQZA 3OUGA 5FTKA 2PNWA 2G5DA 5GM9A 5GLYA 5D6YA 4GA6A 4AOKB 3O5AA 3D30A 1TWGA 1CR5A 3BQBA 3MB5A 3PLXB 4ENGA 1Y1VA 1PPYA 3GTGA 2PICA 2B63A 5CCBA 1AW8B 4CS0A 3X2PA 1L8FA 3FPTA 3SULA 2ENGA 3QQ8A 4FIBA 1WC2A 1I9GA 4C2MA 3TM7B 5T5MD 1KQGA 3FPUA 1S3SA 1FDIA 4RV0A 2KY9A 2YUJA 1PQEA 4CRZA 2NYAA 1AA6A 1YLEA 2VPYA 1PYUB 1SMYD 1E32A 4AYBA 2WAQA
chains in the Genus database with same CATH topology
2PJJA 1SIWA 1TMOA 2B25A 1CZ5A 2NVXA 2JIQA 4KDIA 1G8KA 2R93A 2JA7A 4AS1A 4UC4A 1DMRA 2V3VA 2Q18X 1E18A 5EPPA 1E60A 2G6GA 1E61A 1PQFA 2E2IA 2R7ZA 4KDLA 1OGYA 1QCSA 3H0GA 1CZ4A 3ML1A 1TWAA 2GAEA 3HU1A 2LW6A 1Y4ZA 1TWCA 4GA5A 2QQRA 3HKZA 1Q16A 2AE0X 3QQ7A 4AONB 1QDNA 1SFOA 2NVYA 2A6ED 1PQHA 5D6XA 1R27A 2YU9A 5EQJB 2XDPA 3QC8A 3GTLA 4AZDA 2PI8A 2E2HA 4KODA 1G8JA 2VPZA 2V45A 5C1BA 2GF7A 1YNND 1EU1A 1WCMA 1Y1WA 2C45A 1H5NA 4ARIA 2A6HD 5FTLA 1ZC1A 2NAPA 3ZJTA 4NOHA 3IR7A 2GFAA 5CD1A 5DYIA 3IR6A 4QIWA 3HU3A 2JIOA 1R7RA 2DMRA 5T5ID 2PMZA 1PT1A 4DMRA 1KQFA 1TWFA 2R92A 1TWHA 4KLNA 3ZJVA 2BE5D 4CRYG 4D7ZB 3ZJUA 1UHDA 2A68D 2VPWA 3FPRA 1UHEA 2JIPA 2JIRA 2WB1A 3IR5A 5C18A 2Q19X 4CQNA 3FKIA 5DYGA 4KO8A 5FTJA 5FTNA 2Q1AX 3ZGZA 1E5VA 5GLFA 1PYQA 2JA6A 2MM0A 3GTJA 2QQSA 5B6CA 3GTMA 1YNJD 2YVLA 3LGAA 1K83A 3TIWA 3QWZA 1Y5IA 2PJHB 2EEOB 3GTQA 3LHDA 1ZYRD 3CF2A 1FDOA 1IW7D 2CW0D 4AAYA 1R9TA 5D6WA 2KI8A 1I3QA 1I50A 3GTKA 2E7ZA 2VUMA 3CZBA 5FTMA 5CCXA 2IV2X 4ARCA 2PWYA 1H0HA 1O54A 2Q1DX 2A69D 3GTOA 2JA5A 2JV2A 1DMSA 3HU2A 2O5JD 2MM2A 2VPXA 2Y0SA 1PT0A 3DMRA 1WLFA 2JIMA 3GTPA 4AQ7A 2Q1CX 5ERGB 1VC3B 3CQZA 3OUGA 5FTKA 2PNWA 2G5DA 5D6YA 4GA6A 4AOKB 3O5AA 1TWGA 1CR5A 3BQBA 3MB5A 3PLXB 1Y1VA 1PPYA 3GTGA 2PICA 2B63A 5CCBA 1AW8B 4CS0A 3FPTA 3QQ8A 4FIBA 1I9GA 4C2MA 3TM7B 5T5MD 1KQGA 3FPUA 1S3SA 1FDIA 4RV0A 2KY9A 2YUJA 1PQEA 4CRZA 2NYAA 1AA6A 1YLEA 2VPYA 1PYUB 1SMYD 1E32A 4AYBA 2WAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SIW A;  1TMO A;  1CZ5 A;  2NVX A;  2JIQ A;  4KDI A;  1G8K A;  2R93 A;  2JA7 A;  1DMR A;  2V3V A;  1E18 A;  5EPP A;  1E60 A;  1E61 A;  1PQF A;  2E2I A;  2R7Z A;  4KDL A;  1OGY A;  1QCS