3TJ5A

Human vinculin head domain (vh1, residues 1-258) in complex with the vinculin binding site of the surface cell antigen 4 (sca4-vbs-n; residues 412-434) from rickettsia rickettsii
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
254
structure length
254
Chain Sequence
b'PVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title The rickettsia surface cell antigen 4 applies mimicry to bind to and activate vinculin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/toxin
total genus 108
structure length 254
sequence length 254
ec nomenclature
pdb deposition date 2011-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3tj5A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3tj5A01
1QKRA 3H2UA 1RKCA 1U89A 3TJ6A 1YDIA 2HSQA 2X0CA 1T01A 4P9TA 1XWJA 2LQGA 4PR9A 5L0HA 1DOVA 3VF0A 5L0CA 4E18A 5L0JA 1H6GA 1TR2A 2L7AA 5L0GA 1ZW3A 4W8PA 4ONSA 4EHPA 1RKEA 1L7CA 1ZW2A 2GWWA 2GDCA 3TJ5A 3ZDLA 5L0IA 2IBFA 1DOWA 5FZTA 4IGGA 5L0DA 5L0FA 4DJ9A 3RF3A 1ST6A 2B0HA 4K1OA 1U6HA 4E17A 1SYQA 3MYIA 1ZVZA 3H2VA 3T6GB 1RKEB 3S90A
chains in the Genus database with same CATH superfamily
2R9RB 4H54A 3TOMA 3NG1A 2J7PD 1YLMA 4Z9IA 3DXJF 1I4ZA 3RW0A 2HV6A 2KQ9A 2XL6A 3NMIA 3LESA 4U5FE 3V5ZA 3AG2C 5D92A 4J32B 1KTMA 3TD7A 1KNYA 2EIKC 3EFOA 3MLGA 4LDKA 2H7VC 2A0BA 2W4MA 3KKBA 1VOMA 3DAGA 1WASA 2YQYA 2XLHA 2Q9BA 5CI9A 5B1BC 1OR3A 3ECSA 4I3MA 4NCQA 2A0UA 5F5HA 2R7UA 1Z63A 2GWWA 3EG9A 1EI7A 3AGTA 1H9TA 3V7OA 3IEEA 4AL1A 3W2WA 3E9VA 3A9CA 4IRUA 5KYYA 4WGZA 2EIJC 3MYIA 4MW3A 3EJNA 3T6GB 2OEXA 3LJBA 4OIRF 4EBBA 5A6JA 4OIOF 3EGDB 2OKUA 4XPXA 3C18A 2XLOA 1OQCA 3W2VA 1AUEA 1M57C 4JJGA 1H7IA 1ZU4A 4C7OB 3V5XA 2DYSC 1T01A 1XZQA 2ZXPA 3I5PA 4NTAA 3CAXA 3SP1A 4YN0B 1DOVA 3NYJA 3LLKA 5B3IA 2A1DD 4C3DA 2JPUA 4CIHA 2OJED 2G62A 1NU9C 3RQEA 2MYSA 3ZC4A 1D1BA 3G4XA 4AL0A 2R7TA 4MVSA 4GQHA 1OCRC 1Q0KA 4AE4B 3GEEA 3PDMP 1G4US 1RMVA 3X1OA 1MMNA 1NU7D 3UGOA 4QI2A 4ZLDA 3JYYA 4OIPF 5JP7A 5A6KA 3QVYA 2PBEA 4N6CA 2X0CA 1Q0DA 2LIGA 3K66A 2J0XA 1AVOB 4GEHA 3JZ0A 256BA 2Y39A 1I5NA 4I1OB 4MVMA 5HV9A 4Z9JA 3C63A 4U9EA 4JURI 3ZSUA 1VK5A 5JS5A 4G7ZF 3ITFA 1RCPA 1WTYA 1TKNA 3M79A 3QTHA 4JZAA 5T3WA 2LSEA 2BC5A 3LNMB 3QW1A 4JTCB 2J0WA 3NKEA 1D1AA 1OXBA 2L6HA 2YL7A 3EGXB 1D0XA 3RVZA 2UUHA 3K7DA 5DQTA 3LAYA 3B0UX 1QQ3A 5L0JA 4U5DE 1TR2A 4RD9A 5F28E 1MQVA 2VH3A 3C8GB 3W8IA 2J7PA 5A69A 4XPYA 4O6NA 2MHRA 1SMYF 1NSGB 3GM3A 5DS6A 4YT5A 3M4BA 4OIQF 1Y6DA 1G8XA 2P0NA 3T4RA 3KH2A 1OW8A 2KK1A 4BEMJ 3HTKC 3S0XA 2PNOA 1QKRA 1FR0A 1M2VB 3ZQYA 4EUKB 1U89A 3L8JA 3Q6NA 1TWCA 4LACB 2F22A 1BR2A 1CGOA 1WN0A 