3TIWA

Crystal structure of p97n in complex with the c-terminus of gp78
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
165
structure length
160
Chain Sequence
RPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transitional endoplasmic reticulum ATPase
publication title The Structural and Functional Basis of the p97/Valosin-containing Protein (VCP)-interacting Motif (VIM): MUTUALLY EXCLUSIVE BINDING OF COFACTORS TO THE N-TERMINAL DOMAIN OF p97.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/ligase
total genus 45
structure length 160
sequence length 165
chains with identical sequence B
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2011-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02359 CDC48_N Cell division protein 48 (CDC48), N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 3tiwA01
3.10.330.10 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 3tiwA02
1QCSA 2JIQA 4KDIA 5C18A 1PT0A 4RV0A 1VC3B 1I3QA 2JIRA 2PMZA 4DMRA 1S3SA 1E61A 3GTPA 5EPPA 3TIWA 3IR7A 2JA7A 3QC8A 5FTNA 1R9TA 5T5MD 1H5NA 1WLFA 3GTGA 5B6CA 3HKZA 3DMRA 1FDIA 3GTOA 2B63A 4C2MA 3GTQA 1TWFA 2VPZA 3QQ8A 1TWHA 1CZ5A 2WB1A 1IW7D 1PT1A 3HU2A 1E5VA 3HU3A 1CR5A 4KO8A 1TMOA 1R27A 4KODA 2KI8A 2YUJA 1PYQA 3OUGA 4KDLA 2JA6A 2JIMA 2IV2X 5T5ID 2VPWA 3HU1A 2C45A 1DMRA 1Y5IA 4GA6A 2YU9A 3CF2A 1G8KA 3ML1A 5FTKA 1PPYA 1UHDA 1Y4ZA 2NAPA 4AAYA 2R7ZA 4AZDA 2E2IA 1SIWA 1Y1VA 1TWGA 5DYIA 2E7ZA 1EU1A 2JA5A 1SFOA 2R92A 2E2HA 2EEOB 5FTLA 4CRYG 1OGYA 3O5AA 1R7RA 4CS0A 3GTKA 3PLXB 5FTMA 2DMRA 1CZ4A 3TM7B 3H0GA 2NVXA 1PQFA 3QQ7A 1Y1WA 3IR5A 3IR6A 4D7ZB 1I50A 1ZC1A 2V3VA 1G8JA 3GTLA 4AYBA 5C1BA 4CRZA 1DMSA 1YLEA 1E32A 1TWAA 2V45A 4QIWA 1FDOA 1WCMA 3GTJA 3CQZA 3QWZA 2NVYA 2JV2A 5DYGA 5FTJA 1PQHA 1AA6A 2PJHB 1KQGA 4KLNA 1Q16A 2VUMA 2NYAA 1KQFA 1E60A 1PYUB 2JIPA 4AOKB 1AW8B 1QDNA 5GLFA 2WAQA 2R93A 3FKIA 1PQEA 1K83A 2VPYA 2VPXA 1E18A 4AONB 1TWCA 2JIOA 4GA5A 1H0HA 3GTMA 2Y0SA 1UHEA
