3TJ5A

Human vinculin head domain (vh1, residues 1-258) in complex with the vinculin binding site of the surface cell antigen 4 (sca4-vbs-n; residues 412-434) from rickettsia rickettsii
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
254
structure length
254
Chain Sequence
PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title The rickettsia surface cell antigen 4 applies mimicry to bind to and activate vinculin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/toxin
total genus 108
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2011-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3tj5A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3tj5A01
1XWJA 1RKEB 1YDIA 1DOVA 2B0HA 4K1OA 1SYQA 1ZVZA 5L0JA 3TJ6A 2L7AA 3VF0A 1L7CA 2GDCA 1QKRA 2LQGA 4DJ9A 1TR2A 1RKEA 1ZW2A 3H2UA 5L0FA 3RF3A 3T6GB 1U6HA 2X0CA 1T01A 4P9TA 3ZDLA 2IBFA 5FZTA 1DOWA 5L0GA 5L0IA 5L0CA 4W8PA 4EHPA 1RKCA 3S90A 1ZW3A 4IGGA 1U89A 3H2VA 4PR9A 2GWWA 1ST6A 5L0HA 2HSQA 1H6GA 3TJ5A 4E17A 4ONSA 4E18A 5L0DA 3MYIA
chains in the Genus database with same CATH superfamily
2YL3A 3KMIA 4DRJB 3BRJA 3W4YA 2KQ9A 2TMVP 2V3CC 3K1IC 2XSEA 2MYSA 1T9KA 3EPVA 3QTHA 4KC9A 3L8JA 4PK4A 1ORJA 3VAYA 3WHNA 3FAPB 1U6HA 2OCCC 4CJGA 5KYUB 3JSZA 4C3EA 2NUTB 1F1MA 2CGEA 3M15A 3TQOA 2ZXWC 1IW7F 3AJMA 3NMKA 2DYRC 4AL1A 2XLDA 3HNIA 1A41A 1BR2A 2BL2A 2HKVA 2EILC 1LIHA 4G0HA 4O6YA 2HSQA 1H6GA 4QI0A 4MVSA 2R03A 3ABLC 3EHMA 3JRTA 3KKBA 2CDQA 1RKEB 5T1DB 1QQ3A 2WB7A 2LCHA 2A0UA 1Y6DA 4MTFA 3B0VC 4YWQA 3FXHA 2ZPAA 3EH1A 3AQCA 1OXBA 2LQGA 5JVEA 4YL0A 1OW7A 3H2UA 2FAPB 1WWPA 2A0BA 2XLEA 3VRCA 2V26A 4CDYA 2JX0A 3RFYA 3JTLO 3AG3C 1BBHA 2L6HA 4C3DA 2AWYA 4YT8A 5BQHA 5JLIA 2YLDA 3U0CA 2R7XA 3JCUQ 4ZLCA 4NTAA 1J8MF 2L9JA 2VCAA 2VCBA 2OEVA 3UGOA 4MS2A 4ANJA 5A6BA 2XLOA 4LLCA 4D4NA 3J06A 2LFDA 4DOZA 4DVZA 2CYDA 1YZAA 3O10A 3ABMC 3EG9A 3LJBA 3V5ZA 1FNTc 5E2QA 5AC5A 2A6EF 2OKUA 1Z23A 3QZCA 3AG2C 2EIMC 3POVA 4K0DA 4PJLA 2DYSC 4BJ1A 3QW0A 4KNWA 1EKYA 1WATA 2YL7A 3KYIA 3GODA 2OEXA 2GDCA 4LERA 1QKRA 5JS5A 4XEVA 1TR2A 3UGPA 1UFBA 3DAGA 2R7VA 2OG2A 3B71A 4CSAC 4JCZA 1T6UA 1PCXA 3T4RA 3L34A 2EIKC 2KC3A 1CPQA 2ZD9A 4P9TA 3O39A 3U2LA 4MTGA 5TJ5E 1I5NA 1MMGA 3GEEA 1MNEA 2XS8A 3E70C 3IQCA 3O6XA 5E33A 4A4AA 5B3IA 2LK4A 4HEAJ 3GORA 3F47A 4GEHA 2PF4E 4WGZA 3C63A 4YJWA 1YA9A 2WZFA 1SF8A 4JZAA 5A6AA 4O6MA 4ONSA 1C02A 3C8GD 4YT2A 4CDAA 5HSWA 3SXMA 4O7GA 1FMVA 3C62A 3KH2A 3VYWA 4ER9A 4Q5SF 2JD3A 4OD4A 3GEIA 4IRUA 3K1HA 2DGJA 2R7WA 1QLEC 2NG1A 1FMWA 3GANA 4I44A 4U5BE 3S0XA 4C7OB 2EINC 1Z5ZA 1LE4A 3HKKA 3DXJF 3M79A 