3TL1A

Crystal structure of the streptomyces coelicolor whie orfvi polyketide aromatase/cyclase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
b'MAGHTDNEITIAAPMELVWNMTNDIEKWPGLFSEYASVEVLGRDDDKVTFRLTMHPDADGKVWSWVSERVADPVTRTVRAQRVETGPFQYMNIVWEYAETAEGTVMRWTQDFAMKPDAPVDDAWMTDNINRNSRTQMALIRDRIEQAAGERRTASVLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyketide cyclase
publication title Insight into the Molecular Basis of Aromatic Polyketide Cyclization: Crystal Structure and in Vitro Characterization of WhiE-ORFVI.
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Biosynthetic protein
total genus 43
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03364 Polyketide_cyc Polyketide cyclase / dehydrase and lipid transport
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 3tl1A00
5I8FA 5AMWA 3NJ0A 1IFVA 3P0LA 1E09A 4LG5A 1UW5A 4A88A 3NMNA 3WG8A 3OTLA 4IGYA 3FO5A 2REZA 3PUTA 3Q63A 2WQLA 2E3PA 3KAZA 3H3QA 3K90A 4Q0KA 3TVRA 5JO2A 3NEFA 3KLXA 2LUZA 3IE5A 4A86A 1EM2A 3OQUA 1KCMA 2I9YA 1LN3A 1BTVA 4JHGA 4A85A 1H2OA 2NS9A 3NS2A 4JDAA 4LGBA 2VNEA 3W9RA 2LCGA 4A8UA 1T27A 3NEGA 1XUVA 4BTZA 2MOUA 3R6PA 2BK0A 3H3SA 4A84A 3NJOA 2LIOA 4A83A 3F08A 1FSKA 2E3RA 3NMHA 3NI8A 3P51A 4LA7A 4BKCA 4N0GC 5E4BA 3W9KA 4BK7A 3TL1A 4Y31A 1QMRA 3RT0C 4FPWA 1TXCA 5C9YA 3JRQB 2K5GA 4IGWA 3JRSA 3NMVA 1T17A 4DSBA 4MNSA 4BK6A 3KAYA 4A80A 2IL5A 3GGNA 3IJTA 3KDIA 1LN1A 5I9JA 4GY9A 4XRWA 4JHIA 2FLHA 1XDFA 3E85A 4LGAA 2E3OA 4QIPA 3KDHA 1FM4A 4JHHA 2EJXA 2Z9YA 3P9VA 3UJLA 2RERA 4RYVA 3Q6AA 2L9PA 3KL1A 1XN5A 3TVQA 4BKDA 3ELIA 4IGVA 2Z9ZA 4IGXA 4MAPA 1LLTA 5E4DA 1JSSA 4XRTA 4MA6A 2PSOA 5JNNA 3RT2A 2K7HA 3ZVUA 1X53A 2E3QA 3NJ1A 4M9BA 1LN2A 2GKDA 2KTEA 3KB0A 4WVOA 2M47A 4IHRA 2LGHA 1B6FA 4PSBA 2QIMA 5BRLA 3RD6A 2L8OA 3H3RA 4JDLA 2N4BA 4IH2A 2E3MA 4B9RA 3KB3A 2KF2A 2KCZA 4OICA 4C94A 2L65A 3UIDA 4DSCA 5E4MA 4C9CA 4REIA 2E3NA 2PCSA 2R55A 4A87A 4C9IA 3QSZA 3NR4A 4IH0A 4N3EA 2LPXA 4REJA 3OH8A 2LF2A 3K3KA 3KDJA 1XFSA 1ZXFA 2M89A 4DS8A 2RESA 2KEWA 5JO1A 2LAKA 2E3SA 3PU2A 5E46A 2A1LA 4R7KA 3TFZA 2N4AA 4REHA 2QPVA 4Z3LA 1VJHA 4A8GA 4A8VA 2Q3QA 3NMTA 2NN5A 3C0VA 2LEQA 2VQ5A 3H3TA 4M9WA 1ICXA 1XN6A 3CNWA 3Q64A 1BV1A 3OJIA 2D4RA 4A81A 2FFSA 3UQHA 1TW0A 2LDKA 3QN1A 2LE1A 3NMPA 1Z94A
