3TJHA

42f3-p3a1/h2-ld complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
175
structure length
175
Chain Sequence
GPHSMRYYETATSRRGLGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H2-Ld SBM2
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 56
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2011-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tjhA00
1DUZA 1KPRA 2AV1A 3LKQA 5D7IA 3GMLA 2ESVA 3P9LA 3CPLA 2C7UA 1MWAH 4PGCA 1IM3A 4PJ7A 4JQXA 3SDXA 1QO3A 1YN7A 5GSVA 2J8UA 3BXNA 3VFSA 3PWNA 5C0GA 4PRHA 2XPGA 3OV6A 4HX1A 3KPMA 3KPSA 3UBXA 3VFRA 5MERA 5L2JA 3QFJA 3D3VA 4Y4KA 4O2CA 3MRQA 5MEPA 1I1AA 2ZOKA 5C0FA 5ACZA 3VFPA 4N0FA 4U6XA 3P9MA 5IB1A 3MROA 4ONOA 3KPLA 4ZUTA 1S7VA 3FOMA 4PJBA 3CC5A 1QSEA 3TBTA 3BP7A 5HGDA 4NO3A 1YDPA 3X14A 1AKJA 3AM8A 3P4MA 3MV8A 1AO7A 1Z5LA 4ZUSA 5FA4A 4U6YA 3DMMA 1AGEA 1TVHA 2CKBH 1A1NA 3HE6A 4F7CA 1ZT1A 3FOLA 1S7UA 1I1FA 4X6FA 3ROLA 2X4NA 3LN5A 1Q94A 1L8JA 1P1ZA 4HUUA 1LQVA 1S9WA 4G43A 4PJEA 1KCGC 1QR1A 4WWKC 3V5HA 4WU5A 4U1MA 2GITA 4K71B 1KPVA 3I6KA 3SKMA 3TPUE 1DUYA 1KJVA 2FIKA 2F74A 3OX8A 3TN0A 3RWHA 4L4TA 2GJ6A 2YPKA 3ILQC 4CVXA 1T7YA 1XR9A 4L29A 5FKPA 2F54A 1R3HA 3BZFA 5E6IC 3LN4A 5EFIA 1S7SA 2WY3A 3TA3A 5FDWA 3L3KA 1OGTA 2NW3A 3T1FA 3SDDA 3LKRA 3OXRA 1ZAGA 4APQA 2AXFA 4V3DB 1S7XA 3MRRA 3CCHA 2BVOA 2GAZA 2MHAA 4U1SA 3ERYA 3VFTA 3BGMA 4JFQA 1NEZA 1XR8A 5C08A 3TIEA 3W39A 1HHGA 4F7TA 5IEHA 3C8KA 4ELMA 5ENWA 1P4LA 1WBXA 2VLLA 1A9BA 5AD0A 3PWJA 5B39A 3FQWA 1AGFA 3GSXA 3MRMA 3D18A 3KYOA 4U1KA 3WLBA 3GMOA 3VCLA 5D2NA 5IM7A 4LCCC 4MVBA 4MX7A 3GSUA 5IEKA 3DX8A 3E2HA 1JPGA 3VWJA 4L8DA 4PJXA 4D0BA 1RK0A 1T7ZA 3LKOA 4G8IA 3VWKA 5E8OA 3VXOA 1HSBA 3QUYA 4X6CA 1JUFA 1T1XA 1QVOA 3B3IA 5IVXA 1VACA 5C0IA 2VAAA 3MRJA 3RZCA 4L8CA 3MA7A 4HKJA 1T80A 3AREA 4PRDA 1QQDA 5E8NA 3TO2A 1JE6A 3LKPA 3IT8D 4ZUUA 1ONQA 3FTGA 1JHTA 2YPLA 1GZQA 4QRSA 1I7RA 3BW9A 3PQYA 1MHEA 3X13A 4HWZA 4PJFA 4PJCA 4PJIA 4QRRA 3VXUA 4UQ2A 2VLRA 3VFVA 3MRFA 4ZUWA 1DE4A 1IM9A 1HYRC 2HN7A 4I48A 4ZUVA 2CIKA 3PWPA 4MJ5A 1EEYA 3MYJA 3O3DA 4JFOA 1CG9A 1C16A 1TMCA 4NQDA 3MRPA 2BVQA 4D0CA 3CZFA 4QRUA 1WBZA 4NQXA 1FZJA 5J6HA 4MS8A 4N5EA 1A6ZA 3UPRA 4EI5A 5E00A 3ILPA 5D9SA 3MRDA 3O9WA 2ZOLA 1EFXA 3MR9A 4GKSA 5C0CA 3L9RA 4L3EA 3GMQA 4JFEA 4G59A 1QSFA 2H6PA 5EU4A 3UTSA 3KPRA 3G08A 5EU6A 3QUKA 4LNRA 3RWDA 1KJ2H 1UXWA 2F53A 5E9DA 2P5WA 1AGDA 5ISZA 3VJ6A 1CE6A 1KBGH 3PWUA 3FQTA 4PRIA 4U1JA 5F1IA 3V5KA 1TVBA 3VFWA 3VXSA 2BSSA 3QDJA 1N3NA 5C0BA 5D7JC 5D5MA 4G9DA 2AV7A 2V2XA 3SPVA 3L3HA 5INCA 1ZT7A 3E6FA 3GSNH 3KWWA 4NO0A 3FQRA 1FFOA 4O2FA 4U1NA 3SDCA 5EUOA 5EU5A 5HGBA 1OF2A 3JTCA 4NQEA 5SWQA 1DDHA 2BVPA 3FQUA 3RWGA 5IB3A 3MRBA 3BZEA 5C0AA 3SCMA 1SYSA 3HG1A 4NNXA 3MRNA 4LHUA 4MNQA 5C0DA 3TBYA 1NANH 3MRHA 3RL2A 1HHHA 5C09A 3ARFA 4G8GA 4G42A 1BQHA 1X7QA 4L3CA 4F7PA 3O8XA 4PJ9A 3VXRA 1MHCA 1KJMA 3BWAA 1B0RA 1T20A 1I7UA 3O3EA 4N0CA 2HJKA 3ES6A 5E8PA 5MEQA 2H26A 4IHOA 1T1WA 3BH8A 4IIQC 1N2RA 4MNGA 4PGDA 4G9FA 4IRSA 3RWEA 4WDIA 1OGAA 4N0UA 3QDGA 4QRQA 3RWJA 5C9JA 3LKNA 1G6RH 5JHDA 3KPNA 4XXCA 3B6SA 5F9JA 3P4OA 4JRXA 2FZ3A 1HHJA 3M1BA 3O3BA 2X4UA 1BIIA 1ZSDA 4Y2DA 1T22A 1E28A 1CD1A 4PJ8A 3TO4A 3MRCA 3O4LA 3QQ4A 3VFUA 4PR5A 3VFOA 1GZPA 3H7BA 1NAMH 4QRPA 5DDHA 1A1OA 3QQ3A 3X11A 3RTQA 3GSWA 3MV7A 2DYPA 3GMMA 3D25A 2PO6A 4MQ7A 1JGDA 3KPOA 4NHUE 5MENA 2BSRA 4LCWA 5IROA 4GUPA 1YPZA 2VLKA 3MRGA 3O3AA 3DBXA 4D0DA 2GTZA 3VRJA 2GT9A 2CLRA 1BD2A 1U58A 2GUOA 5D2LA 5BS0A 4PJAA 1JPFA 2X4TA 1S7RA 3FRUA 3TJHA 4PJDA 3GMRA 1JFMA 4NSKA 4PDCE 5HHQA 2X70A 4X6EA 2JCCA 3RUGA 3WL9A 5SWZA 5EOTA 5HHMA 2A83A 1MI5A 4NT6A 3GJFA 1LEGA 2OI9A 2VLJA 3GSQA 3H9HA 4WU7A 4K7FA 3LV3A 2BNQA 1FZMA 1XZ0A 2XFXA 5INDA 4PRAA 4X6DA 3RWFA 1W0WA 4Y4FA 1G7QA 5HGAA 1FG2A 4NO2A 3HLAA 3MRIA 1HOCA 3AU1A 1AGBA 3GSVA 2BSTA 3MREA 1P7QA 1PQZA 4MXQA 3L3GA 3DTXA 4ZFZA 1JF1A 3ARDA 3ARGA 2P5EA 1HHKA 2ZSWA 3BH9A 3KPPA 4LCYA 4PRBA 4WJ5A 3T8XA 1I1YA 1FZOA 3P4NA 3PABA 5GSRA 3BVNA 1K8DA 1KTLA 2VABA 2FWOA 4U1LA 2X4OA 3KPQA 1LP9A 3M17A 5EU3A 3JVGA 4WO4A 3VFMA 3ECBA 2HJLA 1UXSA 1ZHNA 4NNYA 2AKRA 4MJIA 2V2WA 1G7PA 3IXAA 3QDMA 4JFFA 1T21A 1W0VA 3MRKA 5SWSA 1HSAA 5HHOA 1YN6A 3HCVA 4FFEX 4NQVA 5F7DA 3WS3A 3QEQA 3H9SA 2X4QA 3WUWA 3HE7A 1LK2A 4JRYA 3RL1A 2Q7YA 3BEWA 5BJTA 3L3IA 3RWCA 2CLVA 1ZHBA 3HUJA 3HAEA 3QUZA 5DEFA 5BRZA 1JGEA 3FONA 3E6HA 1T0NA 3VH8A 1ZHLA 1FFNA 1M05A 4ZAKA 1QEWA 2X4SA 3V5DA 4F7MA 3PWLA 1T0MA 1LDPH 1S7TA 3I6GA 4PGEA 3QULA 2CIIA 1ED3A 2GTWA 3TVMA 4L4VA 1QRNA 3GMNA 3VXMA 1LD9A 1QLFA 1T7WA 1S7WA 4U1IA 1A1MA 5HGHA 3D2UA 3KYNA 4PJ5A 4L9LC 3GSOA 1ZHKA 3P73A 4PG2A 5HYJA 4PG9A 4HS3A 2CLZA 1N5AA 1ZVSA 1ZS8A 1T1ZA 2BNRA 1S8DA 3L3JA 2X4PA 3OXSA 3FFCA 4HUXA 4HUWA 4I4WA 3W0WA 5J6GA 3TBWA 2AXGA 4F7EA 3FT2A 3KXFA 4PJGA 3BP4A 4WUUA 1N59A 3MGOA 3DX6A 1INQA 3CDGA 3MRLA 2D31A 4PRNA 3QZWA 3L3DA 4Y16A 3WS6A 1FO0H 3FT3A 1T1YA 4V3EB 5J1AA 1UQSA 4S0UC 2VE6A 3REWA 4Z78A 4L8SC 1S7QA 4UQ3A 4Z76A 4PV9A 5L2KA 1EEZA 5EO1A 3SDAA 4Z77A 2FYYA 3I6LD 3GSRA 1I4FA 4JFDA 3VXPA 1FZKA 4PV8A 4E0RA 1S9YA 4HV8A 3S6CA 3DXAA 3ARBA 3RGVC 3FQXA 1HHIA 1WBYA 4WW2C 2OL3H 5EO0A 4E5XA 1XH3A 3HPJA 5B38A 4MJ6A 5BXFA 1ZT4A 1FFPA 3FQNA 4N8VA 5MEOA 3CVHA 2PYEA 4EN3C 3D39A 3SKOA 5C07A 4CW1A 3QI9A 4O2EA 2FO4A 3JTSA 1I7TA 4JQVA 3SJVA 5FA3A 3TFKA 5HHPA 3GIVA 1LEKA 1RK1A 3UTQA 5DEGA 3VFNA 2UWEA 4EUPA 1S9XA 3C9NA 3ROOA 3KLAA 4NQCA 3RWIA 3X12A 1RJYA 1AGCA 5HHNA 4QRTA 3GMPA 4PGBA 4Y4HA 1RJZA 3LKSA 4PP8C 5H94A 5IB5A 3UTTA 3VRIA 3TF7A 4NO5A 1EXUA 5C0JA 4PRPA 4JFPA 1W72A 1VADA 4GKNA 3BUYA 1VGKA 3PWVA 3QFDA 1B0GA 4FTVA 3MV9A 2YEZA 2NX5A 4IRJA 1B3JA 4HUVA 1A9EA 1E27A 1K5NA 3E3QA 3JTTA 5D7LA 1M6OA 5F1NA 3FT4A 4L8BA 5IB2A 5C0EA 3BEVA 2HLAA 2ZSVA 3BHBA 2E7LE 4U1HA 1T7XA 3VXNA 3P77A 4PREA 3TIDA 2AK4A 3QUXA 3CH1A 2BCKA 2X4RA 3DX7A 3MGTA 1SYVA 4CVZA 1KPUA 3BO8A 5IB4A 4PJHA 4QOKA 3TBSA 3NFNA 3TBVA 3U0PA 3TZVC 1BZ9A 1KJ3H 2RFXA 1T7VA 1OSZA
