3TK0A

Mutation of sfalr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
126
structure length
126
Chain Sequence
SMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPSEECAEDLRKRLARNHPDTRTRAAFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-linked sulfhydryl oxidase ALR
publication title sfALR mutation
rcsb
source organism Homo sapiens
molecule tags Flavoprotein
total genus 46
structure length 126
sequence length 126
ec nomenclature ec 1.8.3.2: Thiol oxidase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04777 Evr1_Alr Erv1 / Alr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.310 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) ERV/ALR sulfhydryl oxidase domain 3tk0A01
1OQCA 3GWLA 3TD7A 3U5SA 3TK0A 4E0IA 2HJ3A 3LLKA 3W4YA 3GWNA 3R7CA 4E0HA 3O55A 3LLIA 1JR8A 3MBGA 1JRAA 3U2LA 4LDKA 3U2MA
chains in the Genus database with same CATH superfamily
3C8GD 2R7OA 3UR3C 1LS1A 4HFFB 5JLIA 1ST6A 3L1MA 3JSEO 2GWWA 4HFKB 4K0DA 1BR1A 2R7WA 1YAUO 1LIHA 1XZPA 4AK9A 3JCUQ 1QPUA 3C8GA 3QW1A 4PFPA 1OCRC 5FCLA 4EKWA 2D5RB 4PJJA 4J30B 5KYWA 1FR0A 3PDMP 4A4AA 1VMAA 3LNMB 1BDJB 4JVSA 1ZYRF 1ZU4A 4JW1A 3K7DA 4GYTA 4CJOA 3SYNA 4J7YA 5KYXB 2BC5A 2LFDA 4YT8A 4E0HA 2IM8A 4KNWA 1C02A 1I5NA 2ETSA 2NUTB 2YZSA 3HTKC 3JYYA 3UMIA 4DRHB 4EIYA 4DBQA 1Y4CA 3CQZA 3U2LA 3AQBA 1YVIA 2QLAA 4C3EA 4Z9HA 2H7OA 4BJ6C 4E7ZA 2DB4A 3K66A 3ASNC 2HMZA 3DAGA 3M4BA 4MS2A 2VCCA 3VRCA 3U5SA 5KYXA 3LJBA 3JYHA 1Y6DA 1R5ID 2HJ3A 4IWBA 2D4UA 3JT1A 3Q7GA 2V26A 2NUTA 3RF3A 4BJ5A 3IQ5A 1L7CA 4G7OF 2LFFA 2QUPA 1A0BA 1DOVA 3GWNA 3UNGC 4CIPA 2A6EF 1NLXA 2MHRA 5AC4A 4CSAC 2YLIA 2KW3C 5B3IA 3HNKA 2VCAA 4HE8D 3W2WA 3L34A 4CS9C 2YVKA 3ZC4A 1E84A 5KYNA 4MVZA 5JUAA 1D0YA 2HSBA 3ATPA 4QI0A 4W8KA 4C3DA 4DRIB 4ANJA 5F5FA 2R7RA 1MNDA 2ZXWC 2ZXOA 3T6JA 1OQCA 5DS6A 1NG1A 3RW0A 2OJED 3RQFA 3EZHA 2XL6A 3DI5A 4WABA 3ZTMA 3G50A 3FAJA 2DI3A 2Y3GA 4XTKA 2YWAA 3DE9A 4E0IA 2XRHA 2CGEA 2HJMA 2IXMA 5KYUA 3V5ZA 3B71A 3W8IA 4JIOA 1JAFA 2Q9BA 1WASA 3UGOA 2A69F 1W2WA 1OCCC 4O7GA 1SYQA 2ZXRA 5DVWA 1RKCA 4PJNA 3IQCA 4IGGA 3ABKC 4U5HA 3POVA 3HNLA 2P0NA 3EHNA 5EGYA 1M56C 1RJ9A 3MYFA 4M63A 2YEVA 2J8WA 3ECSA 2ZPAA 1TKNA 4OIRF 2KC3A 2NUPB 3NYLA 3N0TA 5DQTA 1OCOC 3ZTZA 1ORJA 1M6TA 1SR2A 1NZEA 4LLCA 1LM3B 3S84A 3GWLA 3GM2A 4YL0A 1VLTA 4OIPF 1YA7O 1HMOA 2G3VA 1SF8A 3GANA 3V7OA 2W45A 3EG9B 3TQOA 5DS4A 4ZLCA 1D0XA 3HNIA 2EIKC 3MX3A 1YLMA 2Y3BA 2MYSA 2NUPA 5JVEA 1VTMP 1C17M 4LERA 