4CS8A 4CS9A 3I5PA 2XLWA 2XM4A 4BEMJ 3G4XA 2Y3HA 3ECSA 3I4UA 4ULVA 3UMHA 4EKWA 1PD1A 1G4WR 1CGME 3M1CB 3FDQA 1CGOA 3G4ZA 4OIRF 4EHPA 1YYXA 3MFNA 4IGGA 3AG1C 4U5FE 1CPRA 5KYUA 2NUTA 4K7BA 2FGYA 4WGYA 2ICWG 1C03A 4PJMA 4CDVA 2I8BA 4RDAA 3EQLF 3TJ5A 3U3BA 1EI7A 1NU7D 2KNHA 2QY9A 3MYIA 4HE8D 4XEFA 2MWQA 2PFDA 3U5SA 2BE5F 2GA0A 4LDKA 1LPEA 1XZQA 3NYJA 5GPGB 2LFFA 2A6HF 3DM5A 4AX2A 3MLGA 3C7JA 3ZQVA 1V74B 4JC7A 3VF0A 5FCLA 1L7CA 2OJQA 4DJ9A 3NDBB 2Q4FA 2DB4A 2Q7RA 3IHUA 1NU9C 2QE9A 3DE8A 2CCYA 3L0IA 4BPMA 2VH3A 2PP4A 1DOWA 4YL3A 2NPUA 3DWWA 3PMRA 2J7PA 1XZPA 4MVUA 3S28A 1D1AA 1FTSA 4JIOA 3S90A 3RH3A 1QSPA 3RQGA 4LDRA 1MMAA 1J8YF 2GWWA 4MVOA 4EBBA 2IM8A 1ZU4A 1M2VA 2W45A 3T6BA 2C03A 2PNOA 3NMIA 1ZVZA 4F4BA 2XXAB 5D91A 2L81A 1MMDA 3V5YA 2NSFA 1TKNA 5KYWB 2L6FA 2HZ8A 4Z9HA 3HTKC 1TFKB 1NZEA 2WVQA 2XL6A 4FX5A 4JEAA 3VM6A 4C3BA 3ZTZA 5L0FA 5A6KA 2G3KA 5JP7A 4LACB 4DRHB 4H4KC 3IQ6A 4XQ1A 4E0IA 3I5QA 4BJ5A 1U0BB 2W9YA 3RIPA 3EGXA 2L6GA 2LSEA 1HMDA 3ASNC 1K05A 3JT1A 5EGYA 1AEPA 2ETSA 3RVZA 3RW0A 2YLGA 2QTVA 3B9QA 1FFTC 4MTOA 3AGTA 1H9TA 1A7VA 1I4YA 1V4AA 3B29A 1VYIA 2NUPB 3ABKC 3Q7GA 1VTMP 2UUIA 2LP4A 2XLMA 2Z15A 2R9RB 3JYHA 5COFA 5B3SC 1WTYA 3RYLA 1H9GA 4CX9A 5L3VA 3L8IA 4XPWA 3M4CA 3T6JA 1FR0A 3JSEO 4NTFA 2KSFA 3A9CA 4XPXA 1HMOA 2R02A 1NBBA 3Q6NA 4N06A 3EFOB 2HV7A 2B0JA 2HV6A 1PV3A 4IB4A 1QVXA 2J9WA 2IBFA 1AUEA 3NMJA 3DKAA 1W2WA 4YT5A 4EIYA 2O9XA 1OCCC 3ZTMA 4AE4B 2VASA 3W8HA 3FMSA 1AVOB 4AL0A 2EPOA 2YLIA 5E3CA 1RJ9A 5F28E 1H7IA 3GM3A 4RD9A 4UDVA 3SXZA 1OKKD 1TFOB 1S7ZA 5KYNA 3JZ0A 4CS8C 4RBNA 4CS9C 3KYJA 1APCA 4OD5A 2WVOA 4NTBA 2B0HA 2H7BA 5CI9A 4XLNF 1ZHWA 2CNWD 1E83A 1Q0GA 3FOPA 2L7AA 2VC9A 4LLEA 2YZSA 1D1BA 3UNGC 1Q0FA 3B0UX 4G7ZF 3EGDB 4NCQA 1NLXA 5CIVA 1ORSC 3CZ6A 3WG7C 3JRMO 3NG1A 1K40A 2M64A 3K66A 5KYYB 2XLHA 3GM2A 2X0CA 3ZQYA 3LLIA 1GM5A 1EA8A 1BR4A 4MW8A 1VK5A 2H7OA 4O6NA 1LE2A 2X51A 2YQYA 4JTCB 4G7OF 2A69F 3FHDA 1D0YA 1Q0DA 2Y39A 3K7DA 3U8PA 2XS1A 3HNKA 1HY5A 4CBEA 2J9UA 4MW3A 1VYKA 1YJGA 2PX3A 2A1DD 5KYXA 1ZHYA 4E18A 4IARA 3QMKA 1TWCA 4J7TA 3M4BA 2KYHA 4HFKB 4IJJA 3IPMO 4OINF 5JT4A 3EZHA 1M2OA 2J9BA 1HW2A 1O5HA 1TWAA 3LAYA 1HW1A 3C8GA 3C8ZA 1VB5A 4ULWA 1FAPB 2FFHA 3ATPA 4N6HA 3O55A 1ZW2A 4IWBA 1KNYA 2XM0A 3LS1A 4AK9A 5DQZA 4R32A 2QUPA 2Y3BA 3DI5A 3DE9A 3W8IA 5K0IA 3ITFA 1M6TA 1Q0MA 2IOQA 2A68F 3L1MA 4J32B 2XRHA 5DVWA 2KGOA 1R5ID 4Z9JA 3RQFA 5L0GA 3S9OA 1Z63A 5HV9A 1Q0KA 3NKEA 1VLTA 4W8PA 5DLJA 4MQ9F 1E2XA 3WODF 2H7VC 2WZGA 2YL1A 5IY5C 3UR3C 1ZHXA 2OOCA 4BJTA 1OW8A 2LIGA 3TOLA 1Z3IX 4U5GA 2Q9BA 3ZC4A 1KTMA 1Y4CA 4BJ5C 4JJGA 1JR8A 2OU6A 