3TL3A

Structure of a short-chain type dehydrogenase/reductase from mycobacterium ulcerans
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
243
structure length
236
Chain Sequence
b'AVAVVTGGASGLGLATTKRLLDAGAQVVVLDIRGEDVVADLGDRARFAAADVTDEAAVASALDLAETMGTLRIVVNCAGTGNAIRVLSRDGVFSLAAFRKIVDINLVGSFNVLRLAAERIAKTEPVNAEERGVIINTASVADGQIGQAAYSASKGGVVGMTLPIARDLASHRIRVMTIAPGLFDTPLLPEEARASLGKQVPHPSRLGNPDEYGALAVHIIENPMLNGEVIRLDGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain type dehydrogenase/reductase
molecule tags Oxidoreductase
source organism Mycobacterium ulcerans
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
total genus 89
structure length 236
sequence length 243
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tl3A00
5L7WA 4AJIA 3KM0A 5C3MA 2NLOA 4CMIB 1YDWA 3ULKA 5DOVA 1X14A 2VUSA 1U5AA 1NXQA 1KC3A 1YQDA 2HMVA 1HYGA 4U6QA 2BELA 4CM8A 3GHYA 1LBEA 4GWGA 5T5QA 3Q11A 3N74A 2Q99A 4XD2A 1BWSA 1LSSA 5JCJD 1T4DA 3Q6IA 4GX0A 3OQBA 3ZWYA 3JQAA 1LRKA 4BO7A 4BO8A 3D3WA 1BSVA 2HMUA 5KVQA 3P19A 1WNTA 4CMBA 4ZN6A 4M54A 3BAZA 5L4LA 3SVTA 2JJYA 5JE8A 3QRWA 1F0YA 3DAFA 4BVAA 4ZD6A 2CMDA 1GY8A 4XJSA 4CM4B 1E7RA 3U4DA 3DO5A 1MB4A 3H2SA 5A9RA 2GF2A 1EK5A 2Q49A 4YT2A 1WW8A 1YOVA 4I5FA 1LRJA 4B79A 1I5RA 5DCUA 2Y1CA 3I6IA 2XXJA 4GX2A 1HTBA 2UYYA 1UP4A 2C2XA 1EQUA 1PIWA 4PG7A 2QHXA 3NT4A 1GR0A 3H6KA 3G1TA 4WLOA 2CY0A 4CQLB 1R4MA 3ZI0A 2QW8A 4JJFA 3DMYA 4UUMA 1TI7A 2DTEA 3OIFA 3UFXA 3IDSA 4BGVA 3RUAA 3RASA 3AM5A 2VYNA 3PYLA 3AJRA 3QW2A 4YJGB 1LC3A 3BTVA 2ZB7A 5F5LA 1IE3A 5KJ1A 3NAQA 3HUDA 1E92A 3W4KA 1R66A 5KJ6A 3H5AA 2EIHA 5A4DA 4R51A 3ZZNA 1WDKA 5FI3A 1Q0HA 2FSSA 3U4HA 4B4VA 5FEUA 2VYVA 1IY8A 2UUOA 4IUYA 1QORA 3OJOA 4QTZA 1MV8A 2C07A 4A03A 1E1NA 3MJSA 4K9DA 4OKIA 4FOSA 4W9NC 2FR1A 4AVYA 5IDYA 3W8DA 3C24A 4A0SA 4B8WA 1ONNA 1ADBA 1BW9B 1ZK0A 3GZNA 2YHUA 