3GODA 3I5PA 3K33A 3DAFA 4PACA 2J9BA 3ZQYA 3QW0A 4DVYP 4DRJB 2I15A 1LI5A 2PNOA 1HW2A 1T6QA 2R7TA 1MMAA 1JR8A 3MBGA 1FMVA 4ULVA 3EG9A 4O6NA 2A0BA 4E7SA 2CCYA 2Y39A 2J46A 2L9JA 2NSFA 3GORA 4IRUA 4XWJA 3KPHA 2X0CA 2NPUA 4JC7A 4YJWA 3WODF 4L6RA 1H9TA 1A41A 1AUEA 4U5DE 2EPLX 3T6GB 4DJ9A 4CBEA 1A7VA 3O39A 4MW3A 4BEMJ 2WZLA 1EQ1A 1JPNA 4U5CE 3S28A 4CDVA 1FFTC 2AU5A 2Y69C 3NYMA 1CPRA 5KYYB 3ZVRA 2ICWG 4K1OA 3OWTA 4IAOA 3U3BA 3AOUA 1VB5A 4DVZA 2KGOA 3A9CA 3TJ5A 4Q5SF 4I44A 1H9GA 4NCQA 1H7IA 1QKRA 4OD4A 2XLHA 3GM1A 4JCHA 4MVQA 1OW7A 4H54A 3M1CB 2XM4A 3KYIA 1PCXA 3HNJA 3LLIA 4C7OB 4QI2A 2PP4A 3EFOA 1Z23A 1VOMA 3DJNB 4B6IA 4MVMA 2HKVA 5GPGB 1TFKB 4CS8A 2G3KA 1J8YF 3ASOC 4KI2A 5A6JA 3F47A 2ZD9A 2NG1A 3RYLA 3TOLA 3A11A 1T01A 2J45A 3MYIA 1BR2A 5L0JA 4HEAJ 1B68A 5T1DB 4EBJA 1U0BB 1GS9A 1EI7A 2L6GA 3KYJA 2Q3TA 4YK5A 4U5FE 3US6A 2R7VA 1BBHA 4OIQF 1N1CA 1JPJA 3ZSUA 1SMYF 4AX2A 4YT4A 5K0IA 2YKZA 2XXAB 3W2VA 1ZHTA 2LSEA 2QE9A 3I4UA 3U9JA 4NC3A 4DBRA 2E87A 1Q0MA 3OA1A 1NFOA 2GA0A 3S9OA 3SXKA 1O87A 4MTFA 2AWYA 3K6BA 4CDAA 2VC9A 1U89A 2IOQA 4XEVA 4IB4A 1LPEA 3K1IC 2GDCA 2TMVP 3JZ0A 1U6HA 3ZIBA 4EUKB 3B0UX 2XSEA 2P61A 2KJGA 2EPMX 2FFHA 3LUTB 3DM9B 1ZHWA 5B1AC 3QMKA 4CJGA 2PBEA 5B1BC 5A6KA 3T9OA 3S90A 5JS5A 4LLEA 1YYJA 4CIHA 1S05A 1RKEB 2P7VA 3KMIA 3EH2A 3W4YA 2VASA 3BRJA 3N2ZB 4PR9A 2W9YA 1F1MA 3RIPA 1JOGA 4ULWA 2P6VA 3JTLO 1Z6AA 3O6XA 1H6GA 3GEIA 1K04A 2WB7A 3DD7A 2J7PD 2EPNA 2AVKA 2R02A 4BG0A 3TULA 2DGJA 4CS7A 4YT5A 3C62A 5TJ5E 5EHHA 3AGUA 4EBKA 1ZW3A 2YL7A 2IXNA 1D1BA 3L0IA 2EPOA 2J7PA 5CI8A 1RKEA 1V55C 2EPKX 2PFDA 1DOWA 4AL0A 3HJCA 4ONSA 3NKEA 2G62A 2M4EA 1CGNA 5COGA 1K40A 3C7JA 4JTDB 3G4XA 3RQEA 1HY5A 3L8JA 3QZCA 3S27A 1YDIA 4I1MA 3SEOA 1LVKA 1ZHYA 1YJGA 4JZAA 1G4US 2VH3A 1ZZPA 3ITFA 3AQCA 2W4MA 1OKKD 2A68F 1YARO 5COFA 1RMVA 2R7XA 2XS1A 4YL1A 1E2XA 1TWAA 4CS8C 4JTCB 2VCBA 2HS5A 2PX0A 3M79A 1WN0A 1CGME 3VM6A 1QZXA 1T9KA 3NMKA 4J7TA 4BPMA 4E17A 2R7SA 1OKKA 3EH1A 3H65A 3IEEA 3JSZA 2J0WA 1PD0A 1RCPA 5DQZA 3PCVA 4AL1A 2R05A 2WZFA 2CW0F 2J0XA 1I4ZA 3LEOA 4Z9IA 5L0CA 4DOZA 1VYIA 3TK0A 1GQAA 2H7BA 3GEEA 5IY5C 1BZ4A 1ORYA 2FAPB 3RQGA 1WATA 3J06A 2R7QA 4NTFA 4D4NA 3GEHA 3DJUB 3L8IA 2Q9AA 2YLGA 3R7CA 4K7BA 2CYDA 4NTBA 3U9MA 3V5YA 3EGXB 4NTAA 2XLDA 5FZTA 4FX5A 1HE9A 2Q9CA 2B0HA 3O55A 1OW8A 2HSQA 1EA8A 4OINF 2Q7RA 2HZ8A 2I8BA 2HV6A 2XLOA 2KYHA 3X2QC 1T6IA 4E18A 1J8MF 3B0VC 3UGPA 1KU2A 2W4BA 4O6YA 1LE4A 4XEFA 4MNDA 5BQIA 1CGOA 1QQ3A 4BJ5C 