1TWHA 2HSBA 3AGUA 4NTFA 4RBNA 2FGYA 1FMVA 2P1AA 2CGEA 2XLWA 4YL0A 3O55A 4IJJA 1R4TA 3FVYA 4G0HA 1T5OA 2J9BA 3N0TA 4XEKA 4MQ9F 5JVEA 1GS9A 2XSEA 1A7VA 4XEFA 3GEIA 4YL1A 3WHNA 5EHHA 5AGFA 3EPVA 1NBBA 3IPMO 3JT1A 4MS2A 1PCXA 3TJ5A 3QVZA 5FZTA 1YZAA 4MTFA 4Q5SF 3KPHA 3ZG1A 1ST6A 1N1CA 4K1OA 3S9OA 3O6XA 2R7VA 1FFTC 5E3AA 4YT4A 3ZWIA 2DYRC 4MNDA 4LDQA 2PX3A 1KU2A 1HMOA 1K40A 4XEVA 3VYWA 1WGWA 3LUTB 3SXYA 2WZGA 1E86A 1OW6A 3KYIA 4BPMA 2WVOA 5KYWA 1HE1A 2P6VA 1QLEC 3DKAA 2NG1A 2NUPA 4LDRA 4U5EE 2DB4A 3RVYA 2QY9A 2XLVA 3DMDA 4EIYA 4CSAC 3POVA 1OR2A 2E87A 2XS1A 1BBHA 4O6YA 1A7DA 3NYMA 3O39A 1CPRA 2IOQA 1J8YF 2FAPB 3M15A 4U5CE 4YL3A 4XLPF 4YJWA 4DBQA 4EWCA 1ZHTA 1M56C 2CNWA 2Q9AA 2W45A 5E3CA 5JLIA 1FMWA 4O79A 4FAPB 1Q0FA 1D0YA 1ZHWA 1ZHYA 3ZTMA 3MYFA 4AK9A 1RJ9B 3S84A 3GWLA 3O10A 4QI0A 3E70C 5E2QA 3RIPA 3DWWA 3H2VA 4EHPA 1K05A 4IB4A 4DRIB 3LEOA 4LERA 3FOOA 3C8ZA 3I5QA 4AX2A 4W8KA 1OCZC 2BL2A 1M6TA 3HNJA 2EPMX 3IQTA 2R7OA 2RD9A 4JEBA 3NDBB 3R7CA 2L81A 3UMKA 3VM6A 5KYXB 4XLNF 2LP4A 1Z6AA 4CJGA 1LPEA 3WODF 3ZVRA 2MWQA 1T6IA 1M2OA 3CEXA 3OEOA 2VCBA 1ZW2A 2HZ8A 3LS1A 2VC9A 2NSGA 2QTVA 2ZXRA 4PFPA 1C03A 3DZAA 3EFOB 5EK0A 3RF3A 3W8HA 1U6HA 4KNWA 3L8IA 2WVNA 1K04A 1ZZPA 2YZSA 3WG7C 1LIHA 1O5HA 3U9JA 2WZLA 4JE9A 3ATPA 1GQAA 4M63A 3EG9B 2R7QA 1I4YA 4BJTA 4E0HA 1JOGA 1WATA 2HV7A 2H7OA 3TK0A 5DS4A 3FMSA 2R05A 1E84A 5KYYB 2XL4A 2H7BA 3FHDA 3AJMA 2LQGA 4LLEA 3MBGA 4CDVA 4CS8C 3GM2A 2JD3A 3JSZA 1E85A 2R7XA 3PMRA 3RYLA 1PD1A 5F5FA 3T6JA 1U0BB 2GFHA 2KYHA 1NFNA 2R25A 1RKEA 3JTLO 1NZEA 1QSPA 2LD6A 2ZXWC 4ULWA 3ZTZA 1YAUO 4N06A 1A41A 4DRJB 4EBKA 4KBLA 4YT8A 4O6MA 3C7JA 2J45A 4IWBA 4PACA 1Z5ZA 1ZHXA 2CNWD 5FCLA 2YL3A 1HMDA 3NRHA 4FESA 2LK4A 5A6BD 3HNLA 2WB7A 3GANA 3AG4C 2P61A 4JCHA 3AQBA 2I8BA 2C04A 4YT2A 2KW3C 3S29A 3BEHA 3RFYA 4H4KC 5HSWA 3F46A 3Q7LA 4JTDB 2CCYA 3TULA 2ASRA 2IYLD 5JSLA 1TFOB 2GAQA 1LE4A 3FAPB 1V55C 4CIPA 2CW0F 1YARO 1Z23A 2C03A 1L7CA 5DLJA 4C3EA 1D0ZA 4CS7A 4F4BA 5BUOA 5L0IA 2IBFA 1OCOC 2YLIA 3HLZA 3IQCA 2H8AA 1V74B 4KC9A 3UMHA 3W4YA 3OWTA 5DVWA 2XXAA 1YA9A 1YA7O 2HUJA 2KNHA 3LEVA 1G4WR 1SYQA 2R02A 1BZ4A 1SF8A 2X51A 3BRJA 3EH1A 1R5ID 2GA0A 2LFDA 1TFKB 4Q7CA 5KYUA 3FDQA 2W9YA 2V3CC 2HJ3A 2XM0A 3FOPA 1IW7F 4OD5A 4IAQA 1YJGA 2I15A 2D5RB 2ICWG 2NUTA 2A68F 3Q6MA 2QLAA 3G50A 4BJ5C 2J9VA 3PHF2 3SEOA 1LM3B 1A0BA 2XM4A 1OXKA 1Q0MA 2HMQA 4YK5A 3UGPA 2IXOA 3TQOA 1JRAA 1ZHZA 3MX3A 2OQMA 4MVOA 4UDVA 4JCZA 3B71A 1C17M 2IXMA 4P9FA 4NC3A 4BG0A 1QVXA 3Q7GA 1EKYA 1M2VA 1UFBA 1WOLA 2J8WA 4JKVA 4D4XA 5JT4A 1MMGA 2OOCA 1HW2A 3LS0A 4JEAA 4CBEA 2ZPAA 5L0FA 3X2QC 4DJ9A 