3TK8A

Structure of a 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n-succinyltransferase from burkholderia pseudomallei
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
261
structure length
261
Chain Sequence
NMSQQLQQIIDNAWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKIDGAWTVHQWLKKAVLLSFRLEDNAPMPAGGYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPAKDGTHSLYCAVIVKKVDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
publication title Structure of a 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 93
structure length 261
sequence length 261
chains with identical sequence B, C
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14805 THDPS_N_2 Tetrahydrodipicolinate N-succinyltransferase N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.166.10 Mainly Alpha Orthogonal Bundle Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1 Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain 3tk8A01
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3tk8A02
2W0VA 3KWEA 3D8VA 2GGQA 3SRTA 3ST8A 1J2ZA 4EA9A 5AFUU 2IC7A 1QRMA 4HZCA 4M28A 4M9CA 3KWDA 1FXJA 2FKOA 2V0IA 2Q4JA 2QIAA 4R7PA 2V0JA 3BFPA 5E3PA 5E3RA 4N69A 3MQGA 4EGGA 1MR7A 4MYOA 4J09A 3C8VA 3FSBA 3IXCA 4FCEA 2OI5A 3I3XA 4HURA 3FSCA 3P1BA 1MRLA 5ADXU 2IU9A 3MQHA 1V67A 4M99A 4EA7A 1KHRA 3TIOA 2I5KA 2GGOA 2AQ9A 1KK5A 3TK8A 1QQ0A 1KRRA 4ISXA 4M2AA 4R36A 3EG4A 3VBKA 3R1WA 2W0WA 3VBLA 4KNRA 3T57A 3FSXA 4MFGA 2IUAA 3F1XA 1T3DA 3VNPA 1HM9A 4KPZA 3OUPA 1G95A 1KGTA 1S80A 3R0SA 3BSSA 2XATA 2TDTA 4N6BA 3NZ2A 1KK4A 5E3QA 3VBMA 4E79A 3VBNA 2ICXA 3EH0A 4E6TA 1LXAA 1QREA 3HJJA 5DG3A 4E75A 5L6SA 1YP3A 1FWYA 1G97A 1TDTA 2V0LA 2OI7A 3OTZA 3R3IA 4G3PA 1YP2A 4HCQA 3TWDA 3SPTA 4R37A 3BSWA 3DHOA 3FS8A 4IHHA 3EEVA 4KPXA 3D98A 2WLCA 3OU9A 1QRLA 1HM8A 3BSYA 4KNXA 4EABA 3FWWA 3FSYA 3HSQA 3R2WA 3FTTA 2RIJA 1Z90A 1OCXA 4AC3A 4E1KA 1SSTA 1SSQA 3BXYA 4HUSA 4IHFA 4IHGA 5DEPA 1HM0A 5AFUV 4K6RA 3TDTA 4M98A 3CJ8A 3R3RA 1MR9A 4J18A 2VD4A 1YP4A 3R8YA 3DJ4A 2OI6A 3VBPA 3TISA 2NPOA 2WLFA 3MC4A 4HZDA 5F42A 5U2KA 1QRGA 2IU8A 4DCLA 4E6UA 4KQLA 3TV0A 