2KSFA 1D1CA 2XM0A 4N6HA 4N4WA 2J9UA 5CIVA 4JKVA 4NY3A 2PX3A 1V54C 1ZHXA 3EGXA 2KQ9A 1VK5A 4Z9JA 4G78A 4YT2A 1O3UA 2YL3A 2A1DD 1V74B 3V5XA 2UUIA 3RH3A 5E3AA 3R2PA 2M64A 2XLWA 3KKBA 5L3VA 4KC9A 3RFYA 2J9VA 5L0FA 5A6BD 2YLDA 1SZIA 4PK4A 1ZW2A 4QDLA 2UUHA 4MW8A 4X0RA 3SXZA 2XXAA 1M57C 1WGWA 4JJGA 1Z63A 1VYKA 2AP3A 2DYRC 3K1HA 5A6BA 1MMDA 1OXBA 2HV7A 4YL3A 3U0CA 5KYYA 2YL1A 4J32B 4MVUA 4BJ1A 4JTAB 256BA 1Z3IX 2JD3A 1TQGA 1Q0KA 5BUOA 4LDQA 2A0UA 4D4XA 2DYSC 3S29A 3SP1A 3T4RA 4JEBA 3NKDA 2OJQA 1L3PA 1APCA 1MMGA 3Q7LA 4JURI 3RKOF 2Z15A 3T6BA 1K05A 1IW7F 1OCZC 2L6HA 3FDQA 1O5HA 1TWCA 5T3TA 4I3MA 3RVYA 4ER9A 4C7OA 1YZCA 5L0GA 3KL4A 4RBNA 3AGTA 1QVXA 1TWHA 2HUJA 3EZIA 3LEVA 3FXHA 4R32A 1XZQA 3E9VA 3KH2A 4WGYA 4O6MA 4C3BA 1C03A 3DWWA 2WVOA 4N6CA 5L0HA 1Q0FA 3HLZA 3LNRA 1V4AA 2QY9A 4WGZA 3C18A 3UMKA 2NSGA 2MWQA 3AG1C 4MTOA 3M4CA 3B29A 3C8ZA 3NDBB 5E33A 2GAQA 3MLGA 3AG3C 1IZMA 3AJMA 2OOCA 3CEXA 2QNLA 2CDQA 2QTVA 3Q6NA 4FWVA 3ABLC 2CNWD 4P9TA 1BR4A 4PJMA 4RD9A 4F4BA 5JT4A 4RDAA 1GGQA 5E3CA 5BQHA 3EGDB 4EBBA 1MNEA 1S7ZA 1JMWA 1FMWA 2WZGA 3EJNA 3FOPA 4P6IC 2CNWA 1WTYA 1NFNA 3FOOA 3IQTA 2A6HF 3QTHA 1LS4A 4XLPF 2HFIA 3NMIA 5BQGA 2LCHA 3M15A 4MVOA 4O79A 4P9FA 3AG4C 5F5HA 2L7AA 4FAPB 2B0JA 3NMJA 1PV3A 2FGYA 3TJ6A 2LQGA 4Q4ZF 2YRFA 2XLVA 2Y3DA 3E70C 4DXWA 2IYLD 1NBBA 4KBLA 4LDKA 2F22A 1TFOB 1QSPA 1G4WR 3JRMO 3EGDA 3O10A 4IARA 1E83A 2AWCA 2RSEB 2ASRA 2VB6A 3LESA 4JJFA 4U5EE 5D92A 5L3QA 2KNHA 1R4TA 1Z5ZA 3VAYA 3DE8A 4BJTA 4CX9A 3S0XA 1EKYA 3OEOA 4G7ZF 2LP4A 1E86A 1LI7A 3ABMC 4ZLDA 2HMQA 3DKAA 3HKKA 5D91A 1A7DA 3LS1A 4G0HA 1T6UA 1T5OA 3EHMA 3I5QA 4MTGA 2X51A 1GM5A 5COMA 5KYUB 3FVYA 4XEKA 2JPUA 2XL4A 3BEHA 1MMNA 3IPMO 3PMRA 4N06A 4G7HF 2KK1A 4BEJA 1D0ZA 4U9DA 5EK0A 3DM5A 1Q0DA 4XPWA 3X1OA 1YA9A 4GEHA 3RVZA 4MQ9F 3U2MA 4OIOF 1RJ9B 4YWQA 5E2QA 4CDYA 2IXOA 2LIGA 2L6FA 3QVZA 5DS5A 2V3CC 3B0PA 3VYWA 2EIJC 3WHNA 1E85A 1RXQA 3DMDA 3WG7C 1ZU5A 2OG2A 4NQFA 4JCZA 4A2NB 5A69A 5L0IA 1FNTc 4JEAA 4Q7CA 3U3FA 1G8XA 3FMSA 4XPYA 1D1AA 3C63A 3CAXA 3W8HA 2R7UA 4U5GA 2YL0A 3NG1A 4EHPA 3QVYA 1M2VB 2H7VC 3U8PA 2OKUA 4IAQA 2BE5F 2OCCC 2O9XA 2OU6A 3DXJF 2IXPA 3ZWIA 3SXYA 4PJLA 3F46A 2Q00A 2EIMC 1HE1A 4XLNF 3N24A 2LD6A 3ZQVA 1HMDA 2L81A 3ZDLA 1JRAA 4U9EA 2H8AA 2ZXPA 2WVNA 4PFOA 4W8PA 1WWPA 2IBFA 3U8VA 4I1OB 2J9WA 2BL2A 1Q0GA 2Q4FA 3EPVA 1M2VA 1OW6A 1KTMA 1CPQA 1VLSA 3WAQA 3MFNA 1OR2A 4XQ1A 4LACB 2LK4A 1WOLA 3K1IA 2PF4E 4H4KC 3LLKA 2GFHA 2OEVA 2R25A 3Q6MA 3TOMA 