chains in the Genus database with same CATH superfamily
1DUZA 1KPRA 2AV1A 3LKQA 5D7IA 3GMLA 2ESVA 3P9LA 3CPLA 2C7UA 1MWAH 4PGCA 1IM3A 4PJ7A 4JQXA 3SDXA 1QO3A 1YN7A 5GSVA 2J8UA 3BXNA 3VFSA 3PWNA 5C0GA 4PRHA 2XPGA 3OV6A 4HX1A 3KPMA 3KPSA 3UBXA 3VFRA 5MERA 3I0TA 5L2JA 3QFJA 3D3VA 4Y4KA 4O2CA 3MRQA 5MEPA 1I1AA 2ZOKA 5C0FA 5ACZA 3VFPA 4N0FA 4U6XA 3P9MA 5IB1A 3MROA 4ONOA 3KPLA 4ZUTA 1S7VA 3FOMA 4PJBA 3CC5A 1QSEA 3TBTA 3BP7A 5HGDA 4NO3A 1YDPA 3X14A 1AKJA 3AM8A 3P4MA 3MV8A 1AO7A 1Z5LA 4ZUSA 5FA4A 4U6YA 3DMMA 1AGEA 1TVHA 2CKBH 1A1NA 3HE6A 4F7CA 1ZT1A 3FOLA 1S7UA 1I1FA 4X6FA 3ROLA 2X4NA 3LN5A 1Q94A 1L8JA 1P1ZA 4HUUA 1LQVA 1S9WA 4G43A 4PJEA 1KCGC 1QR1A 4WWKC 3V5HA 4WU5A 4U1MA 2GITA 4K71B 1KPVA 3I6KA 3SKMA 3TPUE 1DUYA 1KJVA 2FIKA 2F74A 3OX8A 3TN0A 3RWHA 4L4TA 2GJ6A 2YPKA 3ILQC 4CVXA 1T7YA 1XR9A 4L29A 5FKPA 2F54A 1R3HA 3BZFA 5E6IC 3LN4A 5EFIA 1S7SA 2WY3A 3TA3A 5FDWA 3L3KA 1OGTA 2NW3A 3T1FA 3SDDA 3LKRA 3OXRA 1ZAGA 4APQA 2AXFA 4BKWA 4V3DB 1S7XA 3MRRA 3CCHA 2BVOA 2GAZA 2MHAA 4U1SA 3ERYA 3VFTA 3BGMA 4JFQA 1NEZA 1XR8A 5C08A 3TIEA 3W39A 1HHGA 4F7TA 5IEHA 3C8KA 4ELMA 5ENWA 1P4LA 1WBXA 2VLLA 1A9BA 5AD0A 3PWJA 5B39A 3FQWA 1AGFA 3GSXA 3MRMA 3D18A 3KYOA 4U1KA 3WLBA 3GMOA 3VCLA 5D2NA 5IM7A 4LCCC 4MVBA 4MX7A 3GSUA 5IEKA 3DX8A 3E2HA 1JPGA 3VWJA 4L8DA 4PJXA 4D0BA 1RK0A 1T7ZA 3LKOA 4G8IA 3VWKA 5E8OA 3VXOA 1HSBA 3QUYA 4X6CA 1JUFA 1T1XA 1QVOA 3B3IA 5IVXA 1VACA 5C0IA 2VAAA 3MRJA 3RZCA 4L8CA 3MA7A 4HKJA 1T80A 3AREA 4PRDA 1QQDA 5E8NA 3TO2A 1JE6A 3LKPA 3IT8D 4ZUUA 1ONQA 3FTGA 1JHTA 2YPLA 1GZQA 4QRSA 1I7RA 3BW9A 3PQYA 1MHEA 3X13A 4HWZA 4PJFA 4PJCA 4PJIA 4QRRA 3VXUA 4UQ2A 2VLRA 3VFVA 3MRFA 4ZUWA 1DE4A 1IM9A 1HYRC 2HN7A 4I48A 4ZUVA 2CIKA 3PWPA 4MJ5A 1EEYA 3MYJA 3O3DA 4JO8A 4JFOA 1CG9A 1C16A 1TMCA 4NQDA 3MRPA 2BVQA 4D0CA 3CZFA 4QRUA 1WBZA 4NQXA 1FZJA 5J6HA 4MS8A 4N5EA 1A6ZA 3UPRA 4EI5A 5E00A 3ILPA 5D9SA 3MRDA 3O9WA 2ZOLA 1EFXA 3MR9A 4GKSA 5C0CA 3L9RA 4L3EA 3GMQA 4JFEA 4G59A 1QSFA 2H6PA 5EU4A 3UTSA 3KPRA 3G08A 5EU6A 3QUKA 4LNRA 3RWDA 1KJ2H 1UXWA 2F53A 5E9DA 2P5WA 1AGDA 5ISZA 3VJ6A 1CE6A 1KBGH 3PWUA 3FQTA 4G59C 4PRIA 4U1JA 5F1IA 1TVBA 3V5KA 3VFWA 2BSSA 3QDJA 3VXSA 1N3NA 5C0BA 5D7JC 5D5MA 4G9DA 2AV7A 2V2XA 3SPVA 3L3HA 5INCA 1ZT7A 3E6FA 3GSNH 3KWWA 4NO0A 3FQRA 1FFOA 4O2FA 4U1NA 3SDCA 5EUOA 5EU5A 5HGBA 1OF2A 3JTCA 4NQEA 5SWQA 1DDHA 2BVPA 3FQUA 3RWGA 5IB3A 3MRBA 3BZEA 5C0AA 3SCMA 1SYSA 3HG1A 4NNXA 3MRNA 4LHUA 4MNQA 5C0DA 3TBYA 1NANH 3MRHA 3RL2A 1HHHA 5C09A 3ARFA 4G8GA 4G42A 1BQHA 1X7QA 4L3CA 4F7PA 3O8XA 4PJ9A 3VXRA 1MHCA 1KJMA 3BWAA 1B0RA 1T20A 1I7UA 3O3EA 4N0CA 2HJKA 3ES6A 5E8PA 5MEQA 2H26A 4IHOA 1T1WA 3BH8A 4IIQC 1N2RA 4MNGA 4PGDA 4G9FA 4IRSA 3RWEA 4WDIA 1OGAA 4N0UA 3QDGA 4QRQA 3RWJA 5C9JA 3LKNA 1G6RH 5JHDA 3KPNA 4XXCA 3B6SA 5F9JA 3P4OA 4JRXA 2FZ3A 1HHJA 3M1BA 3O3BA 2X4UA 1BIIA 1ZSDA 4Y2DA 1T22A 1E28A 1CD1A 4PJ8A 3TO4A 3MRCA 3O4LA 2O5NA 3QQ4A 3VFUA 4PR5A 3VFOA 1GZPA 3H7BA 1NAMH 4QRPA 5DDHA 1A1OA 3QQ3A 3X11A 3RTQA 3GSWA 3MV7A 2DYPA 3GMMA 3D25A 2PO6A 4MQ7A 1JGDA 3KPOA 4NHUE 5MENA 2BSRA 4LCWA 5IROA 4GUPA 1YPZA 2VLKA 3MRGA 3O3AA 3DBXA 4D0DA 2GTZA 3VRJA 2GT9A 2CLRA 1BD2A 1U58A 2GUOA 2NYKA 5D2LA 5BS0A 4PJAA 1JPFA 2X4TA 1S7RA 3FRUA 3TJHA 4PJDA 3GMRA 1JFMA 4NSKA 4PDCE 5HHQA 2X70A 4X6EA 2JCCA 3RUGA 3WL9A 5SWZA 5EOTA 5HHMA 2A83A 2IA1A 1MI5A 4NT6A 3GJFA 1LEGA 2OI9A 2VLJA 3GSQA 3H9HA 4WU7A 4K7FA 3LV3A 2BNQA 1FZMA 1XZ0A 2XFXA 5INDA 4PRAA 4X6DA 3RWFA 1W0WA 4Y4FA 1G7QA 5HGAA 1FG2A 4NO2A 3HLAA 3MRIA 1HOCA 3AU1A 1AGBA 3GSVA 2BSTA 3MREA 1P7QA 1PQZA 4MXQA 3L3GA 3DTXA 4ZFZA 1JF1A 3ARDA 3ARGA 2P5EA 1HHKA 2ZSWA 3BH9A 3KPPA 4LCYA 4PRBA 4WJ5A 3T8XA 1I1YA 1FZOA 3P4NA 3PABA 5GSRA 3BVNA 1K8DA 1KTLA 2VABA 2FWOA 4U1LA 2X4OA 3KPQA 1LP9A 3M17A 5EU3A 3JVGA 4WO4A 3VFMA 3ECBA 2HJLA 1UXSA 1ZHNA 4NNYA 2AKRA 4MJIA 2V2WA 1G7PA 3IXAA 3QDMA 4JFFA 1T21A 1W0VA 3MRKA 5SWSA 1HSAA 5HHOA 1YN6A 3HCVA 4FFEX 4NQVA 5F7DA 3WS3A 3QEQA 3H9SA 2X4QA 3WUWA 3HE7A 1LK2A 4JRYA 3RL1A 2Q7YA 3BEWA 5BJTA 3L3IA 3RWCA 2CLVA 1ZHBA 3HUJA 3HAEA 3QUZA 5DEFA 5BRZA 1JGEA 3FONA 3E6HA 1T0NA 3VH8A 1ZHLA 1FFNA 1M05A 4ZAKA 1QEWA 2X4SA 3V5DA 4F7MA 3PWLA 1T0MA 1LDPH 1S7TA 3I6GA 4PGEA 3QULA 2CIIA 1ED3A 2GTWA 3TVMA 4L4VA 1QRNA 3GMNA 3VXMA 1LD9A 1QLFA 1T7WA 1S7WA 4U1IA 1A1MA 5HGHA 3D2UA 3KYNA 4PJ5A 4L9LC 3GSOA 1ZHKA 3P73A 4PG2A 5HYJA 4PG9A 4HS3A 2CLZA 1N5AA 1ZVSA 1ZS8A 1T1ZA 2BNRA 1S8DA 3L3JA 2X4PA 3OXSA 3FFCA 4HUXA 4HUWA 4I4WA 3W0WA 5J6GA 3TBWA 2AXGA 4F7EA 3FT2A 3KXFA 4PJGA 3BP4A 4WUUA 1N59A 3MGOA 3DX6A 1INQA 3CDGA 3MRLA 2D31A 4PRNA 3QZWA 3L3DA 4Y16A 3WS6A 1FO0H 3FT3A 1T1YA 4V3EB 5J1AA 1UQSA 4S0UC 2VE6A 3REWA 4Z78A 4L8SC 