5DP2A 5A1TA 1AGNA 4Q3NA 1A4IA 1YXMA 1KVQA 3PDJA 4R3NA 5F21A 1W73A 4LCEA 2CD9A 3FHLA 1H93A 3ENNA 4D0RA 1KEVA 1VSVA 1I3MA 4RLSA 1HT0A 3ZWVA 1U8FO 5A9SA 4IMRA 3W8EA 5JBIA 3AWDA 1NPYA 1NYTA 4HWKA 4CQMD 1T2CA 1CQJA 4DVJA 3DWFA 3QA9A 4GMFA 1HXHA 4U8GA 1MUUA 4CQMB 3WQQA 4IY1A 2VWGA 1NR1A 4E0BA 1V3UA 4J90A 3E48A 2GZ3A 2AMFA 5L40A 5AXDA 1DOHA 3X2FA 3I52A 3WDSA 3PEFA 1K6XA 3UICA 3DZFA 4MOWA 2YV3A 1PR3A 4FFNA 1E3LA 1K2WA 4R69A 1LA2A 5JXWA 4CR6A 1E7MA 1Y8QA 1VKNA 3PQDA 2I67A 4FB5A 3IP3A 4ND2A 1LQUA 3W4JA 1NVGA 1PZGA 3LT0A 1UXJA 3NUGA 4RF2A 3CMCO 4GH5A 4B4UA 5JO0A 1UJMA 4WLVA 2VRCA 5JMPA 3WR5A 2I76A 1D4FA 4OMUA 4QEDA 1M76A 4KQWA 1KC1A 4PLFA 4NIMA 2RHRA 5A9SB 4NFSA 1U2DA 4HV4A 4F45A 2JD1A 4OXYA 9LDTA 2JCVA 1FF9A 1A9ZA 4YYZA 1LNQA 1E77A 3AY7A 3C7AA 3LSYA 3DAPA 4W99A 4PCVA 3GPDG 4E31A 1XA0A 5ITVA 1H6BA 4NG5A 4AFNA 3BHMA 3KEOA 4AL4A 1B8UA 2JAPA 4DLBA 2Z1MA 3VH2A 1DAPA 4D7AA 2VZ8A 1E3WB 2GZ1A 4RZIA 1NQ5A 3CZMA 4MVJH 2ZCVA 4IDAA 4IM7A 1AXEA 3QP9A 2C54A 1AN9A 2Q2VA 4MINA 4DQXA 3SLKA 3WGQA 4DUPA 4BIIA 1EUCA 3QVXA 3HN2A 4Q39A 4B7XA 4BQRA 3VKVA 1BG6A 4I9HA 3U5TA 3OH8A 4R1SA 2ZATA 4TROA 4BNTA 2EERA 4CUZA 3RIHA 2J5RA 3JQBA 4Q3CA 1DHRA 5IDWA 1TEHA 1XGKA 4WLEA 3B70A 3R3JA 2CFCA 3AOEA 3JQ7B 1U7TA 1DIRA 4EJ0A 4GQAA 4PGFA 1BVUA 2PKQP 3UOGA 3RJ5A 3OICA 2Y1EA 4GAEA 1LI4A 2HMSA 3D3WB 2NQ8A 4IDCA 4XB1A 5JO9A 4BNNA 1ONPA 4BNUA 1YQGA 3GEGA 1QP8A 3JTMA 3D4OA 1MXFA 1J6UA 1O6ZA 2H1SA 3M6IA 1GUFA 2XPCA 4FS3A 3KYDB 5I8WA 4EZBA 5A3JA 4ILKA 3JYOA 3JV7A 3DBLB 4XYMA 4ZQGA 2Y99A 1VSUA 3COSA 1PZHA 3PHHA 3G49A 1XSEA 3MTJA 4JJGA 5DNAA 2JFGA 2IYOA 3OEWA 3S1LA 3NDIA 3GH3A 2I6TA 4YRAA 3MEQA 3RUIA 3WTBA 3P5SA 2CNBA 4UREA 3RQSA 3UXYA 1QXSA 4MKXA 1ZEJA 2FR0A 5H82A 3ZH2A 2PZLA 1K3TA 3TJRA 3EW7A 1D8AA 4UUNA 2CVOA 1PTJA 4J2OA 1EQ2A 1VPDA 2EV9A 3FN4A 3RBXA 4CM4A 1N8KA 1N5DA 2AA3A 2GUGA 2HCTA 3PLNA 3FBGA 