4BJ6A 3PHF2 1ZVZA 5HSWA 1QLEC 2R9RB 1ORSC 2OQMA 5A6AA 1HW1A 3FHDA 4KNVA 3GM3A 1NSGB 1NU9C 1AVOB 1FFHA 2JX0A 3H2UA 5JP7A 2RD9A 1UG7A 3IQ6A 2P1AA 3NRHA 4U5BE 2XL8A 4MVSA 3VF0A 4AE4B 5L0DA 1G5ZA 3B9QA 4MVRA 1KNYA 3AG2C 4FESA 3SZRA 3LAYA 3SNHA 3SXMA 4CSAA 4CS9A 3IHUA 3TD7A 1UFBA 2XS8A 5DLJA 2C04A 3EFOB 1LKXA 3G4ZA 2EINC 4LDRA 5HV9A 2OEXA 1YZAA 4JRZA 1M2OA 1I4YA 1PD1A 2WL8A 3CZ6A 5B3SC 1A7EA 3H2VA 4WJ0A 1LE2A 3LS0A 2R03A 4UDVA 1FTSA 1ZHZA 1Z7Qc 4AE4A 1AEPA 1TR2A 1YYXA 5T3WA 4EWCA 5AC5A 2EILC 4JE9A 5F28E 2Y3HA 3FAPB 4YN0B 5JSLA 1TWGA 3C8GB 3JRTA 2WVQA 1OR3A 5JRAA 3CSKA 3NYJA 1MQVA 2XLMA 5KYWB 3DZAA 2XLEA 1OXKA 3EQLF 3UMHA 1XWJA 5AGFA 2YHSA 1FAPB 2YQYA 4XPXA 4GQHA 1NU7D 4IJJA 4OD5A 5CI9A 3ZG1A 2C03A
chains in the Genus database with same CATH topology
1OQCA 3GWLA 3TD7A 3U5SA 3TK0A 4E0IA 2HJ3A 3LLKA 3W4YA 3GWNA 3R7CA 4E0HA 3O55A 3LLIA 1JR8A 3MBGA 1JRAA 3U2LA 4LDKA 3U2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQC A;  3GWL A;  3TD7 A;  3U5S A;  3TK0 A;  4E0I A;  2HJ3 A;  3LLK A;  3W4Y A;  3GWN A;  3R7C A;  4E0H A;  3O55 A;  3LLI A;  1JR8 A;  3MBG A;  1JRA A;  3U2L A;  4LDK A;  3U2M A; 
#chains in the Genus database with same CATH topology
 3C8G D;  2R7O A;  3UR3 C;  1LS1 A;  4HFF B;  5JLI A;  1ST6 A;  3L1M A;  3JSE O;  2GWW A;  4HFK B;  4K0D A;  1BR1 A;  2R7W A;  1YAU O;  1LIH A;  1XZP A;  4AK9 A;  3JCU Q;  1QPU A;  3C8G A;  3QW1 A;  4PFP A;  1OCR C;  5FCL A;  4EKW A;  2D5R B;  4PJJ A;  4J30 B;  5KYW A;  1FR0 A;  3PDM P;  4A4A A;  1VMA A;  3LNM B;  1BDJ B;  4JVS A;  1ZYR F;  1ZU4 A;  4JW1 A;  3K7D A;  4GYT A;  4CJO A;  3SYN A;  4J7Y A;  5KYX B;  2BC5 A;  2LFD A;  4YT8 A;  4E0H A;  2IM8 A;  4KNW A;  1C02 A;  1I5N A;  2ETS A;  2NUT B;  2YZS A;  3HTK C;  3JYY A;  3UMI A;  4DRH B;  4EIY A;  4DBQ A;  1Y4C A;  3CQZ A;  3U2L A;  3AQB A;  1YVI A;  2QLA A;  4C3E A;  4Z9H A;  2H7O A;  4BJ6 C;  4E7Z A;  2DB4 A;  3K66 A;  3ASN C;  2HMZ A;  3DAG A;  3M4B A;  4MS2 A;  2VCC A;  3VRC A;  3U5S A;  5KYX A;  3LJB A;  3JYH A;  1Y6D A;  1R5I D;  2HJ3 A;  4IWB A;  2D4U A;  3JT1 A;  3Q7G A;  2V26 A;  2NUT A;  3RF3 A;  4BJ5 A;  3IQ5 A;  1L7C A;  4G7O F;  2LFF A;  2QUP A;  1A0B A;  1DOV A;  3GWN A;  3UNG C;  4CIP A;  2A6E F;  1NLX A;  2MHR A;  5AC4 A;  4CSA C;  2YLI A;  2KW3 C;  5B3I A;  3HNK A;  2VCA A;  4HE8 D;  3W2W A;  3L34 A;  4CS9 C;  2YVK A;  3ZC4 A;  1E84 A;  5KYN A;  4MVZ A;  5JUA A;  1D0Y A;  2HSB A;  3ATP A;  4QI0 A;  