3TJ6A

Human vinculin head domain (vh1, residues 1-258) in complex with the vinculin binding site of the surface cell antigen 4 (sca4-vbs-c; residues 812-835) from rickettsia rickettsii
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
257
structure length
253
Chain Sequence
MPVFHTRTIESILEPVAQQISHLVIMHEEGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vinculin
publication title The rickettsia surface cell antigen 4 applies mimicry to bind to and activate vinculin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/toxin
total genus 104
structure length 253
sequence length 257
ec nomenclature
pdb deposition date 2011-08-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3tj6A02
1.20.120.230 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Alpha-catenin/vinculin-like 3tj6A01
1SYQA 4P9TA 3TJ5A 5FZTA 4DJ9A 1L7CA 5L0FA 1U89A 2L7AA 5L0HA 2LQGA 1TR2A 5L0DA 5L0JA 1XWJA 1H6GA 2IBFA 2GDCA 3MYIA 3H2UA 3TJ6A 4E17A 4IGGA 1T01A 1RKEB 3ZDLA 1DOVA 3RF3A 5L0IA 3S90A 4PR9A 2B0HA 1QKRA 1ST6A 1ZW2A 2GWWA 4K1OA 2X0CA 4ONSA 4W8PA 2HSQA 1ZW3A 1U6HA 1YDIA 1ZVZA 3VF0A 3T6GB 3H2VA 4E18A 5L0CA 5L0GA 4EHPA 1RKCA 1DOWA 1RKEA
chains in the Genus database with same CATH superfamily
1D0XA 4MTFA 3CZ6A 3EQLF 3F46A 1BDJB 4H4KC 3MYFA 3B9QA 2LQGA 2EPKX 3EHMA 4NQFA 3EZIA 1FNTc 1L3PA 4J7TA 2PX3A 3EZHA 2YL0A 1E83A 2W9YA 2H8AA 1WWPA 4WABA 2HV7A 1GM5A 3SXKA 4ULWA 1YAUO 3BRJA 3VYWA 3DI5A 1ORSC 2XLVA 4PJMA 5T3WA 4DBRA 3SYNA 4CSAC 3U8PA 4U5BE 2J9UA 1G4WR 4MQ9F 4PR9A 4AL1A 1GGQA 3EGXB 2W4MA 4YN0B 3ZTZA 5JP7A 2XL6A 2HMZA 4E0HA 4CIPA 2CNWA 3CEXA 2CW0F 4OD4A 5F5HA 3ZIBA 4DVYP 1FR0A 1O3UA 3C7JA 2W45A 2M4EA 3LJBA 3LLIA 2A0BA 4JTCB 4CS9C 3RW0A 2CNWD 2Z15A 3W8IA 4OINF 5JUAA 2P61A 2RD9A 4MS2A 4G7OF 4GYTA 2XLDA 4MVSA 4OIPF 3TJ5A 4NTBA 1SZIA 2J45A 1BZ4A 1C02A 3QZCA 4BJ6C 2L6GA 2XL8A 4G7ZF 3C8GA 1XWJA 1HW1A 3DZAA 4JC7A 1NBBA 4PJJA 3KMIA 3M79A 3RH3A 4JURI 3SZRA 1WGWA 1V55C 2DB4A 2XS8A 3A11A 3UGOA 3C8GD 3RF3A 2YKZA 4OIRF 1BBHA 3K33A 4WGZA 2XXAB 1LVKA 1WOLA 2IM8A 4I1OB 1OCZC 3LLKA 3LNRA 3FOPA 2HV6A 4H54A 4Z9JA 3AQBA 2QUPA 2NPUA 2KK1A 3AJMA 4BJTA 2EINC 3DD7A 4CX9A 3EFOA 3E9VA 2XM0A 3FVYA 2R25A 3W8HA 1PD0A 3CAXA 1LI7A 4I3MA 4LERA 5L0CA 5KYUA 2YWAA 3IQ5A 1XZPA 2LFDA 4N6CA 3R2PA 1VLTA 3EGDA 3U2LA 2XLMA 4D4NA 3S84A 4OIOF 3B0PA 1JAFA 2HS5A 2LIGA 3N2ZB 4RBNA 5DQTA 3FHDA 2OEXA 1OR3A 3PDMP 1M2VB 1HW2A 2IBFA 3HKKA 3KYJA 3S0XA 2GDCA 2Y3DA 5T3TA 3JRMO 3WG7C 4D4XA 3NG1A 2I15A 2ETSA 1R5ID 5E3CA 5L0IA 3PHF2 4DRIB 4MVQA 3QMKA 4MTOA 4GEHA 5E3AA 3RVZA 3EH2A 2ZXOA 3OEOA 2P7VA 1PV3A 2AU5A 4W8KA 1ZYRF 3ECSA 