1S7QA 4UQ3A 4Z76A 4PV9A 5L2KA 1EEZA 5EO1A 3SDAA 4Z77A 2FYYA 3I6LD 3GSRA 1I4FA 4JFDA 3VXPA 1FZKA 4PV8A 4E0RA 1S9YA 4HV8A 3S6CA 3DXAA 3ARBA 3RGVC 3FQXA 1HHIA 1WBYA 4WW2C 2OL3H 5EO0A 4E5XA 1XH3A 3HPJA 5B38A 4MJ6A 5BXFA 1ZT4A 1FFPA 3FQNA 4N8VA 5MEOA 3CVHA 2PYEA 4EN3C 3D39A 3SKOA 5C07A 4CW1A 3QI9A 4O2EA 2FO4A 3JTSA 1I7TA 4JQVA 3SJVA 5FA3A 3TFKA 5HHPA 3GIVA 1LEKA 1RK1A 3UTQA 5DEGA 3VFNA 2UWEA 4EUPA 1S9XA 3C9NA 3ROOA 3KLAA 4NQCA 3RWIA 3X12A 1RJYA 1AGCA 5HHNA 4QRTA 3GMPA 4PGBA 4Y4HA 1RJZA 3LKSA 4PP8C 5H94A 5IB5A 3UTTA 3VRIA 3TF7A 4NO5A 1EXUA 5C0JA 4PRPA 4JFPA 1W72A 1VADA 4GKNA 3BUYA 1VGKA 3PWVA 3QFDA 1B0GA 4FTVA 3MV9A 2YEZA 2NX5A 4IRJA 1B3JA 4HUVA 1A9EA 1E27A 1K5NA 3E3QA 3JTTA 5D7LA 1M6OA 5F1NA 3FT4A 4L8BA 5IB2A 5C0EA 3BEVA 2HLAA 2ZSVA 3BHBA 2E7LE 4U1HA 1T7XA 3VXNA 3P77A 4PREA 3TIDA 2AK4A 3QUXA 3CH1A 2BCKA 2X4RA 3DX7A 3MGTA 1SYVA 4CVZA 1KPUA 3BO8A 5IB4A 4PJHA 4QOKA 3TBSA 3NFNA 3TBVA 3U0PA 3TZVC 1BZ9A 1KJ3H 2RFXA 1T7VA 1OSZA
chains in the Genus database with same CATH topology
1DUZA 1KPRA 2AV1A 3LKQA 5D7IA 3GMLA 2ESVA 3P9LA 3CPLA 2C7UA 1MWAH 4PGCA 1IM3A 4PJ7A 4JQXA 3SDXA 1QO3A 1YN7A 5GSVA 2J8UA 3BXNA 3VFSA 3PWNA 5C0GA 4PRHA 2XPGA 3OV6A 4HX1A 3KPMA 3KPSA 3UBXA 3VFRA 5MERA 5L2JA 3QFJA 3D3VA 4Y4KA 4O2CA 3MRQA 5MEPA 1I1AA 2ZOKA 5C0FA 5ACZA 3VFPA 4N0FA 4U6XA 3P9MA 5IB1A 3MROA 4ONOA 3KPLA 4ZUTA 1S7VA 3FOMA 4PJBA 3CC5A 1QSEA 3TBTA 3BP7A 5HGDA 4NO3A 1YDPA 3X14A 1AKJA 3AM8A 3P4MA 3MV8A 1AO7A 1Z5LA 4ZUSA 5FA4A 4U6YA 3DMMA 1AGEA 1TVHA 2CKBH 1A1NA 3HE6A 4F7CA 1ZT1A 3FOLA 1S7UA 1I1FA 4X6FA 3ROLA 2X4NA 3LN5A 1Q94A 1L8JA 1P1ZA 4HUUA 1LQVA 1S9WA 4G43A 4PJEA 1KCGC 1QR1A 4WWKC 3V5HA 4WU5A 4U1MA 2GITA 4K71B 1KPVA 3I6KA 3SKMA 3TPUE 1DUYA 1KJVA 2FIKA 2F74A 3OX8A 3TN0A 3RWHA 4L4TA 2GJ6A 2YPKA 3ILQC 4CVXA 1T7YA 1XR9A 4L29A 5FKPA 2F54A 1R3HA 3BZFA 5E6IC 3LN4A 5EFIA 1S7SA 2WY3A 3TA3A 5FDWA 3L3KA 1OGTA 2NW3A 3T1FA 3SDDA 3LKRA 3OXRA 1ZAGA 4APQA 2AXFA 4V3DB 1S7XA 3MRRA 3CCHA 2BVOA 2GAZA 2MHAA 4U1SA 3ERYA 3VFTA 3BGMA 4JFQA 1NEZA 1XR8A 5C08A 3TIEA 3W39A 1HHGA 4F7TA 5IEHA 3C8KA 4ELMA 5ENWA 1P4LA 1WBXA 2VLLA 1A9BA 5AD0A 3PWJA 5B39A 3FQWA 1AGFA 3GSXA 3MRMA 3D18A 3KYOA 4U1KA 3WLBA 3GMOA 3VCLA 5D2NA 5IM7A 4LCCC 4MVBA 4MX7A 3GSUA 5IEKA 3DX8A 3E2HA 1JPGA 3VWJA 4L8DA 4PJXA 4D0BA 1RK0A 1T7ZA 3LKOA 4G8IA 3VWKA 5E8OA 3VXOA 1HSBA 3QUYA 4X6CA 1JUFA 1T1XA 1QVOA 3B3IA 5IVXA 1VACA 5C0IA 2VAAA 3MRJA 3RZCA 4L8CA 3MA7A 4HKJA 1T80A 3AREA 4PRDA 1QQDA 5E8NA 3TO2A 1JE6A 3LKPA 3IT8D 4ZUUA 1ONQA 3FTGA 1JHTA 2YPLA 1GZQA 4QRSA 1I7RA 3BW9A 3PQYA 1MHEA 3X13A 4HWZA 4PJFA 4PJCA 4PJIA 4QRRA 3VXUA 4UQ2A 2VLRA 3VFVA 3MRFA 4ZUWA 1DE4A 1IM9A 1HYRC 2HN7A 4I48A 4ZUVA 2CIKA 3PWPA 4MJ5A 1EEYA 3MYJA 3O3DA 4JFOA 1CG9A 1C16A 1TMCA 4NQDA 3MRPA 2BVQA 4D0CA 3CZFA 4QRUA 1WBZA 4NQXA 1FZJA 5J6HA 4MS8A 4N5EA 1A6ZA 3UPRA 4EI5A 5E00A 3ILPA 5D9SA 3MRDA 3O9WA 2ZOLA 1EFXA 3MR9A 4GKSA 5C0CA 3L9RA 4L3EA 3GMQA 4JFEA 4G59A 1QSFA 2H6PA 5EU4A 3UTSA 3KPRA 3G08A 5EU6A 3QUKA 4LNRA 3RWDA 1KJ2H 1UXWA 2F53A 5E9DA 2P5WA 1AGDA 5ISZA 3VJ6A 1CE6A 1KBGH 3PWUA 3FQTA 4PRIA 4U1JA 5F1IA 3V5KA 1TVBA 3VFWA 3VXSA 2BSSA 3QDJA 1N3NA 5C0BA 5D7JC 5D5MA 4G9DA 2AV7A 2V2XA 3SPVA 3L3HA 5INCA 1ZT7A 3E6FA 3GSNH 3KWWA 4NO0A 3FQRA 1FFOA 4O2FA 4U1NA 3SDCA 5EUOA 5EU5A 5HGBA 1OF2A 3JTCA 4NQEA 5SWQA 1DDHA 2BVPA 3FQUA 3RWGA 5IB3A 3MRBA 3BZEA 5C0AA 3SCMA 1SYSA 3HG1A 4NNXA 3MRNA 4LHUA 4MNQA 5C0DA 3TBYA 1NANH 3MRHA 3RL2A 1HHHA 5C09A 3ARFA 4G8GA 4G42A 1BQHA 1X7QA 4L3CA 4F7PA 3O8XA 4PJ9A 3VXRA 1MHCA 1KJMA 3BWAA 1B0RA 1T20A 1I7UA 3O3EA 4N0CA 2HJKA 3ES6A 5E8PA 5MEQA 2H26A 4IHOA 1T1WA 3BH8A 4IIQC 1N2RA 4MNGA 4PGDA 4G9FA 4IRSA 3RWEA 4WDIA 1OGAA 4N0UA 3QDGA 4QRQA 3RWJA 5C9JA 3LKNA 1G6RH 5JHDA 3KPNA 4XXCA 3B6SA 5F9JA 3P4OA 4JRXA 2FZ3A 1HHJA 3M1BA 3O3BA 2X4UA 1BIIA 1ZSDA 4Y2DA 1T22A 1E28A 1CD1A 4PJ8A 3TO4A 3MRCA 3O4LA 3QQ4A 3VFUA 4PR5A 3VFOA 1GZPA 3H7BA 1NAMH 4QRPA 5DDHA 1A1OA 3QQ3A 3X11A 3RTQA 3GSWA 3MV7A 2DYPA 3GMMA 3D25A 2PO6A 4MQ7A 1JGDA 3KPOA 4NHUE 5MENA 2BSRA 4LCWA 5IROA 4GUPA 1YPZA 2VLKA 3MRGA 3O3AA 3DBXA 4D0DA 2GTZA 3VRJA 2GT9A 2CLRA 1BD2A 1U58A 2GUOA 5D2LA 5BS0A 4PJAA 1JPFA 2X4TA 1S7RA 3FRUA 3TJHA 4PJDA 3GMRA 1JFMA 4NSKA 4PDCE 5HHQA 2X70A 4X6EA 2JCCA 3RUGA 3WL9A 5SWZA 5EOTA 5HHMA 2A83A 1MI5A 4NT6A 3GJFA 1LEGA 2OI9A 2VLJA 3GSQA 3H9HA 4WU7A 4K7FA 3LV3A 2BNQA 1FZMA 1XZ0A 2XFXA 5INDA 4PRAA 4X6DA 3RWFA 1W0WA 4Y4FA 1G7QA 5HGAA 1FG2A 4NO2A 3HLAA 3MRIA 1HOCA 3AU1A 1AGBA 3GSVA 2BSTA 3MREA 1P7QA 1PQZA 4MXQA 3L3GA 3DTXA 4ZFZA 1JF1A 3ARDA 3ARGA 2P5EA 1HHKA 2ZSWA 3BH9A 3KPPA 4LCYA 4PRBA 4WJ5A 3T8XA 1I1YA 1FZOA 3P4NA 3PABA 5GSRA 3BVNA 1K8DA 1KTLA 2VABA 2FWOA 4U1LA 2X4OA 3KPQA 1LP9A 3M17A 5EU3A 3JVGA 4WO4A 3VFMA 3ECBA 2HJLA 1UXSA 1ZHNA 4NNYA 2AKRA 4MJIA 2V2WA 1G7PA 3IXAA 3QDMA 4JFFA 1T21A 1W0VA 3MRKA 5SWSA 1HSAA 5HHOA 1YN6A 3HCVA 4FFEX 4NQVA 5F7DA 3WS3A 3QEQA 3H9SA 2X4QA 3WUWA 3HE7A 1LK2A 4JRYA 3RL1A 2Q7YA 3BEWA 5BJTA 3L3IA 3RWCA 2CLVA 1ZHBA 3HUJA 3HAEA 3QUZA 5DEFA 5BRZA 1JGEA 3FONA 3E6HA 1T0NA 3VH8A 1ZHLA 1FFNA 1M05A 4ZAKA 1QEWA 2X4SA 3V5DA 4F7MA 3PWLA 1T0MA 1LDPH 1S7TA 3I6GA 4PGEA 3QULA 2CIIA 1ED3A 2GTWA 3TVMA 4L4VA 1QRNA 3GMNA 3VXMA 1LD9A 1QLFA 1T7WA 1S7WA 4U1IA 1A1MA 5HGHA 3D2UA 3KYNA 4PJ5A 4L9LC 3GSOA 1ZHKA 3P73A 4PG2A 5HYJA 4PG9A 4HS3A 2CLZA 