4W8K A;  4C3D A;  4DRI B;  4ANJ A;  5F5F A;  2R7R A;  1MND A;  2ZXW C;  2ZXO A;  3T6J A;  1OQC A;  5DS6 A;  1NG1 A;  3RW0 A;  2OJE D;  3RQF A;  3EZH A;  2XL6 A;  3DI5 A;  4WAB A;  3ZTM A;  3G50 A;  3FAJ A;  2DI3 A;  2Y3G A;  4XTK A;  2YWA A;  3DE9 A;  4E0I A;  2XRH A;  2CGE A;  2HJM A;  2IXM A;  5KYU A;  3V5Z A;  3B71 A;  3W8I A;  4JIO A;  1JAF A;  2Q9B A;  1WAS A;  3UGO A;  2A69 F;  1W2W A;  1OCC C;  4O7G A;  1SYQ A;  2ZXR A;  5DVW A;  1RKC A;  4PJN A;  3IQC A;  4IGG A;  3ABK C;  4U5H A;  3POV A;  3HNL A;  2P0N A;  3EHN A;  5EGY A;  1M56 C;  1RJ9 A;  3MYF A;  4M63 A;  2YEV A;  2J8W A;  3ECS A;  2ZPA A;  1TKN A;  4OIR F;  2KC3 A;  2NUP B;  3NYL A;  3N0T A;  5DQT A;  1OCO C;  3ZTZ A;  1ORJ A;  1M6T A;  1SR2 A;  1NZE A;  4LLC A;  1LM3 B;  3S84 A;  3GWL A;  3GM2 A;  4YL0 A;  1VLT A;  4OIP F;  1YA7 O;  1HMO A;  2G3V A;  1SF8 A;  3GAN A;  3V7O A;  2W45 A;  3EG9 B;  3TQO A;  5DS4 A;  4ZLC A;  1D0X A;  3HNI A;  2EIK C;  3MX3 A;  1YLM A;  2Y3B A;  2MYS A;  2NUP A;  5JVE A;  1VTM P;  1C17 M;  4LER A;  3GOD A;  3I5P A;  3K33 A;  3DAF A;  4PAC A;  2J9B A;  3ZQY A;  3QW0 A;  4DVY P;  4DRJ B;  2I15 A;  1LI5 A;  2PNO A;  1HW2 A;  1T6Q A;  2R7T A;  1MMA A;  1JR8 A;  3MBG A;  1FMV A;  4ULV A;  3EG9 A;  4O6N A;  2A0B A;  4E7S A;  2CCY A;  2Y39 A;  2J46 A;  2L9J A;  2NSF A;  3GOR A;  4IRU A;  4XWJ A;  3KPH A;  2X0C A;  2NPU A;  4JC7 A;  4YJW A;  3WOD F;  4L6R A;  1H9T A;  1A41 A;  1AUE A;  4U5D E;  2EPL X;  3T6G B;  4DJ9 A;  4CBE A;  1A7V A;  3O39 A;  4MW3 A;  4BEM J;  2WZL A;  1EQ1 A;  1JPN A;  4U5C E;  3S28 A;  4CDV A;  1FFT C;  2AU5 A;  2Y69 C;  3NYM A;  1CPR A;  5KYY B;  3ZVR A;  2ICW G;  4K1O A;  3OWT A;  4IAO A;  3U3B A;  3AOU A;  1VB5 A;  4DVZ A;  2KGO A;  3A9C A;  3TJ5 A;  4Q5S F;  4I44 A;  1H9G A;  4NCQ A;  1H7I A;  1QKR A;  4OD4 A;  2XLH A;  3GM1 A;  4JCH A;  4MVQ A;  1OW7 A;  4H54 A;  3M1C B;  2XM4 A;  3KYI A;  1PCX A;  3HNJ A;  3LLI A;  4C7O B;  4QI2 A;  2PP4 A;  3EFO A;  1Z23 A;  1VOM A;  3DJN B;  4B6I A;  4MVM A;  2HKV A;  5GPG B;  1TFK B;  4CS8 A;  2G3K A;  1J8Y F;  3ASO C;  4KI2 A;  5A6J A;  3F47 A;  2ZD9 A;  2NG1 A;  3RYL A;  3TOL A;  3A11 A;  1T01 A;  2J45 A;  3MYI A;  1BR2 A;  5L0J A;  4HEA J;  1B68 A;  5T1D B;  4EBJ A;  1U0B B;  1GS9 A;  1EI7 A;  2L6G A;  3KYJ A;  2Q3T A;  4YK5 A;  4U5F E;  3US6 A;  2R7V A;  1BBH A;  4OIQ F;  1N1C A;  1JPJ A;  3ZSU A;  1SMY F;  4AX2 A;  4YT4 A;  5K0I A;  2YKZ A;  2XXA B;  