3TJEH

Crystal structure of fas receptor extracellular domain in complex with fab e09
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
235
structure length
229
Chain Sequence
QLQLQESGPGLVKPSETLSLTCTVSGASISANSYYGVWVRQSPGKGLEWVGSIAYRGNSNSGSTYYNPSLKSRATVSVDTSKNQVSLRLTSVTAADTALYYCARRQLLDDGTGYQWAAFDVWGQGTMVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab E09, light chain
publication title A series of Fas receptor agonist antibodies that demonstrate an inverse correlation between affinity and potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 43
structure length 229
sequence length 235
ec nomenclature
pdb deposition date 2011-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tjeH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tjeH01
3HE6C 4K7FB 4XPGL 5IF0B 3W11D 5TE4L 5IB2A 5DS8A 3SHSA 1IM9B 5KG9A 2A9MH 3BE1L 5HHMD 4QRPD 3CU1A 4I2XE 4HK0A 2H3NB 5IB1A 3MRPA 4HUWA 4D9LL 4EDXA 4CADA 5MEOB 5HHOD 5LJYH 4K94H 3IDNB 3FFDB 2C7UB 5KJRH 4ZSOA 3OB8A 2YC1B 5DJZA 3LDBB 4GO6B 4OGYH 4QT5A 2FR4A 3ZYOA 4HV8A 2I25N 3MV8A 1C5BL 4FFZH 5K9OB 2R2BB 4H5SA 4M6OH 2IAMA 3IU3B 1X5ZA 4RFOL 4JY5L 3CUPB 5DD1H 2ATKA 3I75A 1X5LA 2WIIA 3BT2L 3T0WA 3LPWA 4LHQB 2OI9B 4IRZL 3R1GL 4WWKD 1MF2H 2VLME 1A1OA 3GSXB 5CHNA 5BO1L 2Q76A 4PGCB 3BPCB 5D2NB 4HG4J 3MYJB 3WUWG 4QRUB 1CD0A 1LO4H 1U8OA 1Q9KB 2WWKT 1CDJA 1TJIH 1CFNA 4KPHH 3QCTL 4D3CL 2ZCKH 3OV6A 5DC4B 3D39D 1BEYH 3PHOB 5BJTA 1QR1A 3UO1L 1T0NB 4WI2A 1JGVL 3G5XA 2EYSB 2VLKD 1KACB 1A64A 3OKNB 4PJAF 1A6VL 5AUMA 1T0MA 4X6DA 3ARFB 2CXGA 1LQSR 3G6JE 2L4OA 2EIZA 4NZUH 2DF3A 5ITFA 3FCTB 3HG1D 1YN6B 4ZFGL 4ZAKC 5DHVA 3JBG7 4GRWB 3D85D 1TQBC 3RY4A 3UXFA 4XWGH 2CK0L 3HNTL 2DI8A 1D5BA 4K3DH 1R5IA 2J8UA 5IB1B 4O2FA 5HYSA 5HTSA 4HUWB 5CJBA 4WGVB 1G9MC 4EDXB 1MI5A 2DQCL 4MA8H 5KS9A 4GLRI 3WKMH 2BHUA 4TNVK 3O2DH 1NMAH 3M8OL 3GSNL 4QT5B 3VXNB 5E9DB 4HV8B 2FWOB 3MV8B 4M6NH 2P48B 3PDOA 1E6OL 4H5SB 4PRPE 2EH7H 2IAMB 2MMXA 3GSQB 1NCWL 1M7IA 3N1MC 1RSFA 2AEQH 2ATKB 2PNDA 5SWZD 3MNZB 3O2WH 4YX2H 4X5WA 3IFNL 4JO2H 4LVHC 1N4XL 3RQ3A 4Z0XA 3H9HA 4M7KH 4S2SB 1G7QA 4RAUA 4E41D 1IGFL 4RQQA 3VDBA 2FHFA 1VKXA 1U8OB 1K8DA 1CFNB 1FLRL 2ZJSL 5E94A 1IEBA 5L8JB 4K23H 1CDGA 4PJ5E 2ICWI 3H9YA 4J3XA 4L3CA 1DQMH 1MY7A 3G5XB 1TIUA 4ZD3H 3UTSE 1MCIA 3CDYA 5T1DH 3ILQD 5AUMB 1TCRA 2MNUA 4LCCA 4EN3A 3KNBA 2EIZB 2PTTA 3SCMA 5GQBA 1HINL 5JHLL 4CUCA 5ITFB 4JGUA 5DHVB 2XQYG 2FYYA 4QXTA 2VRAA 4WW1A 1UM6H 3MTRA 4MWFB 1QNZH 3GJFA 1CIUA 3O6ML 1D5BB 1KCRL 1U95A 3N9GH 2VDQH 5E08H 1R5IB 3CFCH 3QPXH 5LGJA 3BP5A 3U0TA 4WGWB 4O2FB 4CMMA 1LK2B 1LO2L 1HHGA 4YFLF 3UBXI 1CFTB 1MI5B 4EXKA 1RJZA 3L1OH 4Z7OF 5CLTA 4HGMA 5DMJB 1RIHH 1AHWB 4YDIL 4Z7WB 4XCYB 1YEJH 2YMXL 3OJVC 4GG8A 3PDOB 2FATL 4IOIA 4JPWL 43C9A 4EQ2A 1M7IB 1HOCB 1OL0A 2JIXD 4UNVA 5ACZA 2OLDA 1UACL 4JN2A 1F4AA 4NRZA 4F7TB 1CTNA 1FO0L 4OFPA 3J8F7 1F4WL 2AKRB 5E6YA 2ZCLL 4JM2D 4Z0XB 5KSBE 3H9HB 5FYLH 3E1F1 1CBVH 4W6XB 1GGIL 1OM3H 1F4YL 5B4MC 4RQQB 4K94C 4GOSA 2DN7A 1G84A 1VKXB 3S96B 1RV6X 2OTUA 4L4VA 2DYPA 5HGGS 2HJKA 4AEIL 1FAKT 4LNRA 2QTEA 1H9VA 3RWGA 3C6LC 3A67L 4LARL 2GJ6D 4KKNA 2YRZA 4O51B 1TCRB 4LCCB 3QQ3A 1J5OH 5C9JA 4MJ5A 3O6KL 3UAJC 1SJEB 3GHBL 2HN7B 1FJ1A 2FYYB 5JOFA 5KTEH 2GT9A 2PYEA 4QXTB 1U3JA 4P9ML 3GJFB 4E42A 1FVCA 3QEQD 4KK6C 1IFHL 1T03H 4PJBA 3VD5A 1U95B 12E8L 2XTJE 1FYTD 2NY6B 1IC4L 4BZ2H 3U0TB 4CMMB 5HY9A 4N8VB 1HHGB 1FPTL 1RJZB 5AEAA 3GUTA 2BNQD 2QLVB 3OJMB 3C9NA 1AJ7L 3VCLB 4GBXA 4KROD 1P5VA 1QD0A 4GG8B 1ETZB 4JFDB 4IOIB 1OCWH 1TPXB 1ZEAL 3TVMD 4MGXA 2XTLA 4NRZB 5C7XL 2DLTA 3B2UC 5LVEA 2AS5M 5FOJA 5CSGA 1JN6A 5JDJA 4PD4K 4J4PC 5CJOH 3JXAA 5GGRA 2OQJA 1XF1A 1G6RL 1A7NH 1QO3B 1UB5A 4D9RD 3QIUC 2QQNH 5GGUA 3NZHH 3S37X 5TE7H 4JHAL 4PR5B 3ZMRA 1KB5A 4RGND 3SDCD 2DYPB 3NFSH 5J8OA 2NTSP 4G9FA 1U2CA 3E6FA 4K8RL 4X6CE 2OTWA 1CLYL 4LNRB 2DMKA 5FYLE 3TEUA 1ZK9A 3RWGB 3IFLL 4TTGA 5IW1A 3FN3A 3C08H 2R1YA 3VXRE 4KKLD 3BWUC 3S36L 1JGLH 3QQ3B 3H3KA 3VFMA 3TLRA 3A6BL 1YEGL 2DD8L 4C4KO 2YUWA 5FUZH 5F1IA 5DMGC 1UJ3B 2GT9B 2PYEB 3QR2A 5GSRB 1DZBA 5KVDL 2QQKL 4V2CB 3UROR 1AI1H 4IOFD 5CZXC 1OTTD 2P24B 3MV7E 2FBOJ 3MA7A 1MLBA 4O9HL 2YHGA 5HY9B 3DV4A 1BFTA 4Z6AT 2H8PA 5I8KL 1FG9C 2XTJC 4X4ZA 1U2HA 4GBXB 1LEKA 2JB6A 2HT3D 4R4FH 3UC0H 1JNLL 1I85C 3IDYB 1RZIA 4PREA 3OB0K 1CU4H 4JDZA 3VWJC 1J0JA 4DCQA 4R0LC 3FHQA 4DFHA 1F00I 1JYWA 7CGTA 4OF5A 1U8NA 5GGRB 5K33A 1OARL 2OZ4A 1EHAA 3X17A 1S9XA 4NJ9L 4YHML 1EJOH 4Y2OA 3QRFM 3GRWL 4M5YH 1UB5B 5JLZA 2Q86A 2GSIA 5GGUB 4P4KB 3JSSA 5IROA 3ZKND 5DZLA 3ESVF 3QXWA 3HRZA 1KGCD 4G9FB 1WLHA 4NQCB 1YY8B 2OTWB 2X4NA 2YBRB 4F9LC 1C7SA 1UKSA 1DQJB 3U83A 4U1MA 5IW1B 4LBEB 3OHXB 2BNRB 4KRLB 5FV2A 3QQ9D 2FBJH 1IGCL 4H25A 1E6JH 4Z77B 2XA8L 5DHXB 2ITCB 4DK6A 5J7CC 3CZFA 3MLPA 1UKTA 2APFA 5AWNH 5BRZE 4G6AC 5E6IB 3QJHA 4K3EL 1UM5H 4FMFA 4YPGA 4BSWA 3VMPA 1KLUA 5CGYD 4Q9CA 4XMLL 4NCDA 4OF0A 1JGUH 1ZT4B 1LP9F 3ZE0F 3GDBA 3DXAE 1EXUB 1BD2D 4QF1A 3EO9H 2A83A 5IVXF 2DB8A 4XMPH 1A3RH 5C0AB 5DJ6A 1B6DA 4P3DA 2D9CA 2BXYA 4O5LH 3ZTJG 1EUTA 1BBDH 3X12A 4OI8A 1CGVA 1LEKB 5D1QB 4KJQD 1U3HB 4PREB 5CMAA 2XV6B 4DCQB 1M7XA 