3TJ5A

Human vinculin head domain (vh1, residues 1-258) in complex with the vinculin binding site of the surface cell antigen 4 (sca4-vbs-n; residues 412-434) from rickettsia rickettsii
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
254
structure length
254
Chain Sequence
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title The rickettsia surface cell antigen 4 applies mimicry to bind to and activate vinculin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/toxin
total genus 108
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2011-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3tj5A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3tj5A01
1DOVA 1T01A 5FZTA 5L0GA 3VF0A 4DJ9A 5L0FA 2HSQA 4P9TA 1DOWA 5L0IA 1RKEB 1H6GA 5L0DA 1U89A 2LQGA 1XWJA 3TJ5A 1ZW3A 4E17A 5L0HA 2L7AA 2GDCA 3S90A 1L7CA 5L0CA 3MYIA 1RKCA 1ZVZA 4K1OA 4PR9A 2GWWA 4W8PA 1QKRA 2X0CA 3H2UA 4EHPA 4ONSA 1RKEA 2B0HA 2IBFA 1U6HA 3H2VA 4E18A 3TJ6A 1TR2A 3T6GB 3ZDLA 1ST6A 1SYQA 1ZW2A 5L0JA 1YDIA 4IGGA 3RF3A
chains in the Genus database with same CATH superfamily
5KYXA 3W2VA 1YZCA 3FOPA 1AUEA 1K40A 1Q0FA 4MVRA 1Z7Qc 4E0HA 3HKKA 2EINC 1YAUO 1YYXA 3MLGA 1RKEB 5COGA 3RH3A 4CBEA 4HE8D 4I3MA 4GYTA 5A6JA 3POVA 1UG7A 1O5HA 5BQGA 4BPMA 1C02A 2A6HF 4YT4A 4NTAA 2V26A 1V54C 4FESA 4MVSA 2PX0A 2NSFA 3H2UA 5DS4A 1NG1A 2OEVA 1W2WA 1SF8A 3EFOB 2X51A 3C8ZA 4CS9A 3MFNA 1F1MA 4EUKB 3TQOA 1FR0A 3BRJA 3C8GD 4DOZA 3HNLA 2XLEA 3LNRA 2QY9A 3UNGC 1YJGA 4JCZA 5CI9A 2P1AA 2BE5F 2XLOA 3EH1A 3TD7A 2IYLD 2A6EF 5FZTA 1LS1A 5L0IA 4OIRF 1TWGA 3QTHA 4KC9A 1RJ9A 3BEHA 2KSFA 4MVMA 1SZIA 3F46A 1ZZPA 3FMSA 5JP7A 2G3VA 2R7UA 2Y3HA 2L7AA 4PJLA 4YL3A 2E87A 3S90A 3RKOF 1NU9C 1M56C 4H54A 3ABLC 1M2OA 1V55C 4B6IA 4XPXA 5B3SC 3DE9A 1RKCA 3NYLA 4PR9A 3ZQVA 3DAGA 3T6JA 1OR2A 5KYWB 1VYIA 1WN0A 3JYYA 5DVWA 3GEEA 3LS0A 1Y4CA 4CIPA 2Y69C 2AU5A 1TR2A 4XPWA 3T6GB 3ITFA 3SXKA 2EPOA 3M1CB 3X2QC 1HE9A 4MVUA 4CJOA 5A6BD 2BL2A 3GEHA 1LS4A 3VRCA 2HSBA 5L0GA 1JPJA 3IQCA 2A0BA 3AGUA 3GODA 2XM4A 1G8XA 3JT1A 1Z63A 5DQZA 2F22A 4GEHA 3ZTZA 3EG9B 2UUIA 3N0TA 1PCXA 1JRAA 5E3CA 3LAYA 2G3KA 4EBJA 4MQ9F 3RQFA 2A69F 2J7PA 2XXAA 4X0RA 3ZG1A 3JYHA 4U5DE 4NTFA 2OJQA 4U5FE 5E33A 1A7DA 2L6FA 4DBQA 3RW0A 3LEOA 5L3QA 3HNIA 2WVQA 1M2VB 2KJGA 3K7DA 1ORYA 3H65A 2Q3TA 2LK4A 2R7QA 2I15A 3C8GB 1AVOB 2XLVA 1JPNA 2FFHA 2KK1A 1YLMA 1D0XA 3GANA 5JSLA 3VF0A 2VCBA 4NY3A 4KI2A 4RBNA 4MTGA 1T6IA 5L0FA 2HSQA 4BJTA 1BBHA 4OIOF 1J8YF 1MQVA 4KBLA 1OKKD 2P6VA 2Z15A 2P7VA 3R2PA 4CS7A 4DVZA 4A4AA 3U3FA 3Q7GA 4KNWA 2EPNA 4PFOA 1NU7D 2YEVA 4C3DA 