1N5AA 1ZVSA 1ZS8A 1T1ZA 2BNRA 1S8DA 3L3JA 2X4PA 3OXSA 3FFCA 4HUXA 4HUWA 4I4WA 3W0WA 5J6GA 3TBWA 2AXGA 4F7EA 3FT2A 3KXFA 4PJGA 3BP4A 4WUUA 1N59A 3MGOA 3DX6A 1INQA 3CDGA 3MRLA 2D31A 4PRNA 3QZWA 3L3DA 4Y16A 3WS6A 1FO0H 3FT3A 1T1YA 4V3EB 5J1AA 1UQSA 4S0UC 2VE6A 3REWA 4Z78A 4L8SC 1S7QA 4UQ3A 4Z76A 4PV9A 5L2KA 1EEZA 5EO1A 3SDAA 4Z77A 2FYYA 3I6LD 3GSRA 1I4FA 4JFDA 3VXPA 1FZKA 4PV8A 4E0RA 1S9YA 4HV8A 3S6CA 3DXAA 3ARBA 3RGVC 3FQXA 1HHIA 1WBYA 4WW2C 2OL3H 5EO0A 4E5XA 1XH3A 3HPJA 5B38A 4MJ6A 5BXFA 1ZT4A 1FFPA 3FQNA 4N8VA 5MEOA 3CVHA 2PYEA 4EN3C 3D39A 3SKOA 5C07A 4CW1A 3QI9A 4O2EA 2FO4A 3JTSA 1I7TA 4JQVA 3SJVA 5FA3A 3TFKA 5HHPA 3GIVA 1LEKA 1RK1A 3UTQA 5DEGA 3VFNA 2UWEA 4EUPA 1S9XA 3C9NA 3ROOA 3KLAA 4NQCA 3RWIA 3X12A 1RJYA 1AGCA 5HHNA 4QRTA 3GMPA 4PGBA 4Y4HA 1RJZA 3LKSA 4PP8C 5H94A 5IB5A 3UTTA 3VRIA 3TF7A 4NO5A 1EXUA 5C0JA 4PRPA 4JFPA 1W72A 1VADA 4GKNA 3BUYA 1VGKA 3PWVA 3QFDA 1B0GA 4FTVA 3MV9A 2YEZA 2NX5A 4IRJA 1B3JA 4HUVA 1A9EA 1E27A 1K5NA 3E3QA 3JTTA 5D7LA 1M6OA 5F1NA 3FT4A 4L8BA 5IB2A 5C0EA 3BEVA 2HLAA 2ZSVA 3BHBA 2E7LE 4U1HA 1T7XA 3VXNA 3P77A 4PREA 3TIDA 2AK4A 3QUXA 3CH1A 2BCKA 2X4RA 3DX7A 3MGTA 1SYVA 4CVZA 1KPUA 3BO8A 5IB4A 4PJHA 4QOKA 3TBSA 3NFNA 3TBVA 3U0PA 3TZVC 1BZ9A 1KJ3H 2RFXA 1T7VA 1OSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DUZ A;  1KPR A;  2AV1 A;  3LKQ A;  5D7I A;  3GML A;  2ESV A;  3P9L A;  3CPL A;  2C7U A;  1MWA H;  4PGC A;  1IM3 A;  4PJ7 A;  4JQX A;  3SDX A;  1QO3 A;  1YN7 A;  5GSV A;  2J8U A;  3BXN A;  3VFS A;  3PWN A;  5C0G A;  4PRH A;  2XPG A;  3OV6 A;  4HX1 A;  3KPM A;  3KPS A;  3UBX A;  3VFR A;  5MER A;  5L2J A;  3QFJ A;  3D3V A;  4Y4K A;  4O2C A;  3MRQ A;  5MEP A;  1I1A A;  2ZOK A;  5C0F A;  5ACZ A;  3VFP A;  4N0F A;  4U6X A;  3P9M A;  5IB1 A;  3MRO A;  4ONO A;  3KPL A;  4ZUT A;  1S7V A;  3FOM A;  4PJB A;  3CC5 A;  1QSE A;  3TBT A;  3BP7 A;  5HGD A;  4NO3 A;  1YDP A;  3X14 A;  1AKJ A;  3AM8 A;  3P4M A;  3MV8 A;  1AO7 A;  1Z5L A;  4ZUS A;  5FA4 A;  4U6Y A;  3DMM A;  1AGE A;  1TVH A;  2CKB H;  1A1N A;  3HE6 A;  4F7C A;  1ZT1 A;  3FOL A;  1S7U A;  1I1F A;  4X6F A;  3ROL A;  2X4N A;  3LN5 A;  1Q94 A;  1L8J A;  1P1Z A;  4HUU A;  1LQV A;  1S9W A;  4G43 A;  4PJE A;  1KCG C;  1QR1 A;  4WWK C;  3V5H A;  4WU5 A;  4U1M A;  2GIT A;  4K71 B;  1KPV A;  3I6K A;  3SKM A;  3TPU E;  1DUY A;  1KJV A;  2FIK A;  2F74 A;  3OX8 A;  3TN0 A;  3RWH A;  4L4T A;  2GJ6 A;  2YPK A;  3ILQ C;  4CVX A;  1T7Y A;  1XR9 A;  4L29 A;  5FKP A;  2F54 A;  1R3H A;  3BZF A;  5E6I C;  3LN4 A;  5EFI A;  1S7S A;  2WY3 A;  3TA3 A;  5FDW A;  3L3K A;  1OGT A;  2NW3 A;  3T1F A;  3SDD A;  3LKR A;  3OXR A;  1ZAG A;  4APQ A;  2AXF A;  4V3D B;  1S7X A;  3MRR A;  3CCH A;  2BVO A;  2GAZ A;  2MHA A;  4U1S A;  3ERY A;  3VFT A;  3BGM A;  4JFQ A;  1NEZ A;  1XR8 A;  5C08 A;  3TIE A;  3W39 A;  1HHG A;  4F7T A;  5IEH A;  3C8K A;  4ELM A;  5ENW A;  1P4L A;  1WBX A;  2VLL A;  1A9B A;  5AD0 A;  3PWJ A;  5B39 A;  3FQW A;  1AGF A;  3GSX A;  3MRM A;  3D18 A;  3KYO A;  4U1K A;  3WLB A;  3GMO A;  3VCL A;  5D2N A;  5IM7 A;  4LCC C;  4MVB A;  4MX7 A;  3GSU A;  5IEK A;  3DX8 A;  3E2H A;  1JPG A;  3VWJ A;  4L8D A;  4PJX A;  4D0B A;  1RK0 A;  1T7Z A;  3LKO A;  4G8I A;  3VWK A;  5E8O A;  3VXO A;  1HSB A;  3QUY A;  4X6C A;  1JUF A;  1T1X A;  1QVO A;  3B3I A;  5IVX A;  1VAC A;  5C0I A;  2VAA A;  3MRJ A;  3RZC A;  4L8C A;  3MA7 A;  4HKJ A;  1T80 A;  3ARE A;  4PRD A;  1QQD A;  5E8N A;  3TO2 A;  1JE6 A;  3LKP A;  3IT8 D;  4ZUU A;  1ONQ A;  3FTG A;  1JHT A;  2YPL A;  1GZQ A;  4QRS A;  1I7R A;  3BW9 A;  3PQY A;  1MHE A;  3X13 A;  4HWZ A;  4PJF A;  4PJC A;  4PJI A;  4QRR A;  3VXU A;  4UQ2 A;  2VLR A;  3VFV A;  3MRF A;  4ZUW A;  1DE4 A;  1IM9 A;  1HYR C;  2HN7 A;  4I48 A;  4ZUV A;  2CIK A;  3PWP A;  4MJ5 A;  1EEY A;  3MYJ A;  3O3D A;  4JFO A;  1CG9 A;  1C16 A;  1TMC A;  4NQD A;  3MRP A;  2BVQ A;  4D0C A;  3CZF A;  4QRU A;  1WBZ A;  4NQX A;  1FZJ A;  5J6H A;  4MS8 A;  4N5E A;  1A6Z A;  3UPR A;  4EI5 A;  5E00 A;  3ILP A;  5D9S A;  3MRD A;  3O9W A;  2ZOL A;  1EFX A;  3MR9 A;  4GKS A;  5C0C A;  3L9R A;  4L3E A;  3GMQ A;  4JFE A;  4G59 A;  1QSF A;  2H6P A;  5EU4 A;  3UTS A;  3KPR A;  3G08 A;  5EU6 A;  3QUK A;  4LNR A;  3RWD A;  1KJ2 H;  1UXW A;  2F53 A;  5E9D A;  2P5W A;  1AGD A;  5ISZ A;  3VJ6 A;  1CE6 A;  1KBG H;  3PWU A;  3FQT A;  4PRI A;  4U1J A;  5F1I A;  3V5K A;  1TVB A;  3VFW A;  3VXS A;  2BSS A;  3QDJ A;  1N3N A;  5C0B A;  5D7J C;  5D5M A;  4G9D A;  2AV7 A;  2V2X A;  3SPV A;  3L3H A;  5INC A;  1ZT7 A;  3E6F A;  3GSN H;  3KWW A;  4NO0 A;  3FQR A;  1FFO A;  4O2F A;  4U1N A;  3SDC A;  5EUO A;  5EU5 A;  5HGB A;  1OF2 A;  3JTC A;  4NQE A;  5SWQ A;  1DDH A;  2BVP A;  3FQU A;  3RWG A;  5IB3 A;  3MRB A;  3BZE A;  5C0A A;  3SCM A;  1SYS A;  3HG1 A;  4NNX A;  3MRN A;  4LHU A;  4MNQ A;  5C0D A;  3TBY A;  1NAN H;  3MRH A;  3RL2 A;  1HHH A;  5C09 A;  3ARF A;  4G8G A;  4G42 A;  1BQH A;  1X7Q A;  4L3C A;  4F7P A;  3O8X A;  4PJ9 A;  3VXR A;  1MHC A;  1KJM A;  3BWA A;  1B0R A;  1T20 A;  1I7U A;  3O3E A;  4N0C A;  2HJK A;  3ES6 A;  5E8P A;  5MEQ A;  2H26 A;  4IHO A;  1T1W A;  3BH8 A;  4IIQ C;  1N2R A;  4MNG A;  4PGD A;  4G9F A;  4IRS A;  3RWE A;  4WDI A;  1OGA A;  4N0U