4B50A 3FQNA 3QCVL 4JB9H 5JQ6H 1VEPA 3KDMA 1U8NB 3QIWA 3GK8H 2BDNH 3P0GB 3QZWG 5GGVH 3HCVB 5D7LD 1S9XB 5F9AC 4Q9RH 3UTZB 5JLZB 4N90D 1FLTX 2Q86B 2GSIB 4PB9H 2A6IB 2NLJA 5CUSL 3IU4H 3RJQB 1D7FA 4HAGA 3HRZB 1S9VA 3QWOA 1I8KB 2P43B 1HHHA 1NGPL 2ARWA 1WTLA 4HMEA 4S1SH 3S4SA 2JTDA 1WWCA 2APTA 5DRZA 3HE7D 3ETBF 3DO3A 4JZJC 3ARDC 4EI6A 5CZVL 3AB0B 4NHUA 5I8OH 4JRXA 3B3IB 2ICES 3H42L 4WFEE 5IFAH 3RNKB 3T08A 3QJHB 4BSWB 3DBXA 4YPGB 5JPMA 3WEXA 7FABL 4JPKL 1FN4B 4NC2B 1MNUL 5MEND 2W38A 3Q0HA 4QF1B 4OCWL 1YNKL 2A83B 3H9SD 5J12C 4H8WH 4JFXA 3MGTA 4TSCL 2ZUWA 4P3DB 4HD9A 4WI5A 2VERN 5D96C 3MJGX 3G6DL 1MOEA 4MNQE 1OQXA 2WBKA 5D7SL 5GGQH 1EO7A 1YPZB 4YJZL 4AEHL 4Q6IC 5HYFA 4LLWB 1UZ8A 4N9GB 5C08A 5CMAB 5J56B 2HRPH 3QUXB 5EOTA 2OCFD 4KK9D 1GCFA 1LO3L 1JWMA 3MX0A 2FB4L 4RZCA 4WI4A 2YWYA 2VAJA 4I0KA 3RRQA 5ESQA 5FYJH 2I27N 4QHNA 3WS3A 5D1XB 3E6HA 3UJIH 5T3ZD 4PUBL 2VDMH 2VDRH 5TF1L 2JK5A 2QSTA 2NLJB 4HFUH 5GS3A 2VLRA 4CU7A 3NN8B 4YBQD 2Q1EA 2ZUVA 1V7MH 1CDBA 4YC2B 1HHHB 5DFWH 3LH2H 3N1FC 2O5XH 4L3ED 3O81A 5FHAH 1CD8A 1NLDH 2HLFC 2KL6A 4UILL 4OQTH 3S4SB 4P46C 1PLGH 2NY4D 4OCYL 4FABH 2DICA 4L8SC 4GAYA 3QXDA 5CINH 3PWPD 4NHUB 3RTQA 2P4AB 5SWSA 3OJDA 3ULVD 3JVGC 5DD0H 1DJSA 2RJMA 1CICC 2YA0A 1RFDH 3DBXB 5JPMB 4LAQL 4YBHA 4FNLH 1MFDH 4XC1L 1N7MH 3CC5A 1KJMA 5B21A 3I84A 3PGCA 3QISA 2VZSA 1AGCB 2VQUA 4K3JH 3VXMD 3SQOL 4CAGA 2D7TH 4HHAA 4JFXB 1DLFL 3MGTB 2NY7L 5AAWA 4WEMB 1MRCH 3WDJA 4PJCE 2CPCA 3WN5C 2OX5A 3O8XD 4LRIC 4OLZL 1Y6NR 3U9PL 1CLOH 1SMAA 4X80L 3EYSH 1PEZA 3EZ8A 4ZXBA 1EMTL 5C08B 3ORJA 4IRJD 1G1YA 5GS2H 2FLRT 5EOTB 2MWCA 2DM2A 2DMCA 4LSSH 1JWMB 5DK0A 4JO3L 4GG6F 4RZCB 4NN7B 3HS0A 4FTVE 2OS7A 1IKNA 5BVPL 3GMRA 4MS8D 3RIAF 5C09B 4QHNB 3CPLA 3E6HB 3P4OA 2QR0B 5DWUH 4HEPG 5DR5L 2JK5B 3PXHA 1WFNA 2GITA 2VLRB 4XTRC 3R8QA 4TSBL 3SJVE 2FJHA 3KYMA 4D9LH 5JXED 3B9KA 5LXGH 2E8YA 3L3HA 1SM3L 4F9PC 4ZTOL 5DQ9A 1IM9D 5FM4A 4JDTL 2DWEA 3RZWA 1FGVH 5FO8A 2W0FB 5FA4B 5E8EA 1YEEH 5IKCA 1U92A 3MV9D 3LD8C 4JQVA 4I3RL 5M7QA 1IEAA 1XGYL 4MA3A 3OJDB 3EYFB 4GMSL 5J11B 5I75C 4FS0A 3PWNA 3RAJH 3TZVC 2AABL 2R0ZH 1KJ2L 5GRUL 2XI9A 1QSFA 2DQEH 3CC5B 1KJMB 3LHPL 3MLRH 4RMQA 4XVSL 2WWKO 2DBJA 1Q0XL 2WBJA 3PGCB 1VFOA 1T83A 4NQED 5FCSH 2GI7A 3VGHA 5IFHH 3MUJA 2ITDB 2H6PB 4P2YA 5EU6A 1F45A 3IVKA 3EOBA 5I17B 3BP4A 4NRYA 1VDGA 4QHLB 4X4YA 4X0KA 1KPVA 2FEEL 2HFEB 1Z0NA 4P2OA 2FX9L 2C3VB 5HI4C 2ED9A 4YDLC 5I1GH 3JWNC 5E5RB 4OKVA 4LVEA 2WZPD 2GFBB 1KIRA 3MRQA 5ITBH 2Q8AL 1D6VH 2E7HA 3RVXD 4Z7VA 3PHQA 5KAQG 3QFJA 4H8WC 1Q72H 3CPLB 3HNTH 4KC3B 1XCQB 2Y06L 4RNRB 1N64L 2XFXA 3FO2A 4JFED 1VEOA 5E1HB 4U1NA 3BZFB 4P5TC 5HVHB 3ZT7A 2FJHB 3KYMB 3E3QE 3NIDE 4NNYA 4YH6A 1P84K 3B9KB 3MCG1 3W0WA 4PJEF 5A3IC 4UZGA 5LWYL 3MJ9H 1J8HD 2DWEB 2NY0B 1NFDB 3JV4A 3TT1H 4EI5C 2B4CH 5FO8B 4RBPH 3VA2C 5IKCB 4IDJH 1U92B 2VLLB 1AFVL 5C9KA 3ULUH 2F54A 3LQZA 4WVRA 2VSDA 4KDTA 1IEAB 2C3HA 3JUZA 4HWBL 4MA3B 4FQIH 3QIBC 2VIRA 3CSPA 1MHHB 3LPGA 3PWNB 1H5BC 2RQ8A 1S7TA 3H3BC 2EIBA 2EDWA 4JN1L 3MV8D 3TH2T 3MRDA 3BGFB 5E2VL 4RCAA 3I02B 4XP9L 3RKPA 2JJSA 4UT9H 4WHTA 3T0EA 1A5FL 3HE6A 5B8CA 4O02H 5EU4A 4Y4HC 1K4DB 2WBJB 4PFEA 3WD5H 3QAZC 4ZTPL 1JP5A 1FLRH 4HKZB 5JDSA 4JGMA 4U1IA 3PP4L 1V8HA 4FXGA 3ARSA 3IVKB 2XWTA 3EOBB 5E1AA 3TA3C 4ALAH 3BP4B 4NRYB 4X4YB 2NY1B 4LVOC 1NUFA 2BSED 5B39G 4PV8B 2ZCHL 2W9DL 3HI5L 4M93B 1S7RA 4P2OB 1UA6H 2GHWB 4MXQD 2ZOLA 3MODL 5BXFA 1HINH 2V5YA 3K2UL 2D7PA 1BLNA 2MHAA 5L9DL 1FL5A 4XB7A 3I3BA 4RMWA 4QLRA 1LMKA 4Z7VB 3PHQB 2Q8BH 3QFJB 4NNXA 3JV0A 2A2QT 5LCVH 2OL3A 5GRZA 3FO2B 3CLEL 1ZSDA 1HIML 3B5HA 4RWYH 4U1NB 4KHXH 4ZO8A 4I77L 2CO7B 2HFFA 5I1JH 1WK0A 1MREL 2QADD 3W0WB 3KPRE 1O0VA 2OR9L 5CZKA 3JV4B 4I0PB 1NJ9A 4RAVA 3NCEB 2NMSA 4ELKB 1TJGL 4LFHD 4D9QD 3TPKA 1KCUH 4Y16C 3AREA 2VIRB 2AEWA 4HUNB 3OKEA 2ZCLH 1SBBA 4BSVA 2ADGA 5LBSH 3MRDB 4WHTB 3D2UA 5B8CB 5KW9L 2IBZX 1H3PL 1FV1A 3TCLA 1QLEL 3ULUE 1H8SA 3GSWA 3U0WL 5DD3H 4DOHE 3GO1L 4HIIB 1J0HA 4FXGB 4QRSB 1S3KL 2XWTB 3SBWA 2EKSA 5FB8A 1R6VA 3AFLA 5GS0D 4I2XA 2ZOLB 5BXFB 5TQ2H 2VOTA 4BYHA 4XX1G 1G7PA 2MHAB 1YC8A 5T3ZL 3FOLA 1TZGL 1YEDB 3NABL 3UPRB 2NXYB 1G0DA 1QLFA 3OXRA 3PWVA 4LVNC 4NNXB 3MC0A 1IGYB 3LN4A 4JG1L 4ODBD 2OL3B 1Y6KR 4EN3D 4HFWA 4YUEL 4OM0H 3SCMD 5H35A 1ZSDB 3QQ4A 1NKRA 3EJZC 4JGJA 4M03A 2CDEA 4M8VA 1IAIH 2HFFB 4FZ8L 1I7TA 2X4OA 2IF7A 1AJ7H 1OSPL 1UENA 4NZTH 3HB3D 3LS4L 1AO7D 3OAZH 2N4IA 4JKMA 3ULVL 3BH8A 5E24E 4HCRH 1A9BA 4PJAE 3W5MA 1I8LC 3QNZA 1QYGH 5E70A 3RI5F 3AREB 4EOWL 3LN5A 3OKEB 5J9PB 4BSVB 3KYOA 5EZJA 3HZKA 4G7VH 4P5MA 4Z7UB 5EZOL 5DJCA 3K4AA 5TGBA 1WQVT 3GI8H 3UEZA 4KJWC 3G6JA 3NH7H 4Y4KC 5DFVD 3TCLB 5I1DB 1WV7T 4DKEH 4JHAH 3RNQA 2MJWA 4FHBD 1FNEB 3K4ZA 1EHXA 1X6NA 3GSWB 3I85A 3BQUB 1CDHA 3BI9X 2B4CC 4MQSB 5BZWB 1I9IL 2EKSB 5ICZA 2KUTA 4B53A 3QWRA 3ULUC 3ZKXC 4KTEH 3U36A 5ADPH 3VXPA 2AJUL 1YUHB 4KQ4H 4H20H 3WFBL 4L4VD 2DYPD 4ZUUA 2C9AA 2AGJH 2F8VA 3V4VL 1I9EA 4XCCL 4P59L 3S97C 3ABZA 4X99A 5J1TC 3IFPB 4P99A 4CBPA 1QLFB 3OXRB 2F5BH 5DRWA 3D0VA 3LN4B 4PRPA 1EO8H 4HFWB 4HKBB 1UYWH 2B1AH 1UEMA 3F7YB 2Z0BA 3QQ4B 1Z9OA 2JCCB 2B8OT 5F21B 2ZPKL 1I7TB 1GSMA 