1LM3B 2YLGA 3O6XA 1TWHA 5CI8A 3UMKA 3VYWA 4AX2A 1D1BA 5KYNA 2J45A 1LI7A 2YZSA 3B9QA 3GWLA 1Q0MA 2VH3A 5F5HA 4EIYA 3RQEA 3SXMA 1RKEA 1E85A 4MTOA 4RD9A 3U2LA 4BEMJ 4O6MA 1V74B 2C03A 4Q7CA 2PNOA 3KPHA 1VOMA 3ZC4A 1EA8A 3ZQYA 4RDAA 3GM3A 4DJ9A 4Q4ZF 2HMQA 4A2NB 2PFDA 4N4WA 4F4BA 2R7RA 3UGOA 2LSEA 3LESA 3Q7LA 4J7TA 3L0IA 4JIOA 1T6UA 5CIVA 2IXPA 3O39A 3B29A 4AL1A 3EFOA 2AVKA 4XQ1A 2J8WA 3L1MA 4W8KA 3B71A 1T5OA 4BJ6C 3A11A 3O10A 4IWBA 5COFA 5FCLA 3T4RA 3UMHA 1TWAA 1HE1A 2JX0A 2OCCC 4OD4A 4R32A 1QLEC 3EZIA 5KYUA 4OIQF 2P0NA 3S27A 4YL1A 3EHNA 4EHPA 4Z9HA 4ULWA 3N24A 4U5BE 3CQZA 1U6HA 2CNWD 5DLJA 1D0YA 5E3AA 2VB6A 2UUHA 2YRFA 3EZHA 1A41A 3R7CA 4C3BA 2YL0A 1CGOA 1J8MF 3AG2C 3RVYA 5F28E 4C3EA 3FXHA 1FTSA 4P6IC 3WG7C 5KYWA 1D1CA 4LLCA 4BJ1A 4U9DA 1A7VA 4JCHA 3X1OA 1XWJA 2EPLX 3ABMC 4CX9A 4E17A 3SZRA 4DBRA 5AC5A 4MVZA 4CS8C 1EKYA 2W4BA 2LIGA 1VMAA 4IB4A 3ZSUA 4AE4B 1NBBA 1CGME 4I1OB 3SP1A 2AWCA 3LNMB 3AG3C 2LP4A 5F5FA 1ZYRF 2HV7A 3M4BA 3NG1A 1G4US 3FAPB 2HMZA 3HLZA 3L34A 5D92A 3ZDLA 3EG9A 4BG0A 1QQ3A 4XLPF 4LACB 2LFDA 4GQHA 3C63A 3FVYA 2KQ9A 2KNHA 2ZXWC 3J06A 3NMJA 4JEBA 5BQIA 2YLDA 4J30B 3RVZA 2CYDA 5IY5C 1OXKA 1Q0KA 3SXZA 5KYUB 4YT5A 3U2MA 3L8JA 4ANJA 1BR4A 1WTYA 1M2VA 3IHUA 3TJ5A 3TULA 2B0JA 3HTKC 5B1AC 2HJ3A 1NLXA 2R7SA 3C8GA 3EPVA 2A68F 4J32B 4PACA 2QE9A 2OU6A 3AJMA 4G7OF 1ZHWA 3G4XA 1ZVZA 2OQMA 3ASNC 4H4KC 2R25A 1WWPA 3DZAA 3DWWA 1C03A 2J9BA 2KGOA 1VYKA 2AP3A 2R9RB 4W8PA 3LUTB 4G7ZF 2J9VA 3AQBA 2XLWA 3K66A 1QZXA 3W8HA 4ZLCA 3FAJA 4Z9JA 4K0DA 2Q00A 1BDJB 5L3VA 4Q5SF 2XLHA 1HW2A 3QVZA 3S0XA 4JE9A 4PJMA 4MS2A 1V4AA 3LJBA 2NUTA 1MMDA 4P9FA 2Q9AA 4FX5A 4YWQA 1DOWA 1GQAA 1QSPA 3V5ZA 2FAPB 3IQ5A 2CGEA 2Y3DA 4PJNA 3K1IC 2RD9A 1LVKA 2O9XA 3IEEA 1KU2A 2EIMC 2V3CC 2L6HA 2R7VA 4DRHB 3IQTA 3KL4A 3B0PA 1LKXA 2J9UA 1ORSC 5BUOA 5A6BA 1EQ1A 2YQYA 4NTBA 1OQCA 2QNLA 3G50A 2MWQA 3KMIA 3U8PA 5KYYB 3S84A 2YWAA 3DJNB 3AGTA 1EI7A 3JSEO 2ZD9A 3JRMO 1UFBA 1WATA 5JT4A 5A6AA 1G5ZA 1MMNA 2ZPAA 3KKBA 2H7VC 3LLIA 4IJJA 1ST6A 4WJ0A 5EHHA 3IQ6A 2ICWG 5D91A 1O3UA 2HV6A 2Q9CA 2OJED 2GFHA 4DRIB 1Z3IX 1OCCC 5B3IA 1OW7A 3ASOC 4JZAA 1CPQA 3JRTA 2OG2A 4EWCA 3EGDB 2WZLA 3PCVA 5AGFA 2H7BA 3UR3C 4JTAB 1GM5A 4YL0A 2LQGA 4XEFA 1R4TA 4XTKA 3SXYA 4BJ5C 3AG4C 3G4ZA 1YVIA 4PFPA 4XPYA 5E2QA 4CSAC 1OXBA 2NSGA 2R7OA 2NUTB 3MX3A 4WABA 3O55A 1E83A 4U5CE 1KNYA 2GWWA 4QI0A 1S05A 2W9YA 1U0BB 1SMYF 3SNHA 1OW8A 3TOMA 2IBFA 1OKKA 4MTFA 3V5YA 1JAFA 1M6TA 3RQGA 3US6A 1LIHA 2HKVA 1ZHYA 1GGQA 4LDKA 4OD5A 2BC5A 2CDQA 1MMAA 2DI3A 4YJWA 4N06A 3WHNA 4AE4A 3NRHA 1KTMA 4EKWA 3L8IA 1YA9A 2CCYA 3K6BA 1I5NA 3W2WA 