4HE8D 4XEKA 4G7HF 2HUJA 1NG1A 3TOMA 1ZW3A 2TMVP 3ZSUA 3ZG1A 5IY5C 5KYNA 5CIVA 1OQCA 2YL7A 2R7VA 3LS0A 5BQGA 1NZEA 3SP1A 3GM3A 1VB5A 4CDAA 5DVWA 3DJNB 1YZCA 3KKBA 4DRJB 4PFPA 2OJED 2Q7RA 1LM3B 256BA 4JJFA 3U9JA 1OW6A 4JKVA 4AL0A 1OCRC 4FAPB 3QTHA 1HE9A 1KU2A 1Q0KA 3NMKA 1ZU5A 4K7BA 4XTKA 4EIYA 2R7RA 2M64A 1VK5A 2H7BA 3DKAA 2GAQA 2AVKA 4JTAB 2PF4E 2H7OA 4BJ5A 4YWQA 2OJQA 4YT2A 4DRHB 1CPRA 2GWWA 2KC3A 1Y4CA 1W2WA 2O9XA 3IQ6A 3L8IA 4K1OA 4NC3A 4W8PA 4PK4A 4OD5A 1NU7D 2EILC 4XEFA 4MW3A 2L6FA 5B1BC 3GEEA 2IXMA 2CCYA 2W4BA 3HNLA 1U6HA 3H2VA 2JX0A 3IQCA 1AVOB 3LNMB 3MX3A 4LLEA 2EPMX 2XLHA 4U5DE 5DS6A 4CSAA 1M57C 2LP4A 2UUIA 4U5GA 5KYYB 5L0FA 1J8MF 5DS5A 5KYXA 3DWWA 1BR4A 2PNOA 2Q9AA 3EGXA 3MBGA 3B0VC 3LS1A 3PCVA 1Q0FA 5E2QA 1OCCC 4BG0A 1KTMA 3JZ0A 1NFNA 5T1DB 1T5OA 3RVYA 1OXKA 1ST6A 4B6IA 3TULA 2J9BA 5DQZA 1O87A 4BJ6A 2VC9A 1MQVA 1H9TA 1PD1A 3V5YA 2OOCA 2WVQA 2OU6A 1NU9C 3ABLC 3NKDA 4U5CE 1G8XA 2R03A 5JSLA 3ABKC 2YLIA 3AG2C 3GWNA 1YA9A 5EK0A 1V74B 1Y6DA 4N6HA 3TK0A 2XXAA 5L0HA 3HTKC 1TKNA 4PJLA 4U5FE 2XLWA 3ATPA 3VRCA 2PP4A 3M15A 1IW7F 1FFTC 3MYIA 1UG7A 2Q3TA 4JCHA 4HFKB 4DVZA 4E17A 5CI9A 5B1AC 2FAPB 3U5SA 5AC5A 2A6EF 2L6HA 3QVZA 4CS7A 4JEBA 3ITFA 1O5HA 1H9GA 1M2OA 3LESA 2CDQA 3S28A 1CPQA 2DI3A 1V4AA 2NUTB 5COFA 3E70C 1D0YA 2E87A 1LE4A 2JPUA 2P1AA 3IHUA 2IXNA 1CGME 1M2VA 4KC9A 3L1MA 4EBJA 1DOWA 2G3KA 3IQTA 1OW7A 2X51A 1B68A 1GQAA 2QY9A 1M6TA 1TFOB 2D4UA 4YL0A 3AG1C 2HZ8A 4LDKA 1Q0MA 4WJ0A 3V5ZA 1RCPA 4NTAA 3SXYA 2Y3HA 2L81A 2RSEB 3K66A 4MVRA 3VM6A 1Z6AA 1OW8A 3HLZA 4XWJA 3EG9B 3T4RA 3EPVA 3O6XA 4QDLA 2XS1A 2XSEA 4YJWA 1FAPB 4J7YA 2HJMA 1Z7Qc 4C3EA 4Q5SF 2OCCC 3BEHA 3K1HA 4K0DA 5A6BA 3MLGA 1JRAA 1ZVZA 1VOMA 2WL8A 4CDYA 4Z9HA 2A0UA 5JVEA 1NFOA 1BR2A 2DYSC 4IB4A 4O6YA 3V7OA 1SYQA 4JZAA 5A6BD 3EHNA 4ER9A 2HMQA 3SXMA 2EIMC 1E2XA 1FTSA 3MFNA 1TR2A 3G50A 2YL1A 3Q6MA 3GM2A 2EIJC 2ZXWC 3F47A 2WB7A 4KNVA 4BJ1A 3U3FA 2EIKC 4CS8C 2ZXRA 1FMWA 2OEVA 5F5FA 3O39A 2MHRA 4JEAA 4GQHA 3NMJA 5AC4A 2CGEA 1QKRA 3DJUB 3KL4A 3Q6NA 2KGOA 4G78A 4ONSA 1E84A 4BEMJ 2WZGA 5KYYA 5BQHA 4E7SA 3DM5A 1TWCA 4IAQA 4N06A 2BE5F 1YJGA 4YT8A 1N1CA 3C8ZA 5JLIA 1TFKB 2A1DD 2KNHA 1OCOC 2Y3GA 5A6AA 2R02A 4CDVA 2R7TA 3DXJF 3N0TA 2EPOA 2Y3BA 3O10A 3POVA 2QTVA 3GANA 2YVKA 5E33A 4XPYA 3WHNA 2YEVA 1C17M 1Q0GA 2BC5A 4RDAA 3UNGC 4JE9A 1CGNA 4P9FA 2A6HF 4QI0A 1A0BA 3S9OA 1LIHA 3H2UA 4JW1A 1T01A 2I8BA 1PCXA 1M56C 3RKOF 2R9RB 1IZMA 2VB6A 3EH1A 1S7ZA 5CI8A 5JT4A 3LEVA 3O55A 3AG3C 4YK5A 1JPJA 4XPWA 2AP3A 2X0CA 2Q4FA 4G0HA 3ZWIA 1I5NA 2VCBA 3W2WA 2HSBA 1APCA 2IYLD 3I4UA 3I5QA 3NMIA 4FWVA 4MTGA 3VF0A 1D1BA 4BPMA 1G5ZA 