2YEZA 5I8KH 2PYED 2L0DA 1KNOA 2ATPA 4H26A 1BIIA 5HYIA 1NAMA 3EW3B 1A47A 4QOKE 5E2JA 3SKMB 3BH8B 5DRXB 4WHDA 3MLZL 4FXKB 1KPRA 3C6LA 3V4UL 4PJFF 2IBBA 4QKXB 3MO1B 3QHTC 4PJ5A 3RU8H 5EBMA 3L95A 5FO9A 4PP2A 5IVNA 1NSNL 3LN5B 1MFEL 1OARH 1MVFA 3MMEB 3KYOB 1R3LA 3UTSA 3H2WA 5EPMA 5EZJB 4Q9QL 2F8OA 4OM1L 2V7NA 1AGDB 5DJCB 3BOVA 4JCMA 3VG0L 4PYHA 3G6JB 4HMDA 1U93A 3SKNA 1R24A 3ARGB 4P57A 1HEZA 2ERJB 4Y5XC 3H3PL 5HDOA 2QSCH 2VZVA 1PZUB 3RWDA 3PUCA 3L5XH 4JDVA 3FQUA 4KHTL 4WTZG 4Z7OE 4YQXL 2B5IC 1KFAL 4LPXA 5HYJE 4O58L 2Z31C 3F7VA 2IADB 5J1SC 5CBEB 2RCSH 4OTXL 2B0SL 3RHWF 3VXQB 3U36B 1ITCA 3HI6L 4M43L 5F88A 4NQVA 3VXPB 4MD0B 2P49B 3V5KA 3HFML 1W72L 3QH3A 8FABA 4ZUUB 2EDDA 1LDPH 4G9FD 3DX9B 4H88L 1ZWIA 1OAXH 1MJUL 2EH8H 2KZWA 1LEIA 1EHLL 5CILH 1K5NA 4IBLT 2BCKA 4X99B 5DRWB 4PJXF 4QHKI 3D0VB 5GRVK 3V5HB 4PRPB 1IGTA 1S78C 4JFQA 2LV4A 3KLAA 1J1XL 1Z9MA 4Z95L 5DURD 1JUFA 3P73A 4FQPA 1QSEB 3MBEA 2IGFH 5B3JF 2YEZB 5KSBA 4OF8A 3O2DA 4UMGA 4BK5A 1KNOB 3HC3L 4H26B 1G9NH 1P9MC 4AENB 1NAMB 3Q5TA 4OZHF 1E4XL 3O3UN 5JZ7D 1KJ3L 2AJ3A 4N0RA 5E8DL 1DQTA 4OD3L 2XG5A 4CU6A 1KPRB 3QCUL 5F96H 1K85A 4TSAL 5IHLB 5BOZG 4LEXL 1WC7A 4WNQA 2DLIA 2UY6A 3EYUL 4KMTH 5EBMB 5FO9B 4XVTL 4WFGD 4WHYH 4JFHD 5HI5C 3GSVB 4YHOL 3UTSB 5EPMB 3RZCD 2V7NB 4LP5A 5F7EH 1QUNA 5L2KE 4OCMC 1NBYB 1DBAH 1I3RB 4ZOEA 4HWZB 2F5AL 4JQIL 1Z2KA 3SKNB 3S7GA 3DTXA 3QXTA 3P4NA 1HEZB 4LDLB 5E2UH 5DGRA 3RWDB 5BS0E 4JDVB 3DUUA 3FQUB 1BP3B 1FBIL 4NHCL 2ZG3A 1MAMH 4R2GC 1EEUA 1X7QA 4I5BA 5IJVA 1E4KC 3A6CH 3V6ZA 5F88B 1FFOA 3EFFA 5E4EC 1CQYA 1R3JA 5EIQA 5BV7B 4CN4A 5T5FH 4R8WL 1QA9A 3AM8C 2OMBA 3QH3B 4JZNB 4PTUA 2J2ZA 2DDQL 4P0DA 3SDDC 8FABB 4Y1AB 1K3IA 3PWUA 4RBPK 3VGGA 1XGPB 4YXLL 5GRJL 3BIAX 1LEIB 2BCKB 1ED3A 4IMLB 2VE6B 4KMLB 4GAJL 3OGOE 2EDEA 2LU3A 4JFQB 3B8YA 4HUUA 1IC7L 5F3HA 2ICCA 3P73B 1YNKH 3BP6B 4XXCA 3GM0A 4RGOL 3DSFH 4UIMA 3T0BA 2AQ1A 1FG2A 4IIQB 3JTTA 1ADQL 2V9RA 4XCFH 2G5RA 3IFOA 1ZT1B 4M6MH 2YD9A 2AJ3B 9CGTA 3INUL 1RY7B 4EUPA 1IBGH 1I1RA 3HMXH 4IRSA 5KSAA 5K9QI 1WC7B 4WNQB 3IAGC 3B6SA 4X6CA 2FB4H 4M1DH 5C07E 3MRKB 5GHWH 3VXRA 4F7CA 1URLA 1SEBB 2DBLH 1R0AL 2F53E 5IESL 5B38A 1FSKB 3BKYL 4HIXL 4BQ8A 3NCYP 3DTXB 4OFYA 3P4NB 5FUOL 4LF3B 2IH1B 5GS0L 4X6FB 1CS6A 3QIWD 4MNHB 2AJYL 4WWKC 5H37G 1X7QB 4UILH 3AXLA 5IBTH 3V6ZB 3X14A 3GI9H 3MV7A 1FFOB 4U3CA 4NC1E 1R3JB 2NW3B 1KN4L 4IOSD 3I6KA 4UV7L 1QA9B 4PTUB 3FO9A 3U9UB 1PG7X 1Y0LA 1J1PH 1QBMH 3O45A 2AI0L 4LPUA 1DBBL 4UUJA 1RZKH 1ED3B 4MQXD 2DKMA 4KDVA 4JVPA 1UT9A 1NCDL 1WITA 32C2B 1RI8A 2NY3B 4HUUB 4FZEH 5F89A 2D0HA 4JRXD 2DQIH 2V17L 1AQKH 4WJ5A 4BQBA 4BA8A 3MZTA 1MFAL 1TETL 4UIMB 4UQ2B 2OP4L 3JTTB 4NFCA 3IFOB 1WJ3A 4OFDA 5ECJE 1VPOH 1Q9OA 4AIOA 5KVEH 4QXUH 2OK0L 4EUPB 5DUPH 1RIVL 1RJCA 4IRSB 1S8DA 4JZJA 5KSAB 1UCBL 4K07A 5I1KH 5F44A 4F58L 1T7VA 3B6SB 2R2EA 5D4QA 1K6QL 4GRLB 4F7CB 1G9EA 1MRDH 4YPJA 5I18H 5IHUL 3HC4H 2OJEA 5DR5H 1ZOXA 3PIQB 1LP9E 3BRFA 3Q2CA 5IVXE 4G8IA 5BRZA 3K1DA 1VGKA 2Y36L 1WICA 1SYVA 4H0IA 4OKDA 3VRLF 4DZBB 1JPST 3DVGA 3X14B 4RIRA 1ZTXH 3DXAA 2FX8L 3QG7H 2NW2A 2VLRD 3KS0J 4R4ND 3OAZK 4R97B 4OZGF 3FO9B 4I3RH 1ACYL 2ZUTA 1Y0LB 3O45B 4U6XA 1DQDL 1B2WH 4NCC2 3QP3A 3DMMA 1HZHL 4UUJB 1IAIM 4O2EA 3OG6B 2AABH 3C09C 1J0KA 5GRUH 5BMFH 1H3TA 2VH5H 1AH1A 2JELL 5I0ZA 1S9WA 4XVSH 3WJJC 3UTTE 3RTQD 4CVXA 4KKAD 5SWSD 4FQJL 4NQDD 4MX7A 2Y9RT 4OLWH 4MDJB 4WJ5B 5EOCL 4LIQL 4XI5C 5LGHH 5JOPD 3CD4A 5GISL 4GSDH 4NQUA 3HMWL 4KI5F 4NUGH 1Q9OB 2Z92A 3BEWB 2Q7NA 4Y88A 5D2LF 1S8DB 2DQJL 5DVKA 5DTFA 4NOBA 2X9XA 3O6FB 2JJVA 2WK2A 3MNWB 2QSQA 3JVGA 4OD1L 2XZAH 5LQBL 5ILTH 3VFWA 2ED8A 4ZXBD 1CICA 2OJEB 1N64H 1QHOA 3TBYA 4KUZH 4HWNA 4BZYA 3GMQB 5KBNC 4DKAA 4K9EH 4G8IB 1KPUB 3MRCA 2GTZA 1CZ8L 1KB5L 4JM2C 4OLYL 4RFNC 1SYVB 4I3SH 4X9BA 2XZZA 3C60A 3EKCA 3DVGB 5ETUB 4RIRB 4OCSH 5EBLA 4WO4B 3SGDH 3DXAB 2BVPB 3GBNH 4HUXA 1J1OH 3BP7B 4PRID 3B9KD 1FFNA 2FIRT 3HI1B 1T2QH 4GXVH 5BW7C 4MNQA 1EV2E 3DMMB 1MHPL 3VDCA 3QDJE 4O2EB 5CCKH 1ZGLB 5JR1H 5J06A 3UP1A 1TZHA 1B9ZA 1GPOH 3TBTB 4YHKL 5AZ2L 5BOPA 5GGSA 3MGAA 3TYFA 3MRFA 1H3UA 3SE9L 2R8SL 1S9WB 1LO0H 2G2RA 1YPZF 4UU9A 1IGIL 3MLVH 4XAWH 5KVGH 3P30H 4HZLA 4MX7B 1KYOK 4WU7A 2E27H 5EU5A 3CVIL 2A38A 1S9KC 1BGXL 1QSFD 3TN0C 5KVFL 4AY0A 3GSOB 3FRPG 3VXUE 2Z92B 2ZCHH 2W9DH 3HI5H 3QUZC 4UT6L 1OOAA 4Q7DA 5GJSL 2C3XA 1RZKC 1U41A 3MODH 4KFZC 4NWTH 3P2TA 2IALA 2WUCH 3S5LG 2NY5H 3S37H 3N06B 5DTFB 5EU6D 5HPMA 4NM4H 4KROC 3QJFA 1ZLWH 5EG6C 5HJ3A 4H1LG 1JHTA 3CSBA 2BVYA 3GMOA 4P2OD 3VFWB 4A2MA 1Q0YL 4KI1A 2VDNL 1TNMA 1Z5LB 2PXYC 1HIMH 4DK3A 2XKSA 2IFFL 4I77H 3BWAB 3MRCB 1CGSL 2BOBA 3ARBC 5DJXA 3QFJD 1QFUH 4I9WD 3HZMA 3C60B 4IDLA 3PABA 4JFPB 1FFQA 4UT7H 3NBNA 2VDKH 2LU7A 3SDCC 3RFZC 5JPNB 3RIFF 1FFNB 3HA0A 3IETA 2VXUL 4TYUA 4PJCA 3W0WD 3G04A 3V52L 3AU1B 5IWLC 4KKLC 5GGSB 3TYFB 2NXZD 3MRFB 3P9MA 5MP6L 2F54D 4GW1A 1E4JA 1JFQL 4UU9B 2YD8A 4J2XA 3U0WH 2ESVD 2WUBL 4UTAL 3L9RB 3GO1H 4WU7B 4FTVA 3TBSA 3K81A 4P5TA 2X4RA 5EU5B 3T0ED 5HD8D 3HE6D 2ICWJ 4IOFC 1OTTC 1NCAH 4HBCL 4TUOA 3SJVA 4Z18A 4CVZB 5TDNA 5CEZD 4JG0L 3UBXB 5T3ZH 1NEZB 2NX5E 5HPMB 2D0FA 2Z91A 1J88A 3QJFB 