5ADHA 2XF8A 3G17A 3VVBA 5L3ZA 2P9EA 3HJAA 3PHGA 3HHPA 1IZ0A 1V35A 3G1UA 2EGHA 1HLDA 4Y6RA 2YJZA 4IJUA 1QSGA 3F6YA 4ZQEA 3TZQA 3R6DA 1N2SA 1T1SA 2CDCA 1ULSA 2W90A 4A73A 4YTEA 2NACA 3FNFA 3ZWPA 5I9NA 5H83A 3LQFA 3DR3A 2VWPA 4RDHA 2JKVA 4YWJA 4Z0HO 4CQLA 1DIGA 4XYBA 1BVRA 1RWBA 4EJ6A 1HYEA 3WBFA 4BNLA 5EL0A 4OYRA 4JP2A 1GUYA 3LT2A 3I1JA 2X8LA 4I9NA 4K26A 1EVYA 2UAGA 9LDBA 1E0DA 1R16A 3GGPA 4LRSB 1Z45A 4HBGA 4TQGA 3C1OA 3FR7A 3WXBA 1YE3A 1C1XA 3GVPA 4MIEA 4BHTA 1M6HA 4BB6A 3BMNB 1KEUA 3SC6A 3TL3A 3DHYA 1G1AA 3V2GA 5DZSA 1DFGA 1W8DA 3PJDA 4P38A 1EEHA 3C85A 5K9ZA 1PR9A 3ON5A 1KEWA 5TT0A 3SLGA 4EUHA 1PU2A 2F00A 2HLPA 3HFSA 3JQAB 3L07A 4GI2A 4QXMA 3DBHA 1L1FA 2JD0A 5AOVA 2R2GA 2X9NA 1XU9A 2IODA 1E5QA 3L6DA 3UN1A 2O4UX 1GV0A 2NNLD 5IN5A 1HETA 4HNHA 4XYLA 1EMDA 3DOCA 3R0IA 2I9PA 4BNZA 4U0KA 1MX3A 1R6DA 1GTMA 4FPXA 1GAEO 1DSSG 1A4UA 1DC6A 4RVGA 3V2UA 4DGSA 2X22A 3QV1A 1FMCA 4IINA 6ADHA 3C7DB 1M75A 2BH9A 1UP6A 4CMIA 5I7SA 1ORRA 1Q1NA 1RM5A 2EGGA 4MVJF 4ZQHA 4W7HA 3KYBA 3WGHA 3EVNA 1C0PA 3EGOA 4P22A 3O9ZA 4MDHA 4CV0A 4DIFA 3ZU5A 3NTOA 3TZHA 1E5LA 3ADPA 4HXYA 3GFBA 4D44A 2TMGA 4WLFA 1YL6A 3E1KA 3RKUA 2NTNA 1PWZA 4YBZA 4BNHA 1DJNA 1UXHA 4MVJI 2R00A 4UULA 3DC2A 4Z9FA 3ZWBA 2WD7A 1OC2A 1C14A 2VWQA 3BMOB 4CM6A 4U7WA 5L9AA 4A26A 3GA0A 2FR8A 3KEQA 5JSFA 3GPIA 4CM3A 3AU9A 3OJFA 1ISMA 1X0VA 4NNJA 2RCYA 4YCAA 1U8XX 2YFQA 2W2KA 2HMWA 3LYLA 2ZTUA 3QWHA 5DBIA 4XIYA 1KVSA 3DHNA 3BXXA 3A9WA 3FNHA 1ZNQO 1HDRA 3H2ZA 4TKMA 4BO4A 2P9GA 4MP3A 1TVEA 2WYVA 3L4BC 4BKOA 2ZQZA 4W9NA 1IB6A 2Z95A 1PZFA 2WTBA 2PH3A 1ZUD1 1YB1A 4E5YA 2NQTA 3V2HA 1I32A 4YT5A 1D3AA 4J2HA 1ZW1A 2IYPA 3P2YA 4HFNA 3GVCA 2NVUB 1YB4A 3JQ9C 1TT5A 4IQ0A 1V9LA 1EK6A 3E6AA 3JQ7A 4JX8A 2NVWA 3DFUA 3AU8A 1B3RA 2C20A 1R37A 3GZ4A 2C29D 3HSKA 5THQA 5DT9A 3CUKA 4TKLA 3PFFA 4UUPA 4OHUA 3VAZA 2W8ZA 4IIVA 2PNFA 3ZWOA 4CLXA 