5ADXV 3GUEA 1KRUA 1KK6A 2OEGA 4EQYA 3R5DA 2P2OA 2WLEA 4M2BA 1KGQA 3GOSA 3IGJA 1HV9A 3FOQA 4G3QA 4H7OA 4AA7A 2ICYA 2V0HA 4G3SA 3VBIA 2QKXA 3I3AA 4AAWA 1XATA 4EAAA 3Q1XA 2V0KA 3PMOA 1THJA 3VBJA 4EA8A 2QIVX 2OEFA 3OTMA 3DK5A 2VHEA 3ECTA 1V3WA 3BRKX 1QRFA 1SSMA 4MZUA 3OW5A 3R5CA 4N6AA 3R5BA 5L6VA 2WLDA 3GVDA 1KQAA 5DEMA 3V4EA 2WLGA 3P47A 3R5AA 3JQYA 1KRVA 2JF3A 3KWCA 1XHDA 4G87A 2JF2A 4N27A
chains in the Genus database with same CATH superfamily
2W0VA 3KWEA 3D8VA 2GGQA 3SRTA 3ST8A 1J2ZA 4EA9A 5AFUU 2IC7A 1QRMA 3OH4A 4HZCA 4M28A 1N4IA 3KWDA 4M9CA 1FXJA 2FKOA 2V0IA 2Q4JA 2QIAA 4R7PA 3OH0A 2V0JA 3BFPA 5E3PA 5E3RA 4N69A 3MQGA 4EGGA 1MR7A 3OGZA 4MYOA 3SUCA 4J09A 3C8VA 3FSBA 3IXCA 4FCEA 2OI5A 3I3XA 3GQ9A 3FSCA 3P1BA 1MRLA 4HURA 5ADXU 3GQ8A 2IU9A 3MQHA 1V67A 4M99A 4EA7A 1KHRA 3TIOA 2I5KA 2GGOA 2AQ9A 1KK5A 3TK8A 1QQ0A 1KRRA 4ISXA 4M2AA 4R36A 3EG4A 3VBKA 3R1WA 2W0WA 3OH3A 4KNRA 3T57A 3VBLA 3FSXA 4MFGA 2IUAA 3F1XA 1T3DA 3VNPA 1HM9A 4KPZA 3OUPA 1G95A 1KGTA 1S80A 3R0SA 3BSSA 2XATA 2TDTA 4N6BA 3NZ2A 1KK4A 5E3QA 3VBMA 4E79A 3VBNA 2ICXA 3EH0A 4E6TA 1LXAA 1QREA 3HJJA 5DG3A 4E75A 5L6SA 1YP3A 1FWYA 1G97A 1TDTA 2V0LA 2OI7A 3OH1A 3OTZA 3R3IA 4G3PA 1YP2A 4HCQA 3TWDA 3SPTA 4R37A 3BSWA 3DHOA 3FS8A 4IHHA 3EEVA 4KPXA 3D98A 2WLCA 3OU9A 1QRLA 1HM8A 1L0SA 3BSYA 4KNXA 4EABA 3FWWA 3FSYA 3HSQA 3R2WA 3FTTA 2RIJA 1Z90A 3GQ7A 1Z2FA 1OCXA 4AC3A 4E1KA 1SSTA 1SSQA 3BXYA 4HUSA 4IHFA 4IHGA 5DEPA 1HM0A 5AFUV 4K6RA 3TDTA 4M98A 3CJ8A 3R3RA 1MR9A 4J18A 2VD4A 1YP4A 1EWWA 3R8YA 3DJ4A 2OI6A 3VBPA 3TISA 2NPOA 2WLFA 3MC4A 4HZDA 5F42A 5U2KA 1QRGA 2IU8A 4DCLA 4E6UA 4KQLA 3TV0A 5ADXV 3GUEA 1KRUA 1KK6A 2OEGA 4EQYA 3R5DA 2P2OA 2WLEA 4M2BA 3OH2A 1KGQA 3GOSA 3IGJA 1HV9A 3GQAA 3FOQA 4G3QA 4H7OA 4AA7A 2ICYA 2V0HA 4G3SA 3VBIA 2QKXA 3I3AA 4AAWA 1XATA 4EAAA 3Q1XA 2V0KA 1M8NA 3PMOA 1THJA 3VBJA 4EA8A 2QIVX 2OEFA 3OTMA 3DK5A 2VHEA 3ECTA 1V3WA 3BRKX 1QRFA 1SSMA 4MZUA 3OW5A 3R5CA 4N6AA 3R5BA 5L6VA 2WLDA 3GVDA 1KQAA 5DEMA 3V4EA 2WLGA 3P47A 3R5AA 3JQYA 1KRVA 2JF3A 3KWCA 1XHDA 4G87A 2JF2A 4N27A
chains in the Genus database with same CATH topology