2HT3C 3VH8A 5L0QB 1XF5A 5HJ3B 2V5SA 1JHTB 2EZ0D 3MLWL 5ACLA 1H5BA 3GMOB 1D5IL 2VR9A 1V3JA 5FA3A 2BNUA 1UH3A 1N6QL 1X4XA 2FGWH 1BHGA 4UTBL 2BOBB 1P4IH 2GEEA 3RWCB 5DJXB 4YBLC 1OSPH 2MQ3A 3NAAH 1AE6H 4G42A 1A0QH 3HZMB 4ONFH 4XPTH 5AG8A 4L1DA 1HHIA 2V9QA 3ZKNC 1LWRA 1GGCL 4Y4FA 1I9JL 2AV1A 2WAHA 3IETB 1IARB 1JNHB 2YXFA 5C3TA 4PJCB 4DN4L 3CFJB 4EOWH 4LLMB 4AG4L 1UM4L 2EC8A 2W60B 5F9DC 2Y25A 1XCTA 4U0RC 4OZIB 1FFPB 1INEL 4K9EC 1R3IL 1XIWC 3ISWA 3MLTA 5EIIB 3QQ9C 1FDLH 2CKBA 3ARYA 4GW1B 1F90L 3GHEL 1PX4A 4GW5B 1WZ1L 3ARED 4ZOBA 2PW1A 4MJIE 4YFEA 4FTVB 3S35L 2Q7YB 4PJEE 4ZAKD 2CRYA 3BPNC 2YK1H 2EYRA 2GQHA 5DK2B 3OGCA 5CGYC 5EC2A 3D2UD 4Q97A 2UVEA 5DMKA 3BAEL 1RULL 3SJVB 1WT5A 5TDNB 4W68A 1MFNA 1UG9A 4W4OC 3EOTL 5A2KH 3MLYH 2Z91B 1EAJA 4AEFA 4KGJA 4Z9KB 1XF5B 4ZODA 3SDAA 1TQCB 3EYVA 4KJQC 1F6LL 3HZVA 1AD0A 5F8QC 2VZOA 1CDYA 2BNUB 4GXUM 1JGEA 2FX7H 5F1KC 5LAXA 5D6CB 2ED7A 2HWZH 3RGHA 4CVUA 2ZPKH 3G5ZA 3IT8D 3T4AA 3O3DA 3NPSB 3PNWA 4G42B 2N1KA 4DQOH 4JVUA 1Q8MA 2NY5C 4JHWH 4EEEA 1HHIB 4JANA 3JZ7A 5HYEA 4Y4FB 1IM3A 1KCSL 2VLMD 4JEGB 1FIGL 4JLRA 5FUCC 2X05A 5HYSG 1WWWX 3LIZL 3NZ8A 1WTGT 1T22A 4YHLH 5ERWB 4U6VH 3L3GA 2I60L 4LFHG 1SMOA 3HE7C 5DDHA 4ZFOL 3MLTB 5EO1B 2AJSL 2CKBB 4MNGE 1ZA3A 3PGDA 1BAFH 4Y2DA 2CDFB 4QY8A 2VLJE 2MSPA 1E27A 1OTSD 1IAII 5E2WL 1VFMA 3OGCB 5EC2B 3LS5H 2FRGP 2C1PB 4JRYD 5C8JA 2DLHA 3VWKC 1TVDA 1RIUL 4H88H 2DQDH 3L3IA 3KPRA 3RGVA 1MJUH 4EQ3A 4OIIH 4EKXA 5TH2A 1DQLL 2IG2L 3QXVA 1FL3A 3SDAB 2BP3A 3EYVB 1BF8A 4GRWH 2ZUQC 1AD0B 3Q6FA 1EIBA 1JGEB 3RVWC 4I48A 5LAXB 1RJYB 5DT1L 5IEHA 4KK9C 2AXHA 4HXBL 4G7YL 3BIBX 5SWQA 1IC1A 1FE8H 1PG7L 1IL1A 3JWOL 3PNWB 3IXAA 4HULB 3FFCD 4RDQF 1DQQA 2GSGA 1HHKA 5B4MD 4JANB 2PR4H 5I15L 4YBQC 5IT2L 1MY5A 3P77A 1IM3B 1WSST 1FNSL 4N0CD 3T0XA 3WDIA 1M05A 4XVTH 4JLRB 5TF0A 4LSPH 3NZ8B 4KJPC 4MLIA 5DDHB 5GJTL 2NY4C 1K8IB 3BZDA 1U8HA 3C6LD 3QHFH 5D71H 5D1ZB 5DA0B 4KAQL 1ZA3B 4Y2DB 4PJ5D 4JZOA 5EU7E 4QY8B 2OR8A 3ULVC 4HJJH 4JR9L 2BFVH 1CE1L 3UTSD 4YDVA 1EHNA 3Q3GA 1E27B 3CDGA 3IKKA 1A6PA 3SKJH 5C8JB 4KK6D 1NGYA 1U0QA 1ES0A 1QG3A 2DDQH 3OZ9L 5D2NE 1INDL 2GW5A 5DLML 4PB0H 1B4JH 5FAAA 4YWGH 1D9KA 1DN2A 3TWCH 3L3IB 4NKDA 5EFIA 1ZA6A 3KPRB 3RGVB 1MEXH 1DN0A 1ZS8A 5BQ7A 4NZRH 4DGIH 4ZUVA 1FL3B 3LKQB 4PJAA 5DHVH 3NTCL 5ALCL 2R69L 1A3LL 1F3JA 1A7OH 1I8IB 3TJHC 1P6FA 4DAGH 4TOYH 4NJAL 1NCCL 4DGYH 5IEHB 1J8KA 4G80A 1MRFL 1FNLA 3FB6A 5CD3A 5SWQB 3GNML 1BQHB 3IXAB 1JPFB 4YDKL 3IDMA 5F71A 4AIXA 4Y5YC 1IMHC 4XPHL 1DQQB 1HHKB 2W9EL 4UOW0 2VDLH 3MBED 4U1SA 2H45A 3MBXH 1CDUA 2YD7A 3IDJA 4PGZA 2YKLH 4HKJB 5GRYA 1R5VA 3NCFB 5I30H 4P9HL 4LCYA 5CS7A 3ZL4H 1U8HB 1REIA 1E0OB 4P2RE 3T0VA 3I6LE 4NNPL 1ZLWK 1ORSB 5E9DE 1ULVA 3ARRA 1AR1C 3GIVB 4QTHA 1YEKH 3I3DA 5JUEL 4UBDD 2DLGA 2AJYH 1HKFA 3Q3GB 1WIOA 1JBJA 5DMGD 1EZVX 3CDGB 5EU7C 1A7PH 4DGVL 2WLZA 1YA5A 5FK9B 1NGYB 5C0EB 1ONQA 4PJFE 3WFEL 5IV2A 1D9KB 2OI9C 2JCCF 4YZFF 5EFIB 2Z8RA 1ZA6B 4G5ZH 4NM8H 3TO4B 1DN0B 5BQ7B 1DFBL 4J6RL 4HC1A 4KZDL 4I4WA 5J6HA 1CXLA 1AGEA 4ZUVB 5EIVA 4QOKA 2XTJD 4PJAB 3O3AB 3D25A 1F3JB 1MCPL 1CD9B 1QHPA 3U4EA 1CQKA 3G5VA 3GJFH 4U49A 5FGRA 1YDPA 1F8TH 5CSZA 5C0FA 4G80B 3S9DB 3P11L 3B2VL 5EORL 3WXVL 5F7HA 5CD3B 3CCHA 2HKHH 5IHBA 1WEJL 2DQUL 4RMSA 2YSSA 5CJQH 2NY3D 3ARFC 3DUHA 2Y07H 2ZNXA 1M4KA 3U4BL 5CLWA 3IDIB 5TQ0L 1UCBH 5A2IH 4U1SB 4ODUA 2WINB 5HYJA 1BPVA 1NDGA 4FFYH 4HGKC 4LLVA 1BOGB 1P1ZB 5E99H 3IDJB 2YRLA 4UIKH 1RUAL 2WLYA 5GXBB 1R5VB 3BKMH 1MFCH 2F19L 2AERT 4LCYB 4PJXE 3CVHB 1KBGL 4OZFB 4NKIL 1WZLA 4Z7WE 4IRSD 4X98A 4HIJA 2H32A 1WISA 4J3TA 5ALBL 3KLHD 2ICEA 2X1WL 5FYLD 2YRPA 3KPMB 1IAKA 4C83A 4P48A 3VXRD 5E0QA 4F33A 1BVKA 1YN7A 3RVTD 1J7VR 4G6AD 2IAMC 4OZHE 1G9ML 3FN0H 4OFYD 2IQAA 2BMKA 3D9AH 5IV2B 1ACYH 4N0YL 5DQDH 2HH0L 5ADOH 1HZHH 4QOKB 2C4FU 3CX5K 4ZUTA 3MV7D 1HH6A 1U8LA 2YPKB 3ARVA 3QXAA 3D25B 5KANI 4U2ZA 4ZDHA 1LE9B 3U4EB 4MXQC 3G5VB 1EEYB 4G6FD 5H2BA 5GS1A 2D7MA 5CSZB 4PJIF 3CCHB 4S1DC 4KQ3L 5L2KA 2QHRL 3MRRA 3Q1SL 1BWWA 4ISVB 5T1MA 4NOFA 1N5YL 5MEPB 5BS0A 5I16B 4LPWA 4ODUB 5HYJB 1NDGB 3O11A 4QYOB 4LLVB 4ACPA 2FIKB 3BXNA 5HVFB 1IAMA 2VNCA 2W0LA 4OD1H 1X5HA 3P0YH 4X7TA 1BZ7B 5EN2A 5TDPA 5MERB 2VUYA 4WW2F 3RP1A 2DI9A 4XMKH 3MXVL 1S7UA 4NC0B 3ARXA 1AXTL 1C16A 4JFDE 4HIJB 1GIGL 2ICEB 4POYA 3UJTH 3GSRB 1PY9A 1IAKB 1X44A 3MJ7A 4C83B 1AHWC 1GGYA 1KV3A 5DD5L 1GVIA 4ETQA 1JE6A 4LASL 4F33B 4LSTL 1CK0H 1YN7B 3QUKA 1B0RA 4G3YH 3WE6A 3VFOA 1MCOL 2IQAB 1QACA 4X9HA 2VAAA 5F9OH 2GJJA 2BMKB 3HAEG 4GT7A 4M62H 4TTDC 1L0QA 4QWWC 3VXSB 5BRZD 1WFUA 3SGEH 1NL0H 3JTSB 2O5YL 3SE8H 2E7MA 4ZUTB 5I74C 2YN3A 4PGEA 4XC3H 1T89A 1U8LB 3DXAD 3QXAB 4PD4J 3KYKH 5IVZB 4ZDHB 2OXHA 2CGRH 4ORGB 5H2BB 3T1FA 3MRBA 4U7KA 1T80A 4X5XA 4TRPH 1W0VA 5C07A 3CX2A 4PY7B 1EEQA 1GOHA 4K94L 5KJRL 3MRMA 3MRRB 2CLZB 2F53A 1CXIA 5T1MB 2J5LC 2C4FT 4LCCC 4OGYL 4EN3C 1Z3GH 3SCMC 4V2BA 4M6OL 5BS0B 1L9MA 4R7NA 3C6SB 4R26L 5DD1L 3O11B 1BMGA 1QBBA 3BXNB 5CP3A 3HB3C 4LLAA 2VXTH 1MF2L 3B9EA 5E7FA 5EN2B 4X7TB 4J3OC 5TDPB 2NY6C 1RZJH 2OZ4H 5IQ7L 3FQTA 3OX8A 4KTYA 1UQSB 1S7UB 1LO4L 3ZTNL 4JFZH 3ZKQD 3WJJA 1DR9A 4M4RA 1TJIL 3ARPA 