chains in the Genus database with same CATH superfamily
5I8FA 5AMWA 3NJ0A 1IFVA 3P0LA 1E09A 4LG5A 1UW5A 4A88A 3NMNA 3WG8A 3OTLA 4IGYA 3FO5A 2REZA 4NCBA 3PUTA 3Q63A 3HK2A 2WQLA 2E3PA 3KAZA 3H3QA 3K90A 4Q0KA 3TVRA 5JO2A 4N47A 3NEFA 3KLXA 3GOBA 2LUZA 3IE5A 4A86A 3DLHA 1EM2A 3OQUA 3GB4A 1KCMA 2I9YA 1LN3A 1BTVA 4JHGA 4A85A 1H2OA 2NS9A 3NS2A 4JDAA 4LGBA 2VNEA 3W9RA 2LCGA 4A8UA 1T27A 3NEGA 1XUVA 4BTZA 3HVRA 2MOUA 3R6PA 4QDDA 2BK0A 3H3SA 4A84A 3NJOA 2LIOA 4A83A 3F08A 1FSKA 2E3RA 3GKEA 3NI8A 3NMHA 3P51A 3NQNA 4LA7A 2YH6A 4N0GC 5E4BA 3W9KA 3TL1A 4BK7A 4Y31A 3HJFA 3GL0A 1QMRA 3RT0C 4FPWA 1TXCA 5C9YA 3JRQB 2K5GA 3HM9A 4IGWA 2LAFA 3JRSA 3NMVA 1T17A 4DSBA 4MNSA 4BK6A 3KAYA 4A80A 2IL5A 3GGNA 3IJTA 3KDIA 1LN1A 5I9JA 4GY9A 4XRWA 4JHIA 3TGOC 2FLHA 1XDFA 3E85A 4LGAA 2E3OA 4QIPA 4N76A 3KDHA 1FM4A 4JHHA 2EJXA 2Z9YA 3P9VA 4N41A 3UJLA 2RERA 4RYVA 3Q6AA 2L9PA 3KL1A 1XN5A 3TVQA 3HXMA 4BKDA 3ELIA 4IGVA 2Z9ZA 4IGXA 4MAPA 1LLTA 3GTSA 5E4DA 1JSSA 4XRTA 4MA6A 2PSOA 4BKCA 5JNNA 3RT2A 4KPYA 2K7HA 3ZVUA 1X53A 2E3QA 3NJ1A 4M9BA 1LN2A 2GKDA 2KTEA 3KB0A 4WVOA 2M47A 4IHRA 2LGHA 1B6FA 4PSBA 2QIMA 5BRLA 3RD6A 2L8OA 3GL2A 3H3RA 4JDLA 2N4BA 4IH2A 2E3MA 4B9RA 3KB3A 2KF2A 2KCZA 4OICA 4QDCA 2L65A 3UIDA 4C94A 4DSCA 4QDFB 5E4MA 4REIA 4C9CA 4JHYA 2E3NA 2PCSA 2R55A 2ZYLA 4A87A 3F73A 4C9IA 3QSZA 3NR4A 4IH0A 4N3EA 4QDFA 2LPXA 4QCKA 4REJA 3OH8A 2LF2A 3K3KA 3DLBA 3KDJA 1XFSA 3GTEA 1ZXFA 2M89A 4DS8A 2RESA 2KEWA 4NCAA 5JO1A 2LAKA 2E3SA 3PU2A 5E46A 4E6FA 2A1LA 4R7KA 3TFZA 2N4AA 4REHA 2QPVA 4Z3LA 5EKQC 1VJHA 4A8GA 4A8VA 2Q3QA 3NMTA 2NN5A 3C0VA 2LEQA 2VQ5A 3H3TA 4M9WA 1ICXA 1XN6A 3HO1A 3CNWA 3Q64A 1BV1A 3OJIA 2D4RA 4A81A 2FFSA 3UQHA 1TW0A 2LDKA 3QN1A 2LE1A 3NMPA 1Z94A
chains in the Genus database with same CATH topology