5KIAA 4MKZA 4L9RA 3W8FA 4FJ1A 3KB6A 4KDFA 2IDZA 4NFHA 4P4GA 3WS7A 3ZNQA 2DM6A 1JU9A 4HY3A 2BGKA 4L4XA 3OJ0A 1I3KA 1EE9A 2VWHA 1SO8A 5JAZA 4LVUA 1GL3A 4BNWA 1T4BA 3ZDFA 4WGGA 3EDMA 4E5NA 3PLRA 1RJWA 3L9XA 4YJGA 2HUNA 1E3EA 2Q3EA 3E9NA 3VH4A 3GFGA 2VHXA 1M66A 1ZSVA 3ANMA 4FN4A 1ISHA 1N1GA 3JD1A 3IJPA 2DPHA 3E5MA 4ZGWA 2IEDA 3D64A 4WUVA 4J91A 1GYQA 1ZMTA 1D1TA 1R4MB 4XCVA 4Y8VA 4EGFA 1P9LA 3MZ0A 1J4AA 1Y8RB 1YKFA 4CM9D 2DVMA 1CETA 1DRUA 4Y6PA 2GZ2A 1R4NA 3RC1A 2G5CA 3TZKA 2O3QA 2P5UA 4UVHA 3Q9UA 4MVJA 1LUAA 4E5MA 2P4HX 4Y67A 5AVOA 4BNXA 1GZ6A 1IOLA 1EFLA 1NM5A 4R1NA 3DOJA 3RD5A 3O8QA 4KQXA 4W82A 2EW2A 2WJPA 4FFLA 3ONFA 4DBVO 1J49A 3W6ZA 4EEZA 1G0NA 2Y1GA 3GEDA 5TQVA 5H81A 3WTCA 3ZV4A 1M2WA 1EUDA 2Z5LA 4FGWA 4CMCA 5IF3A 5JAIA 4O59O 1LU9A 3WJAA 1XQ1A 2AQ8A 3IS3A 4ND4A 1A7KA 2D5CA 1OAAA 2PLAA 3TQHA 4KWHA 1Y5RA 4G81A 3RJ9A 5KKCA 1ID1A 2NV6A 2HMTA 4UEJA 4E12A 3QHAA 5A03A 4RVHA 1BDBA 4XZ3A 3JYLA 4FJ2A 3UAGA 4LMPA 3IOYA 3GLQA 4I5EA 1X7DA 3C1AA 4PLWA 3RROA 1A72A 1MFZA 4Z3KA 2BRUA 1SB8A 4BO3A 2FP4A 3S2IA 2DTXA 4UAGA 3GF4A 5JAMA 3PI7A 2BLLA 2OL4A 4D3SA 4MO2A 4R1TA 3O03A 4ZRMA 4AJ4A 3ZHBA 4L4SA 2DC1A 2J3KA 2J5KA 1RKXA 1T25A 3PWKA 3MWDB 1ZJYA 3L9WA 4JK3A 5A05A 4ROSA 4CPDA 4IDFA 4BNGA 3VDRA 3BMQB 3BMNA 4CM9A 3QY9A 4CMJA 1VJ1A 3VZQA 2G17A 4I8XA 4RPLA 4UEKA 2VOEA 4E5KA 2CUKA 2PA3A 3IP1A 1E1MA 1JWAB 3L4BA 2NTVA 2ZB3A 1SEVA 4J9UE 4UEOA 5I8ZA 1C0LA 3PGJA 1ZMOA 1AUPA 1Y8QB 1VRWA 3VPXA 1B8VA 5L4NA 2OZPA 4G5HA 3ZWMA 2Y1FA 1YRLA 1LRLA 3PYXA 1ZK3A 4E2YA 1YBAA 5IZCC 1RM4A 2HRZA 4HUJA 3UGKA 5CEJA 4A2CA 2FPIA 4TRRA 4XQEA 2FZEA 1O95A 2B83A 2J3JA 5TIIA 3V8BA 3H5RA 5COQA 2GLXA 4JNKA 1YONA 3GR6A 4AJ1A 3HG7A 4LN1A 3H8VA 2R00C 3AY3A 3AI3A 1I2CA 2G0TA 4TRJA 2ILTA 3QWBA 1CDOA 3LLVA 4KMSA 4RJTA 2V7PA 3NKLA 4PN3A 1DFHA 2Q1TA 4IZIA 5AXAA 4JROA 5CPFA 4DYVA 2P5YA 1U7HA 4FFRA 1IUKA 