3IQTA 2P1AA 1G5ZA 3AG4C 4GQHA 2P7VA 3SNHA 2F22A 3N2ZB 4NC3A 4DVYP 5F5FA 2IXMA 1YARO 1GQAA 2MHRA 4O79A 4QDLA 2WZLA 3DJNB 1ORYA 3U2MA 1RKEA 3WAQA 3PDMP 4CS7A 2XL4A 1TWHA 4P6IC 4A2NB 1M56C 3U9MA 4Q4ZF 1GGQA 3T6GB 3HNLA 1SR2A 1T6IA 3H65A 1T01A 4U5DE 3S29A 4I3MA 3U3FA 2EPNA 2P61A 3PHF2 3EG9B 2EIJC 1L3PA 5D92A 2VB6A 5COMA 4YK5A 4JE9A 3SYNA 1RKCA 3DAFA 4JTDB 4Z9IA 1U89A 3PCVA 1LS4A 4YT4A 1OXKA 3R7CA 3N24A 4EBJA 4QI2A 3A11A 4JEBA 5COGA 4U5HA 4XWJA 2H8AA 4AE4A 1ZZPA 3LNMB 4JJFA 1WN0A 4X0RA 4N4WA 3NKDA 3K33A 1RMVA 3F46A 2KK1A 1DOVA 4K1OA 4I1OB 2HMQA 2Y3DA 3DM9B 3LEVA 2EPLX 3CEXA 2PBEA 3K6BA 4GYTA 4ZLDA 3UMKA 3TJ6A 2KJGA 2Q9AA 3QVZA 3QW1A 4EBKA 4E7ZA 1JPJA 1V54C 1NG1A 2M4EA 1JMWA 3NYLA 2HJ3A 3RKOF 2ZXRA 3SXKA 1LI7A 1NFNA 4PFOA 2D5RB 2YWAA 1D0ZA 3W2WA 5JUAA 3CSKA 1Z7Qc 1JOGA 3GWLA 4MVMA 2J0XA 1JPNA 4H54A 1HE9A 1HE1A 1TWGA 3H2VA 2IXPA 4JURI 3TOMA 3DZAA 2IYLD 2W4MA 2YRFA 3V5XA 1VLSA 1KU2A 1ZU5A 4MVZA 4OIPF 3LESA 5A69A 1YDIA 2Q9CA 5DS4A 3Q7LA 3ASOC 3V7OA 1A7DA 4HFFB 4OIOF 1ZHZA 4PACA 1BDJB 2ASRA 3BEHA 5AGFA 2YEVA 1WGWA 3B0PA 4CJOA 1E84A 2JPUA 3R2PA 3RVYA 3US6A 1MMNA 2E87A 2PX0A 2R25A 1SZIA 3IQ5A 3RF3A 3U9JA 2UUHA 1YAUO 1D1CA 3AQBA 4MVRA 2W4BA 4YN0B 5JRAA 1JAFA 3AGUA 1VOMA 4J7YA 3C18A 4JRZA 5T3WA 4B6IA 4C7OA 3SP1A 4BJ6A 5L0IA 4PR9A 5T3TA 4MNDA 2YKZA 3T9OA 4DBRA 4XEKA 4E0HA 4E17A 2CW0F 2P0NA 1QZXA 1XWJA 1I4ZA 2XL8A 2WVNA 3KL4A 3LLKA 4JCHA 3FAJA 2YL0A 3HLZA 1OKKA 5DS6A 4DBQA 2NSGA 2HJMA 4L6RA 4U9DA 2VCCA 1OCRC 1G4US 2J9VA 2WL8A 3GEHA 1OR3A 4U5EE 5CI8A 1SMYF 5BQGA 2R7TA 4KNVA 3NYMA 3ZSUA 4XLPF 2CNWA 4WABA 4W8KA 3LNRA 4JVSA 5A6BD 2EPMX 3ZDLA 2AWCA 4KBLA 3N0TA 2DI3A 2GAQA 5FZTA 4D4XA 4PJNA 4N6CA 3ZVRA 4PJJA 1M2VB 2OQMA 3K1IA 4FAPB 1NSGB 1A7EA 4FESA 3DMDA 5EK0A 2IXNA 3S27A 5F5HA 5DQTA 3MBGA 3W2VA 2QNLA 1ZYRF 1ST6A 4IAOA 1K04A 1MNDA 3TD7A 2XLVA 4NQFA 4G7HF 1M57C 4PFPA 2AVKA 3RQEA 4JW1A 1LM3B 1SYQA 5B1BC 2R05A 3X1OA 5L3QA 2I15A 2HFIA 2HS5A 4DRIB 5A6JA 3NRHA 4U9EA 5JSLA 3LEOA 1ZHTA 3AOUA 4MVQA 3LS0A 2QLAA 2G3VA 3EGXB 1MQVA 2XXAA 3QVYA 1TQGA 3CAXA 1CGNA 4BEJA 4XPYA 3SEOA 2HSBA 2RD9A 5KYWA 4NY3A 2IXOA 2Q00A 2G62A 1BR1A 1WASA 4CIHA 2R7UA 5L0CA 3S84A 1NFOA 1N1CA 2J45A 1ZW3A 2ZXPA 2AP3A 3UMIA 1OCOC 5BUOA 2R7QA 1YVIA 3X2QC 1O87A 1YLMA 5L0HA 1EQ1A 3DJUB 3Q6MA 5L0DA 2YVKA 3MYFA 1QPUA 2EPKX 5B1AC 5E3AA 1RCPA 1YYJA 1OR2A 1C17M 1LVKA 1OQCA 2KW3C 2NUPA 3OEOA 3EH2A 3ZG1A 4YL1A 3SXYA 1UG7A 3OWTA 3TULA 1IZMA 4JTAB 4XTKA 1S05A 1VMAA 1RJ9B 3GM1A 1BZ4A 1A0BA 3ZWIA 2LD6A 1E85A 1FFHA 3EFOA 1RXQA 3CQZA 2P6VA 4I1MA 1WOLA 2RSEB 2Y3GA 1D0XA 1PD0A 4EWCA 1OW6A 4FWVA 1YA7O 1B68A 