4KPHL 3FTGB 2Z8WC 3MJ7B 3PL6A 1JZ3A 4MZ3A 4FQ1H 4R90H 1BEYL 4KUCF 4POZD 1DEEB 4ETQB 3EIFA 1DDHA 5CEYA 3QUKB 1CICD 1P53A 4NO2A 3WE6B 3VFOB 4XH2A 4NN5B 3S6CA 2VDOH 4XVUC 2E9IA 4ONGL 1RUKL 4NZUL 4W6YB 5E7BA 3VFVA 3K8KA 2A73A 1F4HA 4OCRH 2GK2A 2WWMC 3DUSB 3C60D 5DJ0B 1MCFA 4NQCE 4PGEB 1IGMH 1W8OA 1OHQA 4XWGL 1S5HA 5HHPB 4MZ2A 3MR9B 2JB5H 1MCLA 1DEDA 1FVEA 2KQNA 4K3DL 2BNRE 1KJVB 3N0PB 4MNQD 3FB7A 4UTAH 5C07B 3FZUD 3EGSB 1NCBH 3MRMB 4MA8L 3W5NA 3WKML 5HHNA 2D9QB 3O2DL 3VRLE 1M71B 1NMAL 1LP9A 3B83A 4F3FB 4HBCH 4M6NL 4L29A 1VB9A 5IHZA 5IVXA 4M7JH 1G7IA 4JG0H 4TVSa 4R7NB 2AEQL 4S11A 4WFFE 3LKOA 4OZGE 4XTRD 1I7UB 3SGDI 3BHBA 4M00A 1UJ3C 3BH9A 2NQCA 4HXAH 1E4WH 1GC1H 5C0AE 3O2WL 4YX2L 4NYLB 5DRNA 2XACC 2JJWA 1ZAGA 5HDQH 1RZ8B 2FHCA 3VI3F 3FQTB 3OX8B 1U8JA 4OT1L 1T5WA 5E03A 1N6QH 4G9DA 5DUBA 2X5PA 3OR6A 3ELAT 3PL6B 4GBXC 1RUQH 4WDIB 1U58B 4K23L 1DDHB 3IDYC 1DQML 5CEYB 1YECH 1AKJB 4KI5E 3TZVD 3GKWH 5ICXA 4ZD3L 3UTTA 3BMVA 4YHPA 3UMTA 5T1DL 3RA7H 4BFIB 4XH2B 1JHLL 3TN0A 2ZG1A 1GGCH 4TPRH 1I9JH 3OR7A 3QUZA 3MLSH 5D2LE 1MIEH 1MJJA 3REVA 2QHLA 1R3KA 3WO3B 1I3GL 1QFWH 3KGRA 2A73B 2AK1H 1NBVH 2ZZUT 2QQQA 4RMRA 1J11A 2ORBH 5I8CA 3KXFB 1INEH 1HSAA 2VZTA 1UM6L 1QNZL 4LCUB 2J6EA 3N9GL 1VFAA 1QSZA 3DJ9A 2VDQL 3O0RH 5C0BE 5E08L 3B9VA 25C8H 3CFCL 1WZ1H 4QXGH 1ZANH 2PXYA 4KV5F 5GGVY 3RWFA 1GJIA 3L1OL 4F15B 3CFKA 5HHNB 1RIHL 3ARBA 3WS6C 1LP9B 4D2NA 5I9QB 1YEJL 3GB7A 3BAEH 5T1KA 5HYQA 1RULH 1S5IL 3LVEA 3TF7C 1MVUB 2YUXA 5IHZB 5SV4A 5IVXB 2QQLH 2ENYA 4ZNEE 2KDGA 4WV1B 4FTVD 3LKOB 4LRNH 3V9FA 4A6YA 3BHBB 4P5TD 3RX8A 1QZ1A 3BDYH 5FDYA 2NYYC 3DVFA 5E6IC 4LEOA 5EDXA 2I26N 1U8IA 3NMEA 4AIZA 1EGJA 3I50H 5JZ7C 5FYLL 5DRNB 1CBVL 1FFRA 1OM3L 3SJVD 5C0DB 5C0CB 1I8MB 1Q9LA 1KULA 4EI5D 1T5WB 4WENB 5HHVL 1YPZE 2PYFA 4TNWF 5EBWA 3OAYH 4QRQA 1C7TA 2ZKHH 1SEQL 3QDJA 3GJFK 4PJ8A 3SKOA 3VJ6A 3QIBD 4LQFH 5FFLA 1WZKA 2F15A 5D1QC 3LB6D 4YEFA 1FORL 1MCQA 3EYQD 4PJBF 5TFSH 4OCXH 5ICXB 3UTTB 4YHPB 2MFNA 1QKZH 3VWJB 2XKNA 2X7LB 4DZ8A 3OR7B 1J5OL 4R0LB 1MJJB 5D6DA 1RZJC 3ZE2F 5J3HD 2VZUA 3PQYE 15C8H 1YY9D 4HLZG 4LOUD 4CDGC 2DQTH 1KEMH 5KTEL 5I8CB 3VXUA 5JW5B 4XNYL 2CK2A 1UXWA 5D7JA 5IROC 1T03L 4DJMA 4YDJA 1VFAB 4Y4FD 1H8OA 1X5JA 3RJDA 4BZ2L 4P3CH 3ZLQC 3WUWB 1A14H 1CDIA 3TCXA 3MRGA 3G08A 5JORA 1KENH 4LHJB 4X6BB 3GB7B 1GL4B 2VXVH 5HYQB 2EDKA 3QUYA 1OCWL 4HIEB 1BQLH 4A6YB 5L2JA 1BJMA 3V7AG 4FXLA 4LEOB 2R1WB 3C5ZA 2IG2H 1KIQB 3KJ4B 4G8GA 4PGDA 5CJOL 4AIZB 1J05A 4W4NA 3IXTA 2PKDA 1P7KA 2YR3A 1A7NL 4ZPVB 3HUJF 1HILA 2QQNL 8CGTA 2XZCH 3DI2B 5EBWB 4A2LA 4RGMB 4GG6A 3NFSL 3QDJB 4C55A 2ZWLT 1KUMA 1Y18A 1PG7H 3SKOB 3VJ6B 3SDAD 4ODXA 4J3VA 4JY6B 2VO5A 5E00B 2KH2B 3MJ8A 2J88H 3C08L 1YMMB 4R3SA 3C2SA 1GC1C 3LZFH 4F7EA 5C09E 3WIHA 4DZ8B 5IT2H 3FQXA 1JGLL 1SHMA 2KPNA 4HJGB 4CKVX 4Z5RA 4NKMA 3QUMA 5FUZL 4K2UL 4OIBA 4RMUA 4C4KT 2D7OA 4FP8H 1CGWA 5D1XC 5GJTH 1UXWB 5D7JB 5D72H 5I66B 1IZJA 2CJUH 3QWQB 3KPPA 1AI1L 5CGTA 4KAQH 4YC2C 4XCNA 2WV3A 4PG2A 2NX5A 2HFTA 4FQCH 1GAFH 3B8SA 4YFDB 2JF1A 3MRGB 3G08B 5KN5A 2APVA 4UAOB 3VFPA 4MQXC 2CXKA 4X9FA 1L0XA 4R4FL 1VADA 3T65A 2K7QA 2RB8A 3DNKA 4NKQB 2H41A 1NUNB 2WIMA 3UC0L 1M6OA 3QUYB 4Y2DD 1KEGH 5IEKA 1INDH 1CU4L 5E2TH 4G6MH 1PGRB 5L2JB 2COQA 1G7HA 1I7RA 5H8DA 1W0WA 2CKNA 3C5ZB 1S7VB 4G8GB 4WEBH 4PGDB 5DK3A 1RURH 3O3BB 1P7KB 1EJOL 1FAIH 4M5YL 2H1PH 2YPLD 3F5WA 3QO0A 4QHKJ 2G75A 5T3XH 3RGVD 4GG6B 1QPXA 4HX1A 4ONHA 1OTUD 1Y18B 5DUMH 2VWEC 1UVQA 3SQBA 2MOVA 4Q6IB 1CCZA 3TBVA 4OZIF 1KXQE 4PY8I 4R3SB 1NBQA 4F7EB 1JI2A 1R3HA 4PV9A 2FBJL 4MJIA 4OFKA 2HG5A 2HP4A 1BVLB 1Q1JH 4UINH 5BCAA 4PLJD 3VWKA 4PJEA 3D69B 3QUMB 1NMCB 1GZQA 3E2HB 3T2NL 5T1LB 1CGUA 5AWNL 4W81A 3ULUD 4YHYB 1FCGA 1SVCP 3KPPB 4LSUH 2GK0B 1NFDE 1RVFH 1N6VA 3BD4A 4R4NC 5JNYA 3PP3H 4Z76B 4U1GB 3O4OB 3EO9L 3ZYIA 2EDQA 4XMPL 1A3RL 4FQHA 3GMNA 5KN5B 4HSQA 4GKNB 4J1UA 5CEZH 4O5LL 4AT6A 3DV6A 1BBDL 1AGFA 4P46B 4U0QB 3VGDA 1WUNT 1VADB 3OTTA 2O5ZH 3T65B 3LKSA 1J86A 1M6OB 4KKAC 5FXCH 1JGDB 2UY7A 4UI2A 4N0UE 3ME0A 3U2SA 4CW1A 5J11C 4WUUE 4K7PX 3QI9A 3MXWH 1G7HB 4JB9L 1DFBH 2DIJA 4J6RH 5JQ6L 1W0WB 3GMPA 5IQ9B 5GGVL 3GK8L 1SY6A 1L6XA 5I8EA 1BFOA 2V2XA 4ERSH 4Q9RL 2Z93B 1MCPH 4N1EA 2HVKA 3QO0B 4PB9L 1D9KD 1CIDA 1P2CB 2OL3H 3IU4L 4YK4B 4C56B 3B2VH 4G8FA 4HX1B 4G8EB 4GQ9H 1NKOA 4MB3A 1K2DA 5E8OA 4D94A 4DVRH 2ZSVA 4U1JA 3SPVA 1UVQB 5FF6A 4S1SL 4ZXBC 4LLUA 4YIQB 3TBVB 1ACZA 4MNGA 5TDOB 3UTPE 3H8NA 4PV9B 2VLJA 4MJIB 3WXWH 3K4DA 2HG5B 4MAYB 4XB8A 1MWAB 3REWB 5I8OL 4PJEB 1YEIH 1RUAH 2Z35A 1GZQB 4D8PA 5IFAL 3F6IA 3FQRB 4GQPH 4ZPTA 1NGWB 1KTLB 2EXWD 2ZG2A 1KIUA 2GTWA 5IK3B 5HVHC 2BVOA 4JREB 4U33A 3B9KC 2AJZA 1T7WA 2I07A 2MQ0A 4ODWB 1HH9A 4H8WL 2H9GA 1XF2A 4PRHE 4FQHB 1C1EH 3GMNB 1MH5B 4J1UB 4KVNH 3DV6B 5IB3A 2VTFA 5K9JH 1XT5A 3T09A 1NC4B 2DJ4A 3TJEH 3QFDB 5GGQL 1EEZA 4MXVF 1F02I 5CWSA 3QNXA 4JQVC 4LMQI 5FKPA 3UPAA 4IS6A 4QRRB 1JWSA 1PY4A 3T3MF 4FQXB 3U2SB 3L6FB 4PRDA 2HRPL 3IDUA 1NANH 2H26A 1LO5A 2P8MA 4KTDH 5I1CH 1N59A 1MPAH 2WM0A 4X8JA 1RZ7H 5I8EB 4K7FA 2V2XB 4HWEH 2XWJB 2WBJC 4FFVD 3UJIL 1T83C 1V3KA 2HVKB 2R29H 2VDML 2VDRL 1FZKA 2H3NA 2IANB 5HGBB 