3W2V A;  1ZHT A;  2LSE A;  2QE9 A;  3I4U A;  3U9J A;  4NC3 A;  4DBR A;  2E87 A;  1Q0M A;  3OA1 A;  1NFO A;  2GA0 A;  3S9O A;  3SXK A;  1O87 A;  4MTF A;  2AWY A;  3K6B A;  4CDA A;  2VC9 A;  1U89 A;  2IOQ A;  4XEV A;  4IB4 A;  1LPE A;  3K1I C;  2GDC A;  2TMV P;  3JZ0 A;  1U6H A;  3ZIB A;  4EUK B;  3B0U X;  2XSE A;  2P61 A;  2KJG A;  2EPM X;  2FFH A;  3LUT B;  3DM9 B;  1ZHW A;  5B1A C;  3QMK A;  4CJG A;  2PBE A;  5B1B C;  5A6K A;  3T9O A;  3S90 A;  5JS5 A;  4LLE A;  1YYJ A;  4CIH A;  1S05 A;  1RKE B;  2P7V A;  3KMI A;  3EH2 A;  3W4Y A;  2VAS A;  3BRJ A;  3N2Z B;  4PR9 A;  2W9Y A;  1F1M A;  3RIP A;  1JOG A;  4ULW A;  2P6V A;  3JTL O;  1Z6A A;  3O6X A;  1H6G A;  3GEI A;  1K04 A;  2WB7 A;  3DD7 A;  2J7P D;  2EPN A;  2AVK A;  2R02 A;  4BG0 A;  3TUL A;  2DGJ A;  4CS7 A;  4YT5 A;  3C62 A;  5TJ5 E;  5EHH A;  3AGU A;  4EBK A;  1ZW3 A;  2YL7 A;  2IXN A;  1D1B A;  3L0I A;  2EPO A;  2J7P A;  5CI8 A;  1RKE A;  1V55 C;  2EPK X;  2PFD A;  1DOW A;  4AL0 A;  3HJC A;  4ONS A;  3NKE A;  2G62 A;  2M4E A;  1CGN A;  5COG A;  1K40 A;  3C7J A;  4JTD B;  3G4X A;  3RQE A;  1HY5 A;  3L8J A;  3QZC A;  3S27 A;  1YDI A;  4I1M A;  3SEO A;  1LVK A;  1ZHY A;  1YJG A;  4JZA A;  1G4U S;  2VH3 A;  1ZZP A;  3ITF A;  3AQC A;  2W4M A;  1OKK D;  2A68 F;  1YAR O;  5COF A;  1RMV A;  2R7X A;  2XS1 A;  4YL1 A;  1E2X A;  1TWA A;  4CS8 C;  4JTC B;  2VCB A;  2HS5 A;  2PX0 A;  3M79 A;  1WN0 A;  1CGM E;  3VM6 A;  1QZX A;  1T9K A;  3NMK A;  4J7T A;  4BPM A;  4E17 A;  2R7S A;  1OKK A;  3EH1 A;  3H65 A;  3IEE A;  3JSZ A;  2J0W A;  1PD0 A;  1RCP A;  5DQZ A;  3PCV A;  4AL1 A;  2R05 A;  2WZF A;  2CW0 F;  2J0X A;  1I4Z A;  3LEO A;  4Z9I A;  5L0C A;  4DOZ A;  1VYI A;  3TK0 A;  1GQA A;  2H7B A;  3GEE A;  5IY5 C;  1BZ4 A;  1ORY A;  2FAP B;  3RQG A;  1WAT A;  3J06 A;  2R7Q A;  4NTF A;  4D4N A;  3GEH A;  3DJU B;  3L8I A;  2Q9A A;  2YLG A;  3R7C A;  4K7B A;  2CYD A;  4NTB A;  3U9M A;  3V5Y A;  3EGX B;  4NTA A;  2XLD A;  5FZT A;  4FX5 A;  1HE9 A;  2Q9C A;  2B0H A;  3O55 A;  1OW8 A;  2HSQ A;  1EA8 A;  4OIN F;  2Q7R A;  2HZ8 A;  2I8B A;  2HV6 A;  2XLO A;  2KYH A;  3X2Q C;  1T6I A;  4E18 A;  1J8M F;  3B0V C;  3UGP A;  1KU2 A;  2W4B A;  4O6Y A;  1LE4 A;  4XEF A;  4MND A;  5BQI A;  1CGO A;  1QQ3 A;  4BJ5 C;  2KSF A;  1D1C A;  2XM0 A;  4N6H A;  4N4W A;  2J9U A;  5CIV A;  4JKV A;  4NY3 A;  2PX3 A;  1V54 C;  1ZHX A;  3EGX A;  2KQ9 A;  1VK5 A;  4Z9J A;  4G78 A;  4YT2 A;  1O3U A;  