chains in the Genus database with same CATH superfamily
1QCSA 2JIQA 5D6XA 4KDIA 5C18A 1PT0A 2PNWA 4RV0A 4FG2A 4ARIA 1VC3B 1I3QA 2JIRA 3FPTA 2PMZA 4DMRA 1S3SA 1E61A 3GTPA 5EPPA 3TIWA 3IR7A 3X2IA 1BW4A 2JA7A 2HCZX 3QC8A 3X2HA 3LGAA 5FTNA 1R9TA 5T5MD 1H5NA 1WLFA 3GTGA 5B6CA 3HKZA 4NOHA 3DMRA 1FDIA 2PI8A 3GTOA 4C2MA 3GTQA 2B63A 1TWFA 3CZBA 2VPZA 2KQAA 1N10A 1TWHA 3QQ8A 2LW6A 4FIBA 1CZ5A 2WB1A 1IW7D 3X2NA 1PT1A 2PICA 3HU2A 1E5VA 3SUJA 3HU3A 5EQJB 1CR5A 4KO8A 3ZJUA 1TMOA 1R27A 4KODA 2KI8A 2A68D 2YUJA 3X2PA 4FG4A 2BH0A 1PYQA 3OUGA 4KDLA 2JA6A 4UC4A 2JIMA 2IV2X 5T5ID 2VPWA 3HU1A 1SMYD 2C45A 1DMRA 1Y5IA 4GA6A 2QQSA 2GFAA 2YU9A 4AS1A 2MM2A 2PJJA 2CW0D 3CF2A 4CQNA 3ZJTA 5GLXA 2Q18X 1G8KA 1YNJD 4L48A 2MM0A 2GF7A 3ENGA 4ZM7A 3ML1A 1OA9A 5FTKA 1PPYA 1UHDA 4ENGA 1Y4ZA 2NAPA 3SUKA 2G5DA 4AAYA 2R7ZA 3FPRA 2GAEA 3X2GA 2O5JD 5D6WA 2Q1CX 4AZDA 3ZJVA 3X2MA 2E2IA 1SIWA 1Y1VA 5H4UA 1TWGA 2YVLA 2Q1DX 5DYIA 2E7ZA 2A69D 3D30A 3LHDA 4FFTA 1EU1A 4FERA 2PWYA 2JA5A 1SFOA 4JJOA 5CD1A 2R92A 2E2HA 2EEOB 3SULA 4CRYG 5FTLA 3X2KA 3ZGZA 1OGYA 3O5AA 5GLYA 3FPUA 5CCXA 1R7RA 4CS0A 1I9GA 2XDPA 3GTKA 4ARCA 3PLXB 5FTMA 3BQBA 2G6GA 4AVRA 2Q1AX 2DMRA 1CZ4A 3TM7B 3H0GA 2NVXA 1PQFA 3X2JA 3QQ7A 1Y1WA 3IR5A 3IR6A 4D7ZB 1I50A 1ZC1A 3M3GA 2V3VA 1G8JA 3GTLA 1WC2A 4JCWA 4AYBA 5C1BA 4JP7A 1O54A 4CRZA 1BW3A 2ENGA 1DMSA 1YLEA 1E32A 1TWAA 5ERGB 2V45A 4JP6A 4QIWA 1FDOA 2AE0X 1WCMA 3GTJA 3CQZA 2B25A 2KY9A 5D6YA 2A6ED 3QWZA 2NVYA 2JV2A 4JS7A 5DYGA 5FTJA 1PQHA 1AA6A 5CCBA 2PJHB 1KQGA 4AQ7A 4KLNA 1Q16A 2VUMA 2NYAA 2Q19X 1KQFA 2A6HD 3SUMA 1E60A 2QQRA 1PYUB 1OA7A 3X2LA 3MB5A 2JIPA 4AOKB 1AW8B 1L8FA 1QDNA 5GLFA 2WAQA 2R93A 3FKIA 3X2OA 2BE5D 1PQEA 1H0HA 1K83A 2VPYA 2VPXA 1E18A 4AONB 1TWCA 1ZYRD 2JIOA 1HD5A 5GM9A 4GA5A 1YNND 3GTMA 2Y0SA 1UHEA
chains in the Genus database with same CATH topology