4O7GA 3ZQVA 3CZ6A 1T6QA 5T1DB 4I1MA 3SYNA 4N6HA 5CI8A 4CDYA 4J7TA 1LE2A 3K1HA 1PV3A 1BDJB 3L0IA 4J7YA 4X0RA 2Z15A 5CIVA 1FAPB 1YZCA 4IAOA 3U5SA 1YDIA 1ZU5A 3ABKC 3SNHA 2XS8A 2Y3DA 5COMA 2YRFA 2EPOA 3NKDA 4BJ6A 4CSAA 1SR2A 1T6UA 2NPUA 3S27A 3M1CB 4P9TA 2YL1A 1ZYRF 1W2WA 4BJ6C 3CQZA 1A7EA 2VCAA 3C62A 3HKKA 1VTMP 4PFOA 1VYKA 2O9XA 2RSEB 3RH3A 3DM9B 5COGA 1LS4A 4JC7A 2KC3A 1LI7A 4DBRA 1D1CA 3CSKA 3GWNA 5EGYA 4JRZA 2L6GA 4PJNA 2J46A 5A6BA 1E83A 1CGME 1OKKA 5L0DA 2AP3A 1Z7Qc 4CDAA 4JJFA 4JTAB 2Y69C 4WABA 4B6IA 2V26A 4MVQA 2KSFA 2NSFA 3ABMC 4U5GA 5B1AC 1XZPA 5E33A 2UUIA 5L3QA 4G7HF 1YVIA 1JMWA 1OW7A 2XRHA 3H65A 3SXMA 2Q7RA 4KI2A 1VB5A 1MMDA 3EHMA 1RKCA 3ASNC 4E7ZA 3TJ6A 1TWAA 3N24A 1E2XA 1CGNA 1LI5A 3B9QA 1ORSC 4A2NB 5AC4A 1FFHA 2A6EF 2OG2A 1RJ9A 3DJNB 3MFNA 1XWJA 5L0HA 1FNTc 1EA8A 3ASOC 2XLDA 2XLEA 2ZXOA 3U2LA 3VRCA 3HNIA 2YLDA 3JRTA 1C02A 2L7AA 1SZIA 2AU5A 4W8PA 4LLCA 2P7VA 5DS5A 3C8GD 4CX9A 2EILC 3DE8A 4CS9A 3LLIA 5IY5C 4Q4ZF 4MTGA 2Y3BA 1LVKA 3EQLF 4P6IC 5JRAA 4CS9C 1MNDA 1UG7A 2XLMA 2IM8A 5B3SC 2Y3HA 1JAFA 3U3BA 3KYJA 1TQGA 4DXWA 5KYXA 3U8VA 1JPNA 3S90A 1EQ1A 1NG1A 1F1MA 4JW1A 1J8MF 3GEHA 5AC5A 3B29A 3F47A 1Y4CA 2Q00A 1L3PA 4K0DA 4FWVA 2TMVP 4Z9HA 3K1IA 4CS8A 3US6A 1OCCC 2EPKX 2YHSA 4OD4A 3JRMO 4E18A 3K1IC 4E0IA 2M64A 3GORA 4RDAA 1VMAA 3K6BA 3ZDLA 3AOUA 3EHNA 3EGDA 4EKWA 2R7SA 1BR1A 4DRHB 1PD0A 3G4ZA 2A6HF 4MVRA 4C7OA 2OCCC 4L6RA 3B0PA 1O3UA 4R32A 3IHUA 1RKEB 4HEAJ 1YYXA 2HFIA 3U3FA 3WAQA 5L3VA 3DAFA 3ZIBA 3JCUQ 4PJLA 3JYHA 1O87A 1ORJA 4PJMA 2HSQA 1FTSA 2YWAA 1OKKD 3DE9A 3DD7A 4AE4A 3B0VC 4YWQA 1GGQA 2BE5F 2IXNA 2R7RA 2YLGA 1B68A 4MVUA 2QE9A 3UNGC 3ABLC 3U0CA 4G7OF 3S28A 2KJGA 4C3BA 4MTOA 1CPQA 4GYTA 2B0HA 3OA1A 4HE8D 2W4BA 3UMIA 2AWYA 2YEVA 1HW1A 1JR8A 5JUAA 4U5HA 1V54C 2AWCA 4U5BE 4JIOA 4PR9A 2R7WA 3EGXA 3KL4A 2PF4E 2A69F 2ETSA 1VLSA 2XL8A 2HJMA 3DJUB 5BQHA 4BJ5A 3U9MA 4EBJA 5COFA 3U8PA 3C8GA 3A11A 2XXAB 4XWJA 1APCA 2EPNA 2OEVA 1WWPA 5K0IA 4WJ0A 1LS1A 3RQFA 5KYUB 3UR3C 4NY3A 3IQ5A 1H6GA 3NMKA 2L9JA 3DI5A 3NYLA 5L0GA 1VLTA 1NLXA 1ZW3A 2LCHA 4ONSA 2NUTB 1H9GA 2PP4A 2HKVA 2HS5A 3EZHA 1LKXA 2LFFA 2D4UA 2HMZA 5BQIA 4K7BA 3L1MA 1GM5A 5BQGA 2Q3TA 2R03A 2ZD9A 2KGOA 4G78A 1Z3IX 2YVKA 2G3VA 3AG3C 5D91A 1TWGA 5T3TA 2J9UA 1ZVZA 3HJCA 3RQGA 3AQCA 1HY5A 3U2MA 2AVKA 2EIMC 2WVQA 1IZMA 1QPUA 4D4NA 4XQ1A 4I44A 2PX0A 4OINF 3H2UA 1RXQA 2QUPA 3IQ6A 4U9DA 1HE9A 2B0JA 4ANJA 2M4EA 2Y3GA 4XTKA 2L6FA 3EH2A 4IARA 1T9KA 2EPLX 3L34A 3QZCA 2CDQA 1G5ZA 5A6AA 4DVYP 3GODA 1BR4A 4CJOA 3JSEO 5L0CA 3FXHA 4HFKB 1MMAA 3AG1C 4N4WA 4ER9A 2Q4FA 4E7SA 3I4UA 3EZIA 3NMJA 5TJ5E 3TOLA 