4P9FA 4U5CE 5BQIA 2R7RA 2BC5A 1R4TA 2GFHA 3HNJA 3SZRA 2YHSA 1E86A 1O3UA 3JYYA 1T5OA 3LUTB 1GS9A 5L0JA 1T6QA 4CSAA 2R7SA 4LDQA 4OIQF 3G50A 5EHHA 2OJED 2J0WA 4EUKB 4BJ6C 1YZCA 3OA1A 4JKVA 4J30B 2J46A 2J8WA 2HUJA 3TK0A 3EHNA 4BG0A 2AU5A 4M63A 3HJCA 3DD7A 1LI5A 1LKXA 3KPHA 4IAQA 1LS1A 3ZIBA 3IEEA 2HMZA 2Q3TA 3E9VA 1JRAA 2J7PD 2R7OA 4CIPA 4WJ0A 256BA 3GWNA 4KI2A 5AC4A 3EGDA 4E7SA 1Z6AA 3FOOA 4Q7CA 1G8XA 5KYXB 2D4UA 5DS5A 5KYYA 2ZXOA 3EJNA 3MX3A 2Y69C 3U8VA 4G78A 3EZIA 1V55C 3FVYA 3C8GB 2C04A 4DXWA 1OCZC
chains in the Genus database with same CATH topology
1XWJA 1RKEB 1YDIA 1DOVA 2B0HA 4K1OA 1SYQA 1ZVZA 5L0JA 3TJ6A 2L7AA 3VF0A 1L7CA 2GDCA 1QKRA 2LQGA 4DJ9A 1TR2A 1RKEA 1ZW2A 3H2UA 5L0FA 3RF3A 3T6GB 1U6HA 2X0CA 1T01A 4P9TA 3ZDLA 2IBFA 5FZTA 1DOWA 5L0GA 5L0IA 5L0CA 4W8PA 4EHPA 1RKCA 3S90A 1ZW3A 4IGGA 1U89A 3H2VA 4PR9A 2GWWA 1ST6A 5L0HA 2HSQA 1H6GA 3TJ5A 4E17A 4ONSA 4E18A 5L0DA 3MYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XWJ A;  1RKE B;  1YDI A;  1DOV A;  2B0H A;  4K1O A;  1SYQ A;  1ZVZ A;  5L0J A;  3TJ6 A;  2L7A A;  3VF0 A;  1L7C A;  2GDC A;  1QKR A;  2LQG A;  4DJ9 A;  1TR2 A;  1RKE A;  1ZW2 A;  3H2U A;  5L0F A;  3RF3 A;  3T6G B;  1U6H A;  2X0C A;  1T01 A;  4P9T A;  3ZDL A;  2IBF A;  5FZT A;  1DOW A;  5L0G A;  5L0I A;  5L0C A;  4W8P A;  4EHP A;  1RKC A;  3S90 A;  1ZW3 A;  4IGG A;  1U89 A;  3H2V A;  4PR9 A;  2GWW A;  1ST6 A;  5L0H A;  2HSQ A;  1H6G A;  3TJ5 A;  4E17 A;  4ONS A;  4E18 A;  5L0D A;  3MYI A; 
#chains in the Genus database with same CATH topology
 2YL3 A;  3KMI A;  4DRJ B;  3BRJ A;  3W4Y A;  2KQ9 A;  2TMV P;  2V3C C;  3K1I C;  2XSE A;  2MYS A;  1T9K A;  3EPV A;  3QTH A;  4KC9 A;  3L8J A;  4PK4 A;  1ORJ A;  3VAY A;  3WHN A;  3FAP B;  1U6H A;  2OCC C;  4CJG A;  5KYU B;  3JSZ A;  4C3E A;  2NUT B;  1F1M A;  2CGE A;  3M15 A;  3TQO A;  2ZXW C;  1IW7 F;  3AJM A;  3NMK A;  2DYR C;  4AL1 A;  2XLD A;  3HNI A;  1A41 A;  1BR2 A;  2BL2 A;  2HKV A;  2EIL C;  1LIH A;  4G0H A;  4O6Y A;  2HSQ A;  1H6G A;  4QI0 A;  4MVS A;  2R03 A;  3ABL C;  3EHM A;  3JRT A;  3KKB A;  2CDQ A;  1RKE B;  5T1D B;  1QQ3 A;  2WB7 A;  2LCH A;  2A0U A;  1Y6D A;  4MTF A;  3B0V C;  4YWQ A;  3FXH A;  2ZPA A;  3EH1 A;  3AQC A;  1OXB A;  2LQG A;  5JVE A;  4YL0 A;  1OW7 A;  3H2U A;  2FAP B;  1WWP A;  2A0B A;  2XLE A;  3VRC A;  2V26 A;  4CDY A;  2JX0 A;  3RFY A;  3JTL O;  3AG3 C;  1BBH A;  2L6H A;  4C3D A;  2AWY A;  4YT8 A;  5BQH A;  5JLI A;  2YLD A;  3U0C A;  2R7X A;  3JCU Q;  4ZLC A;  4NTA A;  1J8M F;  2L9J A;  2VCA A;  2VCB A;  2OEV A;  3UGO A;  4MS2 A;  4ANJ A;  