2W0VA 3KWEA 3D8VA 2GGQA 3SRTA 3ST8A 1J2ZA 4EA9A 5AFUU 2IC7A 1QRMA 4HZCA 4M28A 4M9CA 3KWDA 1FXJA 2FKOA 2V0IA 2Q4JA 2QIAA 4R7PA 2V0JA 3BFPA 5E3PA 5E3RA 4N69A 3MQGA 4EGGA 1MR7A 4MYOA 4J09A 3C8VA 3FSBA 3IXCA 4FCEA 2OI5A 3I3XA 4HURA 3FSCA 3P1BA 1MRLA 5ADXU 2IU9A 3MQHA 1V67A 4M99A 4EA7A 1KHRA 3TIOA 2I5KA 2GGOA 2AQ9A 1KK5A 3TK8A 1QQ0A 1KRRA 4ISXA 4M2AA 4R36A 3EG4A 3VBKA 3R1WA 2W0WA 3VBLA 4KNRA 3T57A 3FSXA 4MFGA 2IUAA 3F1XA 1T3DA 3VNPA 1HM9A 4KPZA 3OUPA 1G95A 1KGTA 1S80A 3R0SA 3BSSA 2XATA 2TDTA 4N6BA 3NZ2A 1KK4A 5E3QA 3VBMA 4E79A 3VBNA 2ICXA 3EH0A 4E6TA 1LXAA 1QREA 3HJJA 5DG3A 4E75A 5L6SA 1YP3A 1FWYA 1G97A 1TDTA 2V0LA 2OI7A 3OTZA 3R3IA 4G3PA 1YP2A 4HCQA 3TWDA 3SPTA 4R37A 3BSWA 3DHOA 3FS8A 4IHHA 3EEVA 4KPXA 3D98A 2WLCA 3OU9A 1QRLA 1HM8A 3BSYA 4KNXA 4EABA 3FWWA 3FSYA 3HSQA 3R2WA 3FTTA 2RIJA 1Z90A 1OCXA 4AC3A 4E1KA 1SSTA 1SSQA 3BXYA 4HUSA 4IHFA 4IHGA 5DEPA 1HM0A 5AFUV 4K6RA 3TDTA 4M98A 3CJ8A 3R3RA 1MR9A 4J18A 2VD4A 1YP4A 3R8YA 3DJ4A 2OI6A 3VBPA 3TISA 2NPOA 2WLFA 3MC4A 4HZDA 5F42A 5U2KA 1QRGA 2IU8A 4DCLA 4E6UA 4KQLA 3TV0A 5ADXV 3GUEA 1KRUA 1KK6A 2OEGA 4EQYA 3R5DA 2P2OA 2WLEA 4M2BA 1KGQA 3GOSA 3IGJA 1HV9A 3FOQA 4G3QA 4H7OA 4AA7A 2ICYA 2V0HA 4G3SA 3VBIA 2QKXA 3I3AA 4AAWA 1XATA 4EAAA 3Q1XA 2V0KA 3PMOA 1THJA 3VBJA 4EA8A 2QIVX 2OEFA 3OTMA 3DK5A 2VHEA 3ECTA 1V3WA 3BRKX 1QRFA 1SSMA 4MZUA 3OW5A 3R5CA 4N6AA 3R5BA 5L6VA 2WLDA 3GVDA 1KQAA 5DEMA 3V4EA 2WLGA 3P47A 3R5AA 3JQYA 1KRVA 2JF3A 3KWCA 1XHDA 4G87A 2JF2A 4N27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0V A;  3KWE A;  3D8V A;  2GGQ A;  3SRT A;  3ST8 A;  1J2Z A;  4EA9 A;  5AFU U;  2IC7 A;  1QRM A;  4HZC A;  4M28 A;  4M9C A;  3KWD A;  1FXJ A;  2FKO A;  2V0I A;  2Q4J A;  2QIA A;  4R7P A;  2V0J A;  3BFP A;  5E3P A;  5E3R A;  4N69 A;  3MQG A;  4EGG A;  1MR7 A;  4MYO A;  4J09 A;  3C8V A;  3FSB A;  3IXC A;  4FCE A;  2OI5 A;  3I3X A;  4HUR A;  3FSC A;  3P1B A;  1MRL A;  5ADX U;  2IU9 A;  3MQH A;  1V67 A;  4M99 A;  4EA7 A;  1KHR A;  3TIO A;  2I5K A;  2GGO A;  2AQ9 A;  1KK5 A;  3TK8 A;  1QQ0 A;  1KRR A;  4ISX A;  4M2A A;  4R36 A;  3EG4 A;  3VBK A;  3R1W A;  2W0W A;  3VBL A;  4KNR A;  