5I8FA 5AMWA 3NJ0A 1IFVA 3P0LA 1E09A 4LG5A 1UW5A 4A88A 3NMNA 3WG8A 3OTLA 4IGYA 3FO5A 2REZA 4NCBA 3PUTA 3Q63A 3HK2A 2WQLA 2E3PA 3KAZA 3H3QA 3K90A 4Q0KA 3TVRA 5JO2A 4N47A 3NEFA 3KLXA 3GOBA 2LUZA 3IE5A 4A86A 3DLHA 1EM2A 3OQUA 3GB4A 1KCMA 2I9YA 1LN3A 1BTVA 4JHGA 4A85A 1H2OA 2NS9A 3NS2A 4JDAA 4LGBA 2VNEA 3W9RA 2LCGA 4A8UA 1T27A 3NEGA 1XUVA 4BTZA 3HVRA 2MOUA 3R6PA 4QDDA 2BK0A 3H3SA 4A84A 3NJOA 2LIOA 4A83A 3F08A 1FSKA 2E3RA 3GKEA 3NI8A 3NMHA 3P51A 3NQNA 4LA7A 2YH6A 4N0GC 5E4BA 3W9KA 3TL1A 4BK7A 4Y31A 3HJFA 3GL0A 1QMRA 3RT0C 4FPWA 1TXCA 5C9YA 3JRQB 2K5GA 3HM9A 4IGWA 2LAFA 3JRSA 3NMVA 1T17A 4DSBA 4MNSA 4BK6A 3KAYA 4A80A 2IL5A 3GGNA 3IJTA 3KDIA 1LN1A 5I9JA 4GY9A 4XRWA 4JHIA 3TGOC 2FLHA 1XDFA 3E85A 4LGAA 2E3OA 4QIPA 4N76A 3KDHA 1FM4A 4JHHA 2EJXA 2Z9YA 3P9VA 4N41A 3UJLA 2RERA 4RYVA 3Q6AA 2L9PA 3KL1A 1XN5A 3TVQA 3HXMA 4BKDA 3ELIA 4IGVA 2Z9ZA 4IGXA 4MAPA 1LLTA 3GTSA 5E4DA 1JSSA 4XRTA 4MA6A 2PSOA 4BKCA 5JNNA 3RT2A 4KPYA 2K7HA 3ZVUA 1X53A 2E3QA 3NJ1A 4M9BA 1LN2A 2GKDA 2KTEA 3KB0A 4WVOA 2M47A 4IHRA 2LGHA 1B6FA 4PSBA 2QIMA 5BRLA 3RD6A 2L8OA 3GL2A 3H3RA 4JDLA 2N4BA 4IH2A 2E3MA 4B9RA 3KB3A 2KF2A 2KCZA 4OICA 4QDCA 2L65A 3UIDA 4C94A 4DSCA 4QDFB 5E4MA 4REIA 4C9CA 4JHYA 2E3NA 2PCSA 2R55A 2ZYLA 4A87A 3F73A 4C9IA 3QSZA 3NR4A 4IH0A 4N3EA 4QDFA 2LPXA 4QCKA 4REJA 3OH8A 2LF2A 3K3KA 3DLBA 3KDJA 1XFSA 3GTEA 1ZXFA 2M89A 4DS8A 2RESA 2KEWA 4NCAA 5JO1A 2LAKA 2E3SA 3PU2A 5E46A 4E6FA 2A1LA 4R7KA 3TFZA 2N4AA 4REHA 2QPVA 4Z3LA 5EKQC 1VJHA 4A8GA 4A8VA 2Q3QA 3NMTA 2NN5A 3C0VA 2LEQA 2VQ5A 3H3TA 4M9WA 1ICXA 1XN6A 3HO1A 3CNWA 3Q64A 1BV1A 3OJIA 2D4RA 4A81A 2FFSA 3UQHA 1TW0A 2LDKA 3QN1A 2LE1A 3NMPA 1Z94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I8F A;  5AMW A;  3NJ0 A;  1IFV A;  3P0L A;  1E09 A;  4LG5 A;  1UW5 A;  4A88 A;  3NMN A;  3WG8 A;  3OTL A;  4IGY A;  3FO5 A;  2REZ A;  3PUT A;  3Q63 A;  2WQL A;  2E3P A;  3KAZ A;  3H3Q A;  3K90 A;  4Q0K A;  3TVR A;  5JO2 A;  3NEF A;  3KLX A;  2LUZ A;  3IE5 A;  4A86 A;  1EM2 A;  3OQU A;  1KCM A;  2I9Y A;  1LN3 A;  1BTV A;  4JHG A;  4A85 A;  1H2O A;  2NS9 A;  3NS2 A;  4JDA A;  4LGB A;  2VNE A;  3W9R A;  2LCG A;  4A8U A;  1T27 A;  3NEG A;  1XUV A;  4BTZ A;  2MOU A;  3R6P A;  2BK0 A;  3H3S A;  4A84 A;  3NJO A;  2LIO A;  4A83 A;  3F08 A;  1FSK A;  2E3R A;  3NMH A;  3NI8 A;  3P51 A;  4LA7 A;  4BKC A;  4N0G C;  5E4B A;  3W9K A;  4BK7 A;  3TL1 A;  4Y31 A;  1QMR A;  3RT0 C;  4FPW A;  1TXC A;  5C9Y A;  3JRQ B;  2K5G A;  4IGW A;  3JRS