5ILGA 4RF5A 3JYQA 4P4LA 4ND1A 1BMDA 5DCYA 3RUDA 1ISJA 1F12A 1OOEA 3Q3CA 2QYSA 2NU6A 1E7WA 3RUFA 1E6WA 4OSPA 1LSUA 2JL1A 2RIRA 5KJEA 5B4UA 4YJFB 1MG5A 2X0RA 4AJHA 4KUHA 3IAHA 3U09A 3UCEA 5ILOA 4CM8B 1N1EA 4EDFA 4LISA 3CMMA 4PLCA 4BGIA 5MDHA 1FDTA 2OORA 2HSDA 1Y81A 2P2SA 3CH6A 2B35A 4YEDA 5EESA 2Y67A 1FDUA 1B7GO 4N5LA 4BKRA 4CJXA 4B7CA 3SX2A 1GFSA 2PR2A 4NMHA 1LDEA 2AG8A 1PL7A 4CM1A 2JFFA 4FGSA 2H5LA 4IIUA 2PK3A 3GNSA 1PGJA 3N58A 2WD7B 4K1LA 3TWOA 3VKUA 3H9JA 1EVZA 3IKTA 5JFOA 4JBIA 4YRBA 4YJDA 4DL9A 1LEHA 1Z82A 4NJMB 4PZDA 3A1NA 1MP0A 1LDMA 1JKFA 1JA9A 5F1OA 5GZ1A 2VHVA 3RCBA 3JQDA 3K73O 3D3EA 1ZO8A 4J4HA 4TSKA 3RVDA 4J1SA 3PWSA 2IXBA 3RC2A 3INTA 3ENKA 4IMPA 4K6FA 3OHSX 3BTUA 1FDVA 1SOWA 1BTOA 3E03A 1O94A 3DMTC 1JQBA 4EUEA 2P91A 5CP8A 4BMSA 2C2YA 5CDUA 2NU8A 5BSEA 3H9UA 2ZKLA 4XX0A 3AK4A 1XYGA 4PIVA 3FI9A 3DDNA 3LC2O 1QG6A 1JTVA 3CINA 4MVJG 1PX0A 4A7PA 3TSCA 4XYEA 4NQZA 3VDQA 2CDBA 4J1TA 2BF7A 4XR9A 4L75A 4ALKA 3GDGA 5G0SA 1NQTA 2BMAA 3AW9A 3F9IA 3IJRA 1GQQA 1CQIA 3ITKA 1FJHA 4JBHA 4NJOA 4QO7A 4JJIA 5HS6A 1MXHA 1RM0A 5JDCA 4O63O 3HWRA 1N9GB 4PG6A 2EW8A 3PIIA 1CEQA 4PLPA 2FOIA 4YAKA 3Q2IA 3BZUA 3OF2A 3RBZA 2ZTMA 1FDWA 1PL6A 4WOKA 1BXGB 4GGOA 3GC6A 3NTQA 3NJ4A 3TL2A 1BXKA 1OC4A 1PL8A 3TOZA 4NBTA 5FYDA 1HSZA 4AG3A 3TN7A 1GCUA 4C4OA 3F47A 4DLAA 1HE5A 1P0FA 4D3FA 4YAGA 1ZIDA 4R4JA 1PJ3A 3PK0A 1AXGA 4Z9YA 3VTZA 5I7VA 4OKNA 2Y0DA 5I7EA 1DAOA 3KHUA 5EN4A 3TPCA 3WGIA 2NU9A 1T2EA 3N7UA 2HJRA 3O26A 4CM7A 4DLLA 1JKJA 4Q3AA 2JHGA 3PJFA 1F8GA 3ASUA 3AUUA 1R0SA 3F1KA 2GYYA 4EEXA 4BV9A 1UZMA 4NJMA 4WEOA 1P44A 4OOEA 4RPKA 5F5NA 1HZZA 3K2BA 3VPGA 3CSDA 2NM0A 4J4TA 4NHEA 4PRKA 3S2FA 5JDCC 4M8SA 1NASA 2GN4A 1QR6A 5JAQA 3TF5A 2E82A 3SBOA 2EKPA 4KDEA 2CZCA 5CG1A 3VVCA 4XRGA 2XAAA 1ADFA 1LTHR 2IXAA 2Q46A 3VZRA 2Y68A 4U0JA 1NP3A 2NVUA 4AJEA 4BO1A 2VYND 3VH3A 5ICSA 1PS8A 