4ZLCA 1NFOA 2WZFA 1V4AA 5KYWB 2VCCA 4ULVA 4HFFB 2NUPB 3DM5A 1DOWA 3KMIA 2DI3A 4IGGA 3V5YA 4DVZA 2FFHA 3HNKA 1JPJA 3K33A 3T9OA 3LNRA 3J06A 4BJ1A 1S7ZA 2VASA 2WL8A 2IXPA 4E17A 3QW0A 2QNLA 3RKOF 2OJQA 5KYNA 2YKZA 4WGYA 3R2PA 4FX5A 3N2ZB 2CYDA 3GM1A 3PCVA 2EINC 3QMKA 5DQZA 3SZRA 2PFDA 4MW8A 4NTBA 4PJJA 2OU6A 2JX0A 2VB6A 3FAJA 4NQFA 3VF0A 4BEJA 1QZXA 2DGJA 2G3KA 2YL0A 4XPWA 1Q0GA 2J9WA 4MVZA 2Q9CA 3SXZA 5GPGB 3VAYA 1MNEA 4PK4A 4KNVA 1AEPA 4JVSA 1VYIA 2GDCA 4QDLA 4A4AA 1S05A 1YYJA 3M4CA 3SXKA 1ORYA 4DOZA 4J30B 3T6BA
chains in the Genus database with same CATH topology
1QKRA 3H2UA 1RKCA 1U89A 3TJ6A 1YDIA 2HSQA 2X0CA 1T01A 4P9TA 1XWJA 2LQGA 4PR9A 5L0HA 1DOVA 3VF0A 5L0CA 4E18A 5L0JA 1H6GA 1TR2A 2L7AA 5L0GA 1ZW3A 4W8PA 4ONSA 4EHPA 1RKEA 1L7CA 1ZW2A 2GWWA 2GDCA 3TJ5A 3ZDLA 5L0IA 2IBFA 1DOWA 5FZTA 4IGGA 5L0DA 5L0FA 4DJ9A 3RF3A 1ST6A 2B0HA 4K1OA 1U6HA 4E17A 1SYQA 3MYIA 1ZVZA 3H2VA 3T6GB 1RKEB 3S90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKR A;  3H2U A;  1RKC A;  1U89 A;  3TJ6 A;  1YDI A;  2HSQ A;  2X0C A;  1T01 A;  4P9T A;  1XWJ A;  2LQG A;  4PR9 A;  5L0H A;  1DOV A;  3VF0 A;  5L0C A;  4E18 A;  5L0J A;  1H6G A;  1TR2 A;  2L7A A;  5L0G A;  1ZW3 A;  4W8P A;  4ONS A;  4EHP A;  1RKE A;  1L7C A;  1ZW2 A;  2GWW A;  2GDC A;  3TJ5 A;  3ZDL A;  5L0I A;  2IBF A;  1DOW A;  5FZT A;  4IGG A;  5L0D A;  5L0F A;  4DJ9 A;  3RF3 A;  1ST6 A;  2B0H A;  4K1O A;  1U6H A;  4E17 A;  1SYQ A;  3MYI A;  1ZVZ A;  3H2V A;  3T6G B;  1RKE B;  3S90 A; 
#chains in the Genus database with same CATH topology
 2R9R B;  4H54 A;  3TOM A;  3NG1 A;  2J7P D;  1YLM A;  4Z9I A;  3DXJ F;  1I4Z A;  3RW0 A;  2HV6 A;  2KQ9 A;  2XL6 A;  3NMI A;  3LES A;  4U5F E;  3V5Z A;  3AG2 C;  5D92 A;  4J32 B;  1KTM A;  3TD7 A;  1KNY A;  2EIK C;  3EFO A;  3MLG A;  4LDK A;  2H7V C;  2A0B A;  2W4M A;  3KKB A;  1VOM A;  3DAG A;  1WAS A;  2YQY A;  2XLH A;  2Q9B A;  5CI9 A;  5B1B C;  1OR3 A;  3ECS A;  4I3M A;  4NCQ A;  2A0U A;  5F5H A;  2R7U A;  1Z63 A;  2GWW A;  3EG9 A;  1EI7 A;  3AGT A;  1H9T A;  3V7O A;  3IEE A;  4AL1 A;  3W2W A;  3E9V A;  3A9C A;  4IRU A;  5KYY A;  4WGZ A;  2EIJ C;  3MYI A;  4MW3 A;  3EJN A;  3T6G B;  2OEX A;  3LJB A;  4OIR F;  4EBB A;  5A6J A;  4OIO F;  3EGD B;  2OKU A;  4XPX A;  3C18 A;  2XLO A;  1OQC A;  3W2V A;  1AUE A;  1M57 C;  4JJG A;  1H7I A;  1ZU4 A;  4C7O B;  3V5X A;  2DYS C;  1T01 A;  1XZQ A;  2ZXP A;  3I5P A;  4NTA A;  3CAX A;  3SP1 A;  4YN0 B;  1DOV A;  3NYJ A;  3LLK A;  5B3I A;  2A1D D;  4C3D A;  2JPU A;  4CIH A;  2OJE D;  2G62 A;  1NU9 C;  3RQE A;  2MYS A;  3ZC4 A;  