A;  3NMV A;  1T17 A;  4DSB A;  4MNS A;  4BK6 A;  3KAY A;  4A80 A;  2IL5 A;  3GGN A;  3IJT A;  3KDI A;  1LN1 A;  5I9J A;  4GY9 A;  4XRW A;  4JHI A;  2FLH A;  1XDF A;  3E85 A;  4LGA A;  2E3O A;  4QIP A;  3KDH A;  1FM4 A;  4JHH A;  2EJX A;  2Z9Y A;  3P9V A;  3UJL A;  2RER A;  4RYV A;  3Q6A A;  2L9P A;  3KL1 A;  1XN5 A;  3TVQ A;  4BKD A;  3ELI A;  4IGV A;  2Z9Z A;  4IGX A;  4MAP A;  1LLT A;  5E4D A;  1JSS A;  4XRT A;  4MA6 A;  2PSO A;  5JNN A;  3RT2 A;  2K7H A;  3ZVU A;  1X53 A;  2E3Q A;  3NJ1 A;  4M9B A;  1LN2 A;  2GKD A;  2KTE A;  3KB0 A;  4WVO A;  2M47 A;  4IHR A;  2LGH A;  1B6F A;  4PSB A;  2QIM A;  5BRL A;  3RD6 A;  2L8O A;  3H3R A;  4JDL A;  2N4B A;  4IH2 A;  2E3M A;  4B9R A;  3KB3 A;  2KF2 A;  2KCZ A;  4OIC A;  4C94 A;  2L65 A;  3UID A;  4DSC A;  5E4M A;  4C9C A;  4REI A;  2E3N A;  2PCS A;  2R55 A;  4A87 A;  4C9I A;  3QSZ A;  3NR4 A;  4IH0 A;  4N3E A;  2LPX A;  4REJ A;  3OH8 A;  2LF2 A;  3K3K A;  3KDJ A;  1XFS A;  1ZXF A;  2M89 A;  4DS8 A;  2RES A;  2KEW A;  5JO1 A;  2LAK A;  2E3S A;  3PU2 A;  5E46 A;  2A1L A;  4R7K A;  3TFZ A;  2N4A A;  4REH A;  2QPV A;  4Z3L A;  1VJH A;  4A8G A;  4A8V A;  2Q3Q A;  3NMT A;  2NN5 A;  3C0V A;  2LEQ A;  2VQ5 A;  3H3T A;  4M9W A;  1ICX A;  1XN6 A;  3CNW A;  3Q64 A;  1BV1 A;  3OJI A;  2D4R A;  4A81 A;  2FFS A;  3UQH A;  1TW0 A;  2LDK A;  3QN1 A;  2LE1 A;  3NMP A;  1Z94 A; 
#chains in the Genus database with same CATH topology
 5I8F A;  5AMW A;  3NJ0 A;  1IFV A;  3P0L A;  1E09 A;  4LG5 A;  1UW5 A;  4A88 A;  3NMN A;  3WG8 A;  3OTL A;  4IGY A;  3FO5 A;  2REZ A;  4NCB A;  3PUT A;  3Q63 A;  3HK2 A;  2WQL A;  2E3P A;  3KAZ A;  3H3Q A;  3K90 A;  4Q0K A;  3TVR A;  5JO2 A;  4N47 A;  3NEF A;  3KLX A;  3GOB A;  2LUZ A;  3IE5 A;  4A86 A;  3DLH A;  1EM2 A;  3OQU A;  3GB4 A;  1KCM A;  2I9Y A;  1LN3 A;  1BTV A;  4JHG A;  4A85 A;  1H2O A;  2NS9 A;  3NS2 A;  4JDA A;  4LGB A;  2VNE A;  3W9R A;  2LCG A;  4A8U A;  1T27 A;  3NEG A;  1XUV A;  4BTZ A;  3HVR A;  2MOU A;  3R6P A;  4QDD A;  2BK0 A;  3H3S A;  4A84 A;  3NJO A;  2LIO A;  4A83 A;  3F08 A;  1FSK A;  2E3R A;  3GKE A;  3NI8 A;  3NMH A;  3P51 A;  3NQN A;  4LA7 A;  2YH6 A;  4N0G