2YL3 A;  2A1D D;  1V74 B;  3V5X A;  2UUI A;  3RH3 A;  5E3A A;  3R2P A;  2M64 A;  2XLW A;  3KKB A;  5L3V A;  4KC9 A;  3RFY A;  2J9V A;  5L0F A;  5A6B D;  2YLD A;  1SZI A;  4PK4 A;  1ZW2 A;  4QDL A;  2UUH A;  4MW8 A;  4X0R A;  3SXZ A;  2XXA A;  1M57 C;  1WGW A;  4JJG A;  1Z63 A;  1VYK A;  2AP3 A;  2DYR C;  3K1H A;  5A6B A;  1MMD A;  1OXB A;  2HV7 A;  4YL3 A;  3U0C A;  5KYY A;  2YL1 A;  4J32 B;  4MVU A;  4BJ1 A;  4JTA B;  256B A;  1Z3I X;  2JD3 A;  1TQG A;  1Q0K A;  5BUO A;  4LDQ A;  2A0U A;  4D4X A;  2DYS C;  3S29 A;  3SP1 A;  3T4R A;  4JEB A;  3NKD A;  2OJQ A;  1L3P A;  1APC A;  1MMG A;  3Q7L A;  4JUR I;  3RKO F;  2Z15 A;  3T6B A;  1K05 A;  1IW7 F;  1OCZ C;  2L6H A;  3FDQ A;  1O5H A;  1TWC A;  5T3T A;  4I3M A;  3RVY A;  4ER9 A;  4C7O A;  1YZC A;  5L0G A;  3KL4 A;  4RBN A;  3AGT A;  1QVX A;  1TWH A;  2HUJ A;  3EZI A;  3LEV A;  3FXH A;  4R32 A;  1XZQ A;  3E9V A;  3KH2 A;  4WGY A;  4O6M A;  4C3B A;  1C03 A;  3DWW A;  2WVO A;  4N6C A;  5L0H A;  1Q0F A;  3HLZ A;  3LNR A;  1V4A A;  2QY9 A;  4WGZ A;  3C18 A;  3UMK A;  2NSG A;  2MWQ A;  3AG1 C;  4MTO A;  3M4C A;  3B29 A;  3C8Z A;  3NDB B;  5E33 A;  2GAQ A;  3MLG A;  3AG3 C;  1IZM A;  3AJM A;  2OOC A;  3CEX A;  2QNL A;  2CDQ A;  2QTV A;  3Q6N A;  4FWV A;  3ABL C;  2CNW D;  4P9T A;  1BR4 A;  4PJM A;  4RD9 A;  4F4B A;  5JT4 A;  4RDA A;  1GGQ A;  5E3C A;  5BQH A;  3EGD B;  4EBB A;  1MNE A;  1S7Z A;  1JMW A;  1FMW A;  2WZG A;  3EJN A;  3FOP A;  4P6I C;  2CNW A;  1WTY A;  1NFN A;  3FOO A;  3IQT A;  2A6H F;  3QTH A;  1LS4 A;  4XLP F;  2HFI A;  3NMI A;  5BQG A;  2LCH A;  3M15 A;  4MVO A;  4O79 A;  4P9F A;  3AG4 C;  5F5H A;  2L7A A;  4FAP B;  2B0J A;  3NMJ A;  1PV3 A;  2FGY A;  3TJ6 A;  2LQG A;  4Q4Z F;  2YRF A;  2XLV A;  2Y3D A;  3E70 C;  4DXW A;  2IYL D;  1NBB A;  4KBL A;  4LDK A;  2F22 A;  1TFO B;  1QSP A;  1G4W R;  3JRM O;  3EGD A;  3O10 A;  4IAR A;  1E83 A;  2AWC A;  2RSE B;  2ASR A;  2VB6 A;  3LES A;  4JJF A;  4U5E E;  5D92 A;  5L3Q A;  2KNH A;  1R4T A;  1Z5Z A;  3VAY A;  3DE8 A;  4BJT A;  4CX9 A;  3S0X A;  1EKY A;  3OEO A;  4G7Z F;  2LP4 A;  1E86 A;  1LI7 A;  3ABM C;  4ZLD A;  2HMQ A;  3DKA A;  3HKK A;  5D91 A;  1A7D A;  3LS1 A;  4G0H A;  1T6U A;  1T5O A;  3EHM A;  3I5Q A;  4MTG A;  2X51 A;  1GM5 A;  5COM A;  5KYU B;  3FVY A;  4XEK A;  2JPU A;  2XL4 A;  3BEH A;  1MMN A;  3IPM O;  3PMR A;  4N06 A;  4G7H F;  2KK1 A;  4BEJ A;  1D0Z A;  4U9D A;  5EK0 A;  3DM5 A;  1Q0D