1BR2A 4IRUA 5JVEA 3S29A 3I5QA 1XZPA 1FMWA 3ZIBA 4JTDB 4C7OB 3QW1A 1Z6AA 1LPEA 3KYJA 3F47A 3U3BA 2GA0A 2IXMA 4K1OA 2R05A 1MNDA 4O79A 1QPUA 4O6YA 3U8VA 1ZHTA 2VCAA 3V7OA 4IAOA 1OCOC 1H7IA 2D4UA 2PBEA 3K1HA 4EBKA 5EGYA 4E18A 2NPUA 2XM0A 4K7BA 3E9VA 1K04A 3DI5A 1SYQA 4LERA 1Y6DA 2QLAA 2JPUA 1IW7F 3DE8A 1FAPB 3HJCA 3OEOA 4U9EA 1D0ZA 3WAQA 1ZU4A 3RIPA 4QI2A 2ZXRA 2C04A 2WZGA 4I1MA 5JUAA 1TFOB 3EHMA 1WOLA 2KYHA 2ZXOA 3NMKA 4U5GA 4OINF 1JMWA 3SYNA 2XRHA 4CS9C 3VAYA 2IM8A 1H9GA 2J46A 2ZXPA 1VLSA 1TFKB 2CNWA 4NC3A 2XL4A 2XL8A 3T9OA 2I8BA 1TKNA 2DYRC 3M79A 5BQHA 1JR8A 4DXWA 3UGPA 3LLKA 1VTMP 3MYFA 4O7GA 1GS9A 4IAQA 4WGYA 2WZFA 4CDVA 3DAFA 4U5EE 3QW0A 1VLTA 4YT2A 2M64A 1CGNA 3CZ6A 3K33A 4MVOA 3NKEA 4XEVA 3FOOA 1Z5ZA 4BJ6A 5L0JA 2IXNA 4PJJA 4ZLDA 3DMDA 1LI5A 3ECSA 2XS1A 4E7ZA 2DYSC 4E7SA 4I44A 1ZHXA 2H8AA 4WGZA 1ZHZA 1K05A 2NG1A 3DD7A 4N6HA 2P61A 3VM6A 5L0DA 5KYYA 1Q0DA 3PHF2 3QZCA 3NYMA 2QTVA 4JJGA 3DKAA 3QMKA 2PF4E 5L0HA 1L3PA 1C17M 2PX3A 2WB7A 3EQLF 3KH2A 4D4XA 5JLIA 3B0VC 2HS5A 1LE4A 1FFHA 4Z9IA 3NYJA 3W4YA 3NKDA 5AC4A 2R02A 1E86A 1I4ZA 1OCZC 2H7OA 1Z23A 3AOUA 1MNEA 5COMA 4JJFA 1FFTC 1APCA 2XSEA 2J0XA 4ONSA 1PD0A 3KYIA 4IARA 3U5SA 3EGDA 3TJ6A 3LEVA 2Q4FA 3A9CA 4CS8A 1ZW2A 1ZU5A 2WL8A 4G0HA 1PV3A 4JURI 1ORJA 1CPRA 2YHSA 5EK0A 3WODF 3Q6NA 3GEIA 1TWCA 4QDLA 1SR2A 2R7XA 1NFNA 1YA7O 4NQFA 4HFKB 2L6GA 4YN0B 3SEOA 3HNKA 3M15A 3S9OA 2WVNA 1VK5A 1FMVA 3N2ZB 4LDRA 3Q6MA 3HNJA 4E0IA 5A6KA 3C18A 2G62A 2GDCA 4MNDA 2XLDA 5KYXB 3CAXA 3MYIA 3ZVRA 4J7YA 5TJ5E 4DRJB 1G4WR 2HUJA 4JRZA 3T6BA 2FGYA 3EJNA 4FWVA 3NMIA 1WASA 3LS1A 2LCHA 3GWNA 2B0HA 1TQGA 1YARO 2D5RB 2L9JA 1NFOA 2YL3A 3DM5A 2J7PD 1QVXA 2J0WA 2WVOA 5T3TA 5GPGB 1M57C 5A69A 4C7OA 5DS6A 4OIPF 4U5HA 3OWTA 3TOLA 1B68A 4P9TA 1OCRC 1RXQA 3S28A 5JRAA 1BZ4A 1H6GA 2YLIA 3TK0A 3ZTMA 3U0CA 1HY5A 2MHRA 1Q0GA 2QUPA 3IPMO 4XLNF 2XLMA 5DQTA 5DS5A 2EIJC 3EH2A 1BR1A 4AK9A 5L0CA 2YL7A 2Q7RA 4JW1A 4DVYP 2L81A 5HSWA 2M4EA 2OOCA 2X0CA 1T6QA 1MMGA 1OW6A 1OR3A 1I4YA 1RJ9B 2ETSA 2Q9BA 4MVQA 4M63A 3K1IA 3EGXA 2IOQA 1T9KA 2W45A 2NUPA 5JS5A 1H9TA 3JSZA 4O6NA 1D1AA 3FHDA 3U9MA 2R03A 3JZ0A 3ABKC 4YT8A 1E84A 3M4CA 4G7HF 2XL6A 3QVYA 4L6RA 4MW8A 4CDAA 3B0UX 3GM1A 2LFFA 3AG1C 1NZEA 1IZMA 2OEXA 3C62A 2A0UA 4CJGA 2R7TA 2J9WA 2AWYA 1AEPA 2KW3C 4EBBA 3ATPA 1S7ZA 1WGWA 3C7JA 4LLEA 2RSEB 4UDVA 3E70C 3V5XA 3MBGA 1L7CA 1PD1A 4JKVA 1YZAA 2EILC 2XS8A 2PP4A 3I5PA 1QKRA 2EPKX 2HJMA 5T3WA 2VASA 2Y3GA 4AL0A 3CEXA 3I4UA 4JTCB 3RYLA 3CSKA 3PMRA 3GM2A 5K0IA 4XWJA 3JCUQ 1JOGA 4BJ5A 1NSGB 4YK5A 2XXAB 2VC9A 2R7WA 4BEJA 4CSAA 4JEAA 256BA 3PDMP 1HW1A 