A;  3QDG A;  4QRQ A;  3RWJ A;  5C9J A;  3LKN A;  1G6R H;  5JHD A;  3KPN A;  4XXC A;  3B6S A;  5F9J A;  3P4O A;  4JRX A;  2FZ3 A;  1HHJ A;  3M1B A;  3O3B A;  2X4U A;  1BII A;  1ZSD A;  4Y2D A;  1T22 A;  1E28 A;  1CD1 A;  4PJ8 A;  3TO4 A;  3MRC A;  3O4L A;  3QQ4 A;  3VFU A;  4PR5 A;  3VFO A;  1GZP A;  3H7B A;  1NAM H;  4QRP A;  5DDH A;  1A1O A;  3QQ3 A;  3X11 A;  3RTQ A;  3GSW A;  3MV7 A;  2DYP A;  3GMM A;  3D25 A;  2PO6 A;  4MQ7 A;  1JGD A;  3KPO A;  4NHU E;  5MEN A;  2BSR A;  4LCW A;  5IRO A;  4GUP A;  1YPZ A;  2VLK A;  3MRG A;  3O3A A;  3DBX A;  4D0D A;  2GTZ A;  3VRJ A;  2GT9 A;  2CLR A;  1BD2 A;  1U58 A;  2GUO A;  5D2L A;  5BS0 A;  4PJA A;  1JPF A;  2X4T A;  1S7R A;  3FRU A;  3TJH A;  4PJD A;  3GMR A;  1JFM A;  4NSK A;  4PDC E;  5HHQ A;  2X70 A;  4X6E A;  2JCC A;  3RUG A;  3WL9 A;  5SWZ A;  5EOT A;  5HHM A;  2A83 A;  1MI5 A;  4NT6 A;  3GJF A;  1LEG A;  2OI9 A;  2VLJ A;  3GSQ A;  3H9H A;  4WU7 A;  4K7F A;  3LV3 A;  2BNQ A;  1FZM A;  1XZ0 A;  2XFX A;  5IND A;  4PRA A;  4X6D A;  3RWF A;  1W0W A;  4Y4F A;  1G7Q A;  5HGA A;  1FG2 A;  4NO2 A;  3HLA A;  3MRI A;  1HOC A;  3AU1 A;  1AGB A;  3GSV A;  2BST A;  3MRE A;  1P7Q A;  1PQZ A;  4MXQ A;  3L3G A;  3DTX A;  4ZFZ A;  1JF1 A;  3ARD A;  3ARG A;  2P5E A;  1HHK A;  2ZSW A;  3BH9 A;  3KPP A;  4LCY A;  4PRB A;  4WJ5 A;  3T8X A;  1I1Y A;  1FZO A;  3P4N A;  3PAB A;  5GSR A;  3BVN A;  1K8D A;  1KTL A;  2VAB A;  2FWO A;  4U1L A;  2X4O A;  3KPQ A;  1LP9 A;  3M17 A;  5EU3 A;  3JVG A;  4WO4 A;  3VFM A;  3ECB A;  2HJL A;  1UXS A;  1ZHN A;  4NNY A;  2AKR A;  4MJI A;  2V2W A;  1G7P A;  3IXA A;  3QDM A;  4JFF A;  1T21 A;  1W0V A;  3MRK A;  5SWS A;  1HSA A;  5HHO A;  1YN6 A;  3HCV A;  4FFE X;  4NQV A;  5F7D A;  3WS3 A;  3QEQ A;  3H9S A;  2X4Q A;  3WUW A;  3HE7 A;  1LK2 A;  4JRY A;  3RL1 A;  2Q7Y A;  3BEW A;  5BJT A;  3L3I A;  3RWC A;  2CLV A;  1ZHB A;  3HUJ A;  3HAE A;  3QUZ A;  5DEF A;  5BRZ A;  1JGE A;  3FON A;  3E6H A;  1T0N A;  3VH8 A;  1ZHL A;  1FFN A;  1M05 A;  4ZAK A;  1QEW A;  2X4S A;  3V5D A;  4F7M A;  3PWL A;  1T0M A;  1LDP H;  1S7T A;  3I6G A;  4PGE A;  3QUL A;  2CII A;  1ED3 A;  2GTW A;  3TVM A;  4L4V A;  1QRN A;  3GMN A;  3VXM A;  1LD9 A;  1QLF A;  1T7W A;  1S7W A;  4U1I A;  1A1M A;  5HGH A;  3D2U A;  3KYN A;  4PJ5 A;  4L9L C;  3GSO A;  1ZHK A;  3P73 A;  4PG2 A;  5HYJ A;  4PG9 A;  4HS3 A;  2CLZ A;  1N5A A;  1ZVS A;  1ZS8 A;  1T1Z A;  2BNR A;  1S8D A;  3L3J A;  2X4P A;  3OXS A;  3FFC A;  4HUX A;  4HUW A;  4I4W A;  3W0W A;  5J6G A;  3TBW A;  2AXG A;  4F7E A;  3FT2 A;  3KXF A;  4PJG A;  3BP4 A;  4WUU A;  1N59 A;  3MGO A;  3DX6 A;  1INQ A;  3CDG A;  3MRL A;  2D31 A;  4PRN A;  3QZW A;  3L3D A;  4Y16 A;  3WS6 A;  1FO0 H;  3FT3 A;  1T1Y A;  4V3E B;  5J1A A;  1UQS A;  4S0U C;  2VE6 A;  3REW A;  4Z78 A;  4L8S C;  1S7Q A;  4UQ3 A;  4Z76 A;  4PV9 A;  5L2K A;  1EEZ A;  5EO1 A;  3SDA A;  4Z77 A;  2FYY A;  3I6L D;  3GSR A;  1I4F A;  4JFD A;  3VXP A;  1FZK A;  4PV8 A;  4E0R A;  1S9Y A;  4HV8 A;  3S6C A;  3DXA A;  3ARB A;  3RGV C;  3FQX A;  1HHI A;  1WBY A;  4WW2 C;  2OL3 H;  5EO0 A;  4E5X A;  1XH3 A;  3HPJ A;  5B38 A;  4MJ6 A;  5BXF A;  1ZT4 A;  1FFP A;  3FQN A;  4N8V A;  5MEO A;  3CVH A;  2PYE A;  4EN3 C;  3D39 A;  3SKO A;  5C07 A;  4CW1 A;  3QI9 A;  4O2E A;  2FO4 A;  3JTS A;  1I7T A;  4JQV A;  3SJV A;  5FA3 A;  3TFK A;  5HHP A;  3GIV A;  1LEK A;  1RK1 A;  3UTQ A;  5DEG A;  3VFN A;  2UWE A;  4EUP A;  1S9X A;  3C9N A;  3ROO A;  3KLA A;  4NQC A;  3RWI A;  3X12 A;  1RJY A;  1AGC A;  5HHN A;  4QRT A;  3GMP A;  4PGB A;  4Y4H A;  1RJZ A;  3LKS A;  4PP8 C;  5H94 A;  5IB5 A;  3UTT A;  3VRI A;  3TF7 A;  4NO5 A;  1EXU A;  5C0J A;  4PRP A;  4JFP A;  1W72 A;  1VAD A;  4GKN A;  3BUY A;  1VGK A;  3PWV A;  3QFD A;  1B0G A;  4FTV A;  3MV9 A;  2YEZ A;  2NX5 A;  4IRJ A;  1B3J A;  4HUV A;  1A9E A;  1E27 A;  1K5N A;  3E3Q A;  3JTT A;  5D7L A;  1M6O A;  5F1N A;  3FT4 A;  4L8B A;  5IB2 A;  5C0E A;  3BEV A;  2HLA A;  2ZSV A;  3BHB A;  2E7L E;  4U1H A;  1T7X A;  3VXN A;  3P77 A;  4PRE A;  3TID A;  2AK4 A;  3QUX A;  3CH1 A;  2BCK A;  2X4R A;  3DX7 A;  3MGT A;  1SYV A;  4CVZ A;  1KPU A;  3BO8 A;  5IB4 A;  4PJH A;  4QOK A;  3TBS A;  3NFN A;  3TBV A;  3U0P A;  3TZV C;  1BZ9 A;  1KJ3 H;  2RFX A;  1T7V A;  1OSZ A; 
#chains in the Genus database with same CATH topology
 1DUZ A;  1KPR A;  2AV1 A;  3LKQ A;  5D7I A;  3GML A;  2ESV A;  3P9L A;  3CPL A;  2C7U A;  1MWA H;  4PGC A;  1IM3 A;  4PJ7 A;  4JQX A;  3SDX A;  1QO3 A;  1YN7 A;  5GSV A;  2J8U A;  3BXN A;  3VFS A;  3PWN A;  5C0G A;  4PRH A;  2XPG A;  3OV6 A;  4HX1 A;  3KPM A;  3KPS A;  3UBX A;  3VFR A;  5MER A;  3I0T A;  5L2J A;  3QFJ A;  3D3V A;  4Y4K A;  4O2C A;  3MRQ A;  5MEP A;  1I1A A;  2ZOK A;  5C0F A;  5ACZ A;  3VFP A;  4N0F A;  4U6X A;  3P9M A;  5IB1 A;  3MRO A;  4ONO A;  3KPL A;  4ZUT A;  1S7V A;  3FOM A;  4PJB A;  3CC5 A;  1QSE A;  3TBT A;  3BP7 A;  5HGD A;  4NO3 A;  1YDP A;  3X14 A;  1AKJ A;  3AM8 A;  3P4M A;  3MV8 A;  1AO7 A;  1Z5L A;  4ZUS A;  5FA4 A;  4U6Y A;  3DMM A;  1AGE A;  1TVH A;  2CKB H;  1A1N A;  3HE6 A;  4F7C A;  1ZT1 A;  3FOL A;  1S7U A;  1I1F A;  4X6F A;  3ROL A;  2X4N A;  3LN5 A;  1Q94 A;  1L8J A;  1P1Z A;  4HUU A;  1LQV A;  