A;  3H0G A;  1CZ4 A;  3ML1 A;  1TWA A;  3HU1 A;  1Y4Z A;  1TWC A;  4GA5 A;  3HKZ A;  1Q16 A;  3QQ7 A;  4AON B;  1QDN A;  1SFO A;  2NVY A;  1PQH A;  1R27 A;  2YU9 A;  3QC8 A;  3GTL A;  4AZD A;  2E2H A;  4KOD A;  1G8J A;  2VPZ A;  2V45 A;  5C1B A;  1WCM A;  1EU1 A;  1Y1W A;  2C45 A;  1H5N A;  5FTL A;  2NAP A;  1ZC1 A;  3IR7 A;  5DYI A;  3IR6 A;  4QIW A;  3HU3 A;  2JIO A;  1R7R A;  2DMR A;  5T5I D;  2PMZ A;  1PT1 A;  4DMR A;  1KQF A;  1TWF A;  2R92 A;  1TWH A;  4KLN A;  4CRY G;  4D7Z B;  1UHD A;  2VPW A;  1UHE A;  2JIP A;  2JIR A;  3IR5 A;  2WB1 A;  5C18 A;  3FKI A;  5DYG A;  4KO8 A;  5FTJ A;  5FTN A;  1E5V A;  5GLF A;  1PYQ A;  2JA6 A;  3GTJ A;  5B6C A;  3GTM A;  1K83 A;  3TIW A;  3QWZ A;  1Y5I A;  2PJH B;  2EEO B;  3GTQ A;  4AAY A;  3CF2 A;  1FDO A;  1IW7 D;  1R9T A;  2KI8 A;  1I3Q A;  1I50 A;  3GTK A;  2E7Z A;  2VUM A;  5FTM A;  2IV2 X;  1H0H A;  3GTO A;  2JA5 A;  2JV2 A;  1DMS A;  3HU2 A;  2VPX A;  2Y0S A;  1PT0 A;  3DMR A;  1WLF A;  2JIM A;  3GTP A;  1VC3 B;  3CQZ A;  3OUG A;  5FTK A;  4GA6 A;  4AOK B;  3O5A A;  1TWG A;  1CR5 A;  3PLX B;  1Y1V A;  1PPY A;  3GTG A;  2B63 A;  1AW8 B;  4CS0 A;  3QQ8 A;  4C2M A;  3TM7 B;  5T5M D;  1KQG A;  1S3S A;  1FDI A;  4RV0 A;  2YUJ A;  1PQE A;  4CRZ A;  2NYA A;  1AA6 A;  1YLE A;  2VPY A;  1PYU B;  1E32 A;  4AYB A;  2WAQ A; 
#chains in the Genus database with same CATH topology
 2PJJ A;  1SIW A;  1TMO A;  4JJO A;  2B25 A;  1CZ5 A;  2NVX A;  2JIQ A;  4KDI A;  3X2L A;  3X2M A;  1G8K A;  2R93 A;  2JA7 A;  4AS1 A;  4UC4 A;  1DMR A;  2V3V A;  2Q18 X;  1E18 A;  5EPP A;  1E60 A;  1OA9 A;  2G6G A;  3M3G A;  1E61 A;  1HD5 A;  3X2H A;  1PQF A;  2E2I A;  2R7Z A;  4KDL A;  1OGY A;  1QCS A;  3H0G A;  1CZ4 A;  1N10 A;  3ML1 A;  3X2N A;  1TWA A;  2GAE A;  3HU1 A;  2LW6 A;  1Y4Z A;  1TWC A;  4GA5 A;  3X2J A;  2QQR A;  3HKZ A;  1Q16 A;  2AE0 X;  3QQ7 A;  4AON B;  1QDN A;  1SFO A;  2NVY A;  2A6E D;  1PQH A;  5D6X A;  1R27 A;  2YU9 A;  5EQJ B;  2XDP A;  3QC8 A;  3GTL A;  4AZD A;  2PI8 A;  2E2H A;  3X2I A;  4KOD A;  1BW4 A;  1G8J A;  2VPZ A;  2V45 A;  3SUJ A;  5C1B A;  2GF7 A;  1YNN D;  1EU1 A;  1WCM A;  2KQA A;  1Y1W A;  2C45 A;  1H5N A;  4ARI A;  2A6H D;  5FTL A;  1ZC1 A;  2NAP A;  3ZJT A;  4NOH A;  5H4U A;  3IR7 A;  2GFA A;  5CD1 A;  4FG2 A;  5DYI A;  5GLX A;  3ENG A;  3IR6 A;  4QIW A;  1OA7 A;  3HU3 A;  2JIO A;  1R7R A;  2DMR A;  5T5I D;  2PMZ A;  1PT1 A;  4DMR A;  1KQF A;  1TWF A;  2R92 A;  1TWH A;  4KLN A;  3ZJV A;  2BE5 D;  4CRY G;  4D7Z B;  4JP6 A;  1UHD A;  2A68 D;  3ZJU A;  2VPW A;  3FPR A;  1UHE A;  2JIP A;  2JIR A;  2WB1 A;  3IR5 A;  2HCZ X;  5C18 A;  2Q19 X;  4CQN A;  3X2G A;  3FKI A;  5DYG A;  4KO8 A;  5FTJ A;  5FTN A;  2Q1A X;  3ZGZ A;  4JCW A;  1E5V A;  5GLF A;  1PYQ A;  2JA6 A;  2MM0 A;  3GTJ A;  2QQS A;  4L48 A;  4JP7 A;  5B6C A;  3GTM A;  1YNJ D;  2YVL A;  4FG4 A;  3X2O A;  3LGA A;  1K83 A;  3TIW A;  3QWZ A;  1Y5I A;  2PJH B;  2BH0 A;  2EEO B;  3GTQ A;  3LHD A;  1ZYR D;  3CF2 A;  1FDO A;  1IW7 D;  2CW0 D;  4AAY A;  1R9T A;  5D6W A;  3SUM A;  2KI8 A;  1I3Q A;  1I50 A;  3GTK A;  4ZM7 A;  2E7Z A;  2VUM A;  3CZB A;  5FTM A;  1BW3 A;  5CCX A;  2IV2 X;  4ARC A;  2PWY A;  1H0H A;  1O54 A;  2Q1D X;  4FFT A;  3X2K A;  2A69 D;  3GTO A;  2JA5 A;  4AVR A;  1DMS A;  3HU2 A;  2O5J D;  2JV2 A;  2VPX A;  2MM2 A;  2Y0S A;  4FER A;  1PT0 A;  4JS7 A;  3DMR A;  1WLF A;  3SUK A;  2JIM A;  3GTP A;  4AQ7 A;  2Q1C X;  5ERG B;  1VC3 B;  3CQZ A;  3OUG A;  5FTK A;  2PNW A;  2G5D A;  5GM9 A;  5GLY A;  5D6Y A;  4GA6 A;  4AOK B;  3O5A A;  3D30 A;  1TWG A;  1CR5 A;  3BQB A;  3MB5 A;  3PLX B;  4ENG A;  1Y1V A;  1PPY A;  3GTG A;  2PIC A;  2B63 A;  5CCB A;  1AW8 B;  4CS0 A;  3X2P A;  1L8F A;  3FPT A;  3SUL A;  2ENG A;  3QQ8 A;  4FIB A;  1WC2 A;  1I9G A;  4C2M A;  3TM7 B;  5T5M D;  1KQG A;  3FPU A;  1S3S A;  1FDI A;  4RV0 A;  2KY9 A;  2YUJ A;  1PQE A;  4CRZ A;  2NYA A;  1AA6 A;  1YLE A;  2VPY A;  1PYU B;  1SMY D;  1E32 A;  4AYB A;  2WAQ A; 
#chains in the Genus database with same CATH homology