1V7ML 5JO5A 1K2DB 3DVIA 5C0JA 5E8OB 4QOKD 3FFDA 4LCWE 3LH2L 2QHRH 1KN2H 2NY1C 2WMPA 1OGAE 2X4SA 2ZSVB 3SPVB 5FF6B 4Z0BL 5FHAL 3RIFK 1MFBL 4TQEH 2JJTC 1QFWM 4P2OC 1NLDL 3DHMA 4LLUB 4OQTL 1OAKH 1PLGL 4ZFFA 2SEBA 1A4JB 4FABL 5CINL 4POUB 3U7AA 3GJEB 2VLJB 3S88H 1P5UA 1GGUA 4EZMA 4D8PB 4C59B 4MHHI 5I73B 2CSPA 2Q20A 2CR3A 3LQMA 1GZPA 4R2GD 1RFDL 1KG0B 2HT4D 4FNLL 4PGCA 1MFDL 1TCMA 5D2NA 2BVOB 1N7ML 1QBLH 4X9GA 1GIGH 1MAKA 5HYJD 1ODAA 2AJZB 2OTPA 2RAMA 2I07B 4K3JL 2ADIB 2D7TL 2H9GB 3EO0B 1XF2B 5FM8A 1CF8H 1MRCL 3T2PA 3VMOA 4ZQKA 3SGKA 5IB3B 4LSTH 4XNXH 1T0NA 3MCLL 3OAYK 3BPLB 2EYSA 5F9WB 5A1AA 1CLOL 4KGLA 1AGBB 1KCKA 3BYTA 3EYSL 4Z7UE 1KELH 1G7JA 4GXUN 4KDTC 5FKPB 3ARFA 4IS6B 4NZDA 4PRDB 2ARJA 5JIKA 5EBGA 1IAOB 4LSSL 3WV0A 2H26B 4KH2A 1LO5B 2P8MB 5I76A 2LE9A 3WSQH 4DTGH 5ANMB 4I1NB 2JJSC 4X8JB 5B8CC 2HA1A 1YNTA 5JA9A 4MB5A 3KYNB 1YJDH 5DWUL 1FZKB 1QRNE 3VFTA 2WW8A 2R0LH 3VXTB 3K0WA 1DL7L 1I9RH 2CO6B 3KPLB 5JO5B 5C0JB 5LXGL 3ILPA 4OSUH 2X4SB 3C5SB 4LVOB 2EZ0C 4P2RA 4FG6C 4TNVF 2IPTH 3VXNA 5E9DA 2FWOA 4ZFFB 1FGVL 1NAMH 2FO4A 2SEBB 5I1IH 3GSQA 1I1AA 1YEEL 4EBQH 4R26H 5FOBB 4XP5H 4BZ1H 3MNZA 2JCCE 2NXYC 4YZFE 5L2KD 3FO1B 5GRVL 4ODSH 3RAJL 1GZPB 1FC1A 4S2SA 1II4E 2R0ZL 1CXKA 1OVZA 5IQ7H 4KRPD 4PJFA 3QZWB 1ROWA 2DQEL 5BS0D 3MLRL 3PXJA 3EJJX 1I4FB 5F7WC 3ZTNH 3VXME 3W2DH 3KYAA 4N8PA 5IFHL 3VFGH 3BKCH 4U1LA 2R0KH 4ZQKB 1S7XB 5L88H 1FNGA 3MACH 1YEFH 3ARTA 5A16A 4XWOD 1EBAA 5EZIH 2E8ZA 1G7JB 5IMMB 3T4YA 2KBGA 4G43A 5B38G 3AREC 4ZOCA 4ONGH 1RUKH 4Y16B 5BV7H 2ARJB 3DX8A 5I1GL 5I76B 2MKWA 5ITBL 1D6VL 1ZLUH 3EDKA 4M48H 4MWFA 4R9HA 1MHCB 1T4KA 4NSKA 1YNTB 1Q72L 4V1DA 3WUZA 4DKFH 1CFBA 5D93B 3VFTB 3GSNA 3UCRA 1KF9B 1LK2A 3GBLA 3SBWC 1CFTA 5F6IB 5HSFA 5FGBA 4N5EC 5DVNA 3WFCH 1B90A 4JY4B 4PJXA 1BJ8A 1EFXB 3ILPB 2UZYB 1NC2A 2ADFL 1AHWA 4P2RB 4Z7WA 3MJ9L 4XCYA 1IQDA 4Q0XH 1T5XA 3TT1L 2B4CL 2FO4B 4LP4A 1I1AB 4EDWH 4IDJL 1HOCA 3MYZA 5C07D 4OGZA 1OAQH 3ULUL 4JFFE 1EERB 1N0LA 1IE5A 3K74B 4F7TA 1KTRL 4FQIL 1LDSA 2P5WE 1QSEE 2F53D 2AKRA 4OZHA 5DMIH 1JYNA 3AGVA 3X3FH 3ZYZA 1A1NA 4PJFB 3SGEI 4UT9L 4XNZB 1GHFH 4OT1H 4O02L 1XGUB 1JMXA 3S96A 5D7KD 3U82B 3WD5L 1U8MA 3VD3A 4PJIE 3QDGE 4U1LB 4BK4A 4ETYA 2VITB 3GSUA 1FNGB 2FH8A 3HPLB 4ALAL 3BSZL 1OT2A 3BISA 5A16B 3VW3L 1JHLH 3OKYA 4O51A 3T4YB 1WAAF 1UA6L 5DFTA 4G43B 2O61A 3V6FA 1SJEA 3THMH 3PL6D 4M8QA 3DX8B 1I3GH 2HN7A 4JHBA 1OTSC 4XI5D 2YD6A 3KPNA 3CIQA 5JQHC 3I2CL 2Q8BL 5ISZB 1T4KB 4NIKB 4NSKB 5LCVL 4X7FC 4Y4KB 2GYSA 4V1DB 5L8LB 1X5XA 2NY2D 3GSNB 1DSFH 2G60H 4RWYL 4N8VA 4KHXL 5I1JL 1NAKH 3LKNA 4J3UA 4OCLC 4Y1AE 2F8XC 3PP3K 3S34H 4XPFH 4PJXB 3VCLA 1NC2B 4ENED 2BX5A 1J8HE 2J8HA 4PJDF 1IQDB 1T5XB 1S5IH 4JFDA 1FVDA 1ETZA 1WGOA 2VN7A 1EJ6A 4N1HB 3D0LA 3LY6A 2FLBT 4EUPH 1ORQA 3CK0H 1KCUL 1NH6A 3GZKA 1YJDC 3M17B 4OZHB 1HNFA 4P2QE 5LBSL 1A1NB 1QO3A 2E6JA 1QVOB 3EZJB 5HHVH 4N0CC 4PR5A 4X7SH 3NGBB 1U8MB 1SEQH 5DD3L 3FJTA 4MQTB 1JYXA 3GSUB 1CGTA 2OJZH 1FORH 1UB6B 4L9LA 3DX6A 3CXDH 4C58B 5HVWA 4QNPE 5A2LH 3Q48A 2UUDH 2O61B 4TUKH 1RUML 3V6FB 1BX2A 1ZT7A 5TQ2L 3RY6A 4M8QB 3KJ6H 4U6YA 3RKDC 3UJJH 1UJ3A 3KPNB 5GSRA 5D8JH 5IGXH 4XNYH 3UTTD 1WCQA 2DL2A 1J0IA 3TN0D 2NCMA 5K9QG 2EKJA 2DJUA 3QUZD 2P24A 4Y5XB 4OM0L 2BRRL 3O2VH 5TE6H 1IAIL 3K46A 2Z31B 3LKNB 4XP6H 3CGTA 4NZTL 4B0MM 2J12B 1JPTH 5BV7C 1JWUB 3SEPA 1FO0B 5FIEA 1FVDB 4HCRL 3BRDA 3GBMH 3F7RA 2PXYD 3D0LB 5B39A 1VESA 2OBGA 2FNBA 1ORQB 1WBZB 1QYGL 2YD3A 2A1WH 4GH7B 3BX7C 4OCNC 3WFDH 1YQVH 3ARBD 3OG4B 5GZOD 1JK8A 2R56H 1DP0A 4G7VL 3QNYA 3EDEA 5T1KD 3RUGF 1QFWI 3WNLA 4L5FH 4YHIA 3GI8L 4HPYH 3EO1B 3TNMB 3NH7L 2J1KA 1XGTA 4HW6A 3MBEC 4P4KA 2R15A 4DKEL 4I8DA 2CIIB 2VQ1B 1KTDB 5BVJA 1ZVYA 5CJXA 3WNMA 2UYLB 1AIFA 5E95B 4NQCA 3DLQR 1YY8A 2YBRA 1DQJA 4L9LB 3DX6B 2FJFA 4LBEA 1QFHA 1A7RL 4KTEL 3OHXA 3NPZB 5ADPL 2BNRA 3ZKMD 4KQ4L 2R4RL 5JXAH 3WS6A 4H20L 5F7MC 3FOMA 3PGFH 4Z77A 1BX2B 1ZT7B 3QDJD 4P23A 4UBDC 2AGJL 1NDMA 4PJ8D 2ITCA 4U6YB 4K2UH 3RWHA 4ZO7A 4LLQB 4M5ZH 3R0NA 5CD5D 1FSKC 3MFFA 5E6IA 3WNPA 2F5BL 3B5TA 3VI3E 1EO8L 1ZT4A 5EC1B 1UYWL 2B1AL 4OZGA 1LHZA 1EXUA 4HS3B 5C0AA 1A6UH 3K1KC 3HR6A 3VXUD 5F7YC 5F97E 4U31A 5K59F 2XZQH 1NUGA 3OAUH 5D1QA 1U3HA 3SDDB 1G6RB 3MUHL 4OQ1A 1JZ8A 3GRWA 5B39B 4WTXA 1MIMH 2Z8SA 5SX4I 3U7WH 1CFQB 1U3ZA 3RU8L 3TIEB 3IDXH 1F97A 1JK8B 1AQDA 3HCVA 4AQ1B 2V6HA 2NY3C 5E8PA 3QNYB 3UTZA 2IH3A 3V8OA 3QUYD 4LCIH 4MJ2A 4YHIB 4XXCC 5D2LA 3WJLA 1XGTB 4GMTH 2A6IA 1ZE3C 5BVJB 1U6AH 1F58H 2CRIA 2QSCL 1AIFB 3C5ZD 1I8KA 3H0TA 1MCHA 1UFUA 3L5XL 4NO0B 4NWUH 5JMOC 1OGTB 5IG7A 4XBPA 3IS0X 2RCSL 2FJFB 4IHOB 4QRPB 4JKPL 3HC0A 5C0BA 1XIWD 4JRWA 3WHE1 4IRSC 5KSAC 3VH8G 3H7LA 3LKPA 3KLHC 3FOMB 4P23B 1LDPL 1NDMB 3B3IA 1QSVA 1SJHB 4GRLC 3RWHB 3P9LA 1OAXL 4X7EC 1CI5A 3T2NH 4QHUA 4APQA 3NCJH 2EH8L 3RNKA 5CILL 3DVNB 3RVTC 4YNYA 3VGBA 1OY3B 3MFFB 1GH7A 3ARZA 2AV7A 2R4SH 4S0TD 4ZNEA 1UWGH 5DEFA 1FN4A 1I1YB 4OZGB 1SYSA 4J3SA 2PTUA 3HNVH 2X4QB 5I0DA 5HGAA 4WWKB 2IGFL 1IQWH 5DVOA 2E7CA 2EXYD 4E41A 4Y19E 3TV3H 2A77H 2VXSL 1G9NL 1BBJA 3QHZH 5AZEL 1YPZA 4LIQE 4R97C 5CKGA 4JO1H 4PJGF 5F96L 5IB4A 2YWZA 1HYRC 2NX5D 4LLWA 4N9GA 4HWUA 