1D1B A;  3G4X A;  4AL0 A;  2R7T A;  4MVS A;  4GQH A;  1OCR C;  1Q0K A;  4AE4 B;  3GEE A;  3PDM P;  1G4U S;  1RMV A;  3X1O A;  1MMN A;  1NU7 D;  3UGO A;  4QI2 A;  4ZLD A;  3JYY A;  4OIP F;  5JP7 A;  5A6K A;  3QVY A;  2PBE A;  4N6C A;  2X0C A;  1Q0D A;  2LIG A;  3K66 A;  2J0X A;  1AVO B;  4GEH A;  3JZ0 A;  256B A;  2Y39 A;  1I5N A;  4I1O B;  4MVM A;  5HV9 A;  4Z9J A;  3C63 A;  4U9E A;  4JUR I;  3ZSU A;  1VK5 A;  5JS5 A;  4G7Z F;  3ITF A;  1RCP A;  1WTY A;  1TKN A;  3M79 A;  3QTH A;  4JZA A;  5T3W A;  2LSE A;  2BC5 A;  3LNM B;  3QW1 A;  4JTC B;  2J0W A;  3NKE A;  1D1A A;  1OXB A;  2L6H A;  2YL7 A;  3EGX B;  1D0X A;  3RVZ A;  2UUH A;  3K7D A;  5DQT A;  3LAY A;  3B0U X;  1QQ3 A;  5L0J A;  4U5D E;  1TR2 A;  4RD9 A;  5F28 E;  1MQV A;  2VH3 A;  3C8G B;  3W8I A;  2J7P A;  5A69 A;  4XPY A;  4O6N A;  2MHR A;  1SMY F;  1NSG B;  3GM3 A;  5DS6 A;  4YT5 A;  3M4B A;  4OIQ F;  1Y6D A;  1G8X A;  2P0N A;  3T4R A;  3KH2 A;  1OW8 A;  2KK1 A;  4BEM J;  3HTK C;  3S0X A;  2PNO A;  1QKR A;  1FR0 A;  1M2V B;  3ZQY A;  4EUK B;  1U89 A;  3L8J A;  3Q6N A;  1TWC A;  4LAC B;  2F22 A;  1BR2 A;  1CGO A;  1WN0 A;  1TWH A;  2HSB A;  3AGU A;  4NTF A;  4RBN A;  2FGY A;  1FMV A;  2P1A A;  2CGE A;  2XLW A;  4YL0 A;  3O55 A;  4IJJ A;  1R4T A;  3FVY A;  4G0H A;  1T5O A;  2J9B A;  3N0T A;  4XEK A;  4MQ9 F;  5JVE A;  1GS9 A;  2XSE A;  1A7V A;  4XEF A;  3GEI A;  4YL1 A;  3WHN A;  5EHH A;  5AGF A;  3EPV A;  1NBB A;  3IPM O;  3JT1 A;  4MS2 A;  1PCX A;  3TJ5 A;  3QVZ A;  5FZT A;  1YZA A;  4MTF A;  4Q5S F;  3KPH A;  3ZG1 A;  1ST6 A;  1N1C A;  4K1O A;  3S9O A;  3O6X A;  2R7V A;  1FFT C;  5E3A A;  4YT4 A;  3ZWI A;  2DYR C;  4MND A;  4LDQ A;  2PX3 A;  1KU2 A;  1HMO A;  1K40 A;  4XEV A;  3VYW A;  1WGW A;  3LUT B;  3SXY A;  2WZG A;  1E86 A;  1OW6 A;  3KYI A;  4BPM A;  2WVO A;  5KYW A;  1HE1 A;  2P6V A;  1QLE C;  3DKA A;  2NG1 A;  2NUP A;  4LDR A;  4U5E E;  2DB4 A;  3RVY A;  2QY9 A;  2XLV A;  3DMD A;  4EIY A;  4CSA C;  3POV A;  1OR2 A;  2E87 A;  2XS1 A;  1BBH A;  4O6Y A;  1A7D A;  3NYM A;  3O39 A;  1CPR A;  2IOQ A;  1J8Y F;  2FAP B;  3M15 A;  4U5C E;  4YL3 A;  4XLP F;  4YJW A;  4DBQ A;  4EWC A;  1ZHT A;  1M56 C;  2CNW A;  2Q9A A;  2W45 A;  5E3C A;  5JLI A;  1FMW A;  4O79 A;  4FAP B;  1Q0F A;  1D0Y A;  1ZHW A;  1ZHY A;  3ZTM A;  3MYF A;  4AK9 A;  1RJ9 B;  3S84 A;  3GWL A;  3O10 A;  4QI0 A;  3E70 C;  5E2Q A;  3RIP A;  3DWW A;  3H2V A;  4EHP A;  1K05 A;  4IB4 A;  4DRI B;  3LEO A;  4LER A;  3FOO A;  3C8Z A;  3I5Q A;  4AX2 A;  4W8K A;  1OCZ C;  2BL2 A;  1M6T A;  3HNJ A;  2EPM X;  3IQT A;  2R7O