5A6B A;  2XLO A;  4LLC A;  4D4N A;  3J06 A;  2LFD A;  4DOZ A;  4DVZ A;  2CYD A;  1YZA A;  3O10 A;  3ABM C;  3EG9 A;  3LJB A;  3V5Z A;  1FNT c;  5E2Q A;  5AC5 A;  2A6E F;  2OKU A;  1Z23 A;  3QZC A;  3AG2 C;  2EIM C;  3POV A;  4K0D A;  4PJL A;  2DYS C;  4BJ1 A;  3QW0 A;  4KNW A;  1EKY A;  1WAT A;  2YL7 A;  3KYI A;  3GOD A;  2OEX A;  2GDC A;  4LER A;  1QKR A;  5JS5 A;  4XEV A;  1TR2 A;  3UGP A;  1UFB A;  3DAG A;  2R7V A;  2OG2 A;  3B71 A;  4CSA C;  4JCZ A;  1T6U A;  1PCX A;  3T4R A;  3L34 A;  2EIK C;  2KC3 A;  1CPQ A;  2ZD9 A;  4P9T A;  3O39 A;  3U2L A;  4MTG A;  5TJ5 E;  1I5N A;  1MMG A;  3GEE A;  1MNE A;  2XS8 A;  3E70 C;  3IQC A;  3O6X A;  5E33 A;  4A4A A;  5B3I A;  2LK4 A;  4HEA J;  3GOR A;  3F47 A;  4GEH A;  2PF4 E;  4WGZ A;  3C63 A;  4YJW A;  1YA9 A;  2WZF A;  1SF8 A;  4JZA A;  5A6A A;  4O6M A;  4ONS A;  1C02 A;  3C8G D;  4YT2 A;  4CDA A;  5HSW A;  3SXM A;  4O7G A;  1FMV A;  3C62 A;  3KH2 A;  3VYW A;  4ER9 A;  4Q5S F;  2JD3 A;  4OD4 A;  3GEI A;  4IRU A;  3K1H A;  2DGJ A;  2R7W A;  1QLE C;  2NG1 A;  1FMW A;  3GAN A;  4I44 A;  4U5B E;  3S0X A;  4C7O B;  2EIN C;  1Z5Z A;  1LE4 A;  3HKK A;  3DXJ F;  3M79 A;  4CS8 A;  4CS9 A;  3I5P A;  2XLW A;  2XM4 A;  4BEM J;  3G4X A;  2Y3H A;  3ECS A;  3I4U A;  4ULV A;  3UMH A;  4EKW A;  1PD1 A;  1G4W R;  1CGM E;  3M1C B;  3FDQ A;  1CGO A;  3G4Z A;  4OIR F;  4EHP A;  1YYX A;  3MFN A;  4IGG A;  3AG1 C;  4U5F E;  1CPR A;  5KYU A;  2NUT A;  4K7B A;  2FGY A;  4WGY A;  2ICW G;  1C03 A;  4PJM A;  4CDV A;  2I8B A;  4RDA A;  3EQL F;  3TJ5 A;  3U3B A;  1EI7 A;  1NU7 D;  2KNH A;  2QY9 A;  3MYI A;  4HE8 D;  4XEF A;  2MWQ A;  2PFD A;  3U5S A;  2BE5 F;  2GA0 A;  4LDK A;  1LPE A;  1XZQ A;  3NYJ A;  5GPG B;  2LFF A;  2A6H F;  3DM5 A;  4AX2 A;  3MLG A;  3C7J A;  3ZQV A;  1V74 B;  4JC7 A;  3VF0 A;  5FCL A;  1L7C A;  2OJQ A;  4DJ9 A;  3NDB B;  2Q4F A;  2DB4 A;  2Q7R A;  3IHU A;  1NU9 C;  2QE9 A;  3DE8 A;  2CCY A;  3L0I A;  4BPM A;  2VH3 A;  2PP4 A;  1DOW A;  4YL3 A;  2NPU A;  3DWW A;  3PMR A;  2J7P A;  1XZP A;  4MVU A;  3S28 A;  1D1A A;  1FTS A;  4JIO A;  3S90 A;  3RH3 A;  1QSP A;  3RQG A;  4LDR A;  1MMA A;  1J8Y F;  2GWW A;  4MVO A;  4EBB A;  2IM8 A;  1ZU4 A;  1M2V A;  2W45 A;  3T6B A;  2C03 A;  2PNO A;  3NMI A;  1ZVZ A;  4F4B A;  2XXA B;  5D91 A;  2L81 A;  1MMD A;  3V5Y A;  2NSF A;  1TKN A;  5KYW B;  2L6F A;  2HZ8 A;  4Z9H A;  3HTK C;  1TFK B;  1NZE A;  2WVQ A;  2XL6 A;  4FX5 A;  4JEA A;  3VM6 A;  4C3B A;  3ZTZ A;  5L0F A;  5A6K A;  2G3K A;  5JP7 A;  4LAC B;  4DRH B;  4H4K C;  3IQ6 A;  4XQ1 A;  4E0I A;  3I5Q A;  4BJ5 