1YDIA 5T1DB 4KNVA 4IGGA 1A0BA 1DOVA 4N6CA 1T01A 2IXOA 4ULVA 4XEKA 5B1BC 2LD6A 4FAPB 4PK4A 1RMVA 4JVSA 2YKZA 4HFFB 4CDYA 1N1CA 2HZ8A 3EGXB 1U89A 2ASRA 1O87A 2EIKC 1HMOA 1VB5A 2EPMX 2GAQA 1ZW3A 4CIHA 3AQCA 2NUPB 4JC7A 4ER9A 2Y3BA 1YYJA 2CW0F 4LDQA 3UMIA 3W8IA 2JD3A 2DGJA 2VCCA 3JTLO 1RCPA 3ZWIA 1R5ID 2YVKA 3DM9B 2DB4A 2HFIA 1XZQA 2A1DD 1LE2A 3RFYA 3DXJF 4NCQA 2OKUA 3NDBB 5HV9A 2YL1A 3H2VA 1A7EA 4G78A 4MW3A 2Y39A 4D4NA 3DJUB 1HMDA 2MYSA 4HEAJ 2TMVP 1E2XA 3OA1A 3U9JA 2KC3A 3FDQA 1FNTc 2W4MA 3GORA 3RF3A
chains in the Genus database with same CATH topology
1DOVA 1T01A 5FZTA 5L0GA 3VF0A 4DJ9A 5L0FA 2HSQA 4P9TA 1DOWA 5L0IA 1RKEB 1H6GA 5L0DA 1U89A 2LQGA 1XWJA 3TJ5A 1ZW3A 4E17A 5L0HA 2L7AA 2GDCA 3S90A 1L7CA 5L0CA 3MYIA 1RKCA 1ZVZA 4K1OA 4PR9A 2GWWA 4W8PA 1QKRA 2X0CA 3H2UA 4EHPA 4ONSA 1RKEA 2B0HA 2IBFA 1U6HA 3H2VA 4E18A 3TJ6A 1TR2A 3T6GB 3ZDLA 1ST6A 1SYQA 1ZW2A 5L0JA 1YDIA 4IGGA 3RF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOV A;  1T01 A;  5FZT A;  5L0G A;  3VF0 A;  4DJ9 A;  5L0F A;  2HSQ A;  4P9T A;  1DOW A;  5L0I A;  1RKE B;  1H6G A;  5L0D A;  1U89 A;  2LQG A;  1XWJ A;  3TJ5 A;  1ZW3 A;  4E17 A;  5L0H A;  2L7A A;  2GDC A;  3S90 A;  1L7C A;  5L0C A;  3MYI A;  1RKC A;  1ZVZ A;  4K1O A;  4PR9 A;  2GWW A;  4W8P A;  1QKR A;  2X0C A;  3H2U A;  4EHP A;  4ONS A;  1RKE A;  2B0H A;  2IBF A;  1U6H A;  3H2V A;  4E18 A;  3TJ6 A;  1TR2 A;  3T6G B;  3ZDL A;  1ST6 A;  1SYQ A;  1ZW2 A;  5L0J A;  1YDI A;  4IGG A;  3RF3 A; 
#chains in the Genus database with same CATH topology
 5KYX A;  3W2V A;  1YZC A;  3FOP A;  1AUE A;  1K40 A;  1Q0F A;  4MVR A;  1Z7Q c;  4E0H A;  3HKK A;  2EIN C;  1YAU O;  1YYX A;  3MLG A;  1RKE B;  5COG A;  3RH3 A;  4CBE A;  4HE8 D;  4I3M A;  4GYT A;  5A6J A;  3POV A;  1UG7 A;  1O5H A;  5BQG A;  4BPM A;  1C02 A;  2A6H F;  4YT4 A;  4NTA A;  2V26 A;  1V54 C;  4FES A;  4MVS A;  2PX0 A;  2NSF A;  3H2U A;  5DS4 A;  1NG1 A;  2OEV A;  1W2W A;  1SF8 A;  3EFO B;  2X51 A;  3C8Z A;  4CS9 A;  3MFN A;  1F1M A;  4EUK B;  3TQO A;  1FR0 A;  3BRJ A;  3C8G D;  4DOZ A;  3HNL A;  2XLE A;  3LNR A;  2QY9 A;  3UNG C;  1YJG A;  4JCZ A;  5CI9 A;  2P1A A;  2BE5 F;  2XLO A;  3EH1 A;  3TD7 A;  2IYL D;  2A6E F;  5FZT A;  1LS1 A;  5L0I A;  4OIR F;  1TWG A;  3QTH A;  4KC9 A;  1RJ9 A;  3BEH A;  2KSF A;  4MVM A;  1SZI A;  3F46 A;  1ZZP A;  3FMS A;  5JP7 A;  2G3V A;  2R7U A;  2Y3H A;  2L7A A;  4PJL A;  4YL3 A;  2E87 A;  3S90 A;  3RKO F;  1NU9 C;  1M56 C;  4H54 A;  3ABL C;  1M2O A;  1V55 C;  4B6I A;  4XPX A;  5B3S C;  3DE9 A;  1RKC A;  3NYL A;  4PR9 A;  3ZQV A;  3DAG