3T57 A;  3FSX A;  4MFG A;  2IUA A;  3F1X A;  1T3D A;  3VNP A;  1HM9 A;  4KPZ A;  3OUP A;  1G95 A;  1KGT A;  1S80 A;  3R0S A;  3BSS A;  2XAT A;  2TDT A;  4N6B A;  3NZ2 A;  1KK4 A;  5E3Q A;  3VBM A;  4E79 A;  3VBN A;  2ICX A;  3EH0 A;  4E6T A;  1LXA A;  1QRE A;  3HJJ A;  5DG3 A;  4E75 A;  5L6S A;  1YP3 A;  1FWY A;  1G97 A;  1TDT A;  2V0L A;  2OI7 A;  3OTZ A;  3R3I A;  4G3P A;  1YP2 A;  4HCQ A;  3TWD A;  3SPT A;  4R37 A;  3BSW A;  3DHO A;  3FS8 A;  4IHH A;  3EEV A;  4KPX A;  3D98 A;  2WLC A;  3OU9 A;  1QRL A;  1HM8 A;  3BSY A;  4KNX A;  4EAB A;  3FWW A;  3FSY A;  3HSQ A;  3R2W A;  3FTT A;  2RIJ A;  1Z90 A;  1OCX A;  4AC3 A;  4E1K A;  1SST A;  1SSQ A;  3BXY A;  4HUS A;  4IHF A;  4IHG A;  5DEP A;  1HM0 A;  5AFU V;  4K6R A;  3TDT A;  4M98 A;  3CJ8 A;  3R3R A;  1MR9 A;  4J18 A;  2VD4 A;  1YP4 A;  3R8Y A;  3DJ4 A;  2OI6 A;  3VBP A;  3TIS A;  2NPO A;  2WLF A;  3MC4 A;  4HZD A;  5F42 A;  5U2K A;  1QRG A;  2IU8 A;  4DCL A;  4E6U A;  4KQL A;  3TV0 A;  5ADX V;  3GUE A;  1KRU A;  1KK6 A;  2OEG A;  4EQY A;  3R5D A;  2P2O A;  2WLE A;  4M2B A;  1KGQ A;  3GOS A;  3IGJ A;  1HV9 A;  3FOQ A;  4G3Q A;  4H7O A;  4AA7 A;  2ICY A;  2V0H A;  4G3S A;  3VBI A;  2QKX A;  3I3A A;  4AAW A;  1XAT A;  4EAA A;  3Q1X A;  2V0K A;  3PMO A;  1THJ A;  3VBJ A;  4EA8 A;  2QIV X;  2OEF A;  3OTM A;  3DK5 A;  2VHE A;  3ECT A;  1V3W A;  3BRK X;  1QRF A;  1SSM A;  4MZU A;  3OW5 A;  3R5C A;  4N6A A;  3R5B A;  5L6V A;  2WLD A;  3GVD A;  1KQA A;  5DEM A;  3V4E A;  2WLG A;  3P47 A;  3R5A A;  3JQY A;  1KRV A;  2JF3 A;  3KWC A;  1XHD A;  4G87 A;  2JF2 A;  4N27 A; 
#chains in the Genus database with same CATH topology
 2W0V A;  3KWE A;  3D8V A;  2GGQ A;  3SRT A;  3ST8 A;  1J2Z A;  4EA9 A;  5AFU U;  2IC7 A;  1QRM A;  3OH4 A;  4HZC A;  4M28 A;  1N4I A;  3KWD A;  4M9C A;  1FXJ A;  2FKO A;  2V0I A;  2Q4J A;  2QIA A;  4R7P A;  3OH0 A;  2V0J A;  3BFP A;  5E3P A;  5E3R A;  4N69 A;  3MQG A;  4EGG A;  1MR7 A;  3OGZ A;  4MYO A;  3SUC A;  4J09 A;  3C8V A;  3FSB A;  3IXC A;  4FCE A;  2OI5 A;  3I3X A;  3GQ9 A;  3FSC A;  3P1B A;  1MRL A;  4HUR A;  5ADX U;  3GQ8 