A;  1U0B B;  2W9Y A;  3RIP A;  3EGX A;  2L6G A;  2LSE A;  1HMD A;  3ASN C;  1K05 A;  3JT1 A;  5EGY A;  1AEP A;  2ETS A;  3RVZ A;  3RW0 A;  2YLG A;  2QTV A;  3B9Q A;  1FFT C;  4MTO A;  3AGT A;  1H9T A;  1A7V A;  1I4Y A;  1V4A A;  3B29 A;  1VYI A;  2NUP B;  3ABK C;  3Q7G A;  1VTM P;  2UUI A;  2LP4 A;  2XLM A;  2Z15 A;  2R9R B;  3JYH A;  5COF A;  5B3S C;  1WTY A;  3RYL A;  1H9G A;  4CX9 A;  5L3V A;  3L8I A;  4XPW A;  3M4C A;  3T6J A;  1FR0 A;  3JSE O;  4NTF A;  2KSF A;  3A9C A;  4XPX A;  1HMO A;  2R02 A;  1NBB A;  3Q6N A;  4N06 A;  3EFO B;  2HV7 A;  2B0J A;  2HV6 A;  1PV3 A;  4IB4 A;  1QVX A;  2J9W A;  2IBF A;  1AUE A;  3NMJ A;  3DKA A;  1W2W A;  4YT5 A;  4EIY A;  2O9X A;  1OCC C;  3ZTM A;  4AE4 B;  2VAS A;  3W8H A;  3FMS A;  1AVO B;  4AL0 A;  2EPO A;  2YLI A;  5E3C A;  1RJ9 A;  5F28 E;  1H7I A;  3GM3 A;  4RD9 A;  4UDV A;  3SXZ A;  1OKK D;  1TFO B;  1S7Z A;  5KYN A;  3JZ0 A;  4CS8 C;  4RBN A;  4CS9 C;  3KYJ A;  1APC A;  4OD5 A;  2WVO A;  4NTB A;  2B0H A;  2H7B A;  5CI9 A;  4XLN F;  1ZHW A;  2CNW D;  1E83 A;  1Q0G A;  3FOP A;  2L7A A;  2VC9 A;  4LLE A;  2YZS A;  1D1B A;  3UNG C;  1Q0F A;  3B0U X;  4G7Z F;  3EGD B;  4NCQ A;  1NLX A;  5CIV A;  1ORS C;  3CZ6 A;  3WG7 C;  3JRM O;  3NG1 A;  1K40 A;  2M64 A;  3K66 A;  5KYY B;  2XLH A;  3GM2 A;  2X0C A;  3ZQY A;  3LLI A;  1GM5 A;  1EA8 A;  1BR4 A;  4MW8 A;  1VK5 A;  2H7O A;  4O6N A;  1LE2 A;  2X51 A;  2YQY A;  4JTC B;  4G7O F;  2A69 F;  3FHD A;  1D0Y A;  1Q0D A;  2Y39 A;  3K7D A;  3U8P A;  2XS1 A;  3HNK A;  1HY5 A;  4CBE A;  2J9U A;  4MW3 A;  1VYK A;  1YJG A;  2PX3 A;  2A1D D;  5KYX A;  1ZHY A;  4E18 A;  4IAR A;  3QMK A;  1TWC A;  4J7T A;  3M4B A;  2KYH A;  4HFK B;  4IJJ A;  3IPM O;  4OIN F;  5JT4 A;  3EZH A;  1M2O A;  2J9B A;  1HW2 A;  1O5H A;  1TWA A;  3LAY A;  1HW1 A;  3C8G A;  3C8Z A;  1VB5 A;  4ULW A;  1FAP B;  2FFH A;  3ATP A;  4N6H A;  3O55 A;  1ZW2 A;  4IWB A;  1KNY A;  2XM0 A;  3LS1 A;  4AK9 A;  5DQZ A;  4R32 A;  2QUP A;  2Y3B A;  3DI5 A;  3DE9 A;  3W8I A;  5K0I A;  3ITF A;  1M6T A;  1Q0M A;  2IOQ A;  2A68 F;  3L1M A;  4J32 B;  2XRH A;  5DVW A;  2KGO A;  1R5I D;  4Z9J A;  3RQF A;  5L0G A;  3S9O A;  1Z63 A;  5HV9 A;  1Q0K A;  3NKE A;  1VLT A;  4W8P A;  5DLJ A;  4MQ9 F;  1E2X A;  3WOD F;  2H7V C;  2WZG A;  2YL1 A;  5IY5 C;  3UR3 C;  1ZHX A;  2OOC A;  4BJT A;  1OW8 A;  2LIG A;  3TOL A;  1Z3I X;  4U5G A;  2Q9B A;  3ZC4 A;  1KTM A;  1Y4C A;  4BJ5 C;  4JJG A;  1JR8 A;  2OU6 A;  3IQT A;  2P1A A;  1G5Z A;  3AG4 C;  4GQH A;  2P7V A;  3SNH A;  2F22 A;  3N2Z B;  4NC3 A;  4DVY P;  5F5F A;  2IXM