1QCSA 2JIQA 5D6XA 4KDIA 5C18A 1PT0A 2PNWA 4RV0A 4ARIA 1VC3B 1I3QA 2JIRA 3FPTA 2PMZA 4DMRA 1S3SA 1E61A 3GTPA 5EPPA 3TIWA 3IR7A 2XDPA 2JA7A 3QC8A 3LGAA 5FTNA 1R9TA 5T5MD 1H5NA 1WLFA 3GTGA 5B6CA 3HKZA 4NOHA 3DMRA 1FDIA 2PI8A 3GTOA 4C2MA 3GTQA 2B63A 1TWFA 3CZBA 2VPZA 2LW6A 3QQ8A 1TWHA 4FIBA 1CZ5A 2WB1A 1IW7D 1PT1A 2PICA 3HU2A 1E5VA 3HU3A 5EQJB 1CR5A 4KO8A 3ZJUA 1TMOA 1R27A 4KODA 2KI8A 2A68D 2YUJA 1PYQA 3OUGA 4KDLA 2JA6A 4UC4A 2JIMA 2IV2X 5T5ID 2VPWA 3HU1A 1SMYD 2C45A 1DMRA 1Y5IA 4GA6A 2QQSA 2GFAA 2YU9A 4AS1A 2MM2A 2PJJA 2CW0D 3CF2A 4CQNA 3ZJTA 2Q18X 1G8KA 1YNJD 2MM0A 2GF7A 3ML1A 5FTKA 1PPYA 1UHDA 1Y4ZA 2NAPA 2G5DA 4AAYA 2R7ZA 3FPRA 2GAEA 2O5JD 5D6WA 2Q1CX 4AZDA 3ZJVA 2E2IA 1SIWA 1Y1VA 1TWGA 2YVLA 2Q1DX 5DYIA 2E7ZA 2A69D 3LHDA 1EU1A 2PWYA 2JA5A 1SFOA 5CD1A 2R92A 2E2HA 2EEOB 5FTLA 4CRYG 3ZGZA 1OGYA 3O5AA 3FPUA 5CCXA 1R7RA 4CS0A 1I9GA 3GTKA 4ARCA 3PLXB 5FTMA 3BQBA 2G6GA 2Q1AX 2DMRA 1CZ4A 3TM7B 3H0GA 2NVXA 1PQFA 3QQ7A 1Y1WA 3IR5A 3IR6A 4D7ZB 1I50A 1ZC1A 2V3VA 1G8JA 3GTLA 4AYBA 5C1BA 1O54A 4CRZA 1DMSA 1YLEA 1E32A 1TWAA 5ERGB 2V45A 4QIWA 1FDOA 2AE0X 1WCMA 3GTJA 3CQZA 2B25A 2KY9A 5D6YA 2A6ED 3QWZA 2NVYA 2JV2A 5DYGA 5FTJA 1PQHA 1AA6A 5CCBA 2PJHB 1KQGA 4AQ7A 4KLNA 1Q16A 2VUMA 2NYAA 2Q19X 1KQFA 2A6HD 1E60A 2QQRA 1PYUB 3MB5A 2JIPA 4AOKB 1AW8B 1QDNA 5GLFA 2WAQA 2R93A 3FKIA 2BE5D 1PQEA 1H0HA 1K83A 2VPYA 2VPXA 1E18A 4AONB 1TWCA 1ZYRD 2JIOA 4GA5A 1YNND 3GTMA 2Y0SA 1UHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCS A;  2JIQ A;  4KDI A;  5C18 A;  1PT0 A;  4RV0 A;  1VC3 B;  1I3Q A;  2JIR A;  2PMZ A;  4DMR A;  1S3S A;  1E61 A;  3GTP A;  5EPP A;  3TIW A;  3IR7 A;  2JA7 A;  3QC8 A;  5FTN A;  1R9T A;  5T5M D;  1H5N A;  1WLF A;  3GTG A;  5B6C A;  3HKZ A;  3DMR A;  1FDI A;  3GTO A;  2B63 A;  4C2M A;  3GTQ A;  1TWF A;  2VPZ A;  3QQ8 A;  1TWH A;  1CZ5 A;  2WB1 A;  1IW7 D;  1PT1 A;  3HU2 A;  1E5V A;  3HU3 A;  1CR5 A;  4KO8 A;  1TMO A;  1R27 A;  4KOD A;  2KI8 A;  2YUJ A;  1PYQ A;  3OUG A;  4KDL A;  2JA6 A;  2JIM A;  2IV2 X;  5T5I D;  2VPW A;  3HU1 A;  2C45 A;  