1S9W A;  4G43 A;  4PJE A;  1KCG C;  1QR1 A;  4WWK C;  3V5H A;  4WU5 A;  4U1M A;  2GIT A;  4K71 B;  1KPV A;  3I6K A;  3SKM A;  3TPU E;  1DUY A;  1KJV A;  2FIK A;  2F74 A;  3OX8 A;  3TN0 A;  3RWH A;  4L4T A;  2GJ6 A;  2YPK A;  3ILQ C;  4CVX A;  1T7Y A;  1XR9 A;  4L29 A;  5FKP A;  2F54 A;  1R3H A;  3BZF A;  5E6I C;  3LN4 A;  5EFI A;  1S7S A;  2WY3 A;  3TA3 A;  5FDW A;  3L3K A;  1OGT A;  2NW3 A;  3T1F A;  3SDD A;  3LKR A;  3OXR A;  1ZAG A;  4APQ A;  2AXF A;  4BKW A;  4V3D B;  1S7X A;  3MRR A;  3CCH A;  2BVO A;  2GAZ A;  2MHA A;  4U1S A;  3ERY A;  3VFT A;  3BGM A;  4JFQ A;  1NEZ A;  1XR8 A;  5C08 A;  3TIE A;  3W39 A;  1HHG A;  4F7T A;  5IEH A;  3C8K A;  4ELM A;  5ENW A;  1P4L A;  1WBX A;  2VLL A;  1A9B A;  5AD0 A;  3PWJ A;  5B39 A;  3FQW A;  1AGF A;  3GSX A;  3MRM A;  3D18 A;  3KYO A;  4U1K A;  3WLB A;  3GMO A;  3VCL A;  5D2N A;  5IM7 A;  4LCC C;  4MVB A;  4MX7 A;  3GSU A;  5IEK A;  3DX8 A;  3E2H A;  1JPG A;  3VWJ A;  4L8D A;  4PJX A;  4D0B A;  1RK0 A;  1T7Z A;  3LKO A;  4G8I A;  3VWK A;  5E8O A;  3VXO A;  1HSB A;  3QUY A;  4X6C A;  1JUF A;  1T1X A;  1QVO A;  3B3I A;  5IVX A;  1VAC A;  5C0I A;  2VAA A;  3MRJ A;  3RZC A;  4L8C A;  3MA7 A;  4HKJ A;  1T80 A;  3ARE A;  4PRD A;  1QQD A;  5E8N A;  3TO2 A;  1JE6 A;  3LKP A;  3IT8 D;  4ZUU A;  1ONQ A;  3FTG A;  1JHT A;  2YPL A;  1GZQ A;  4QRS A;  1I7R A;  3BW9 A;  3PQY A;  1MHE A;  3X13 A;  4HWZ A;  4PJF A;  4PJC A;  4PJI A;  4QRR A;  3VXU A;  4UQ2 A;  2VLR A;  3VFV A;  3MRF A;  4ZUW A;  1DE4 A;  1IM9 A;  1HYR C;  2HN7 A;  4I48 A;  4ZUV A;  2CIK A;  3PWP A;  4MJ5 A;  1EEY A;  3MYJ A;  3O3D A;  4JO8 A;  4JFO A;  1CG9 A;  1C16 A;  1TMC A;  4NQD A;  3MRP A;  2BVQ A;  4D0C A;  3CZF A;  4QRU A;  1WBZ A;  4NQX A;  1FZJ A;  5J6H A;  4MS8 A;  4N5E A;  1A6Z A;  3UPR A;  4EI5 A;  5E00 A;  3ILP A;  5D9S A;  3MRD A;  3O9W A;  2ZOL A;  1EFX A;  3MR9 A;  4GKS A;  5C0C A;  3L9R A;  4L3E A;  3GMQ A;  4JFE A;  4G59 A;  1QSF A;  2H6P A;  5EU4 A;  3UTS A;  3KPR A;  3G08 A;  5EU6 A;  3QUK A;  4LNR A;  3RWD A;  1KJ2 H;  1UXW A;  2F53 A;  5E9D A;  2P5W A;  1AGD A;  5ISZ A;  3VJ6 A;  1CE6 A;  1KBG H;  3PWU A;  3FQT A;  4G59 C;  4PRI A;  4U1J A;  5F1I A;  1TVB A;  3V5K A;  3VFW A;  2BSS A;  3QDJ A;  3VXS A;  1N3N A;  5C0B A;  5D7J C;  5D5M A;  4G9D A;  2AV7 A;  2V2X A;  3SPV A;  3L3H A;  5INC A;  1ZT7 A;  3E6F A;  3GSN H;  3KWW A;  4NO0 A;  3FQR A;  1FFO A;  4O2F A;  4U1N A;  3SDC A;  5EUO A;  5EU5 A;  5HGB A;  1OF2 A;  3JTC A;  4NQE A;  5SWQ A;  1DDH A;  2BVP A;  3FQU A;  3RWG A;  5IB3 A;  3MRB A;  3BZE A;  5C0A A;  3SCM A;  1SYS A;  3HG1 A;  4NNX A;  3MRN A;  4LHU A;  4MNQ A;  5C0D A;  3TBY A;  1NAN H;  3MRH A;  3RL2 A;  1HHH A;  5C09 A;  3ARF A;  4G8G A;  4G42 A;  1BQH A;  1X7Q A;  4L3C A;  4F7P A;  3O8X A;  4PJ9 A;  3VXR A;  1MHC A;  1KJM A;  3BWA A;  1B0R A;  1T20 A;  1I7U A;  3O3E A;  4N0C A;  2HJK A;  3ES6 A;  5E8P A;  5MEQ A;  2H26 A;  4IHO A;  1T1W A;  3BH8 A;  4IIQ C;  1N2R A;  4MNG A;  4PGD A;  4G9F A;  4IRS A;  3RWE A;  4WDI A;  1OGA A;  4N0U A;  3QDG A;  4QRQ A;  3RWJ A;  5C9J A;  3LKN A;  1G6R H;  5JHD A;  3KPN A;  4XXC A;  3B6S A;  5F9J A;  3P4O A;  4JRX A;  2FZ3 A;  1HHJ A;  3M1B A;  3O3B A;  2X4U A;  1BII A;  1ZSD A;  4Y2D A;  1T22 A;  1E28 A;  1CD1 A;  4PJ8 A;  3TO4 A;  3MRC A;  3O4L A;  2O5N A;  3QQ4 A;  3VFU A;  4PR5 A;  3VFO A;  1GZP A;  3H7B A;  1NAM H;  4QRP A;  5DDH A;  1A1O A;  3QQ3 A;  3X11 A;  3RTQ A;  3GSW A;  3MV7 A;  2DYP A;  3GMM A;  3D25 A;  2PO6 A;  4MQ7 A;  1JGD A;  3KPO A;  4NHU E;  5MEN A;  2BSR A;  4LCW A;  5IRO A;  4GUP A;  1YPZ A;  2VLK A;  3MRG A;  3O3A A;  3DBX A;  4D0D A;  2GTZ A;  3VRJ A;  2GT9 A;  2CLR A;  1BD2 A;  1U58 A;  2GUO A;  2NYK A;  5D2L A;  5BS0 A;  4PJA A;  1JPF A;  2X4T A;  1S7R A;  3FRU A;  3TJH A;  4PJD A;  3GMR A;  1JFM A;  4NSK A;  4PDC E;  5HHQ A;  2X70 A;  4X6E A;  2JCC A;  3RUG A;  3WL9 A;  5SWZ A;  5EOT A;  5HHM A;  2A83 A;  2IA1 A;  1MI5 A;  4NT6 A;  3GJF A;  1LEG A;  2OI9 A;  2VLJ A;  3GSQ A;  3H9H A;  4WU7 A;  4K7F A;  3LV3 A;  2BNQ A;  1FZM A;  1XZ0 A;  2XFX A;  5IND A;  4PRA A;  4X6D A;  3RWF A;  1W0W A;  4Y4F A;  1G7Q A;  5HGA A;  1FG2 A;  4NO2 A;  3HLA A;  3MRI A;  1HOC A;  3AU1 A;  1AGB A;  3GSV A;  2BST A;  3MRE A;  1P7Q A;  1PQZ A;  4MXQ A;  3L3G A;  3DTX A;  4ZFZ A;  1JF1 A;  3ARD A;  3ARG A;  2P5E A;  1HHK A;  2ZSW A;  3BH9 A;  3KPP A;  4LCY A;  4PRB A;  4WJ5 A;  3T8X A;  1I1Y A;  1FZO A;  3P4N A;  3PAB A;  5GSR A;  3BVN A;  1K8D A;  1KTL A;  2VAB A;  2FWO A;  4U1L A;  2X4O A;  3KPQ A;  1LP9 A;  3M17 A;  5EU3 A;  3JVG A;  4WO4 A;  3VFM A;  3ECB A;  2HJL A;  1UXS A;  1ZHN A;  4NNY A;  2AKR A;  4MJI A;  2V2W A;  1G7P A;  3IXA A;  3QDM A;  4JFF A;  1T21 A;  1W0V A;  3MRK A;  5SWS A;  1HSA A;  5HHO A;  1YN6 A;  3HCV A;  4FFE X;  4NQV A;  5F7D A;  3WS3 A;  3QEQ A;  3H9S A;  2X4Q A;  3WUW A;  3HE7 A;  1LK2 A;  4JRY A;  3RL1 A;  2Q7Y A;  3BEW A;  5BJT A;  3L3I A;  3RWC A;  2CLV A;  1ZHB A;  3HUJ A;  3HAE A;  3QUZ A;  5DEF A;  5BRZ A;  1JGE A;  3FON A;  3E6H A;  1T0N A;  3VH8 A;  1ZHL A;  1FFN A;  1M05 A;  4ZAK A;  1QEW A;  2X4S A;  3V5D A;  4F7M A;  3PWL A;  1T0M A;  1LDP H;  1S7T A;  3I6G A;  4PGE A;  3QUL A;  