A;  3T6J A;  1OR2 A;  5KYW B;  1VYI A;  1WN0 A;  3JYY A;  5DVW A;  3GEE A;  3LS0 A;  1Y4C A;  4CIP A;  2Y69 C;  2AU5 A;  1TR2 A;  4XPW A;  3T6G B;  3ITF A;  3SXK A;  2EPO A;  3M1C B;  3X2Q C;  1HE9 A;  4MVU A;  4CJO A;  5A6B D;  2BL2 A;  3GEH A;  1LS4 A;  3VRC A;  2HSB A;  5L0G A;  1JPJ A;  3IQC A;  2A0B A;  3AGU A;  3GOD A;  2XM4 A;  1G8X A;  3JT1 A;  1Z63 A;  5DQZ A;  2F22 A;  4GEH A;  3ZTZ A;  3EG9 B;  2UUI A;  3N0T A;  1PCX A;  1JRA A;  5E3C A;  3LAY A;  2G3K A;  4EBJ A;  4MQ9 F;  3RQF A;  2A69 F;  2J7P A;  2XXA A;  4X0R A;  3ZG1 A;  3JYH A;  4U5D E;  4NTF A;  2OJQ A;  4U5F E;  5E33 A;  1A7D A;  2L6F A;  4DBQ A;  3RW0 A;  3LEO A;  5L3Q A;  3HNI A;  2WVQ A;  1M2V B;  2KJG A;  3K7D A;  1ORY A;  3H65 A;  2Q3T A;  2LK4 A;  2R7Q A;  2I15 A;  3C8G B;  1AVO B;  2XLV A;  1JPN A;  2FFH A;  2KK1 A;  1YLM A;  1D0X A;  3GAN A;  5JSL A;  3VF0 A;  2VCB A;  4NY3 A;  4KI2 A;  4RBN A;  4MTG A;  1T6I A;  5L0F A;  2HSQ A;  4BJT A;  1BBH A;  4OIO F;  1J8Y F;  1MQV A;  4KBL A;  1OKK D;  2P6V A;  2Z15 A;  2P7V A;  3R2P A;  4CS7 A;  4DVZ A;  4A4A A;  3U3F A;  3Q7G A;  4KNW A;  2EPN A;  4PFO A;  1NU7 D;  2YEV A;  4C3D A;  1LM3 B;  2YLG A;  3O6X A;  1TWH A;  5CI8 A;  3UMK A;  3VYW A;  4AX2 A;  1D1B A;  5KYN A;  2J45 A;  1LI7 A;  2YZS A;  3B9Q A;  3GWL A;  1Q0M A;  2VH3 A;  5F5H A;  4EIY A;  3RQE A;  3SXM A;  1RKE A;  1E85 A;  4MTO A;  4RD9 A;  3U2L A;  4BEM J;  4O6M A;  1V74 B;  2C03 A;  4Q7C A;  2PNO A;  3KPH A;  1VOM A;  3ZC4 A;  1EA8 A;  3ZQY A;  4RDA A;  3GM3 A;  4DJ9 A;  4Q4Z F;  2HMQ A;  4A2N B;  2PFD A;  4N4W A;  4F4B A;  2R7R A;  3UGO A;  2LSE A;  3LES A;  3Q7L A;  4J7T A;  3L0I A;  4JIO A;  1T6U A;  5CIV A;  2IXP A;  3O39 A;  3B29 A;  4AL1 A;  3EFO A;  2AVK A;  4XQ1 A;  2J8W A;  3L1M A;  4W8K A;  3B71 A;  1T5O A;  4BJ6 C;  3A11 A;  3O10 A;  4IWB A;  5COF A;  5FCL A;  3T4R A;  3UMH A;  1TWA A;  1HE1 A;  2JX0 A;  2OCC C;  4OD4 A;  4R32 A;  1QLE C;  3EZI A;  5KYU A;  4OIQ F;  2P0N A;  3S27 A;  4YL1 A;  3EHN A;  4EHP A;  4Z9H A;  4ULW A;  3N24 A;  4U5B E;  3CQZ A;  1U6H A;  2CNW D;  5DLJ A;  1D0Y A;  5E3A A;  2VB6 A;  2UUH A;  2YRF A;  3EZH A;  1A41 A;  3R7C A;  4C3B A;  2YL0 A;  1CGO A;  1J8M F;  3AG2 C;  3RVY A;  5F28 E;  4C3E A;  3FXH A;  1FTS A;  4P6I C;  3WG7 C;  5KYW A;  1D1C A;  4LLC A;  4BJ1 A;  4U9D A;  1A7V A;  4JCH A;  3X1O A;  1XWJ A;  2EPL X;  3ABM C;  4CX9 A;  4E17 A;  3SZR A;  4DBR A;  5AC5 A;  4MVZ A;  4CS8 C;  1EKY A;  2W4B A;  2LIG A;  1VMA A;  4IB4 A;  3ZSU A;  4AE4 B;  1NBB A;  1CGM E;  4I1O B;  3SP1 A;  2AWC A;  3LNM B;  3AG3 