1DMR A;  1Y5I A;  4GA6 A;  2YU9 A;  3CF2 A;  1G8K A;  3ML1 A;  5FTK A;  1PPY A;  1UHD A;  1Y4Z A;  2NAP A;  4AAY A;  2R7Z A;  4AZD A;  2E2I A;  1SIW A;  1Y1V A;  1TWG A;  5DYI A;  2E7Z A;  1EU1 A;  2JA5 A;  1SFO A;  2R92 A;  2E2H A;  2EEO B;  5FTL A;  4CRY G;  1OGY A;  3O5A A;  1R7R A;  4CS0 A;  3GTK A;  3PLX B;  5FTM A;  2DMR A;  1CZ4 A;  3TM7 B;  3H0G A;  2NVX A;  1PQF A;  3QQ7 A;  1Y1W A;  3IR5 A;  3IR6 A;  4D7Z B;  1I50 A;  1ZC1 A;  2V3V A;  1G8J A;  3GTL A;  4AYB A;  5C1B A;  4CRZ A;  1DMS A;  1YLE A;  1E32 A;  1TWA A;  2V45 A;  4QIW A;  1FDO A;  1WCM A;  3GTJ A;  3CQZ A;  3QWZ A;  2NVY A;  2JV2 A;  5DYG A;  5FTJ A;  1PQH A;  1AA6 A;  2PJH B;  1KQG A;  4KLN A;  1Q16 A;  2VUM A;  2NYA A;  1KQF A;  1E60 A;  1PYU B;  2JIP A;  4AOK B;  1AW8 B;  1QDN A;  5GLF A;  2WAQ A;  2R93 A;  3FKI A;  1PQE A;  1K83 A;  2VPY A;  2VPX A;  1E18 A;  4AON B;  1TWC A;  2JIO A;  4GA5 A;  1H0H A;  3GTM A;  2Y0S A;  1UHE A; 
#chains in the Genus database with same CATH topology
 1QCS A;  2JIQ A;  5D6X A;  4KDI A;  5C18 A;  1PT0 A;  2PNW A;  4RV0 A;  4FG2 A;  4ARI A;  1VC3 B;  1I3Q A;  2JIR A;  3FPT A;  2PMZ A;  4DMR A;  1S3S A;  1E61 A;  3GTP A;  5EPP A;  3TIW A;  3IR7 A;  3X2I A;  1BW4 A;  2JA7 A;  2HCZ X;  3QC8 A;  3X2H A;  3LGA A;  5FTN A;  1R9T A;  5T5M D;  1H5N A;  1WLF A;  3GTG A;  5B6C A;  3HKZ A;  4NOH A;  3DMR A;  1FDI A;  2PI8 A;  3GTO A;  4C2M A;  3GTQ A;  2B63 A;  1TWF A;  3CZB A;  2VPZ A;  2KQA A;  1N10 A;  1TWH A;  3QQ8 A;  2LW6 A;  4FIB A;  1CZ5 A;  2WB1 A;  1IW7 D;  3X2N A;  1PT1 A;  2PIC A;  3HU2 A;  1E5V A;  3SUJ A;  3HU3 A;  5EQJ B;  1CR5 A;  4KO8 A;  3ZJU A;  1TMO A;  1R27 A;  4KOD A;  2KI8 A;  2A68 D;  2YUJ A;  3X2P A;  4FG4 A;  2BH0 A;  1PYQ A;  3OUG A;  4KDL A;  2JA6 A;  4UC4 A;  2JIM A;  2IV2 X;  5T5I D;  2VPW A;  3HU1 A;  1SMY D;  2C45 A;  1DMR A;  1Y5I A;  4GA6 A;  2QQS A;  2GFA A;  2YU9 A;  4AS1 A;  2MM2 A;  2PJJ A;  2CW0 D;  3CF2 A;  