3KTDA 1NVTA 3DBRB 3S8MA 3ICPA 1CJCA 1UUFA 3GVIA 1H5QA 2CF5A 3QWAA 2DBVO 1ZK2A 1I10A 2B69A 3I9KA 1XEAA 1QLHA 3EHEA 3MJCA 5IAAA 1P1HA 3ICCA 4OL9A 1P1RA 5KVVA 1M67A 2HK7A 3FRJA 3E9MA 4AJOA 2QRKA 3KYDA 3LF1A 1KBZA 5TSDA 1HE4A 5LC1A 4YXFA 1ZVMA 4MIYA 4QT0A 4XB2A 1HEUA 1UAYA 2YZ7A 4PLHA 1UXGA 5C37A 4DMMA 2VZ0A 3NGXA 1LDNA 1JAXA 1N7HA 4UVGA 3WBBA 4ALIA 3SEFA 3WYBA 3JQEA 3JD3A 4AICA 1V0JA 3WNVA 1Q7GA 3AOGA 4ZICA 1YO6A 5B37A 4Z6KA 2UV8A 3U4CA 1G0OA 5FI5A 2CDAA 2PH5A 4W4TA 4L76A 2O2SA 4A27A 4B3JA 1UAGA 1H9AA 3GN2A 3ZW8A 3CXRA 1ULUA 5KOIA 1WZEA 2DAPA 4QQRA 4XQCA 3S2GA 4WK6A 4D43A 4URFA 3B20A 4BNIA 2A4KA 1HZJA 5EMHA 1R12A 2AXQA 4DRYA 1ZK4A 5L7YA 3DZKA 3GHHA 4FCCA 4D42A 4MVJE 1HKUA 1E3JA 1QYXA 2A9FA 2OHXA 1BGVA 2EP7A 5EIOA 3OQ1A 5JDIC 3QSGA 2Y0CA 2ET6A 3QQPA 3SJUA 3T7EA 3KETA 2D59A 3I9MA 4IJKA 4GKVA 1HDXA 2EG9A 1FXSA 1NQAO 1IPEA 1P1JA 1DB3A 1MC4A 1H6CA 1DC3A 2YY7A 1PGQA 3FWNA 4J4BA 4DIOA 2FSVA 2GN6A 3WIEA 4GVLA 5A5FA 2H63A 4FC7A 3GMSA 4EBFA 1T2DA 3ONDA 5I9MA 1NAHA 1KERA 2B4TO 2EEZA 4WEQA 3UCFA 1X15A 5TC4A 4IGEA 1PJSA 3KSDO 3GAZA 1YJ8A 4NK5A 1Q7CA 3D0OA 2HJSA 5L53A 1NPTO 4DREA 1LLDA 2B5VA 2Y0EA 1ADCA 3AM4A 4WCFB 2FHSA 1VL6A 5B1YA 2EHDA 5LCXA 1R4NB 4OO3A 4HFJA 5DULA 3RFXA 1LLQA 5KNLA 2C7GA 1QRRA 2RHCA 3ORFA 2P4QA 4BO6A 2JCXA 3KLPX 4XGNA 2A35A 4ALJA 1ISFA 2PKRA 1B3BA 1BXZA 1GQ2A 3JQCA 2X86A 2BKAA 3MOIA 5TRTA 5BQFA 2VNAA 4O1MA 4R9SA 4LCJA 5U9CA 4CQMA 1A7AA 2DQ4A 4EJMA 3OMLA 3X2EA 1U3WA 5JY1A 2AEJA 1D1SA 4FQ8A 2E4AA 1LC0A 3GOHA 4ZQFA 2BGMA 4MIOA 1X1EA 2WWRA 3KSZO 2JAHA 3OETA 3RC7A 5C7IO 5JYDA 4NPCA 4BNKA 3AUAA 1JDJA 3DZBA 2BFMA 2PFGA 5AXCA 4CODB 4BO9A 3GT0A 3DONA 4HP8A 5JW6A 4HFMA 3QVWA 4MP6A 3ADOA 4WE3A 1MFPA 2B4QA 3ETDA 3CIFA 4D46A 1B26A 1N7GA 2PZJA 3BMCB 2EKLA 3KYCB 4QO8A 1BHSA 4II3A 4MVJD 4DQVA 4E2XA 3LU1A 1ENOA 4KTTE 3WFJA 2OXIA 3HB5X 4CLDA 1PQWA 4DYDA 1XELA 