 2PJJ A;  1SIW A;  1TMO A;  2B25 A;  1CZ5 A;  2NVX A;  2JIQ A;  4KDI A;  1G8K A;  2R93 A;  2JA7 A;  4AS1 A;  4UC4 A;  1DMR A;  2V3V A;  2Q18 X;  1E18 A;  5EPP A;  1E60 A;  2G6G A;  1E61 A;  1PQF A;  2E2I A;  2R7Z A;  4KDL A;  1OGY A;  1QCS A;  3H0G A;  1CZ4 A;  3ML1 A;  1TWA A;  2GAE A;  3HU1 A;  2LW6 A;  1Y4Z A;  1TWC A;  4GA5 A;  2QQR A;  3HKZ A;  1Q16 A;  2AE0 X;  3QQ7 A;  4AON B;  1QDN A;  1SFO A;  2NVY A;  2A6E D;  1PQH A;  5D6X A;  1R27 A;  2YU9 A;  5EQJ B;  2XDP A;  3QC8 A;  3GTL A;  4AZD A;  2PI8 A;  2E2H A;  4KOD A;  1G8J A;  2VPZ A;  2V45 A;  5C1B A;  2GF7 A;  1YNN D;  1EU1 A;  1WCM A;  1Y1W A;  2C45 A;  1H5N A;  4ARI A;  2A6H D;  5FTL A;  1ZC1 A;  2NAP A;  3ZJT A;  4NOH A;  3IR7 A;  2GFA A;  5CD1 A;  5DYI A;  3IR6 A;  4QIW A;  3HU3 A;  2JIO A;  1R7R A;  2DMR A;  5T5I D;  2PMZ A;  1PT1 A;  4DMR A;  1KQF A;  1TWF A;  2R92 A;  1TWH A;  4KLN A;  3ZJV A;  2BE5 D;  4CRY G;  4D7Z B;  3ZJU A;  1UHD A;  2A68 D;  2VPW A;  3FPR A;  1UHE A;  2JIP A;  2JIR A;  2WB1 A;  3IR5 A;  5C18 A;  2Q19 X;  4CQN A;  3FKI A;  5DYG A;  4KO8 A;  5FTJ A;  5FTN A;  2Q1A X;  3ZGZ A;  1E5V A;  5GLF A;  1PYQ A;  2JA6 A;  2MM0 A;  3GTJ A;  2QQS A;  5B6C A;  3GTM A;  1YNJ D;  2YVL A;  3LGA A;  1K83 A;  3TIW A;  3QWZ A;  1Y5I A;  2PJH B;  2EEO B;  3GTQ A;  3LHD A;  1ZYR D;  3CF2 A;  1FDO A;  1IW7 D;  2CW0 D;  4AAY A;  1R9T A;  5D6W A;  2KI8 A;  1I3Q A;  1I50 A;  3GTK A;  2E7Z A;  2VUM A;  3CZB A;  5FTM A;  5CCX A;  2IV2 X;  4ARC A;  2PWY A;  1H0H A;  1O54 A;  2Q1D X;  2A69 D;  3GTO A;  2JA5 A;  2JV2 A;  1DMS A;  3HU2 A;  2O5J D;  2MM2 A;  2VPX A;  2Y0S A;  1PT0 A;  3DMR A;  1WLF A;  2JIM A;  3GTP A;  4AQ7 A;  2Q1C X;  5ERG B;  1VC3 B;  3CQZ A;  3OUG A;  5FTK A;  2PNW A;  2G5D A;  5D6Y A;  4GA6 A;  4AOK B;  3O5A A;  1TWG A;  1CR5 A;  3BQB A;  3MB5 A;  3PLX B;  1Y1V A;  1PPY A;  3GTG A;  2PIC A;  2B63 A;  5CCB A;  1AW8 B;  4CS0 A;  3FPT A;  3QQ8 A;  4FIB A;  1I9G A;  4C2M A;  3TM7 B;  5T5M D;  1KQG A;  3FPU A;  1S3S A;  1FDI A;  4RV0 A;  2KY9 A;  2YUJ A;  1PQE A;  4CRZ A;  2NYA A;  1AA6 A;  1YLE A;  2VPY A;  1PYU B;  1SMY D;  1E32 A;  4AYB A;  2WAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...