A;  1YAR O;  1GQA A;  2MHR A;  4O79 A;  4QDL A;  2WZL A;  3DJN B;  1ORY A;  3U2M A;  1RKE A;  3WAQ A;  3PDM P;  4CS7 A;  2XL4 A;  1TWH A;  4P6I C;  4A2N B;  1M56 C;  3U9M A;  4Q4Z F;  1GGQ A;  3T6G B;  3HNL A;  1SR2 A;  1T6I A;  3H65 A;  1T01 A;  4U5D E;  3S29 A;  4I3M A;  3U3F A;  2EPN A;  2P61 A;  3PHF 2;  3EG9 B;  2EIJ C;  1L3P A;  5D92 A;  2VB6 A;  5COM A;  4YK5 A;  4JE9 A;  3SYN A;  1RKC A;  3DAF A;  4JTD B;  4Z9I A;  1U89 A;  3PCV A;  1LS4 A;  4YT4 A;  1OXK A;  3R7C A;  3N24 A;  4EBJ A;  4QI2 A;  3A11 A;  4JEB A;  5COG A;  4U5H A;  4XWJ A;  2H8A A;  4AE4 A;  1ZZP A;  3LNM B;  4JJF A;  1WN0 A;  4X0R A;  4N4W A;  3NKD A;  3K33 A;  1RMV A;  3F46 A;  2KK1 A;  1DOV A;  4K1O A;  4I1O B;  2HMQ A;  2Y3D A;  3DM9 B;  3LEV A;  2EPL X;  3CEX A;  2PBE A;  3K6B A;  4GYT A;  4ZLD A;  3UMK A;  3TJ6 A;  2KJG A;  2Q9A A;  3QVZ A;  3QW1 A;  4EBK A;  4E7Z A;  1JPJ A;  1V54 C;  1NG1 A;  2M4E A;  1JMW A;  3NYL A;  2HJ3 A;  3RKO F;  2ZXR A;  3SXK A;  1LI7 A;  1NFN A;  4PFO A;  2D5R B;  2YWA A;  1D0Z A;  3W2W A;  5JUA A;  3CSK A;  1Z7Q c;  1JOG A;  3GWL A;  4MVM A;  2J0X A;  1JPN A;  4H54 A;  1HE9 A;  1HE1 A;  1TWG A;  3H2V A;  2IXP A;  4JUR I;  3TOM A;  3DZA A;  2IYL D;  2W4M A;  2YRF A;  3V5X A;  1VLS A;  1KU2 A;  1ZU5 A;  4MVZ A;  4OIP F;  3LES A;  5A69 A;  1YDI A;  2Q9C A;  5DS4 A;  3Q7L A;  3ASO C;  3V7O A;  1A7D A;  4HFF B;  4OIO F;  1ZHZ A;  4PAC A;  1BDJ B;  2ASR A;  3BEH A;  5AGF A;  2YEV A;  1WGW A;  3B0P A;  4CJO A;  1E84 A;  2JPU A;  3R2P A;  3RVY A;  3US6 A;  1MMN A;  2E87 A;  2PX0 A;  2R25 A;  1SZI A;  3IQ5 A;  3RF3 A;  3U9J A;  2UUH A;  1YAU O;  1D1C A;  3AQB A;  4MVR A;  2W4B A;  4YN0 B;  5JRA A;  1JAF A;  3AGU A;  1VOM A;  4J7Y A;  3C18 A;  4JRZ A;  5T3W A;  4B6I A;  4C7O A;  3SP1 A;  4BJ6 A;  5L0I A;  4PR9 A;  5T3T A;  4MND A;  2YKZ A;  3T9O A;  4DBR A;  4XEK A;  4E0H A;  4E17 A;  2CW0 F;  2P0N A;  1QZX A;  1XWJ A;  1I4Z A;  2XL8 A;  2WVN A;  3KL4 A;  3LLK A;  4JCH A;  3FAJ A;  2YL0 A;  3HLZ A;  1OKK A;  5DS6 A;  4DBQ A;  2NSG A;  2HJM A;  4L6R A;  4U9D A;  2VCC A;  1OCR C;  1G4U S;  2J9V A;  2WL8 A;  3GEH A;  1OR3 A;  4U5E E;  5CI8 A;  1SMY F;  5BQG A;  2R7T A;  4KNV A;  3NYM A;  3ZSU A;  4XLP F;  2CNW A;  4WAB A;  4W8K A;  3LNR A;  4JVS A;  5A6B D;  2EPM X;  3ZDL A;  2AWC A;  4KBL A;  3N0T A;  2DI3 A;  2GAQ A;  5FZT A;  4D4X A;  4PJN A;  4N6C A;  3ZVR A;  4PJJ A;  1M2V B;  2OQM A;  3K1I A;  4FAP B;  1NSG B;  1A7E A;  4FES A;  3DMD A;  5EK0 A;  2IXN A;  3S27 A;  5F5H A;  5DQT A;  3MBG A;  3W2V A;  2QNL A;  1ZYR F;  1ST6 A;  4IAO