1MA0A 1Z75A 3HFGA 4WJZA 5A06A 2D1YA 1ZSNA 1DBVO 1F14A 4GMGA 1H6AA 4N18A 5F1PA 3LT1A 1DJQA 1CWUA 4AJ2A 1EDZA 3FBTA 3ZGYA 1GD1O 2CSUA 3IUSA 1ISGA 1EDOA 4AJLA 4FDAA 3RU7A 3RFTA 1J0XO 1EE2A 2E6UX 2X5KO 1QV6A 1KEPA 5JMWA 1JVBA 4OXNA 5KJCA 2GN9A 1Y6JA 2QZZA 2B5WA 1Q2XA 4CMEA 1QLJA 1JN0A 3RUEA 2PGDA 1F06A 1F17A 4OIMA 5CAEA 1AHHA 1T1RA 1UH5A 4IPTA 1KVTA 4CV2A 4LRTB 4LW8A 2HQ1A 4YACA 2EP5A 1DLJA 1PJCA 2IEBA 1WDMA 4RGBA 2NTJA 5B4VA 1I2ZA 2ZQYA 4PLVA 5KWEA 5TJHA 1LJ8A 1O89A 4WKGA 1R0LA 1WP4A 3EVTA 1UDBA 4J1NA 3INRA 1E1KA 5KVCA 4YDRA 1B2LA 1TLTA 2AQKA 4Y9DA 2ZK7A 1B14A 3EZYA 1GYPA 3E9QA 2WE7A 4C7JA 2VN8A 4WCDA 3GG9A 4TVBA 2OFPA 2HK9A 2O3JA 2C7VA 4OOFA 4R5MA 1GPDG 3DBLA 3H9QA 2BI8A 5BNIA 1LXCA 1PEDA 3ZWWA 2W4QA 3PTZA 2IE0A 4J7XA 1EZ4A 1WMAA 2DTDA 4FW8A 3PQEA 2PD6A 4NBVA 1NWHA 3ZU4A 1K6IA 3KZVA 3RI3A 5F3RA 3RUCA 3ZV6A 3DHEA 4L8VA 3DFZA 2X7HA 1D7OA 3D4PA 3O38A 1FK8A 1KS9A 3ZW9A 3I9NA 2Q45A 1FDSA 3DL2A 2VHZA 1KIFA 2EJWA 2A92A 4TVOA 3ZV5A 1HYHA 1SBYA 2V6GA 3H65A 1HDCA 2PY6A 3E5RA 3INGA 3FNEA 2O48X 3EC7A 2GPTA 1ZSYA 3BMQA 3HDYA 4EYEA 1PGPA 2GASA 3NDRA 3H7AA 5EQDA 4QX6A 3EUWA 3WLEA 3OQ6A 2DT5A 2VT2A 3K92A 3ZWNA 3E18A 5CG2A 1T2FA 4XR4A 5BSGA 1BRMA 1C1XB 3A14A 3E82A 4N54A 2ZB4A 1VL8A 3CPSA 2OUIA 2VUTA 4RO0A 5LDGA 1DIAA 2HK8A 2PTGA 3RU9A 5K6AA 3IL2A 3JD2A 4H3VA 3RSHA 3BIOA 5IN4A 5CFZA 3BHIA 5EERA 1DPGA 5F1KA 3IUPA 3WGOA 1ZXLA 5JC1A 4GSLA 2G82A 2CVQA 3I83A 4U5QA 2RAFA 4JN6B 2TMDA 5AXBA 4B3HA 2O50A 3DOOA 2ZYAA 1QYVA 4RF4A 5EQFA 3FNGA 5BNFA 1X7GA 5TLSA 2FPPA 4NDNE 4CMHA 1E7SA 2GO1A 4BB5A 1LDGA 3I4CA 2RH4A 4WOJA 3ZWXA 5JDIA 4HNGA 1ZFNA 4GKBA 4IS3A 4JQCA 1V3VA 4BKPA 1LDBA 2JHFA 4RL6A 3CTMA 4D41A 4E33A 2PKQO 1YBVA 1LLUA 4LK3A 2D8AA 3NT2A 1O0SA 3UW3A 2HDHA 1OFGA 5JYEA 3VZPA 2I3GA 1PQUA 1F8FA 1P33A 1Z74A 2E48A 3A06A 3GRPA 4FC6A 4K6CA 3LT4A 4N7RA 3OJEA 1U3UA 1Q7BA 2OMEA 1DIBA 