1JPNA 3FAJA 4C3BA 1YLMA 2IOQA 1MMDA 1VMAA 1SMYF 3CSKA 1AUEA 5A6KA 3U0CA 3AGUA 2R7OA 1LI5A 1MNEA 2MWQA 5DS4A 2Q9BA 4KI2A 2LD6A 2ZPAA 2IXOA 2J0XA 3SNHA 1GS9A 3JSZA 5L0JA 1HMOA 3W4YA 5FCLA 2KJGA 3ZDLA 1JMWA 2PBEA 4U5HA 3QW0A 4CJOA 3PMRA 4L6RA 2FGYA 3QW1A 5DLJA 1R4TA 2LK4A 2LCHA 2XLOA 2L9JA 3DE8A 2B0HA 4N4WA 3JRTA 3JTLO 3J06A 3FMSA 1YZAA 5GPGB 2IXPA 3DAFA 3ZVRA 2R7XA 2H7VC 2HSQA 2UUHA 4DXWA 3KPHA 3LEOA 1FFHA 4MVZA 4E18A 1D0ZA 1SR2A 1QSPA 2YL3A 5EGYA 1YYJA 4PJNA 3DE9A 2YZSA 4AE4B 3B29A 1KNYA 3G4ZA 1QZXA 4U9DA 4E0IA 1WN0A 5EHHA 1K40A 3SXZA 3EG9A 1F1MA 3QVYA 2NSGA 1LS4A 3C63A 3HJCA 2C04A 4JIOA 2R05A 2ZXPA 1TWHA 5D91A 4C7OA 4EWCA 2OQMA 2YRFA 4BEJA 1HE1A 2HFIA 1EI7A 4FX5A 1ORJA 4JCZA 2OKUA 3RFYA 3FXHA 2V26A 3K1IC 3HNIA 3ASOC 1CGOA 1JOGA 1BR1A 2YQYA 3UMIA 2P6VA 4CS8A 3ZQYA 2BL2A 4O79A 2QNLA 3M4BA 4A2NB 4EHPA 4Q7CA 2Y69C 4Q4ZF 3K7DA 4DJ9A 2NUPB 1L7CA 1JR8A 4NCQA 4AX2A 3AGTA 3HNJA 1RJ9B 3V5XA 1S05A 2DGJA 4KBLA 1YYXA 4ZLCA 5HV9A 1E85A 3T6BA 4DOZA 1RXQA 1HMDA 3JCUQ 4LDRA 3U3BA 3ZQVA 1RMVA 5KYXB 3C18A 4IAOA 4CBEA 4KNWA 1MNDA 2YHSA 2WZFA 1T6UA 2XL4A 4AK9A 5COGA 2ASRA 1A7DA 4M63A 1LS1A 2VCCA 4EKWA 4XQ1A 5B3SC 3SEOA 3NYMA 3X1OA 3HNKA 3X2QC 5KYWB 1ORYA 1E86A 4XLPF 4JVSA 1LPEA 5JRAA 2Q00A 1QLEC 3ZTMA 1K04A 4X0RA 3UR3C 2DYRC 1YA7O 1ZHZA 4P6IC 2EPNA 2D5RB 2NG1A 2HKVA 1MMNA 4Z9IA 1TQGA 2LSEA 1EA8A 4ZLDA 1H6GA 4RD9A 2J7PA 3JSEO 1T6IA 1H7IA 5L0GA 3TJ6A 1I4YA 3A9CA 1RKEB 4I1MA 2VCAA 5BUOA 1UFBA 2J7PD 1J8YF 1YVIA 5JS5A 3EJNA 4C7OB 5B3IA 4QI2A 3LAYA 4HEAJ 1Q0DA 1QPUA 2F22A 4MVUA 2WVOA 4F4BA 2A69F 2AWCA 3DM9B 3LUTB 4XPXA 4NTFA 1TWAA 2ZD9A 4C3DA 3T6GB 1A7VA 4MVMA 1TWGA 2CYDA 4NY3A 3Q7LA 1K05A 4O7GA 4PACA 4EUKB 3AQCA 3OWTA 3RQGA 4ANJA 1C03A 3H65A 1WTYA 4LDQA 3U8VA 1D1AA 4UDVA 3KH2A 1OKKA 5AGFA 1WATA 1Z3IX 2HJ3A 3K6BA 4CIHA 2R7QA 1LE2A 1OXBA 4O6MA 4YT5A 3TOLA 5L3VA 4J30B 3FAPB 2A68F 2QE9A 1VYIA 3TQOA 1OKKD 1VYKA 3G4XA 4YL3A 3CQZA 5A6JA 1V54C 3GEHA 3TD7A 1I4ZA 4J32B 2OG2A 3T6JA 3C8GB 3RIPA 1SF8A 1T9KA 4AE4A 3C62A 3GORA 4E7ZA 1ZU4A 1U0BB 2WZLA 3WAQA 1FMVA 2KQ9A 1NSGB 2XLEA 3S29A 1YDIA 4JJGA 4JTDB 1HY5A 2LFFA 4U9EA 1RKCA 2G62A 3ZC4A 2KW3C 3M1CB 3GODA 4FESA 4O6NA 5F28E 1EKYA 4P9TA 4LACB 3ASNC 3NKEA 2XM4A 3EFOB 4HFFB 1U89A 2L7AA 4U5EE 4XEVA 3FDQA 2C03A 4IARA 2J46A 5K0IA 2AWYA 5KYUB 2YLGA 3K1IA 2P0NA 4IGGA 3EGDB 1Z63A 1DOVA 2Y39A 3AG4C 2NUTA 3N24A 3AOUA 4IWBA 2J9WA 2J8WA 2KSFA 3S90A 4OIQF 3UMHA 1ZW2A 5TJ5E 3W2VA 1ZHTA 2EPLX 2YLDA 3R7CA 3WODF 5L3QA 1T6QA 3RQFA 1A7EA 1QQ3A 2NUPA 4CJGA 5BQIA 5A69A 3NYJA 4I44A 2VH3A 1XZQA 3RQEA 1RJ9A 2J0WA 1A41A 3ABMC 3DMDA 4A4AA 3L8JA 3JT1A 4IJJA 5COMA 