C;  2LP4 A;  5F5F A;  1ZYR F;  2HV7 A;  3M4B A;  3NG1 A;  1G4U S;  3FAP B;  2HMZ A;  3HLZ A;  3L34 A;  5D92 A;  3ZDL A;  3EG9 A;  4BG0 A;  1QQ3 A;  4XLP F;  4LAC B;  2LFD A;  4GQH A;  3C63 A;  3FVY A;  2KQ9 A;  2KNH A;  2ZXW C;  3J06 A;  3NMJ A;  4JEB A;  5BQI A;  2YLD A;  4J30 B;  3RVZ A;  2CYD A;  5IY5 C;  1OXK A;  1Q0K A;  3SXZ A;  5KYU B;  4YT5 A;  3U2M A;  3L8J A;  4ANJ A;  1BR4 A;  1WTY A;  1M2V A;  3IHU A;  3TJ5 A;  3TUL A;  2B0J A;  3HTK C;  5B1A C;  2HJ3 A;  1NLX A;  2R7S A;  3C8G A;  3EPV A;  2A68 F;  4J32 B;  4PAC A;  2QE9 A;  2OU6 A;  3AJM A;  4G7O F;  1ZHW A;  3G4X A;  1ZVZ A;  2OQM A;  3ASN C;  4H4K C;  2R25 A;  1WWP A;  3DZA A;  3DWW A;  1C03 A;  2J9B A;  2KGO A;  1VYK A;  2AP3 A;  2R9R B;  4W8P A;  3LUT B;  4G7Z F;  2J9V A;  3AQB A;  2XLW A;  3K66 A;  1QZX A;  3W8H A;  4ZLC A;  3FAJ A;  4Z9J A;  4K0D A;  2Q00 A;  1BDJ B;  5L3V A;  4Q5S F;  2XLH A;  1HW2 A;  3QVZ A;  3S0X A;  4JE9 A;  4PJM A;  4MS2 A;  1V4A A;  3LJB A;  2NUT A;  1MMD A;  4P9F A;  2Q9A A;  4FX5 A;  4YWQ A;  1DOW A;  1GQA A;  1QSP A;  3V5Z A;  2FAP B;  3IQ5 A;  2CGE A;  2Y3D A;  4PJN A;  3K1I C;  2RD9 A;  1LVK A;  2O9X A;  3IEE A;  1KU2 A;  2EIM C;  2V3C C;  2L6H A;  2R7V A;  4DRH B;  3IQT A;  3KL4 A;  3B0P A;  1LKX A;  2J9U A;  1ORS C;  5BUO A;  5A6B A;  1EQ1 A;  2YQY A;  4NTB A;  1OQC A;  2QNL A;  3G50 A;  2MWQ A;  3KMI A;  3U8P A;  5KYY B;  3S84 A;  2YWA A;  3DJN B;  3AGT A;  1EI7 A;  3JSE O;  2ZD9 A;  3JRM O;  1UFB A;  1WAT A;  5JT4 A;  5A6A A;  1G5Z A;  1MMN A;  2ZPA A;  3KKB A;  2H7V C;  3LLI A;  4IJJ A;  1ST6 A;  4WJ0 A;  5EHH A;  3IQ6 A;  2ICW G;  5D91 A;  1O3U A;  2HV6 A;  2Q9C A;  2OJE D;  2GFH A;  4DRI B;  1Z3I X;  1OCC C;  5B3I A;  1OW7 A;  3ASO C;  4JZA A;  1CPQ A;  3JRT A;  2OG2 A;  4EWC A;  3EGD B;  2WZL A;  3PCV A;  5AGF A;  2H7B A;  3UR3 C;  4JTA B;  1GM5 A;  4YL0 A;  2LQG A;  4XEF A;  1R4T A;  4XTK A;  3SXY A;  4BJ5 C;  3AG4 C;  3G4Z A;  1YVI A;  4PFP A;  4XPY A;  5E2Q A;  4CSA C;  1OXB A;  2NSG A;  2R7O A;  2NUT B;  3MX3 A;  4WAB A;  3O55 A;  1E83 A;  4U5C E;  1KNY A;  2GWW A;  4QI0 A;  1S05 A;  2W9Y A;  1U0B B;  1SMY F;  3SNH A;  1OW8 A;  3TOM A;  2IBF A;  1OKK A;  4MTF A;  3V5Y A;  1JAF A;  1M6T A;  3RQG A;  3US6 A;  1LIH A;  2HKV A;  1ZHY A;  1GGQ A;  4LDK A;  4OD5 A;  2BC5 A;  2CDQ A;  1MMA A;  2DI3 A;  4YJW A;  4N06 A;  3WHN A;  4AE4 A;  3NRH A;  1KTM A;  4EKW A;  3L8I A;  1YA9 A;  2CCY A;  3K6B A;  1I5N A;  3W2W A;  1BR2 A;  4IRU A;  5JVE A;  3S29 A;  3I5Q A;  1XZP A;  1FMW A;  3ZIB A;  4JTD B;  4C7O B;  3QW1 A;  1Z6A A;  1LPE