C;  5E4B A;  3W9K A;  3TL1 A;  4BK7 A;  4Y31 A;  3HJF A;  3GL0 A;  1QMR A;  3RT0 C;  4FPW A;  1TXC A;  5C9Y A;  3JRQ B;  2K5G A;  3HM9 A;  4IGW A;  2LAF A;  3JRS A;  3NMV A;  1T17 A;  4DSB A;  4MNS A;  4BK6 A;  3KAY A;  4A80 A;  2IL5 A;  3GGN A;  3IJT A;  3KDI A;  1LN1 A;  5I9J A;  4GY9 A;  4XRW A;  4JHI A;  3TGO C;  2FLH A;  1XDF A;  3E85 A;  4LGA A;  2E3O A;  4QIP A;  4N76 A;  3KDH A;  1FM4 A;  4JHH A;  2EJX A;  2Z9Y A;  3P9V A;  4N41 A;  3UJL A;  2RER A;  4RYV A;  3Q6A A;  2L9P A;  3KL1 A;  1XN5 A;  3TVQ A;  3HXM A;  4BKD A;  3ELI A;  4IGV A;  2Z9Z A;  4IGX A;  4MAP A;  1LLT A;  3GTS A;  5E4D A;  1JSS A;  4XRT A;  4MA6 A;  2PSO A;  4BKC A;  5JNN A;  3RT2 A;  4KPY A;  2K7H A;  3ZVU A;  1X53 A;  2E3Q A;  3NJ1 A;  4M9B A;  1LN2 A;  2GKD A;  2KTE A;  3KB0 A;  4WVO A;  2M47 A;  4IHR A;  2LGH A;  1B6F A;  4PSB A;  2QIM A;  5BRL A;  3RD6 A;  2L8O A;  3GL2 A;  3H3R A;  4JDL A;  2N4B A;  4IH2 A;  2E3M A;  4B9R A;  3KB3 A;  2KF2 A;  2KCZ A;  4OIC A;  4QDC A;  2L65 A;  3UID A;  4C94 A;  4DSC A;  4QDF B;  5E4M A;  4REI A;  4C9C A;  4JHY A;  2E3N A;  2PCS A;  2R55 A;  2ZYL A;  4A87 A;  3F73 A;  4C9I A;  3QSZ A;  3NR4 A;  4IH0 A;  4N3E A;  4QDF A;  2LPX A;  4QCK A;  4REJ A;  3OH8 A;  2LF2 A;  3K3K A;  3DLB A;  3KDJ A;  1XFS A;  3GTE A;  1ZXF A;  2M89 A;  4DS8 A;  2RES A;  2KEW A;  4NCA A;  5JO1 A;  2LAK A;  2E3S A;  3PU2 A;  5E46 A;  4E6F A;  2A1L A;  4R7K A;  3TFZ A;  2N4A A;  4REH A;  2QPV A;  4Z3L A;  5EKQ C;  1VJH A;  4A8G A;  4A8V A;  2Q3Q A;  3NMT A;  2NN5 A;  3C0V A;  2LEQ A;  2VQ5 A;  3H3T A;  4M9W A;  1ICX A;  1XN6 A;  3HO1 A;  3CNW A;  3Q64 A;  1BV1 A;  3OJI A;  2D4R A;  4A81 A;  2FFS A;  3UQH A;  1TW0 A;  2LDK A;  3QN1 A;  2LE1 A;  3NMP A;  1Z94 A; 
#chains in the Genus database with same CATH homology
 5I8F A;  5AMW A;  3NJ0 A;  1IFV A;  3P0L A;  1E09 A;  4LG5 A;  1UW5 A;  4A88 A;  3NMN A;  3WG8 A;  3OTL A;  4IGY A;  3FO5 A;  2REZ A;  4NCB A;  3PUT A;  3Q63 A;  3HK2 A;  2WQL A;  2E3P A;  3KAZ A;  3H3Q A;  3K90 A;  4Q0K A;  3TVR A;  5JO2 A;  4N47 A;  3NEF A;  3KLX A;  3GOB A;  2LUZ A;  3IE5 A;  4A86 A;  3DLH A;  1EM2 A;  3OQU A;  3GB4 A;  1KCM