2KYHA 3FOOA 4EBKA 1MMAA 3KYIA 3L0IA 4IRUA 4XLNF 2PX0A 1D1CA 1NLXA 3S27A 3JYYA 2R7SA 2GFHA 1QVXA 2MYSA 2WVNA 2G3VA 5FZTA 2PFDA 1ZHYA 3GEIA 4MNDA 1EQ1A 2NSFA 1YARO 1ZHWA 3M4CA 1OR2A 3NYLA 5D92A 3US6A 4EBBA 2QLAA 5L0DA 1VTMP 3U2MA 3I5PA 3L34A 2V3CC 3NRHA 2VASA 4WGYA 4CS9A 4YT4A 3UGPA 1G4US 1WASA 3B71A 4DBQA 4YL1A 4MW8A 2FFHA 4R32A 4JRZA 3JYHA 3UMKA 1ZZPA 5HSWA 3T9OA 5KYWA 3NDBB 4PFOA 2GA0A 2R7UA 2ICWG 1ZHXA 3IEEA 2XRHA 1AEPA 1LKXA 4BJ5C 2B0JA 3Q7GA 1Z5ZA 3IPMO 2Q9CA 3GM1A 4ULVA 3VAYA 3DAGA 1VLSA 2R7WA 3RYLA 3B0UX 3GWLA 1MMGA 2J9VA 4MVOA 2JD3A 4LLCA 3OA1A 1Z23A 3U9MA 1RKEA
chains in the Genus database with same CATH topology
1SYQA 4P9TA 3TJ5A 5FZTA 4DJ9A 1L7CA 5L0FA 1U89A 2L7AA 5L0HA 2LQGA 1TR2A 5L0DA 5L0JA 1XWJA 1H6GA 2IBFA 2GDCA 3MYIA 3H2UA 3TJ6A 4E17A 4IGGA 1T01A 1RKEB 3ZDLA 1DOVA 3RF3A 5L0IA 3S90A 4PR9A 2B0HA 1QKRA 1ST6A 1ZW2A 2GWWA 4K1OA 2X0CA 4ONSA 4W8PA 2HSQA 1ZW3A 1U6HA 1YDIA 1ZVZA 3VF0A 3T6GB 3H2VA 4E18A 5L0CA 5L0GA 4EHPA 1RKCA 1DOWA 1RKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYQ A;  4P9T A;  3TJ5 A;  5FZT A;  4DJ9 A;  1L7C A;  5L0F A;  1U89 A;  2L7A A;  5L0H A;  2LQG A;  1TR2 A;  5L0D A;  5L0J A;  1XWJ A;  1H6G A;  2IBF A;  2GDC A;  3MYI A;  3H2U A;  3TJ6 A;  4E17 A;  4IGG A;  1T01 A;  1RKE B;  3ZDL A;  1DOV A;  3RF3 A;  5L0I A;  3S90 A;  4PR9 A;  2B0H A;  1QKR A;  1ST6 A;  1ZW2 A;  2GWW A;  4K1O A;  2X0C A;  4ONS A;  4W8P A;  2HSQ A;  1ZW3 A;  1U6H A;  1YDI A;  1ZVZ A;  3VF0 A;  3T6G B;  3H2V A;  4E18 A;  5L0C A;  5L0G A;  4EHP A;  1RKC A;  1DOW A;  1RKE A; 
#chains in the Genus database with same CATH topology
 1D0X A;  4MTF A;  3CZ6 A;  3EQL F;  3F46 A;  1BDJ B;  4H4K C;  3MYF A;  3B9Q A;  2LQG A;  2EPK X;  3EHM A;  4NQF A;  3EZI A;  1FNT c;  1L3P A;  4J7T A;  2PX3 A;  3EZH A;  2YL0 A;  1E83 A;  2W9Y A;  2H8A A;  1WWP A;  4WAB A;  2HV7 A;  1GM5 A;  3SXK A;  4ULW A;  1YAU O;  3BRJ A;  3VYW A;  3DI5 A;  1ORS C;  2XLV A;  4PJM A;  5T3W A;  4DBR A;  3SYN A;  4CSA C;  3U8P A;  4U5B E;  2J9U A;  1G4W R;  4MQ9 F;  4PR9 A;  4AL1 A;  1GGQ A;  3EGX B;  2W4M A;  4YN0 B;  3ZTZ A;  5JP7 A;  2XL6 A;  2HMZ A;  4E0H A;  4CIP A;  2CNW A;  3CEX A;  2CW0 F;  4OD4 A;  5F5H A;  3ZIB A;  4DVY P;  1FR0 A;  1O3U A;  3C7J A;  2W45 A;  2M4E A;  3LJB A;  3LLI A;  2A0B A;  4JTC B;  4CS9 C;  3RW0 A;  2CNW D;  2Z15 A;  3W8I A;  4OIN F;  5JUA A;  2P61 A;  2RD9 A;  4MS2 A;  4G7O F;  4GYT A;  2XLD A;  4MVS A;  4OIP F;  3TJ5 A;  4NTB A;  1SZI A;  2J45 A;  1BZ4 A;  1C02 A;  3QZC A;  4BJ6 C;  2L6G A;  2XL8 A;  4G7Z F;  3C8G A;  1XWJ A;  1HW1 A;  3DZA A;  4JC7 