A;  3KYJ A;  3F47 A;  3U3B A;  2GA0 A;  2IXM A;  4K1O A;  2R05 A;  1MND A;  4O79 A;  1QPU A;  4O6Y A;  3U8V A;  1ZHT A;  2VCA A;  3V7O A;  4IAO A;  1OCO C;  1H7I A;  2D4U A;  2PBE A;  3K1H A;  4EBK A;  5EGY A;  4E18 A;  2NPU A;  2XM0 A;  4K7B A;  3E9V A;  1K04 A;  3DI5 A;  1SYQ A;  4LER A;  1Y6D A;  2QLA A;  2JPU A;  1IW7 F;  3DE8 A;  1FAP B;  3HJC A;  3OEO A;  4U9E A;  1D0Z A;  3WAQ A;  1ZU4 A;  3RIP A;  4QI2 A;  2ZXR A;  2C04 A;  2WZG A;  4I1M A;  5JUA A;  1TFO B;  3EHM A;  1WOL A;  2KYH A;  2ZXO A;  3NMK A;  4U5G A;  4OIN F;  1JMW A;  3SYN A;  2XRH A;  4CS9 C;  3VAY A;  2IM8 A;  1H9G A;  2J46 A;  2ZXP A;  1VLS A;  1TFK B;  2CNW A;  4NC3 A;  2XL4 A;  2XL8 A;  3T9O A;  2I8B A;  1TKN A;  2DYR C;  3M79 A;  5BQH A;  1JR8 A;  4DXW A;  3UGP A;  3LLK A;  1VTM P;  3MYF A;  4O7G A;  1GS9 A;  4IAQ A;  4WGY A;  2WZF A;  4CDV A;  3DAF A;  4U5E E;  3QW0 A;  1VLT A;  4YT2 A;  2M64 A;  1CGN A;  3CZ6 A;  3K33 A;  4MVO A;  3NKE A;  4XEV A;  3FOO A;  1Z5Z A;  4BJ6 A;  5L0J A;  2IXN A;  4PJJ A;  4ZLD A;  3DMD A;  1LI5 A;  3ECS A;  2XS1 A;  4E7Z A;  2DYS C;  4E7S A;  4I44 A;  1ZHX A;  2H8A A;  4WGZ A;  1ZHZ A;  1K05 A;  2NG1 A;  3DD7 A;  4N6H A;  2P61 A;  3VM6 A;  5L0D A;  5KYY A;  1Q0D A;  3PHF 2;  3QZC A;  3NYM A;  2QTV A;  4JJG A;  3DKA A;  3QMK A;  2PF4 E;  5L0H A;  1L3P A;  1C17 M;  2PX3 A;  2WB7 A;  3EQL F;  3KH2 A;  4D4X A;  5JLI A;  3B0V C;  2HS5 A;  1LE4 A;  1FFH A;  4Z9I A;  3NYJ A;  3W4Y A;  3NKD A;  5AC4 A;  2R02 A;  1E86 A;  1I4Z A;  1OCZ C;  2H7O A;  1Z23 A;  3AOU A;  1MNE A;  5COM A;  4JJF A;  1FFT C;  1APC A;  2XSE A;  2J0X A;  4ONS A;  1PD0 A;  3KYI A;  4IAR A;  3U5S A;  3EGD A;  3TJ6 A;  3LEV A;  2Q4F A;  3A9C A;  4CS8 A;  1ZW2 A;  1ZU5 A;  2WL8 A;  4G0H A;  1PV3 A;  4JUR I;  1ORJ A;  1CPR A;  2YHS A;  5EK0 A;  3WOD F;  3Q6N A;  3GEI A;  1TWC A;  4QDL A;  1SR2 A;  2R7X A;  1NFN A;  1YA7 O;  4NQF A;  4HFK B;  2L6G A;  4YN0 B;  3SEO A;  3HNK A;  3M15 A;  3S9O A;  2WVN A;  1VK5 A;  1FMV A;  3N2Z B;  4LDR A;  3Q6M A;  3HNJ A;  4E0I A;  5A6K A;  3C18 A;  2G62 A;  2GDC A;  4MND A;  2XLD A;  5KYX B;  3CAX A;  3MYI A;  3ZVR A;  4J7Y A;  5TJ5 E;  4DRJ B;  1G4W R;  2HUJ A;  4JRZ A;  3T6B A;  2FGY A;  3EJN A;  4FWV A;  3NMI A;  1WAS A;  3LS1 A;  2LCH A;  3GWN A;  2B0H A;  1TQG A;  1YAR O;  2D5R B;  2L9J A;  1NFO A;  2YL3 A;  3DM5 A;  2J7P D;  1QVX A;  2J0W A;  2WVO A;  5T3T A;  5GPG B;  1M57 C;  5A69 A;  4C7O A;  5DS6 A;  4OIP F;  4U5H A;  3OWT A;  3TOL A;  1B68 A;  4P9T A;  1OCR C;  1RXQ A;  3S28 A;  5JRA A;  1BZ4 A;  1H6G A;  2YLI A;  3TK0 