A;  2RD9 A;  4JEB A;  3NDB B;  3R7C A;  2L81 A;  3UMK A;  3VM6 A;  5KYX B;  4XLN F;  2LP4 A;  1Z6A A;  4CJG A;  1LPE A;  3WOD F;  3ZVR A;  2MWQ A;  1T6I A;  1M2O A;  3CEX A;  3OEO A;  2VCB A;  1ZW2 A;  2HZ8 A;  3LS1 A;  2VC9 A;  2NSG A;  2QTV A;  2ZXR A;  4PFP A;  1C03 A;  3DZA A;  3EFO B;  5EK0 A;  3RF3 A;  3W8H A;  1U6H A;  4KNW A;  3L8I A;  2WVN A;  1K04 A;  1ZZP A;  2YZS A;  3WG7 C;  1LIH A;  1O5H A;  3U9J A;  2WZL A;  4JE9 A;  3ATP A;  1GQA A;  4M63 A;  3EG9 B;  2R7Q A;  1I4Y A;  4BJT A;  4E0H A;  1JOG A;  1WAT A;  2HV7 A;  2H7O A;  3TK0 A;  5DS4 A;  3FMS A;  2R05 A;  1E84 A;  5KYY B;  2XL4 A;  2H7B A;  3FHD A;  3AJM A;  2LQG A;  4LLE A;  3MBG A;  4CDV A;  4CS8 C;  3GM2 A;  2JD3 A;  3JSZ A;  1E85 A;  2R7X A;  3PMR A;  3RYL A;  1PD1 A;  5F5F A;  3T6J A;  1U0B B;  2GFH A;  2KYH A;  1NFN A;  2R25 A;  1RKE A;  3JTL O;  1NZE A;  1QSP A;  2LD6 A;  2ZXW C;  4ULW A;  3ZTZ A;  1YAU O;  4N06 A;  1A41 A;  4DRJ B;  4EBK A;  4KBL A;  4YT8 A;  4O6M A;  3C7J A;  2J45 A;  4IWB A;  4PAC A;  1Z5Z A;  1ZHX A;  2CNW D;  5FCL A;  2YL3 A;  1HMD A;  3NRH A;  4FES A;  2LK4 A;  5A6B D;  3HNL A;  2WB7 A;  3GAN A;  3AG4 C;  2P61 A;  4JCH A;  3AQB A;  2I8B A;  2C04 A;  4YT2 A;  2KW3 C;  3S29 A;  3BEH A;  3RFY A;  4H4K C;  5HSW A;  3F46 A;  3Q7L A;  4JTD B;  2CCY A;  3TUL A;  2ASR A;  2IYL D;  5JSL A;  1TFO B;  2GAQ A;  1LE4 A;  3FAP B;  1V55 C;  4CIP A;  2CW0 F;  1YAR O;  1Z23 A;  2C03 A;  1L7C A;  5DLJ A;  4C3E A;  1D0Z A;  4CS7 A;  4F4B A;  5BUO A;  5L0I A;  2IBF A;  1OCO C;  2YLI A;  3HLZ A;  3IQC A;  2H8A A;  1V74 B;  4KC9 A;  3UMH A;  3W4Y A;  3OWT A;  5DVW A;  2XXA A;  1YA9 A;  1YA7 O;  2HUJ A;  2KNH A;  3LEV A;  1G4W R;  1SYQ A;  2R02 A;  1BZ4 A;  1SF8 A;  2X51 A;  3BRJ A;  3EH1 A;  1R5I D;  2GA0 A;  2LFD A;  1TFK B;  4Q7C A;  5KYU A;  3FDQ A;  2W9Y A;  2V3C C;  2HJ3 A;  2XM0 A;  3FOP A;  1IW7 F;  4OD5 A;  4IAQ A;  1YJG A;  2I15 A;  2D5R B;  2ICW G;  2NUT A;  2A68 F;  3Q6M A;  2QLA A;  3G50 A;  4BJ5 C;  2J9V A;  3PHF 2;  3SEO A;  1LM3 B;  1A0B A;  2XM4 A;  1OXK A;  1Q0M A;  2HMQ A;  4YK5 A;  3UGP A;  2IXO A;  3TQO A;  1JRA A;  1ZHZ A;  3MX3 A;  2OQM A;  4MVO A;  4UDV A;  4JCZ A;  3B71 A;  1C17 M;  2IXM A;  4P9F A;  4NC3 A;  4BG0 A;  1QVX A;  3Q7G A;  1EKY A;  1M2V A;  1UFB A;  1WOL A;  2J8W A;  4JKV A;  4D4X A;  5JT4 A;  1MMG A;  2OOC A;  1HW2 A;  3LS0 A;  4JEA A;  4CBE A;  2ZPA A;  5L0F A;  3X2Q C;  4DJ9 A;  4O7G A;  3ZQV A;  3CZ6 A;  1T6Q A;  5T1D B;  4I1M A;  3SYN A;  4N6H A;  5CI8 A;  4CDY A;  4J7T A;  1LE2 A;  3K1H A;  1PV3 A;  1BDJ B;  3L0I A;  