4CQN A;  3ZJT A;  5GLX A;  2Q18 X;  1G8K A;  1YNJ D;  4L48 A;  2MM0 A;  2GF7 A;  3ENG A;  4ZM7 A;  3ML1 A;  1OA9 A;  5FTK A;  1PPY A;  1UHD A;  4ENG A;  1Y4Z A;  2NAP A;  3SUK A;  2G5D A;  4AAY A;  2R7Z A;  3FPR A;  2GAE A;  3X2G A;  2O5J D;  5D6W A;  2Q1C X;  4AZD A;  3ZJV A;  3X2M A;  2E2I A;  1SIW A;  1Y1V A;  5H4U A;  1TWG A;  2YVL A;  2Q1D X;  5DYI A;  2E7Z A;  2A69 D;  3D30 A;  3LHD A;  4FFT A;  1EU1 A;  4FER A;  2PWY A;  2JA5 A;  1SFO A;  4JJO A;  5CD1 A;  2R92 A;  2E2H A;  2EEO B;  3SUL A;  4CRY G;  5FTL A;  3X2K A;  3ZGZ A;  1OGY A;  3O5A A;  5GLY A;  3FPU A;  5CCX A;  1R7R A;  4CS0 A;  1I9G A;  2XDP A;  3GTK A;  4ARC A;  3PLX B;  5FTM A;  3BQB A;  2G6G A;  4AVR A;  2Q1A X;  2DMR A;  1CZ4 A;  3TM7 B;  3H0G A;  2NVX A;  1PQF A;  3X2J A;  3QQ7 A;  1Y1W A;  3IR5 A;  3IR6 A;  4D7Z B;  1I50 A;  1ZC1 A;  3M3G A;  2V3V A;  1G8J A;  3GTL A;  1WC2 A;  4JCW A;  4AYB A;  5C1B A;  4JP7 A;  1O54 A;  4CRZ A;  1BW3 A;  2ENG A;  1DMS A;  1YLE A;  1E32 A;  1TWA A;  5ERG B;  2V45 A;  4JP6 A;  4QIW A;  1FDO A;  2AE0 X;  1WCM A;  3GTJ A;  3CQZ A;  2B25 A;  2KY9 A;  5D6Y A;  2A6E D;  3QWZ A;  2NVY A;  2JV2 A;  4JS7 A;  5DYG A;  5FTJ A;  1PQH A;  1AA6 A;  5CCB A;  2PJH B;  1KQG A;  4AQ7 A;  4KLN A;  1Q16 A;  2VUM A;  2NYA A;  2Q19 X;  1KQF A;  2A6H D;  3SUM A;  1E60 A;  2QQR A;  1PYU B;  1OA7 A;  3X2L A;  3MB5 A;  2JIP A;  4AOK B;  1AW8 B;  1L8F A;  1QDN A;  5GLF A;  2WAQ A;  2R93 A;  3FKI A;  3X2O A;  2BE5 D;  1PQE A;  1H0H A;  1K83 A;  2VPY A;  2VPX A;  1E18 A;  4AON B;  1TWC A;  1ZYR D;  2JIO A;  1HD5 A;  5GM9 A;  4GA5 A;  1YNN D;  3GTM A;  2Y0S A;  1UHE A; 
#chains in the Genus database with same CATH homology