2CII A;  1ED3 A;  2GTW A;  3TVM A;  4L4V A;  1QRN A;  3GMN A;  3VXM A;  1LD9 A;  1QLF A;  1T7W A;  1S7W A;  4U1I A;  1A1M A;  5HGH A;  3D2U A;  3KYN A;  4PJ5 A;  4L9L C;  3GSO A;  1ZHK A;  3P73 A;  4PG2 A;  5HYJ A;  4PG9 A;  4HS3 A;  2CLZ A;  1N5A A;  1ZVS A;  1ZS8 A;  1T1Z A;  2BNR A;  1S8D A;  3L3J A;  2X4P A;  3OXS A;  3FFC A;  4HUX A;  4HUW A;  4I4W A;  3W0W A;  5J6G A;  3TBW A;  2AXG A;  4F7E A;  3FT2 A;  3KXF A;  4PJG A;  3BP4 A;  4WUU A;  1N59 A;  3MGO A;  3DX6 A;  1INQ A;  3CDG A;  3MRL A;  2D31 A;  4PRN A;  3QZW A;  3L3D A;  4Y16 A;  3WS6 A;  1FO0 H;  3FT3 A;  1T1Y A;  4V3E B;  5J1A A;  1UQS A;  4S0U C;  2VE6 A;  3REW A;  4Z78 A;  4L8S C;  1S7Q A;  4UQ3 A;  4Z76 A;  4PV9 A;  5L2K A;  1EEZ A;  5EO1 A;  3SDA A;  4Z77 A;  2FYY A;  3I6L D;  3GSR A;  1I4F A;  4JFD A;  3VXP A;  1FZK A;  4PV8 A;  4E0R A;  1S9Y A;  4HV8 A;  3S6C A;  3DXA A;  3ARB A;  3RGV C;  3FQX A;  1HHI A;  1WBY A;  4WW2 C;  2OL3 H;  5EO0 A;  4E5X A;  1XH3 A;  3HPJ A;  5B38 A;  4MJ6 A;  5BXF A;  1ZT4 A;  1FFP A;  3FQN A;  4N8V A;  5MEO A;  3CVH A;  2PYE A;  4EN3 C;  3D39 A;  3SKO A;  5C07 A;  4CW1 A;  3QI9 A;  4O2E A;  2FO4 A;  3JTS A;  1I7T A;  4JQV A;  3SJV A;  5FA3 A;  3TFK A;  5HHP A;  3GIV A;  1LEK A;  1RK1 A;  3UTQ A;  5DEG A;  3VFN A;  2UWE A;  4EUP A;  1S9X A;  3C9N A;  3ROO A;  3KLA A;  4NQC A;  3RWI A;  3X12 A;  1RJY A;  1AGC A;  5HHN A;  4QRT A;  3GMP A;  4PGB A;  4Y4H A;  1RJZ A;  3LKS A;  4PP8 C;  5H94 A;  5IB5 A;  3UTT A;  3VRI A;  3TF7 A;  4NO5 A;  1EXU A;  5C0J A;  4PRP A;  4JFP A;  1W72 A;  1VAD A;  4GKN A;  3BUY A;  1VGK A;  3PWV A;  3QFD A;  1B0G A;  4FTV A;  3MV9 A;  2YEZ A;  2NX5 A;  4IRJ A;  1B3J A;  4HUV A;  1A9E A;  1E27 A;  1K5N A;  3E3Q A;  3JTT A;  5D7L A;  1M6O A;  5F1N A;  3FT4 A;  4L8B A;  5IB2 A;  5C0E A;  3BEV A;  2HLA A;  2ZSV A;  3BHB A;  2E7L E;  4U1H A;  1T7X A;  3VXN A;  3P77 A;  4PRE A;  3TID A;  2AK4 A;  3QUX A;  3CH1 A;  2BCK A;  2X4R A;  3DX7 A;  3MGT A;  1SYV A;  4CVZ A;  1KPU A;  3BO8 A;  5IB4 A;  4PJH A;  4QOK A;  3TBS A;  3NFN A;  3TBV A;  3U0P A;  3TZV C;  1BZ9 A;  1KJ3 H;  2RFX A;  1T7V A;  1OSZ A; 
#chains in the Genus database with same CATH homology
 1DUZ A;  1KPR A;  2AV1 A;  3LKQ A;  5D7I A;  3GML A;  2ESV A;  3P9L A;  3CPL A;  2C7U A;  1MWA H;  4PGC A;  1IM3 A;  4PJ7 A;  4JQX A;  3SDX A;  1QO3 A;  1YN7 A;  5GSV A;  2J8U A;  3BXN A;  3VFS A;  3PWN A;  5C0G A;  4PRH A;  2XPG A;  3OV6 A;  4HX1 A;  3KPM A;  3KPS A;  3UBX A;  3VFR A;  5MER A;  5L2J A;  3QFJ A;  3D3V A;  4Y4K A;  4O2C A;  3MRQ A;  5MEP A;  1I1A A;  2ZOK A;  5C0F A;  5ACZ A;  3VFP A;  4N0F A;  4U6X A;  3P9M A;  5IB1 A;  3MRO A;  4ONO A;  3KPL A;  4ZUT A;  1S7V A;  3FOM A;  4PJB A;  3CC5 A;  1QSE A;  3TBT A;  3BP7 A;  5HGD A;  4NO3 A;  1YDP A;  3X14 A;  1AKJ A;  3AM8 A;  3P4M A;  3MV8 A;  1AO7 A;  1Z5L A;  4ZUS A;  5FA4 A;  4U6Y A;  3DMM A;  1AGE A;  1TVH A;  2CKB H;  1A1N A;  3HE6 A;  4F7C A;  1ZT1 A;  3FOL A;  1S7U A;  1I1F A;  4X6F A;  3ROL A;  2X4N A;  3LN5 A;  1Q94 A;  1L8J A;  1P1Z A;  4HUU A;  1LQV A;  1S9W A;  4G43 A;  4PJE A;  1KCG C;  1QR1 A;  4WWK C;  3V5H A;  4WU5 A;  4U1M A;  2GIT A;  4K71 B;  1KPV A;  3I6K A;  3SKM A;  3TPU E;  1DUY A;  1KJV A;  2FIK A;  2F74 A;  3OX8 A;  3TN0 A;  3RWH A;  4L4T A;  2GJ6 A;  2YPK A;  3ILQ C;  4CVX A;  1T7Y A;  1XR9 A;  4L29 A;  5FKP A;  2F54 A;  1R3H A;  3BZF A;  5E6I C;  3LN4 A;  5EFI A;  1S7S A;  2WY3 A;  3TA3 A;  5FDW A;  3L3K A;  1OGT A;  2NW3 A;  3T1F A;  3SDD A;  3LKR A;  3OXR A;  1ZAG A;  4APQ A;  2AXF A;  4V3D B;  1S7X A;  3MRR A;  3CCH A;  2BVO A;  2GAZ A;  2MHA A;  4U1S A;  3ERY A;  3VFT A;  3BGM A;  4JFQ A;  1NEZ A;  1XR8 A;  5C08 A;  3TIE A;  3W39 A;  1HHG A;  4F7T A;  5IEH A;  3C8K A;  4ELM A;  5ENW A;  1P4L A;  1WBX A;  2VLL A;  1A9B A;  5AD0 A;  3PWJ A;  5B39 A;  3FQW A;  1AGF A;  3GSX A;  3MRM A;  3D18 A;  3KYO A;  4U1K A;  3WLB A;  3GMO A;  3VCL A;  5D2N A;  5IM7 A;  4LCC C;  4MVB A;  4MX7 A;  3GSU A;  5IEK A;  3DX8 A;  3E2H A;  1JPG A;  3VWJ A;  4L8D A;  4PJX A;  4D0B A;  1RK0 A;  1T7Z A;  3LKO A;  4G8I A;  3VWK A;  5E8O A;  3VXO A;  1HSB A;  3QUY A;  4X6C A;  1JUF A;  1T1X A;  1QVO A;  3B3I A;  5IVX A;  1VAC A;  5C0I A;  2VAA A;  3MRJ A;  3RZC A;  4L8C A;  3MA7 A;  4HKJ A;  1T80 A;  3ARE A;  4PRD A;  1QQD A;  5E8N A;  3TO2 A;  1JE6 A;  3LKP A;  3IT8 D;  4ZUU A;  1ONQ A;  3FTG A;  1JHT A;  2YPL A;  1GZQ A;  4QRS A;  1I7R A;  3BW9 A;  3PQY A;  1MHE A;  3X13 A;  4HWZ A;  4PJF A;  4PJC A;  4PJI A;  4QRR A;  3VXU A;  4UQ2 A;  2VLR A;  3VFV A;  3MRF A;  4ZUW A;  1DE4 A;  1IM9 A;  1HYR C;  2HN7 A;  4I48 A;  4ZUV A;  2CIK A;  3PWP A;  4MJ5 A;  1EEY A;  3MYJ A;  3O3D A;  4JFO A;  1CG9 A;  1C16 A;  1TMC A;  4NQD A;  3MRP A;  2BVQ A;  4D0C A;  3CZF A;  4QRU A;  1WBZ A;  4NQX A;  1FZJ A;  5J6H A;  4MS8 A;  4N5E A;  1A6Z A;  3UPR A;  4EI5 A;  5E00 A;  3ILP A;  5D9S A;  3MRD A;  3O9W A;  2ZOL A;  1EFX A;  3MR9 A;  4GKS A;  5C0C A;  3L9R A;  4L3E A;  3GMQ A;  4JFE A;  4G59 A;  1QSF A;  2H6P A;  5EU4 A;  3UTS A;  3KPR A;  3G08 A;  5EU6 A;  3QUK A;  4LNR A;  3RWD A;  1KJ2 H;  1UXW A;  2F53 A;  5E9D A;  2P5W A;  1AGD A;  5ISZ A;  3VJ6 A;  1CE6 A;  1KBG H;  3PWU A;  3FQT