A;  1NBB A;  4PJJ A;  3KMI A;  3M79 A;  3RH3 A;  4JUR I;  3SZR A;  1WGW A;  1V55 C;  2DB4 A;  2XS8 A;  3A11 A;  3UGO A;  3C8G D;  3RF3 A;  2YKZ A;  4OIR F;  1BBH A;  3K33 A;  4WGZ A;  2XXA B;  1LVK A;  1WOL A;  2IM8 A;  4I1O B;  1OCZ C;  3LLK A;  3LNR A;  3FOP A;  2HV6 A;  4H54 A;  4Z9J A;  3AQB A;  2QUP A;  2NPU A;  2KK1 A;  3AJM A;  4BJT A;  2EIN C;  3DD7 A;  4CX9 A;  3EFO A;  3E9V A;  2XM0 A;  3FVY A;  2R25 A;  3W8H A;  1PD0 A;  3CAX A;  1LI7 A;  4I3M A;  4LER A;  5L0C A;  5KYU A;  2YWA A;  3IQ5 A;  1XZP A;  2LFD A;  4N6C A;  3R2P A;  1VLT A;  3EGD A;  3U2L A;  2XLM A;  4D4N A;  3S84 A;  4OIO F;  3B0P A;  1JAF A;  2HS5 A;  2LIG A;  3N2Z B;  4RBN A;  5DQT A;  3FHD A;  2OEX A;  1OR3 A;  3PDM P;  1M2V B;  1HW2 A;  2IBF A;  3HKK A;  3KYJ A;  3S0X A;  2GDC A;  2Y3D A;  5T3T A;  3JRM O;  3WG7 C;  4D4X A;  3NG1 A;  2I15 A;  2ETS A;  1R5I D;  5E3C A;  5L0I A;  3PHF 2;  4DRI B;  4MVQ A;  3QMK A;  4MTO A;  4GEH A;  5E3A A;  3RVZ A;  3EH2 A;  2ZXO A;  3OEO A;  2P7V A;  1PV3 A;  2AU5 A;  4W8K A;  1ZYR F;  3ECS A;  4HE8 D;  4XEK A;  4G7H F;  2HUJ A;  1NG1 A;  3TOM A;  1ZW3 A;  2TMV P;  3ZSU A;  3ZG1 A;  5IY5 C;  5KYN A;  5CIV A;  1OQC A;  2YL7 A;  2R7V A;  3LS0 A;  5BQG A;  1NZE A;  3SP1 A;  3GM3 A;  1VB5 A;  4CDA A;  5DVW A;  3DJN B;  1YZC A;  3KKB A;  4DRJ B;  4PFP A;  2OJE D;  2Q7R A;  1LM3 B;  256B A;  4JJF A;  3U9J A;  1OW6 A;  4JKV A;  4AL0 A;  1OCR C;  4FAP B;  3QTH A;  1HE9 A;  1KU2 A;  1Q0K A;  3NMK A;  1ZU5 A;  4K7B A;  4XTK A;  4EIY A;  2R7R A;  2M64 A;  1VK5 A;  2H7B A;  3DKA A;  2GAQ A;  2AVK A;  4JTA B;  2PF4 E;  2H7O A;  4BJ5 A;  4YWQ A;  2OJQ A;  4YT2 A;  4DRH B;  1CPR A;  2GWW A;  2KC3 A;  1Y4C A;  1W2W A;  2O9X A;  3IQ6 A;  3L8I A;  4K1O A;  4NC3 A;  4W8P A;  4PK4 A;  4OD5 A;  1NU7 D;  2EIL C;  4XEF A;  4MW3 A;  2L6F A;  5B1B C;  3GEE A;  2IXM A;  2CCY A;  2W4B A;  3HNL A;  1U6H A;  3H2V A;  2JX0 A;  3IQC A;  1AVO B;  3LNM B;  3MX3 A;  4LLE A;  2EPM X;  2XLH A;  4U5D E;  5DS6 A;  4CSA A;  1M57 C;  2LP4 A;  2UUI A;  4U5G A;  5KYY B;  5L0F A;  1J8M F;  5DS5 A;  5KYX A;  3DWW A;  1BR4 A;  2PNO A;  2Q9A A;  3EGX A;  3MBG A;  3B0V C;  3LS1 A;  3PCV A;  1Q0F A;  5E2Q A;  1OCC C;  4BG0 A;  1KTM A;  3JZ0 A;  1NFN A;  5T1D B;  1T5O A;  3RVY A;  1OXK A;  1ST6 A;  4B6I A;  3TUL A;  2J9B A;  5DQZ A;  1O87 A;  4BJ6 A;  2VC9 A;  1MQV A;  1H9T A;  1PD1 A;  3V5Y A;  2OOC A;  2WVQ A;  2OU6 A;  1NU9 C;  3ABL C;  3NKD A;  4U5C E;  1G8X A;  2R03 A;  5JSL A;  3ABK C;  2YLI A;  3AG2 C;  3GWN A;  1YA9 A;  5EK0 A;  1V74 B;  1Y6D A;  4N6H A;  3TK0 A;  2XXA A;  5L0H A;  3HTK C;  1TKN A;  4PJL A;  4U5F E;  2XLW A;  3ATP A;  3VRC A;  2PP4 A;  3M15 A;  1IW7 F;  1FFT C;  3MYI A;  1UG7 A;  2Q3T A;  4JCH A;  4HFK B;  4DVZ A;  4E17 A;  5CI9 A;  5B1A C;  2FAP B;  3U5S A;  5AC5 A;  2A6E F;  2L6H A;  3QVZ A;  4CS7 A;  4JEB A;  3ITF A;  1O5H A;  1H9G A;  1M2O A;  3LES A;  2CDQ A;  3S28 A;  1CPQ A;  2DI3 A;  1V4A A;  2NUT B;  5COF A;  3E70 C;  1D0Y A;  2E87 A;  1LE4 A;  2JPU A;  2P1A A;  3IHU A;  2IXN A;  1CGM E;  1M2V A;  4KC9 A;  3L1M A;  4EBJ A;  1DOW A;  2G3K A;  3IQT A;  1OW7 A;  2X51 A;  1B68 A;  1GQA A;  2QY9 A;  1M6T A;  1TFO B;  2D4U A;  4YL0 A;  3AG1 C;  2HZ8 A;  4LDK A;  1Q0M A;  4WJ0 A;  3V5Z A;  1RCP A;  4NTA A;  3SXY A;  2Y3H A;  2L81 A;  2RSE B;  3K66 A;  4MVR A;  3VM6 A;  1Z6A A;  1OW8 A;  3HLZ A;  4XWJ A;  3EG9 B;  3T4R A;  3EPV A;  3O6X A;  4QDL A;  2XS1 A;  2XSE A;  4YJW A;  1FAP B;  4J7Y A;  2HJM A;  1Z7Q c;  4C3E A;  4Q5S F;  2OCC C;  3BEH A;  3K1H A;  4K0D A;  5A6B A;  3MLG A;  1JRA A;  1ZVZ A;  1VOM A;  2WL8 A;  4CDY A;  4Z9H A;  2A0U A;  5JVE A;  1NFO A;  1BR2 A;  2DYS C;  4IB4 A;  4O6Y A;  3V7O A;  1SYQ A;  4JZA A;  5A6B D;  3EHN A;  4ER9 A;  2HMQ A;  3SXM A;  2EIM C;  1E2X A;  1FTS A;  3MFN A;  1TR2 A;  3G50 A;  2YL1 A;  3Q6M A;  3GM2 A;  2EIJ C;  2ZXW C;  3F47 A;  2WB7 A;  4KNV A;  4BJ1 A;  3U3F A;  2EIK C;  4CS8 C;  2ZXR A;  1FMW A;  2OEV A;  5F5F A;  3O39 A;  2MHR A;  4JEA A;  4GQH A;  3NMJ A;  5AC4 A;  2CGE A;  1QKR A;  3DJU B;  3KL4 A;  3Q6N A;  2KGO A;  4G78 A;  4ONS A;  1E84 A;  4BEM J;  2WZG A;  5KYY A;  5BQH A;  4E7S A;  3DM5 A;  1TWC A;  4IAQ A;  4N06 A;  2BE5 F;  1YJG A;  4YT8 A;  1N1C A;  3C8Z A;  5JLI A;  1TFK B;  2A1D D;  2KNH A;  1OCO C;  2Y3G A;  5A6A A;  2R02 A;  4CDV A;  2R7T A;  3DXJ F;  3N0T A;  2EPO A;  2Y3B A;  3O10 A;  3POV A;  2QTV A;  3GAN A;  2YVK A;  5E33 A;  4XPY A;  3WHN A;  2YEV A;  1C17 M;  1Q0G A;  2BC5 A;  4RDA A;  3UNG C;  4JE9 A;  1CGN A;  4P9F A;  2A6H F;  4QI0 A;  1A0B A;  3S9O A;  1LIH A;  3H2U A;  4JW1 A;  1T01 A;  2I8B A;  1PCX A;  1M56 C;  3RKO F;  2R9R B;  1IZM A;  2VB6 A;  3EH1 A;  1S7Z A;  5CI8 A;  5JT4 A;  3LEV A;  3O55 A;  3AG3 C;  4YK5 A;  1JPJ A;  4XPW A;  2AP3 A;  2X0C A;  2Q4F A;  4G0H A;  3ZWI A;  1I5N A;  2VCB A;  3W2W A;  2HSB A;  1APC A;  2IYL D;  3I4U A;  3I5Q A;  3NMI A;  4FWV A;  4MTG A;  3VF0 A;  1D1B A;  4BPM A;  1G5Z A;  1JPN A;  3FAJ A;  4C3B A;  1YLM A;  2IOQ A;  1MMD A;  1VMA A;  1SMY F;  3CSK A;  1AUE A;  5A6K A;  3U0C A;  3AGU A;  2R7O A;  1LI5 A;  1MNE A;  2MWQ A;  5DS4 A;  2Q9B A;  4KI2 A;  2LD6 A;  2ZPA A;  2IXO A;  2J0X A;  