 1QCS A;  2JIQ A;  5D6X A;  4KDI A;  5C18 A;  1PT0 A;  2PNW A;  4RV0 A;  4ARI A;  1VC3 B;  1I3Q A;  2JIR A;  3FPT A;  2PMZ A;  4DMR A;  1S3S A;  1E61 A;  3GTP A;  5EPP A;  3TIW A;  3IR7 A;  2XDP A;  2JA7 A;  3QC8 A;  3LGA A;  5FTN A;  1R9T A;  5T5M D;  1H5N A;  1WLF A;  3GTG A;  5B6C A;  3HKZ A;  4NOH A;  3DMR A;  1FDI A;  2PI8 A;  3GTO A;  4C2M A;  3GTQ A;  2B63 A;  1TWF A;  3CZB A;  2VPZ A;  2LW6 A;  3QQ8 A;  1TWH A;  4FIB A;  1CZ5 A;  2WB1 A;  1IW7 D;  1PT1 A;  2PIC A;  3HU2 A;  1E5V A;  3HU3 A;  5EQJ B;  1CR5 A;  4KO8 A;  3ZJU A;  1TMO A;  1R27 A;  4KOD A;  2KI8 A;  2A68 D;  2YUJ A;  1PYQ A;  3OUG A;  4KDL A;  2JA6 A;  4UC4 A;  2JIM A;  2IV2 X;  5T5I D;  2VPW A;  3HU1 A;  1SMY D;  2C45 A;  1DMR A;  1Y5I A;  4GA6 A;  2QQS A;  2GFA A;  2YU9 A;  4AS1 A;  2MM2 A;  2PJJ A;  2CW0 D;  3CF2 A;  4CQN A;  3ZJT A;  2Q18 X;  1G8K A;  1YNJ D;  2MM0 A;  2GF7 A;  3ML1 A;  5FTK A;  1PPY A;  1UHD A;  1Y4Z A;  2NAP A;  2G5D A;  4AAY A;  2R7Z A;  3FPR A;  2GAE A;  2O5J D;  5D6W A;  2Q1C X;  4AZD A;  3ZJV A;  2E2I A;  1SIW A;  1Y1V A;  1TWG A;  2YVL A;  2Q1D X;  5DYI A;  2E7Z A;  2A69 D;  3LHD A;  1EU1 A;  2PWY A;  2JA5 A;  1SFO A;  5CD1 A;  2R92 A;  2E2H A;  2EEO B;  5FTL A;  4CRY G;  3ZGZ A;  1OGY A;  3O5A A;  3FPU A;  5CCX A;  1R7R A;  4CS0 A;  1I9G A;  3GTK A;  4ARC A;  3PLX B;  5FTM A;  3BQB A;  2G6G A;  2Q1A X;  2DMR A;  1CZ4 A;  3TM7 B;  3H0G A;  2NVX A;  1PQF A;  3QQ7 A;  1Y1W A;  3IR5 A;  3IR6 A;  4D7Z B;  1I50 A;  1ZC1 A;  2V3V A;  1G8J A;  3GTL A;  4AYB A;  5C1B A;  1O54 A;  4CRZ A;  1DMS A;  1YLE A;  1E32 A;  1TWA A;  5ERG B;  2V45 A;  4QIW A;  1FDO A;  2AE0 X;  1WCM A;  3GTJ A;  3CQZ A;  2B25 A;  2KY9 A;  5D6Y A;  2A6E D;  3QWZ A;  2NVY A;  2JV2 A;  5DYG A;  5FTJ A;  1PQH A;  1AA6 A;  5CCB A;  2PJH B;  1KQG A;  4AQ7 A;  4KLN A;  1Q16 A;  2VUM A;  2NYA A;  2Q19 X;  1KQF A;  2A6H D;  1E60 A;  2QQR A;  1PYU B;  3MB5 A;  2JIP A;  4AOK B;  1AW8 B;  1QDN A;  5GLF A;  2WAQ A;  2R93 A;  3FKI A;  2BE5 D;  1PQE A;  1H0H A;  1K83 A;  2VPY A;  2VPX A;  1E18 A;  4AON B;  1TWC A;  1ZYR D;  2JIO A;  4GA5 A;  1YNN D;  3GTM A;  2Y0S A;  1UHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...