A;  2IU9 A;  3MQH A;  1V67 A;  4M99 A;  4EA7 A;  1KHR A;  3TIO A;  2I5K A;  2GGO A;  2AQ9 A;  1KK5 A;  3TK8 A;  1QQ0 A;  1KRR A;  4ISX A;  4M2A A;  4R36 A;  3EG4 A;  3VBK A;  3R1W A;  2W0W A;  3OH3 A;  4KNR A;  3T57 A;  3VBL A;  3FSX A;  4MFG A;  2IUA A;  3F1X A;  1T3D A;  3VNP A;  1HM9 A;  4KPZ A;  3OUP A;  1G95 A;  1KGT A;  1S80 A;  3R0S A;  3BSS A;  2XAT A;  2TDT A;  4N6B A;  3NZ2 A;  1KK4 A;  5E3Q A;  3VBM A;  4E79 A;  3VBN A;  2ICX A;  3EH0 A;  4E6T A;  1LXA A;  1QRE A;  3HJJ A;  5DG3 A;  4E75 A;  5L6S A;  1YP3 A;  1FWY A;  1G97 A;  1TDT A;  2V0L A;  2OI7 A;  3OH1 A;  3OTZ A;  3R3I A;  4G3P A;  1YP2 A;  4HCQ A;  3TWD A;  3SPT A;  4R37 A;  3BSW A;  3DHO A;  3FS8 A;  4IHH A;  3EEV A;  4KPX A;  3D98 A;  2WLC A;  3OU9 A;  1QRL A;  1HM8 A;  1L0S A;  3BSY A;  4KNX A;  4EAB A;  3FWW A;  3FSY A;  3HSQ A;  3R2W A;  3FTT A;  2RIJ A;  1Z90 A;  3GQ7 A;  1Z2F A;  1OCX A;  4AC3 A;  4E1K A;  1SST A;  1SSQ A;  3BXY A;  4HUS A;  4IHF A;  4IHG A;  5DEP A;  1HM0 A;  5AFU V;  4K6R A;  3TDT A;  4M98 A;  3CJ8 A;  3R3R A;  1MR9 A;  4J18 A;  2VD4 A;  1YP4 A;  1EWW A;  3R8Y A;  3DJ4 A;  2OI6 A;  3VBP A;  3TIS A;  2NPO A;  2WLF A;  3MC4 A;  4HZD A;  5F42 A;  5U2K A;  1QRG A;  2IU8 A;  4DCL A;  4E6U A;  4KQL A;  3TV0 A;  5ADX V;  3GUE A;  1KRU A;  1KK6 A;  2OEG A;  4EQY A;  3R5D A;  2P2O A;  2WLE A;  4M2B A;  3OH2 A;  1KGQ A;  3GOS A;  3IGJ A;  1HV9 A;  3GQA A;  3FOQ A;  4G3Q A;  4H7O A;  4AA7 A;  2ICY A;  2V0H A;  4G3S A;  3VBI A;  2QKX A;  3I3A A;  4AAW A;  1XAT A;  4EAA A;  3Q1X A;  2V0K A;  1M8N A;  3PMO A;  1THJ A;  3VBJ A;  4EA8 A;  2QIV X;  2OEF A;  3OTM A;  3DK5 A;  2VHE A;  3ECT A;  1V3W A;  3BRK X;  1QRF A;  1SSM A;  4MZU A;  3OW5 A;  3R5C A;  4N6A A;  3R5B A;  5L6V A;  2WLD A;  3GVD A;  1KQA A;  5DEM A;  3V4E A;  2WLG A;  3P47 A;  3R5A A;  3JQY A;  1KRV A;  2JF3 A;  3KWC A;  1XHD A;  4G87 A;  2JF2 A;  4N27 A; 
#chains in the Genus database with same CATH homology