3SNH A;  1GS9 A;  3JSZ A;  5L0J A;  1HMO A;  3W4Y A;  5FCL A;  2KJG A;  3ZDL A;  1JMW A;  2PBE A;  4U5H A;  3QW0 A;  4CJO A;  3PMR A;  4L6R A;  2FGY A;  3QW1 A;  5DLJ A;  1R4T A;  2LK4 A;  2LCH A;  2XLO A;  2L9J A;  3DE8 A;  2B0H A;  4N4W A;  3JRT A;  3JTL O;  3J06 A;  3FMS A;  1YZA A;  5GPG B;  2IXP A;  3DAF A;  3ZVR A;  2R7X A;  2H7V C;  2HSQ A;  2UUH A;  4DXW A;  3KPH A;  3LEO A;  1FFH A;  4MVZ A;  4E18 A;  1D0Z A;  1SR2 A;  1QSP A;  2YL3 A;  5EGY A;  1YYJ A;  4PJN A;  3DE9 A;  2YZS A;  4AE4 B;  3B29 A;  1KNY A;  3G4Z A;  1QZX A;  4U9D A;  4E0I A;  1WN0 A;  5EHH A;  1K40 A;  3SXZ A;  3EG9 A;  1F1M A;  3QVY A;  2NSG A;  1LS4 A;  3C63 A;  3HJC A;  2C04 A;  4JIO A;  2R05 A;  2ZXP A;  1TWH A;  5D91 A;  4C7O A;  4EWC A;  2OQM A;  2YRF A;  4BEJ A;  1HE1 A;  2HFI A;  1EI7 A;  4FX5 A;  1ORJ A;  4JCZ A;  2OKU A;  3RFY A;  3FXH A;  2V26 A;  3K1I C;  3HNI A;  3ASO C;  1CGO A;  1JOG A;  1BR1 A;  2YQY A;  3UMI A;  2P6V A;  4CS8 A;  3ZQY A;  2BL2 A;  4O79 A;  2QNL A;  3M4B A;  4A2N B;  4EHP A;  4Q7C A;  2Y69 C;  4Q4Z F;  3K7D A;  4DJ9 A;  2NUP B;  1L7C A;  1JR8 A;  4NCQ A;  4AX2 A;  3AGT A;  3HNJ A;  1RJ9 B;  3V5X A;  1S05 A;  2DGJ A;  4KBL A;  1YYX A;  4ZLC A;  5HV9 A;  1E85 A;  3T6B A;  4DOZ A;  1RXQ A;  1HMD A;  3JCU Q;  4LDR A;  3U3B A;  3ZQV A;  1RMV A;  5KYX B;  3C18 A;  4IAO A;  4CBE A;  4KNW A;  1MND A;  2YHS A;  2WZF A;  1T6U A;  2XL4 A;  4AK9 A;  5COG A;  2ASR A;  1A7D A;  4M63 A;  1LS1 A;  2VCC A;  4EKW A;  4XQ1 A;  5B3S C;  3SEO A;  3NYM A;  3X1O A;  3HNK A;  3X2Q C;  5KYW B;  1ORY A;  1E86 A;  4XLP F;  4JVS A;  1LPE A;  5JRA A;  2Q00 A;  1QLE C;  3ZTM A;  1K04 A;  4X0R A;  3UR3 C;  2DYR C;  1YA7 O;  1ZHZ A;  4P6I C;  2EPN A;  2D5R B;  2NG1 A;  2HKV A;  1MMN A;  4Z9I A;  1TQG A;  2LSE A;  1EA8 A;  4ZLD A;  1H6G A;  4RD9 A;  2J7P A;  3JSE O;  1T6I A;  1H7I A;  5L0G A;  3TJ6 A;  1I4Y A;  3A9C A;  1RKE B;  4I1M A;  2VCA A;  5BUO A;  1UFB A;  2J7P D;  1J8Y F;  1YVI A;  5JS5 A;  3EJN A;  4C7O B;  5B3I A;  4QI2 A;  3LAY A;  4HEA J;  1Q0D A;  1QPU A;  2F22 A;  4MVU A;  2WVO A;  4F4B A;  2A69 F;  2AWC A;  3DM9 B;  3LUT B;  4XPX A;  4NTF A;  1TWA A;  2ZD9 A;  4C3D A;  3T6G B;  1A7V A;  4MVM A;  1TWG A;  2CYD A;  4NY3 A;  3Q7L A;  1K05 A;  4O7G A;  4PAC A;  4EUK B;  3AQC A;  3OWT A;  3RQG A;  4ANJ A;  1C03 A;  3H65 A;  1WTY A;  4LDQ A;  3U8V A;  1D1A A;  4UDV A;  3KH2 A;  1OKK A;  5AGF A;  1WAT A;  1Z3I X;  2HJ3 A;  3K6B A;  4CIH A;  2R7Q A;  1LE2 A;  1OXB A;  4O6M A;  4YT5 A;  3TOL A;  5L3V A;  4J30 B;  3FAP B;  2A68 F;  2QE9 A;  1VYI A;  3TQO A;  1OKK D;  