A;  1K04 A;  1MND A;  3TD7 A;  2XLV A;  4NQF A;  4G7H F;  1M57 C;  4PFP A;  2AVK A;  3RQE A;  4JW1 A;  1LM3 B;  1SYQ A;  5B1B C;  2R05 A;  3X1O A;  5L3Q A;  2I15 A;  2HFI A;  2HS5 A;  4DRI B;  5A6J A;  3NRH A;  4U9E A;  5JSL A;  3LEO A;  1ZHT A;  3AOU A;  4MVQ A;  3LS0 A;  2QLA A;  2G3V A;  3EGX B;  1MQV A;  2XXA A;  3QVY A;  1TQG A;  3CAX A;  1CGN A;  4BEJ A;  4XPY A;  3SEO A;  2HSB A;  2RD9 A;  5KYW A;  4NY3 A;  2IXO A;  2Q00 A;  2G62 A;  1BR1 A;  1WAS A;  4CIH A;  2R7U A;  5L0C A;  3S84 A;  1NFO A;  1N1C A;  2J45 A;  1ZW3 A;  2ZXP A;  2AP3 A;  3UMI A;  1OCO C;  5BUO A;  2R7Q A;  1YVI A;  3X2Q C;  1O87 A;  1YLM A;  5L0H A;  1EQ1 A;  3DJU B;  3Q6M A;  5L0D A;  2YVK A;  3MYF A;  1QPU A;  2EPK X;  5B1A C;  5E3A A;  1RCP A;  1YYJ A;  1OR2 A;  1C17 M;  1LVK A;  1OQC A;  2KW3 C;  2NUP A;  3OEO A;  3EH2 A;  3ZG1 A;  4YL1 A;  3SXY A;  1UG7 A;  3OWT A;  3TUL A;  1IZM A;  4JTA B;  4XTK A;  1S05 A;  1VMA A;  1RJ9 B;  3GM1 A;  1BZ4 A;  1A0B A;  3ZWI A;  2LD6 A;  1E85 A;  1FFH A;  3EFO A;  1RXQ A;  3CQZ A;  2P6V A;  4I1M A;  1WOL A;  2RSE B;  2Y3G A;  1D0X A;  1PD0 A;  4EWC A;  1OW6 A;  4FWV A;  1YA7 O;  1B68 A;  4P9F A;  4U5C E;  5BQI A;  2R7R A;  2BC5 A;  1R4T A;  2GFH A;  3HNJ A;  3SZR A;  2YHS A;  1E86 A;  1O3U A;  3JYY A;  1T5O A;  3LUT B;  1GS9 A;  5L0J A;  1T6Q A;  4CSA A;  2R7S A;  4LDQ A;  4OIQ F;  3G50 A;  5EHH A;  2OJE D;  2J0W A;  4EUK B;  4BJ6 C;  1YZC A;  3OA1 A;  4JKV A;  4J30 B;  2J46 A;  2J8W A;  2HUJ A;  3TK0 A;  3EHN A;  4BG0 A;  2AU5 A;  4M63 A;  3HJC A;  3DD7 A;  1LI5 A;  1LKX A;  3KPH A;  4IAQ A;  1LS1 A;  3ZIB A;  3IEE A;  2HMZ A;  2Q3T A;  3E9V A;  1JRA A;  2J7P D;  2R7O A;  4CIP A;  4WJ0 A;  256B A;  3GWN A;  4KI2 A;  5AC4 A;  3EGD A;  4E7S A;  1Z6A A;  3FOO A;  4Q7C A;  1G8X A;  5KYX B;  2D4U A;  5DS5 A;  5KYY A;  2ZXO A;  3EJN A;  3MX3 A;  2Y69 C;  3U8V A;  4G78 A;  3EZI A;  1V55 C;  3FVY A;  3C8G B;  2C04 A;  4DXW A;  1OCZ C; 
#chains in the Genus database with same CATH homology
 1XWJ A;  1RKE B;  1YDI A;  1DOV A;  2B0H A;  4K1O A;  1SYQ A;  1ZVZ A;  5L0J A;  3TJ6 A;  2L7A A;  3VF0 A;  1L7C A;  2GDC A;  1QKR A;  2LQG A;  4DJ9 A;  1TR2 A;  1RKE A;  1ZW2 A;  3H2U A;  5L0F A;  3RF3 A;  3T6G B;  1U6H A;  2X0C A;  1T01 A;  4P9T A;  3ZDL A;  2IBF A;  5FZT A;  1DOW A;  5L0G A;  5L0I A;  5L0C A;  4W8P A;  4EHP A;  1RKC A;  3S90 A;  1ZW3 A;  4IGG A;  1U89 A;  3H2V A;  4PR9 A;  2GWW A;  1ST6 A;  5L0H A;  2HSQ A;  1H6G A;  3TJ5 A;  4E17 A;  4ONS A;  4E18 A;  5L0D A;  3MYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...