A;  3ZTM A;  3U0C A;  1HY5 A;  2MHR A;  1Q0G A;  2QUP A;  3IPM O;  4XLN F;  2XLM A;  5DQT A;  5DS5 A;  2EIJ C;  3EH2 A;  1BR1 A;  4AK9 A;  5L0C A;  2YL7 A;  2Q7R A;  4JW1 A;  4DVY P;  2L81 A;  5HSW A;  2M4E A;  2OOC A;  2X0C A;  1T6Q A;  1MMG A;  1OW6 A;  1OR3 A;  1I4Y A;  1RJ9 B;  2ETS A;  2Q9B A;  4MVQ A;  4M63 A;  3K1I A;  3EGX A;  2IOQ A;  1T9K A;  2W45 A;  2NUP A;  5JS5 A;  1H9T A;  3JSZ A;  4O6N A;  1D1A A;  3FHD A;  3U9M A;  2R03 A;  3JZ0 A;  3ABK C;  4YT8 A;  1E84 A;  3M4C A;  4G7H F;  2XL6 A;  3QVY A;  4L6R A;  4MW8 A;  4CDA A;  3B0U X;  3GM1 A;  2LFF A;  3AG1 C;  1NZE A;  1IZM A;  2OEX A;  3C62 A;  2A0U A;  4CJG A;  2R7T A;  2J9W A;  2AWY A;  1AEP A;  2KW3 C;  4EBB A;  3ATP A;  1S7Z A;  1WGW A;  3C7J A;  4LLE A;  2RSE B;  4UDV A;  3E70 C;  3V5X A;  3MBG A;  1L7C A;  1PD1 A;  4JKV A;  1YZA A;  2EIL C;  2XS8 A;  2PP4 A;  3I5P A;  1QKR A;  2EPK X;  2HJM A;  5T3W A;  2VAS A;  2Y3G A;  4AL0 A;  3CEX A;  3I4U A;  4JTC B;  3RYL A;  3CSK A;  3PMR A;  3GM2 A;  5K0I A;  4XWJ A;  3JCU Q;  1JOG A;  4BJ5 A;  1NSG B;  4YK5 A;  2XXA B;  2VC9 A;  2R7W A;  4BEJ A;  4CSA A;  4JEA A;  256B A;  3PDM P;  1HW1 A;  1YDI A;  5T1D B;  4KNV A;  4IGG A;  1A0B A;  1DOV A;  4N6C A;  1T01 A;  2IXO A;  4ULV A;  4XEK A;  5B1B C;  2LD6 A;  4FAP B;  4PK4 A;  1RMV A;  4JVS A;  2YKZ A;  4HFF B;  4CDY A;  1N1C A;  2HZ8 A;  3EGX B;  1U89 A;  2ASR A;  1O87 A;  2EIK C;  1HMO A;  1VB5 A;  2EPM X;  2GAQ A;  1ZW3 A;  4CIH A;  3AQC A;  2NUP B;  4JC7 A;  4ER9 A;  2Y3B A;  1YYJ A;  2CW0 F;  4LDQ A;  3UMI A;  3W8I A;  2JD3 A;  2DGJ A;  2VCC A;  3JTL O;  1RCP A;  3ZWI A;  1R5I D;  2YVK A;  3DM9 B;  2DB4 A;  2HFI A;  1XZQ A;  2A1D D;  1LE2 A;  3RFY A;  3DXJ F;  4NCQ A;  2OKU A;  3NDB B;  5HV9 A;  2YL1 A;  3H2V A;  1A7E A;  4G78 A;  4MW3 A;  2Y39 A;  4D4N A;  3DJU B;  1HMD A;  2MYS A;  4HEA J;  2TMV P;  1E2X A;  3OA1 A;  3U9J A;  2KC3 A;  3FDQ A;  1FNT c;  2W4M A;  3GOR A;  3RF3 A; 
#chains in the Genus database with same CATH homology
 1DOV A;  1T01 A;  5FZT A;  5L0G A;  3VF0 A;  4DJ9 A;  5L0F A;  2HSQ A;  4P9T A;  1DOW A;  5L0I A;  1RKE B;  1H6G A;  5L0D A;  1U89 A;  2LQG A;  1XWJ A;  3TJ5 A;  1ZW3 A;  4E17 A;  5L0H A;  2L7A A;  2GDC A;  3S90 A;  1L7C A;  5L0C A;  3MYI A;  1RKC A;  1ZVZ A;  4K1O A;  4PR9 A;  2GWW A;  4W8P A;  1QKR A;  2X0C A;  3H2U A;  4EHP A;  4ONS A;  1RKE A;  2B0H A;  2IBF A;  1U6H A;  3H2V A;  4E18 A;  3TJ6 A;  1TR2 A;  3T6G B;  3ZDL A;  1ST6 A;  1SYQ A;  1ZW2 A;  5L0J A;  1YDI A;  4IGG A;  3RF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...