1VYK A;  3G4X A;  4YL3 A;  3CQZ A;  5A6J A;  1V54 C;  3GEH A;  3TD7 A;  1I4Z A;  4J32 B;  2OG2 A;  3T6J A;  3C8G B;  3RIP A;  1SF8 A;  1T9K A;  4AE4 A;  3C62 A;  3GOR A;  4E7Z A;  1ZU4 A;  1U0B B;  2WZL A;  3WAQ A;  1FMV A;  2KQ9 A;  1NSG B;  2XLE A;  3S29 A;  1YDI A;  4JJG A;  4JTD B;  1HY5 A;  2LFF A;  4U9E A;  1RKC A;  2G62 A;  3ZC4 A;  2KW3 C;  3M1C B;  3GOD A;  4FES A;  4O6N A;  5F28 E;  1EKY A;  4P9T A;  4LAC B;  3ASN C;  3NKE A;  2XM4 A;  3EFO B;  4HFF B;  1U89 A;  2L7A A;  4U5E E;  4XEV A;  3FDQ A;  2C03 A;  4IAR A;  2J46 A;  5K0I A;  2AWY A;  5KYU B;  2YLG A;  3K1I A;  2P0N A;  4IGG A;  3EGD B;  1Z63 A;  1DOV A;  2Y39 A;  3AG4 C;  2NUT A;  3N24 A;  3AOU A;  4IWB A;  2J9W A;  2J8W A;  2KSF A;  3S90 A;  4OIQ F;  3UMH A;  1ZW2 A;  5TJ5 E;  3W2V A;  1ZHT A;  2EPL X;  2YLD A;  3R7C A;  3WOD F;  5L3Q A;  1T6Q A;  3RQF A;  1A7E A;  1QQ3 A;  2NUP A;  4CJG A;  5BQI A;  5A69 A;  3NYJ A;  4I44 A;  2VH3 A;  1XZQ A;  3RQE A;  1RJ9 A;  2J0W A;  1A41 A;  3ABM C;  3DMD A;  4A4A A;  3L8J A;  3JT1 A;  4IJJ A;  5COM A;  2KYH A;  3FOO A;  4EBK A;  1MMA A;  3KYI A;  3L0I A;  4IRU A;  4XLN F;  2PX0 A;  1D1C A;  1NLX A;  3S27 A;  3JYY A;  2R7S A;  2GFH A;  1QVX A;  2MYS A;  2WVN A;  2G3V A;  5FZT A;  2PFD A;  1ZHY A;  3GEI A;  4MND A;  1EQ1 A;  2NSF A;  1YAR O;  1ZHW A;  3M4C A;  1OR2 A;  3NYL A;  5D92 A;  3US6 A;  4EBB A;  2QLA A;  5L0D A;  1VTM P;  3U2M A;  3I5P A;  3L34 A;  2V3C C;  3NRH A;  2VAS A;  4WGY A;  4CS9 A;  4YT4 A;  3UGP A;  1G4U S;  1WAS A;  3B71 A;  4DBQ A;  4YL1 A;  4MW8 A;  2FFH A;  4R32 A;  4JRZ A;  3JYH A;  3UMK A;  1ZZP A;  5HSW A;  3T9O A;  5KYW A;  3NDB B;  4PFO A;  2GA0 A;  2R7U A;  2ICW G;  1ZHX A;  3IEE A;  2XRH A;  1AEP A;  1LKX A;  4BJ5 C;  2B0J A;  3Q7G A;  1Z5Z A;  3IPM O;  2Q9C A;  3GM1 A;  4ULV A;  3VAY A;  3DAG A;  1VLS A;  2R7W A;  3RYL A;  3B0U X;  3GWL A;  1MMG A;  2J9V A;  4MVO A;  2JD3 A;  4LLC A;  3OA1 A;  1Z23 A;  3U9M A;  1RKE A; 
#chains in the Genus database with same CATH homology
 1SYQ A;  4P9T A;  3TJ5 A;  5FZT A;  4DJ9 A;  1L7C A;  5L0F A;  1U89 A;  2L7A A;  5L0H A;  2LQG A;  1TR2 A;  5L0D A;  5L0J A;  1XWJ A;  1H6G A;  2IBF A;  2GDC A;  3MYI A;  3H2U A;  3TJ6 A;  4E17 A;  4IGG A;  1T01 A;  1RKE B;  3ZDL A;  1DOV A;  3RF3 A;  5L0I A;  3S90 A;  4PR9 A;  2B0H A;  1QKR A;  1ST6 A;  1ZW2 A;  2GWW A;  4K1O A;  2X0C A;  4ONS A;  4W8P A;  2HSQ A;  1ZW3 A;  1U6H A;  1YDI A;  1ZVZ A;  3VF0 A;  3T6G B;  3H2V A;  4E18 A;  5L0C A;  5L0G A;  4EHP A;  1RKC A;  1DOW A;  1RKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...