4J7Y A;  4X0R A;  2Z15 A;  5CIV A;  1FAP B;  1YZC A;  4IAO A;  3U5S A;  1YDI A;  1ZU5 A;  3ABK C;  3SNH A;  2XS8 A;  2Y3D A;  5COM A;  2YRF A;  2EPO A;  3NKD A;  4BJ6 A;  4CSA A;  1SR2 A;  1T6U A;  2NPU A;  3S27 A;  3M1C B;  4P9T A;  2YL1 A;  1ZYR F;  1W2W A;  4BJ6 C;  3CQZ A;  1A7E A;  2VCA A;  3C62 A;  3HKK A;  1VTM P;  4PFO A;  1VYK A;  2O9X A;  2RSE B;  3RH3 A;  3DM9 B;  5COG A;  1LS4 A;  4JC7 A;  2KC3 A;  1LI7 A;  4DBR A;  1D1C A;  3CSK A;  3GWN A;  5EGY A;  4JRZ A;  2L6G A;  4PJN A;  2J46 A;  5A6B A;  1E83 A;  1CGM E;  1OKK A;  5L0D A;  2AP3 A;  1Z7Q c;  4CDA A;  4JJF A;  4JTA B;  2Y69 C;  4WAB A;  4B6I A;  2V26 A;  4MVQ A;  2KSF A;  2NSF A;  3ABM C;  4U5G A;  5B1A C;  1XZP A;  5E33 A;  2UUI A;  5L3Q A;  4G7H F;  1YVI A;  1JMW A;  1OW7 A;  2XRH A;  3H65 A;  3SXM A;  2Q7R A;  4KI2 A;  1VB5 A;  1MMD A;  3EHM A;  1RKC A;  3ASN C;  4E7Z A;  3TJ6 A;  1TWA A;  3N24 A;  1E2X A;  1CGN A;  1LI5 A;  3B9Q A;  1ORS C;  4A2N B;  5AC4 A;  1FFH A;  2A6E F;  2OG2 A;  1RJ9 A;  3DJN B;  3MFN A;  1XWJ A;  5L0H A;  1FNT c;  1EA8 A;  3ASO C;  2XLD A;  2XLE A;  2ZXO A;  3U2L A;  3VRC A;  3HNI A;  2YLD A;  3JRT A;  1C02 A;  2L7A A;  1SZI A;  2AU5 A;  4W8P A;  4LLC A;  2P7V A;  5DS5 A;  3C8G D;  4CX9 A;  2EIL C;  3DE8 A;  4CS9 A;  3LLI A;  5IY5 C;  4Q4Z F;  4MTG A;  2Y3B A;  1LVK A;  3EQL F;  4P6I C;  5JRA A;  4CS9 C;  1MND A;  1UG7 A;  2XLM A;  2IM8 A;  5B3S C;  2Y3H A;  1JAF A;  3U3B A;  3KYJ A;  1TQG A;  4DXW A;  5KYX A;  3U8V A;  1JPN A;  3S90 A;  1EQ1 A;  1NG1 A;  1F1M A;  4JW1 A;  1J8M F;  3GEH A;  5AC5 A;  3B29 A;  3F47 A;  1Y4C A;  2Q00 A;  1L3P A;  4K0D A;  4FWV A;  2TMV P;  4Z9H A;  3K1I A;  4CS8 A;  3US6 A;  1OCC C;  2EPK X;  2YHS A;  4OD4 A;  3JRM O;  4E18 A;  3K1I C;  4E0I A;  2M64 A;  3GOR A;  4RDA A;  1VMA A;  3K6B A;  3ZDL A;  3AOU A;  3EHN A;  3EGD A;  4EKW A;  2R7S A;  1BR1 A;  4DRH B;  1PD0 A;  3G4Z A;  2A6H F;  4MVR A;  4C7O A;  2OCC C;  4L6R A;  3B0P A;  1O3U A;  4R32 A;  3IHU A;  1RKE B;  4HEA J;  1YYX A;  2HFI A;  3U3F A;  3WAQ A;  5L3V A;  3DAF A;  3ZIB A;  3JCU Q;  4PJL A;  3JYH A;  1O87 A;  1ORJ A;  4PJM A;  2HSQ A;  1FTS A;  2YWA A;  1OKK D;  3DE9 A;  3DD7 A;  4AE4 A;  3B0V C;  4YWQ A;  1GGQ A;  2BE5 F;  2IXN A;  2R7R A;  2YLG A;  1B68 A;  4MVU A;  2QE9 A;  3UNG C;  3ABL C;  3U0C A;  4G7O F;  3S28 A;  2KJG A;  4C3B A;  4MTO A;  1CPQ A;  4GYT A;  2B0H A;  3OA1 A;  4HE8 D;  2W4B A;  3UMI A;  2AWY A;  2YEV A;  1HW1 A;  1JR8 A;  5JUA A;  4U5H A;  1V54 C;  2AWC A;  4U5B E;  4JIO A;  4PR9 A;  2R7W A;  3EGX A;  3KL4 A;  2PF4 E;  2A69 