A;  4PRI A;  4U1J A;  5F1I A;  3V5K A;  1TVB A;  3VFW A;  3VXS A;  2BSS A;  3QDJ A;  1N3N A;  5C0B A;  5D7J C;  5D5M A;  4G9D A;  2AV7 A;  2V2X A;  3SPV A;  3L3H A;  5INC A;  1ZT7 A;  3E6F A;  3GSN H;  3KWW A;  4NO0 A;  3FQR A;  1FFO A;  4O2F A;  4U1N A;  3SDC A;  5EUO A;  5EU5 A;  5HGB A;  1OF2 A;  3JTC A;  4NQE A;  5SWQ A;  1DDH A;  2BVP A;  3FQU A;  3RWG A;  5IB3 A;  3MRB A;  3BZE A;  5C0A A;  3SCM A;  1SYS A;  3HG1 A;  4NNX A;  3MRN A;  4LHU A;  4MNQ A;  5C0D A;  3TBY A;  1NAN H;  3MRH A;  3RL2 A;  1HHH A;  5C09 A;  3ARF A;  4G8G A;  4G42 A;  1BQH A;  1X7Q A;  4L3C A;  4F7P A;  3O8X A;  4PJ9 A;  3VXR A;  1MHC A;  1KJM A;  3BWA A;  1B0R A;  1T20 A;  1I7U A;  3O3E A;  4N0C A;  2HJK A;  3ES6 A;  5E8P A;  5MEQ A;  2H26 A;  4IHO A;  1T1W A;  3BH8 A;  4IIQ C;  1N2R A;  4MNG A;  4PGD A;  4G9F A;  4IRS A;  3RWE A;  4WDI A;  1OGA A;  4N0U A;  3QDG A;  4QRQ A;  3RWJ A;  5C9J A;  3LKN A;  1G6R H;  5JHD A;  3KPN A;  4XXC A;  3B6S A;  5F9J A;  3P4O A;  4JRX A;  2FZ3 A;  1HHJ A;  3M1B A;  3O3B A;  2X4U A;  1BII A;  1ZSD A;  4Y2D A;  1T22 A;  1E28 A;  1CD1 A;  4PJ8 A;  3TO4 A;  3MRC A;  3O4L A;  3QQ4 A;  3VFU A;  4PR5 A;  3VFO A;  1GZP A;  3H7B A;  1NAM H;  4QRP A;  5DDH A;  1A1O A;  3QQ3 A;  3X11 A;  3RTQ A;  3GSW A;  3MV7 A;  2DYP A;  3GMM A;  3D25 A;  2PO6 A;  4MQ7 A;  1JGD A;  3KPO A;  4NHU E;  5MEN A;  2BSR A;  4LCW A;  5IRO A;  4GUP A;  1YPZ A;  2VLK A;  3MRG A;  3O3A A;  3DBX A;  4D0D A;  2GTZ A;  3VRJ A;  2GT9 A;  2CLR A;  1BD2 A;  1U58 A;  2GUO A;  5D2L A;  5BS0 A;  4PJA A;  1JPF A;  2X4T A;  1S7R A;  3FRU A;  3TJH A;  4PJD A;  3GMR A;  1JFM A;  4NSK A;  4PDC E;  5HHQ A;  2X70 A;  4X6E A;  2JCC A;  3RUG A;  3WL9 A;  5SWZ A;  5EOT A;  5HHM A;  2A83 A;  1MI5 A;  4NT6 A;  3GJF A;  1LEG A;  2OI9 A;  2VLJ A;  3GSQ A;  3H9H A;  4WU7 A;  4K7F A;  3LV3 A;  2BNQ A;  1FZM A;  1XZ0 A;  2XFX A;  5IND A;  4PRA A;  4X6D A;  3RWF A;  1W0W A;  4Y4F A;  1G7Q A;  5HGA A;  1FG2 A;  4NO2 A;  3HLA A;  3MRI A;  1HOC A;  3AU1 A;  1AGB A;  3GSV A;  2BST A;  3MRE A;  1P7Q A;  1PQZ A;  4MXQ A;  3L3G A;  3DTX A;  4ZFZ A;  1JF1 A;  3ARD A;  3ARG A;  2P5E A;  1HHK A;  2ZSW A;  3BH9 A;  3KPP A;  4LCY A;  4PRB A;  4WJ5 A;  3T8X A;  1I1Y A;  1FZO A;  3P4N A;  3PAB A;  5GSR A;  3BVN A;  1K8D A;  1KTL A;  2VAB A;  2FWO A;  4U1L A;  2X4O A;  3KPQ A;  1LP9 A;  3M17 A;  5EU3 A;  3JVG A;  4WO4 A;  3VFM A;  3ECB A;  2HJL A;  1UXS A;  1ZHN A;  4NNY A;  2AKR A;  4MJI A;  2V2W A;  1G7P A;  3IXA A;  3QDM A;  4JFF A;  1T21 A;  1W0V A;  3MRK A;  5SWS A;  1HSA A;  5HHO A;  1YN6 A;  3HCV A;  4FFE X;  4NQV A;  5F7D A;  3WS3 A;  3QEQ A;  3H9S A;  2X4Q A;  3WUW A;  3HE7 A;  1LK2 A;  4JRY A;  3RL1 A;  2Q7Y A;  3BEW A;  5BJT A;  3L3I A;  3RWC A;  2CLV A;  1ZHB A;  3HUJ A;  3HAE A;  3QUZ A;  5DEF A;  5BRZ A;  1JGE A;  3FON A;  3E6H A;  1T0N A;  3VH8 A;  1ZHL A;  1FFN A;  1M05 A;  4ZAK A;  1QEW A;  2X4S A;  3V5D A;  4F7M A;  3PWL A;  1T0M A;  1LDP H;  1S7T A;  3I6G A;  4PGE A;  3QUL A;  2CII A;  1ED3 A;  2GTW A;  3TVM A;  4L4V A;  1QRN A;  3GMN A;  3VXM A;  1LD9 A;  1QLF A;  1T7W A;  1S7W A;  4U1I A;  1A1M A;  5HGH A;  3D2U A;  3KYN A;  4PJ5 A;  4L9L C;  3GSO A;  1ZHK A;  3P73 A;  4PG2 A;  5HYJ A;  4PG9 A;  4HS3 A;  2CLZ A;  1N5A A;  1ZVS A;  1ZS8 A;  1T1Z A;  2BNR A;  1S8D A;  3L3J A;  2X4P A;  3OXS A;  3FFC A;  4HUX A;  4HUW A;  4I4W A;  3W0W A;  5J6G A;  3TBW A;  2AXG A;  4F7E A;  3FT2 A;  3KXF A;  4PJG A;  3BP4 A;  4WUU A;  1N59 A;  3MGO A;  3DX6 A;  1INQ A;  3CDG A;  3MRL A;  2D31 A;  4PRN A;  3QZW A;  3L3D A;  4Y16 A;  3WS6 A;  1FO0 H;  3FT3 A;  1T1Y A;  4V3E B;  5J1A A;  1UQS A;  4S0U C;  2VE6 A;  3REW A;  4Z78 A;  4L8S C;  1S7Q A;  4UQ3 A;  4Z76 A;  4PV9 A;  5L2K A;  1EEZ A;  5EO1 A;  3SDA A;  4Z77 A;  2FYY A;  3I6L D;  3GSR A;  1I4F A;  4JFD A;  3VXP A;  1FZK A;  4PV8 A;  4E0R A;  1S9Y A;  4HV8 A;  3S6C A;  3DXA A;  3ARB A;  3RGV C;  3FQX A;  1HHI A;  1WBY A;  4WW2 C;  2OL3 H;  5EO0 A;  4E5X A;  1XH3 A;  3HPJ A;  5B38 A;  4MJ6 A;  5BXF A;  1ZT4 A;  1FFP A;  3FQN A;  4N8V A;  5MEO A;  3CVH A;  2PYE A;  4EN3 C;  3D39 A;  3SKO A;  5C07 A;  4CW1 A;  3QI9 A;  4O2E A;  2FO4 A;  3JTS A;  1I7T A;  4JQV A;  3SJV A;  5FA3 A;  3TFK A;  5HHP A;  3GIV A;  1LEK A;  1RK1 A;  3UTQ A;  5DEG A;  3VFN A;  2UWE A;  4EUP A;  1S9X A;  3C9N A;  3ROO A;  3KLA A;  4NQC A;  3RWI A;  3X12 A;  1RJY A;  1AGC A;  5HHN A;  4QRT A;  3GMP A;  4PGB A;  4Y4H A;  1RJZ A;  3LKS A;  4PP8 C;  5H94 A;  5IB5 A;  3UTT A;  3VRI A;  3TF7 A;  4NO5 A;  1EXU A;  5C0J A;  4PRP A;  4JFP A;  1W72 A;  1VAD A;  4GKN A;  3BUY A;  1VGK A;  3PWV A;  3QFD A;  1B0G A;  4FTV A;  3MV9 A;  2YEZ A;  2NX5 A;  4IRJ A;  1B3J A;  4HUV A;  1A9E A;  1E27 A;  1K5N A;  3E3Q A;  3JTT A;  5D7L A;  1M6O A;  5F1N A;  3FT4 A;  4L8B A;  5IB2 A;  5C0E A;  3BEV A;  2HLA A;  2ZSV A;  3BHB A;  2E7L E;  4U1H A;  1T7X A;  3VXN A;  3P77 A;  4PRE A;  3TID A;  2AK4 A;  3QUX A;  3CH1 A;  2BCK A;  2X4R A;  3DX7 A;  3MGT A;  1SYV A;  4CVZ A;  1KPU A;  3BO8 A;  5IB4 A;  4PJH A;  4QOK A;  3TBS A;  3NFN A;  3TBV A;  3U0P A;  3TZV C;  1BZ9 A;  1KJ3 H;  2RFX A;  1T7V A;  1OSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...