5AYUL 3QUXA 3D39B 2PUQT 3ZE2E 1KCVH 4KMTL 2NZ9C 5FHBL 1UWEH 3QQNA 1ZHKA 2VLKB 1AQDB 5E8PB 5F7EL 2IH3B 1H3GA 2P5EE 1DBAL 5D1XA 5D2LB 3CH1A 2DTMH 1ZLUK 1F3RB 3HG1B 5F7DA 3NN8A 4PTTB 3PQYA 5E2UL 4UDTA 3H0TB 3C8KB 3U79A 1CLZH 4U6HA 3D85B 1XH3A 4U3HA 5LG1A 4L4TE 5DZOA 4QEGA 5IG7B 1MAML 1KYOJ 4XBPB 3I9GH 1BM3H 3VXOA 3TT3H 3W82A 5IBLC 3V5DB 3A6CL 3HC0B 3CFBB 5C0BB 4AEEA 1D5XB 4DVBA 3RBGA 3LKPB 4OLEA 5T5FL 3O6FC 3BGAA 2D03H 5FGSA 1PZ5B 3P9LB 1OPGL 4QHUB 2JLLA 4APQB 1OD7A 2M8XA 4JO4H 4YNYB 4Y89A 2PCPB 2AV7B 1DTUA 4KKBC 3SGJA 4FMKA 2IJ0C 4RRPA 5DEFB 3HUJE 2Y23A 1Y6MR 2NR6C 4MJID 4NQSA 2X1XR 1T1WA 4UDUB 1SYSB 4FQ2L 3VWKD 1AGCA 3MA9H 2OMNA 3UDWA 5HGAB 1JPSH 3DSFL 1H3XA 2FD6H 2I5YH 4E41B 4AMKH 1OQOA 1RQ5A 2FCBA 4WO4C 4XCFL 4MD4B 1BBJB 4OIAA 4WTZA 4M6ML 4GFTB 2FEDC 35C8H 1NGZA 4ZUSA 5IB4B 1IBGL 2BJMH 2MTPA 1ZLSH 2V2WA 1AY1H 3RVWD 3HMXL 3AAZB 5HI3C 3DMMC 2RIKA 1NLBH 4WFGE 1LILA 2BY0A 1ZHKB 4M1DL 4B41A 2E6QA 2GJ6A 1W8NA 4LQ1A 1HXMB 2XN9E 5GHWL 2DBLL 5C09A 2X70B 3D87B 4MJ4A 2GJZB 4L3AA 2QR0A 3CH1B 2ZOKA 5F7DB 3QI9D 3PQYB 2YUZA 4UDTB 4M02A 4U6HB 2J8OA 1XH3B 4Z0BH 4KJPD 1MFBH 1N26A 3VXOB 5IBTL 3GI9L 2XY2A 2W0FA 1P7QD 5FA4A 3CXHK 4DVBB 4BH8A 4LGRB 4N0FB 4KJYA 1RK1A 3IGAB 4N1CA 1YNLH 1J1PL 1QBML 4M7ZB 3EYFA 4POZC 1FRGH 4OD2B 4M1GH 1RZKL 1XFPA 1MELA 2W65A 3TVMA 2JIXB 3FL7A 4PJ9A 1W2KT 2VLJD 4NQSB 1T1WB 4FZEL 5FV1L 2P7TB 2DQIL 2CKBH 1AQKL 4FQQB 4JM2B 4PG9B 2ITDA 2H6PA 5DJDB 3C60C 4RFNB 5I17A 1A6WH 2FL5A 3MCLH 1NCUA 1GGBH 4QHLA 1O7VA 1T7ZA 1GOFA 1A4KB 2DMBA 1VPOL 2DIBA 3IB4A 5M94B 4OZIE 3OXSA 2HFEA 4QXUL 5F9JB 5KVEL 1NGZB 4ZUSB 2C3VA 2EEBA 5DUPL 2V2WB 3TJHD 1HWHB 3FZUC 5I1KL 4XXDB 3MCKA 3SDXF 5EUOB 2VABB 2GFBA 2UUDK 4XRCA 1EAPB 2GJ6B 4GW4A 1MRDL 2WP3T 5I18L 3HC4L 1XCQA 1J0ZA 4GAFB 3BZ4B 3BFOA 3NCCB 1MJ8H 4RNRA 2ZOKB 1FZJB 3BUYA 2FECI 3BZFA 1DL7H 4B7IA 3LRSA 2V9TA 2X1OA 3M45A 5JHDE 5CKAA 2F9BT 4C57C 4ZNCD 4ELMF 5C0GB 3QEQB 1EVTC 1B88A 1HI6A 1CXHA 5C6PB 1NFDA 3MPCA 1ZTXL 3QG7L 4HF5H 4BH8B 2VLLA 3OPZH 1AR1D 3CMOH 2BNQB 4KJYB 1F2QA 1RK1B 1EK3A 5L0QC 3RPKA 1B2WL 1MHHA 3D1MC 2N7AA 5DYOA 2W65B 1NANI 4UOJA 3S3SA 3I02A 3TVMB 5BMFL 2VH5L 4PJ9B 4N0UA 1FHGA 4WUUA 1K4DA 3O41A 2UZXB 1JTOA 5IJKA 4HKZA 4LSVH 4OLWL 2HFGH 4LNVA 1X5GA 1JTTA 5LGHL 2FL5B 3LV3A 5D5MB 4WFHE 5IB5A 4GSDL 4WI3A 1PFCA 3A6OA 1Z6JT 4NUGL 1PJ9A 3OXSB 4PV8A 2L7JA 1ZHBB 3WFHA 2JJTA 2MCG1 4RX4A 4RGNB 4WI8A 1VCAA 4ORZC 2DL9A 4Z78A 1NGXB 3MCKB 4OZ4A 5I1HH 4XRCB 4CMHC 4GW4B 4KKCC 2PO6A 1A6AB 2XZAL 3P4MB 5ILTL 3VMNA 3ARFD 4KUZL 2K1MA 2FZ3B 3LEYL 3ARQA 4ZMAT 3BUYB 4GAGH 5EULV 4CNIA 4K9EL 3LRSB 3V0WH 1WIUA 5HVGB 1A3QA 5H94B 4JE4B 3W9EA 2ADFH 4HUVA 1JZ6A 1KC5H 4I3SL 1HI6B 5DD6A 4JFOA 2EIDA 4OCSL 2F58H 4MXVE 1BD2A 3VFSA 2PW2B 4I0PA 3GBNL 5JW4R 1KJ2B 1J1OL 2I9LA 4PRHA 3T3ME 4ELKA 3W81A 1T2QL 1H3WM 1MQKH 4GXVL 1Z9SA 3U0PB 3CDCA 3LB6C 3T04D 5ICYA 1C5DA 3EYQC 3F6LA 1MUJA 3I6LD 2HTKC 3N50A 5CCKL 5JR1L 5DYOB 5E9DD 1GPOL 2AJVH 1KT2A 2IAMD 1I1AD 4N0UB 1HQRA 1LO0L 2AK4E 4WUUB 3O41B 1UC6A 4NQDE 4HLJA 3MLVL 4XAWL 5KVGL 1JL8A 1CR9H 3P30L 5J3HC 1YY9C 4LOUC 4HIIA 4QRSA 2E27L 2IQ9H 1IC5H 1JRHH 4F37K 3LV3B 3RX5A 1U8PA 3BSZH 5IB5B 3VW3H 3Q5OA 6FABH 4LSQL 4Y4FC 1O7SA 4HT1H 3WFHB 4NWTL 5ID1B 2WUCL 2NY5L 1EUUA 2DIAA 1T1YB 4LCWA 3S37L 4Z78B 2CLRB 1KSRA 1OGAA 1RZFH 1YEDA 4U0RB 2CRMA 4OZ4B 4NM4L 3UPRA 4P49A 5HHXH 4S1DD 1HHJB 1DVFA 4WUKH 3I2CH 2A6KB 1RAMA 1IGYA 2PO6B 3D3VE 3FB5B 4RISH 1D6EA 4CNIB 4R6UA 3UYRH 5IBUG 5CEXA 5GGTA 5EZLB 3W9EB 2J7LA 4HUVB 1QFUL 5B22A 5DD6B 1WT5C 4JFOB 3E3QC 1X5AA 4CN1A 3VFSB 1BD2B 2ZSWA 4UT7L 2X10A 3B5GA 2I9LB 2VDKL 4PRHB 1MI5D 5LGKA 4K3HA 4MSWA 3MRJB 3SDAC 5DI8A 5ICYB 5J9PA 1C5DB 3RWEA 5E4IA 1MUJB 3V6OE 4O4YH 4Z7UA 3UPCA 2RGSA 2AJXH 1KT2B 3BVNA 4YE4H 1HQRB 2B39A 3A0OA 3CVHH 3PV7A 4OZFH 4MAUH 5I1DA 5HHQA 2GAZB 1I75A 1FNEA 2DWDB 3F62A 4TTDD 3BQUA 4RMVA 4QWWD 2NZIA 1YYLH 5BZWA 1A1MA 3P0VH 1U8PB 1JIBA 2YOCA 4XNMA 1QRNA 1NCAL 1YUHA 3ULSB 3MOAH 1WBYA 5J6GA 1I3UA 3ALWA 1RUMH 3VD9A 4L8DB 4LCWB 4LLDA 4LLYB 1OGAB 3S36X 2BERA 3CLFH 2DS4A 1CG9A 3TGXA 1ERNA 1DVFB 3IFPA 4NO5A 5D1ZC 1P4LA 4HC1H 4Y2DC 4HKBA 1JNNH 3F7YA 2BRRH 1CTOA 2QBWA 2JCCA 1D6EB 5CIPB 1N0XH 3QEUA 4PP1C 2X4TA 2AP2A 2CUMA 2FGWL 5CEXB 1P4IL 2FSEA 1OSZA 1M7DA 3NAAL 1AE6L 4WIQA 4LHUA 1A0QL 4GKSA 4ONFL 3SKMA 5DRXA 5MENB 2NY6D 4XPTL 4IJ3B 2ZSWB 4JM4H 4FXKA 3VXMA 3PJSB 3FRPA 3RGVC 1KLGA 3WNOA 3MO1A 1JHKH 1OTUC 2BOCB 4MSWB 1X3DA 5DI8B 3O8XA 3S5LA 4YXKH 3RWEB 3VU2A 3MMEA 2H2PC 4KK8D 4QCIB 3AVEA 4HUKB 4JFDD 4OLUH 1AGDA 3BVNB 2V7HB 2H2SD 3PWJA 1FDLL 3ARGA 3FT4B 4H1LA 3UZQA 5HHQB 3ZKSD 4PLJC 4XVUD 3HZYA 2ESVE 3LKRA 1CN4A 4FOMA 2H32H 1PD6A 4K7PH 1A1MB 3CFIC 4XHJD 1MJ7H 2IADA 4WHYG 1AP2A 2WWMD 4D0DA 5CBEA 5FEBA 2YK1L 3WIFA 3VXQA 3LQAH 1A7RH 4XNMB 3V7AE 1QRNB 5L7XL 4F7MB 4MD0A 2GY5A 2R4RH 5AD0A 3ROOB 5JXEA 1WBYB 5J6GB 1WVZA 4Q74A 1ZVHA 3SO3B 2XQBH 3DX9A 4L3EB 2PETA 4LLDB 3RDTA 3MLYL 3GM8A 5DF0A 1CG9B 4NO5B 1AXSA 1P4LB 2VDPH 4OI7A 3V5HA 3U30B 2EDLA 4JFFA 1T3FB 1SJVA 2J4WH 3B43A 2FX7L 1H8NA 2VC2L 3F12B 2P5WA 3QEUB 1QSEA 2HWZL 2X4TB 3HHRB 3RBSA 4D0CB 2FSEB 4NZJA 1OSZB 1M7DB 4LHUB 1LK3H 3BIKB 