 2W0V A;  3KWE A;  3D8V A;  2GGQ A;  3SRT A;  3ST8 A;  1J2Z A;  4EA9 A;  5AFU U;  2IC7 A;  1QRM A;  4HZC A;  4M28 A;  4M9C A;  3KWD A;  1FXJ A;  2FKO A;  2V0I A;  2Q4J A;  2QIA A;  4R7P A;  2V0J A;  3BFP A;  5E3P A;  5E3R A;  4N69 A;  3MQG A;  4EGG A;  1MR7 A;  4MYO A;  4J09 A;  3C8V A;  3FSB A;  3IXC A;  4FCE A;  2OI5 A;  3I3X A;  4HUR A;  3FSC A;  3P1B A;  1MRL A;  5ADX U;  2IU9 A;  3MQH A;  1V67 A;  4M99 A;  4EA7 A;  1KHR A;  3TIO A;  2I5K A;  2GGO A;  2AQ9 A;  1KK5 A;  3TK8 A;  1QQ0 A;  1KRR A;  4ISX A;  4M2A A;  4R36 A;  3EG4 A;  3VBK A;  3R1W A;  2W0W A;  3VBL A;  4KNR A;  3T57 A;  3FSX A;  4MFG A;  2IUA A;  3F1X A;  1T3D A;  3VNP A;  1HM9 A;  4KPZ A;  3OUP A;  1G95 A;  1KGT A;  1S80 A;  3R0S A;  3BSS A;  2XAT A;  2TDT A;  4N6B A;  3NZ2 A;  1KK4 A;  5E3Q A;  3VBM A;  4E79 A;  3VBN A;  2ICX A;  3EH0 A;  4E6T A;  1LXA A;  1QRE A;  3HJJ A;  5DG3 A;  4E75 A;  5L6S A;  1YP3 A;  1FWY A;  1G97 A;  1TDT A;  2V0L A;  2OI7 A;  3OTZ A;  3R3I A;  4G3P A;  1YP2 A;  4HCQ A;  3TWD A;  3SPT A;  4R37 A;  3BSW A;  3DHO A;  3FS8 A;  4IHH A;  3EEV A;  4KPX A;  3D98 A;  2WLC A;  3OU9 A;  1QRL A;  1HM8 A;  3BSY A;  4KNX A;  4EAB A;  3FWW A;  3FSY A;  3HSQ A;  3R2W A;  3FTT A;  2RIJ A;  1Z90 A;  1OCX A;  4AC3 A;  4E1K A;  1SST A;  1SSQ A;  3BXY A;  4HUS A;  4IHF A;  4IHG A;  5DEP A;  1HM0 A;  5AFU V;  4K6R A;  3TDT A;  4M98 A;  3CJ8 A;  3R3R A;  1MR9 A;  4J18 A;  2VD4 A;  1YP4 A;  3R8Y A;  3DJ4 A;  2OI6 A;  3VBP A;  3TIS A;  2NPO A;  2WLF A;  3MC4 A;  4HZD A;  5F42 A;  5U2K A;  1QRG A;  2IU8 A;  4DCL A;  4E6U A;  4KQL A;  3TV0 A;  5ADX V;  3GUE A;  1KRU A;  1KK6 A;  2OEG A;  4EQY A;  3R5D A;  2P2O A;  2WLE A;  4M2B A;  1KGQ A;  3GOS A;  3IGJ A;  1HV9 A;  3FOQ A;  4G3Q A;  4H7O A;  4AA7 A;  2ICY A;  2V0H A;  4G3S A;  3VBI A;  2QKX A;  3I3A A;  4AAW A;  1XAT A;  4EAA A;  3Q1X A;  2V0K A;  3PMO A;  1THJ A;  3VBJ A;  4EA8 A;  2QIV X;  2OEF A;  3OTM A;  3DK5 A;  2VHE A;  3ECT A;  1V3W A;  3BRK X;  1QRF A;  1SSM A;  4MZU A;  3OW5 A;  3R5C A;  4N6A A;  3R5B A;  5L6V A;  2WLD A;  3GVD A;  1KQA A;  5DEM A;  3V4E A;  2WLG A;  3P47 A;  3R5A A;  3JQY A;  1KRV A;  2JF3 A;  3KWC A;  1XHD A;  4G87 A;  2JF2 A;  4N27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...