A;  2I9Y A;  1LN3 A;  1BTV A;  4JHG A;  4A85 A;  1H2O A;  2NS9 A;  3NS2 A;  4JDA A;  4LGB A;  2VNE A;  3W9R A;  2LCG A;  4A8U A;  1T27 A;  3NEG A;  1XUV A;  4BTZ A;  3HVR A;  2MOU A;  3R6P A;  4QDD A;  2BK0 A;  3H3S A;  4A84 A;  3NJO A;  2LIO A;  4A83 A;  3F08 A;  1FSK A;  2E3R A;  3GKE A;  3NI8 A;  3NMH A;  3P51 A;  3NQN A;  4LA7 A;  2YH6 A;  4N0G C;  5E4B A;  3W9K A;  3TL1 A;  4BK7 A;  4Y31 A;  3HJF A;  3GL0 A;  1QMR A;  3RT0 C;  4FPW A;  1TXC A;  5C9Y A;  3JRQ B;  2K5G A;  3HM9 A;  4IGW A;  2LAF A;  3JRS A;  3NMV A;  1T17 A;  4DSB A;  4MNS A;  4BK6 A;  3KAY A;  4A80 A;  2IL5 A;  3GGN A;  3IJT A;  3KDI A;  1LN1 A;  5I9J A;  4GY9 A;  4XRW A;  4JHI A;  3TGO C;  2FLH A;  1XDF A;  3E85 A;  4LGA A;  2E3O A;  4QIP A;  4N76 A;  3KDH A;  1FM4 A;  4JHH A;  2EJX A;  2Z9Y A;  3P9V A;  4N41 A;  3UJL A;  2RER A;  4RYV A;  3Q6A A;  2L9P A;  3KL1 A;  1XN5 A;  3TVQ A;  3HXM A;  4BKD A;  3ELI A;  4IGV A;  2Z9Z A;  4IGX A;  4MAP A;  1LLT A;  3GTS A;  5E4D A;  1JSS A;  4XRT A;  4MA6 A;  2PSO A;  4BKC A;  5JNN A;  3RT2 A;  4KPY A;  2K7H A;  3ZVU A;  1X53 A;  2E3Q A;  3NJ1 A;  4M9B A;  1LN2 A;  2GKD A;  2KTE A;  3KB0 A;  4WVO A;  2M47 A;  4IHR A;  2LGH A;  1B6F A;  4PSB A;  2QIM A;  5BRL A;  3RD6 A;  2L8O A;  3GL2 A;  3H3R A;  4JDL A;  2N4B A;  4IH2 A;  2E3M A;  4B9R A;  3KB3 A;  2KF2 A;  2KCZ A;  4OIC A;  4QDC A;  2L65 A;  3UID A;  4C94 A;  4DSC A;  4QDF B;  5E4M A;  4REI A;  4C9C A;  4JHY A;  2E3N A;  2PCS A;  2R55 A;  2ZYL A;  4A87 A;  3F73 A;  4C9I A;  3QSZ A;  3NR4 A;  4IH0 A;  4N3E A;  4QDF A;  2LPX A;  4QCK A;  4REJ A;  3OH8 A;  2LF2 A;  3K3K A;  3DLB A;  3KDJ A;  1XFS A;  3GTE A;  1ZXF A;  2M89 A;  4DS8 A;  2RES A;  2KEW A;  4NCA A;  5JO1 A;  2LAK A;  2E3S A;  3PU2 A;  5E46 A;  4E6F A;  2A1L A;  4R7K A;  3TFZ A;  2N4A A;  4REH A;  2QPV A;  4Z3L A;  5EKQ C;  1VJH A;  4A8G A;  4A8V A;  2Q3Q A;  3NMT A;  2NN5 A;  3C0V A;  2LEQ A;  2VQ5 A;  3H3T A;  4M9W A;  1ICX A;  1XN6 A;  3HO1 A;  3CNW A;  3Q64 A;  1BV1 A;  3OJI A;  2D4R A;  4A81 A;  2FFS A;  3UQH A;  1TW0 A;  2LDK A;  3QN1 A;  2LE1 A;  3NMP A;  1Z94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...