4AENA 4DQOL 4GKSB 2X09A 2X1PA 1QP1A 4HH9A 3DGGA 2APXA 4JHWL 4OGXH 2VJXA 1D9KC 2N56A 2A74B 3VXMB 2P8PA 4BFBD 1WAAE 4U2YA 3TO4C 5C0RH 4PJIA 1AC6A 1KLGB 3QDGA 3BYYA 3G9AB 3O8XB 4GBXD 2EE9A 3S5LB 4OBSA 3T0AA 3GSVA 4YHLL 4KVCH 2HYMA 4U6VL 4ZYKA 1NBYA 1I3RA 4OUOA 4UNUA 1LE5B 4HWZA 1WF5A 4IRJB 3BPOB 1DANU 3PWJB 5TPWH 3C8DA 4H1LB 3KPOA 3FAWA 5IMKA 1BAFL 3HZYB 3LKRB 1T1ZA 5J0BA 2DQHH 3NOIA 1XF3A 2XIDA 4Q2ZB 1FH5H 4NP4H 5KANG 1AP2B 4D0DB 2FDBP 4WW2A 3WIFB 2BHYA 2EXWC 1S7SA 4PJDE 4JKPH 3LS5L 4P4KD 5AD0B 4QHMA 1JF5A 1XR8A 4JZNA 5AAMA 1TNNA 4NQCD 4Y1AA 2DQDL 3RDTB 1XGPA 1XGRB 2HKFH 1J8HA 4OIIL 5CBAB 4JPIB 4IMLA 1AXSB 3ULUF 2VE6A 1C08B 1DBJH 2BNRD 5FCUH 4B5EA 2IBZY 1T0PB 3MV9B 4JFFB 4P23D 2D4FA 3WBDA 3BP6A 3SN6N 2P5WB 5DC0A 4K55A 1UH2A 4HPOL 3VXSE 4P2QA 2NYYD 5E6ID 2VXSH 1FE8L 3KG5A 4IIQA 5GGRY 1ZT1A 2DRUA 5AZEH 4FFVC 4HH9B 3DGGB 4WFFD 3L5WA 2P8PB 3UZVB 2PR4L 2VR5A 4NQEB 1TZIB 5C0AD 5AYUH 5KZCB 3O6LH 4PJIB 1MCNA 3QDGB 2QEJA 5FHBH 4LSPL 3MRKA 5CP3H 5D1QD 4ZS6D 3MV11 4ZYKB 1SEBA 1U3HD 2XA3A 4S1QH 3QHFL 4PLNC 3M07A 4MCYA 5D70H 5D71L 2IPUK 4F2MB 2N7BA 3KPOB 3EJYD 2NNAA 4GRMB 5IMKB 4LF3A 2IH1A 2O93L 3O4LE 5JIPA 1T1ZB 4X6FA 1W72B 4HJJL 4LDOB 1XF3B 2WSKA 4KI5D 4I18A 4MNHA 2BFVL 3CNKA 4WW2B 2VL4A 1A7BA 2ENSA 1S7SB 3OKOA 2HT4C 4JRYE 4JFEB 4KZEH 4X9IA 1BFVH 2EYTB 3SKJL 2NW3A 4HJ0C 4OB5H 4QHMB 4PGJA 1SBSL 1XR8B 3N85H 4DN3H 4PY8J 4YWGL 4IMKA 3SE3A 1DANT 2W91A 1B4JL 2X41A 4PB0L 3U9UA 2B7DT 5IB2B 3TWCL 3SE4A 5DS8B 1OPGH 1MEXL 1J8HB 5KG9B 4NZRL 4DGIL 3DYOA 5C0BD 2DLFH 4HK0B 5F8RC 3RUGE 1OAUH 3MRPB 32C2A 1A7OL 1ADQA 4CADB 5JW3L 1F4XH 1PEWA 3KR3H 4FQ2H 4DAGL 4TOYL 5C6TH 4ZSOB 4DGYL 3SDYH 3LQAC 5FM5O 5DJZB 3QO1A 4MVBD 4APQD 2FR4B 5F6HJ 4P2QB 4XBEH 4UQ2A 4QTIH 3MV01 2CIKA 3PWLA 3FFCE 3TO2A 1J87A 5J13B 3AS3A 5C92A 3TBWA 3I75B 2WIIB 3L5WB 1ZV5A 2W0PA 2D3VA 2VDLL 5KAQF 1C5CH 2X4UA 5EOQH 3MBXL 1A1OB 5CHNB 2YKLL 2Q76B 5F7KC 3STBA 1TJHL 5I30L 4GRLA 3K7UA 2E7LA 3ZL4L 3EFDH 5GS1C 4MCYB 1CWVA 3PIQA 3V79C 3QUXD 2NNAB 5EO9A 1QR1B 1RU9H 3AC0A 1YEKL 1UJTA 4LGSB 5BJTB 4I18B 3P9WB 1T0MB 4X6DB 4CL7A 4PBXA 4DZBA 5K59E 5D1XD 3OKOB 4KRPC 2EDRA 1A7PL 1K4CA 1JYVA 5GSVA 2VZ3A 5C86A 1WFTA 4NN6B 3PQYD 5DO2D 5C3LD 2QADB 3JWDH 4NM8L 4G5ZL 1AO7A 2DLEA 3WLWD 2J8UB 4JJHA 4XWOC 5HYSB 1JZ2A 1L7TH 4XP4H 2A0LD 5KS9B 3FMGH 5E8NA 2J6EH 1F8TL 3QO1B 3TESA 4MDJA 3UZEA 5EWIH 1RZGA 1MCJA 2HKHL 2CIKB 3PWLB 3TO2B 4ZS7H 4NN5C 1INQA 3TBWB 3KXFE 5CJQL 3KPQA 3BEWA 2Y07L 2WANA 1N2RA 4X5WB 2AW2A 4KY1H 4ODTL 2X4UB 2Z8VC 2E9BA 1F3DH 1G7QB 4RAUB 4FFYL 5EA0H 4ODHH 4UV4H 3O6FA 5E99L 4UIKL 4A6YH 1T89C 3MNWA 1OAYH 5I74B 1SVZA 2WP3O 3BKML 1MFCL 4BQCA 1NGQH 4NPYA 4JQXA 1K8DB 3DOSA 1EGJH 5C08D 5IP4A 1PKQE 1I1CA 3NFNA 1YEHL 5MHSE 5E94B 3GMQA 3ZE0E 1IEBB 5C71A 1G9NC 5EO9B 1RUPH 5DJAA 2FHBA 4L3CB 3MLUH 3S98A 1KPUA 3UX9B 2B2XL 3CMGA 3E8UH 2J5LB 4YGAB 5C09D 3BKJH 4EN3B 3KNBB 4ODVH 5ETUA 2PTTB 4MA7H 1K4CB 3SCMB 4WO4A 5GSVB 3FN0L 3MLXH 2BVPA 5FYKH 4PJGE 5C0CE 3BP7A 3D9AL 4F57H 1UZ6F 3HI1A 2AQ3A 4WW1B 4Y19A 5DQDL 1KIPA 1QPPA 2B1HL 3L3DA 1QOKA 5ADOL 4NC1C 1H3VA 3SY0A 1AO7B 1T7YA 1ZGLA 5LGJB 3BP5B 3TBTA 4TULH 2YA2A 4OJFL 1HN1A 1ND0A 3PL6C 5E8NB 3EDFA 1RZGB 3DETC 2UZIH 2D31A 43C9B 2MCPH 1IT9H 2P5EA 2R2HA 3L3OA 4OGAD 2JE8A 5ACZB 1INQB 1OT1A 4PJ9D 5F1OB 2EEDA 3GSOA 4LU5H 3LMJH 4JN2B 3KPQB 1A6ZA 3V6BR 4UQ3A 1I3VA 2NY2C 4G6KH 1N2RB 3DHJA 4L4TA 3RWIA 4LSRH 4ENEC 5JW4N 3ZHDA 3VE0A 3ZHLA 4NPYB 3P0YL 1B0GA 4ZO6A 2RBLA 2OTUB 4L4VB 4XMKL 3R06A 2HJKB 1Z5LA 3NFNB 1DBML 3LEYH 4AL8H 4PS4H 5DJAB 5JIHA 1A2YA 4F15C 3GFUA 3BWAA 3UJTL 1M1SA 2VYRE 5I9QC 4LKXA 5C9JB 1CK0L 3HUJA 4MJ5B 2CMRL 4JFPA 4G3YL 4WV1C 3V4PH 1FJ1B 5F9OL 2BVTA 5I71C 5JOFB 4M62L 5JPNA 1MCEA 3WIHH 2EDYA 4Y19B 1KIPB 4S0SD 3L3DB 5C0IA 4E42B 1FVCB 1V7NH 3NA9H 3SY0B 4PJBB 2ICWA 3AU1A 1VFBA 1NL0L 3GIZH 3QUMH 3SE8L 2VUOA 2NY0D 4XPAH 5C2BL 4WI7A 3RVVD 4HQQH 4XC3L 3CFEA 3KLDA 1VEMA 3VFNA 3KYKL 5FYKE 1MCWW 2CGRL 2E9JA 3GUTB 1ND0B 1YMME 2DQGH 3C9NB 5L6YH 3L5IA 4TRPL 3L9RA 3RZCA 1F6FB 2XN9A 3NCYS 2D31B 2P5EB 2R2HB 3L3OB 3JWDC 4LSQH 1KB9K 4R7DA 5IR1A 1A6ZB 4WUUD 1RMFL 1Z3GL 2WBJD 3QEGL 5EOCJ 3W9DA 4UQ3B 2I9TA 4CVZA 1JN6B 2OQJB 4L8CA 4L4TB 3RWIB 3UBXA 1NEZA 4X5LA 4XVJL 3VE0B 2NY1D 1ITBB 2V5TA 2VXTL 4HH8A 1B0GB 1KB5B 1L7IH 1RZJL 2OZ4L 1F6AA 4RX4D 2MPAL 4YXHH 3R06B 1U42A 1D5ZA 3GMLA 5A2FA 3E6FB 1X4YA 5B3NA 1A2YB 4JFZL 5DQJA 5AG9A 3DRTA 1A7QL 4NDMA 3RWCA 2R1YB 5GZOC 4FQ1L 4R90L 4JVWA 3UTPD 3X3GH 2PO6D 2C4XA 4LKXB 3VFMB 4G8GE 3HUJB 5DURB 5T3XD 1BOYA 4P2CG 4BUGA 3FO0H 5F1IB 3V0VA 5ESAA 2VDOL 1A6TA 1JNHA 2Y5TA 3KJ4C 4PRBA 5C0IB 3CFJA 3SDXE 4LLMA 1XGQA 4GG6E 3SOBL 1MWAH 2ICWB 4JM2F 4OCRL 5DC9B 1VFBB 2C5DC 2LU4A 2W60A 4WY7L 4OZIA 1FFPA 5HBBA 3MA7B 3QULA 1MLBB 1IGML 3CFEB 1J0YA 4I0PD 3VFNB 3ZKMC 3DV4B 2ZP0T 5EIIA 2HJLA 4MDIA 2H8PB 4QGTA 2JB5L 4PRHD 5JA8B 4KWUA 4RGMC 4LDEB 2C26A 4GW5A 4XP1H 3LEVH 4PJ8C 2EDXA 2JB6B 3RZCB 5CD5C 1HKLH 1NCBL 1FYHB 2Q7YA 2XN9B 4ELME 4Y5VA 3IDGA 5EUOF 1RZIB 4OLXH 1IVLA 1PQZA 4JDZB 5DK2A 4MA1B 4Y8AA 5IR1B 4R7DB 3W9DB 2I9TB 5D6DC 4J8RA 4M7JL 5JHDA 4L8CB 4Y8DC 4BSJA 4OUUA 4N9OB 3HAEA 4HXAL 1E4WL 1GC1L