F;  2ETS A;  1VLS A;  2XL8 A;  2HJM A;  3DJU B;  5BQH A;  4BJ5 A;  3U9M A;  4EBJ A;  5COF A;  3U8P A;  3C8G A;  3A11 A;  2XXA B;  4XWJ A;  1APC A;  2EPN A;  2OEV A;  1WWP A;  5K0I A;  4WJ0 A;  1LS1 A;  3RQF A;  5KYU B;  3UR3 C;  4NY3 A;  3IQ5 A;  1H6G A;  3NMK A;  2L9J A;  3DI5 A;  3NYL A;  5L0G A;  1VLT A;  1NLX A;  1ZW3 A;  2LCH A;  4ONS A;  2NUT B;  1H9G A;  2PP4 A;  2HKV A;  2HS5 A;  3EZH A;  1LKX A;  2LFF A;  2D4U A;  2HMZ A;  5BQI A;  4K7B A;  3L1M A;  1GM5 A;  5BQG A;  2Q3T A;  2R03 A;  2ZD9 A;  2KGO A;  4G78 A;  1Z3I X;  2YVK A;  2G3V A;  3AG3 C;  5D91 A;  1TWG A;  5T3T A;  2J9U A;  1ZVZ A;  3HJC A;  3RQG A;  3AQC A;  1HY5 A;  3U2M A;  2AVK A;  2EIM C;  2WVQ A;  1IZM A;  1QPU A;  4D4N A;  4XQ1 A;  4I44 A;  2PX0 A;  4OIN F;  3H2U A;  1RXQ A;  2QUP A;  3IQ6 A;  4U9D A;  1HE9 A;  2B0J A;  4ANJ A;  2M4E A;  2Y3G A;  4XTK A;  2L6F A;  3EH2 A;  4IAR A;  1T9K A;  2EPL X;  3L34 A;  3QZC A;  2CDQ A;  1G5Z A;  5A6A A;  4DVY P;  3GOD A;  1BR4 A;  4CJO A;  3JSE O;  5L0C A;  3FXH A;  4HFK B;  1MMA A;  3AG1 C;  4N4W A;  4ER9 A;  2Q4F A;  4E7S A;  3I4U A;  3EZI A;  3NMJ A;  5TJ5 E;  3TOL A;  4ZLC A;  1NFO A;  2WZF A;  1V4A A;  5KYW B;  2VCC A;  4ULV A;  4HFF B;  2NUP B;  3DM5 A;  1DOW A;  3KMI A;  2DI3 A;  4IGG A;  3V5Y A;  4DVZ A;  2FFH A;  3HNK A;  1JPJ A;  3K33 A;  3T9O A;  3LNR A;  3J06 A;  4BJ1 A;  1S7Z A;  2VAS A;  2WL8 A;  2IXP A;  4E17 A;  3QW0 A;  2QNL A;  3RKO F;  2OJQ A;  5KYN A;  2YKZ A;  4WGY A;  3R2P A;  4FX5 A;  3N2Z B;  2CYD A;  3GM1 A;  3PCV A;  2EIN C;  3QMK A;  5DQZ A;  3SZR A;  2PFD A;  4MW8 A;  4NTB A;  4PJJ A;  2OU6 A;  2JX0 A;  2VB6 A;  3FAJ A;  4NQF A;  3VF0 A;  4BEJ A;  1QZX A;  2DGJ A;  2G3K A;  2YL0 A;  4XPW A;  1Q0G A;  2J9W A;  4MVZ A;  2Q9C A;  3SXZ A;  5GPG B;  3VAY A;  1MNE A;  4PK4 A;  4KNV A;  1AEP A;  4JVS A;  1VYI A;  2GDC A;  4QDL A;  4A4A A;  1S05 A;  1YYJ A;  3M4C A;  3SXK A;  1ORY A;  4DOZ A;  4J30 B;  3T6B A; 
#chains in the Genus database with same CATH homology
 1QKR A;  3H2U A;  1RKC A;  1U89 A;  3TJ6 A;  1YDI A;  2HSQ A;  2X0C A;  1T01 A;  4P9T A;  1XWJ A;  2LQG A;  4PR9 A;  5L0H A;  1DOV A;  3VF0 A;  5L0C A;  4E18 A;  5L0J A;  1H6G A;  1TR2 A;  2L7A A;  5L0G A;  1ZW3 A;  4W8P A;  4ONS A;  4EHP A;  1RKE A;  1L7C A;  1ZW2 A;  2GWW A;  2GDC A;  3TJ5 A;  3ZDL A;  5L0I A;  2IBF A;  1DOW A;  5FZT A;  4IGG A;  5L0D A;  5L0F A;  4DJ9 A;  3RF3 A;  1ST6 A;  2B0H A;  4K1O A;  1U6H A;  4E17 A;  1SYQ A;  3MYI A;  1ZVZ A;  3H2V A;  3T6G B;  1RKE B;  3S90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...