A;  4XPW A;  3X1O A;  1YA9 A;  4GEH A;  3RVZ A;  4MQ9 F;  3U2M A;  4OIO F;  1RJ9 B;  4YWQ A;  5E2Q A;  4CDY A;  2IXO A;  2LIG A;  2L6F A;  3QVZ A;  5DS5 A;  2V3C C;  3B0P A;  3VYW A;  2EIJ C;  3WHN A;  1E85 A;  1RXQ A;  3DMD A;  3WG7 C;  1ZU5 A;  2OG2 A;  4NQF A;  4JCZ A;  4A2N B;  5A69 A;  5L0I A;  1FNT c;  4JEA A;  4Q7C A;  3U3F A;  1G8X A;  3FMS A;  4XPY A;  1D1A A;  3C63 A;  3CAX A;  3W8H A;  2R7U A;  4U5G A;  2YL0 A;  3NG1 A;  4EHP A;  3QVY A;  1M2V B;  2H7V C;  3U8P A;  2OKU A;  4IAQ A;  2BE5 F;  2OCC C;  2O9X A;  2OU6 A;  3DXJ F;  2IXP A;  3ZWI A;  3SXY A;  4PJL A;  3F46 A;  2Q00 A;  2EIM C;  1HE1 A;  4XLN F;  3N24 A;  2LD6 A;  3ZQV A;  1HMD A;  2L81 A;  3ZDL A;  1JRA A;  4U9E A;  2H8A A;  2ZXP A;  2WVN A;  4PFO A;  4W8P A;  1WWP A;  2IBF A;  3U8V A;  4I1O B;  2J9W A;  2BL2 A;  1Q0G A;  2Q4F A;  3EPV A;  1M2V A;  1OW6 A;  1KTM A;  1CPQ A;  1VLS A;  3WAQ A;  3MFN A;  1OR2 A;  4XQ1 A;  4LAC B;  2LK4 A;  1WOL A;  3K1I A;  2PF4 E;  4H4K C;  3LLK A;  2GFH A;  2OEV A;  2R25 A;  3Q6M A;  3TOM A;  4BJ6 A;  3PHF 2;  1ZVZ A;  5HSW A;  1QLE C;  2R9R B;  1ORS C;  2OQM A;  5A6A A;  1HW1 A;  3FHD A;  4KNV A;  3GM3 A;  1NSG B;  1NU9 C;  1AVO B;  1FFH A;  2JX0 A;  3H2U A;  5JP7 A;  2RD9 A;  1UG7 A;  3IQ6 A;  2P1A A;  3NRH A;  4U5B E;  2XL8 A;  4MVS A;  3VF0 A;  4AE4 B;  5L0D A;  1G5Z A;  3B9Q A;  4MVR A;  1KNY A;  3AG2 C;  4FES A;  3SZR A;  3LAY A;  3SNH A;  3SXM A;  4CSA A;  4CS9 A;  3IHU A;  3TD7 A;  1UFB A;  2XS8 A;  5DLJ A;  2C04 A;  3EFO B;  1LKX A;  3G4Z A;  2EIN C;  4LDR A;  5HV9 A;  2OEX A;  1YZA A;  4JRZ A;  1M2O A;  1I4Y A;  1PD1 A;  2WL8 A;  3CZ6 A;  5B3S C;  1A7E A;  3H2V A;  4WJ0 A;  1LE2 A;  3LS0 A;  2R03 A;  4UDV A;  1FTS A;  1ZHZ A;  1Z7Q c;  4AE4 A;  1AEP A;  1TR2 A;  1YYX A;  5T3W A;  4EWC A;  5AC5 A;  2EIL C;  4JE9 A;  5F28 E;  2Y3H A;  3FAP B;  4YN0 B;  5JSL A;  1TWG A;  3C8G B;  3JRT A;  2WVQ A;  1OR3 A;  5JRA A;  3CSK A;  3NYJ A;  1MQV A;  2XLM A;  5KYW B;  3DZA A;  2XLE A;  1OXK A;  3EQL F;  3UMH A;  1XWJ A;  5AGF A;  2YHS A;  1FAP B;  2YQY A;  4XPX A;  4GQH A;  1NU7 D;  4IJJ A;  4OD5 A;  5CI9 A;  3ZG1 A;  2C03 A; 
#chains in the Genus database with same CATH homology
 1OQC A;  3GWL A;  3TD7 A;  3U5S A;  3TK0 A;  4E0I A;  2HJ3 A;  3LLK A;  3W4Y A;  3GWN A;  3R7C A;  4E0H A;  3O55 A;  3LLI A;  1JR8 A;  3MBG A;  1JRA A;  3U2L A;  4LDK A;  3U2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...