4IQ8A 1ZZEA 1B16A 4ZHSA 3W6UA 2A94A 1B8PA 5CDSA 5DCWA 1QMGA 2ZJ1A 2XXBA 4DC1A 2P68A 5GZ6A 4E32A 7ADHA 3ITDA 2W2LD 3KRTA 1HL3A 4NU5A 4WECA 3MCVA 5FFFA 2O3UA 4HX5A 2GRAA 4Z0TA 3QWIA 4Q3DA 3E8XA 3QLJA 3ZU3A 1SNYA 4CLHA 3DZIA 5L4SA 3R1IA 1NR7A 4NBRA 3RFVA 3NGLA 1K6JA 1O8CA 4JIGA 3ABIA 2AG5A 3KSUA 3LC7O 2OBNA 3FPLA 2LDXA 3O8QB 1SCUA 4MP8A 3PDUA 3ZWCA 4BMVA 1DRWA 1IHYA 2DPGA 2X6TA 3B1FA 3BMCA 1R15A 2PD3A 4E13A 4EI2A 4FFPA 2FY8A 1LSJA 4R16A 4XQGA 3VOSA 2ZTVA 2HAEA 1ARZA 3C7CB 1U2GA 4LSWA 3KVOA 3P2OA 3JD0A 3WG9A 2I3AA 2BGLA 1DIHA 1B15A 1U4OA 3K8ZA 3C8MA 4J9VA 1TT5B 2WDZA 3NRCA 4TMFA 4RCVA 3ANNA 3FR8A 1PGNA 4O5OA 3U9LA 4FFMA 2YV1A 4HFRA 3LC1O 3JQ8B 3RC9A 3FPCA 2Z1NA 3GNQA 3ZHXA 3JSAA 2FMUA 1SB9A 3GRKA 2O3TA 3PXXA 1PSDA 4Q3EA 1K5HA 3BYZA 5BNTA 1QYDA 5LDHA 1JVSA 2DUWA 3EY4A 1YBMA 3DXFA 3OIDA 2O3RA 3WOHA 2O4CA 3BTSA 5HS4A 1XLTA 2X5JO 3GG2A 4ZVVA 4J43A 2DBQA 4B8ZA 3NV9A 5BT9A 4DBZA 3NX4A 4ONEA 2PD4A 1AHIA 4F3YA 3C1TA 4JCOA 5C7LO 4PRLA 5G0TA 4ESOA 3TZCA 4ID9A 2D3TA 1HSOA 5U4QA 2IZ0A 3TZ6A 3EYWA 2VT3A 3NDJA 4E5PA 4I5GA 1CYDA 4I1IA 3K2EA 4WLUA 4QECA 3KYCA 3A4VA 3K5PA 3NTRA 5CDTA 1OZAA 3ANLA 4JGBA 1V8BA 3SXPA 1DFIA 3FWZA 5CDGA 1ZEMA 1OMOA 2POQX 4IBOA 3DBVO 4CUJA 5I9LA 3KV3O 2D5AA 1WDLA 4PVCA 2D4AA 4I5DA 5ER6A 4L4RA 3I9LA 1VKOA 8ADHA 3F1LA 3JQ9A 3PZRA 1EBFA 3VHRA 4BV8A 5JCXA 3V1UA 2G1UA 3LLSA 4RPGA 2H6EA 1G6KA 3F5QA 3STHA 3B1KA 5KKAA 2UDPA 4PLGA 1YDEA 5T57A 2EXXA 2WYUA 2Q1WA 7MDHA 3OP4A 3JYNA 4IS2A 3PP8A 3O4RA 4KOAA 2B36A 4R01A 1TB4A 3DBHB 1I33A 3I9OA 1ZH8A 1XHLA 1U4SA 1E3SA 1Q0QA 3EAGA 4JP3A 2EJVA 3DMTA 6LDHA 2GGSA 1C3VA 1P1IA 5CHEA 4ALLA 4E21A 1XDWA 1Y8RA 3AM3A 5JNLA 3DZJA 3JQGA 4C7KA 2C59A 3K6JA 1GEGA 2QQ5A 2DBZA 3LDHA 4JBGA 1JKIA 1IZ9A 3F4LA 4ND3A 1HDOA 3QE3A 4RVFA 3U4IA 2IZ1A 2O3SA 3Q1LA 2VTEA 3IKVA 2CF6A 3I6QA 4NR0A 1DC4A 1MGOA 1AE1A 2I99A 4D79A 5K6AC 2AQHA 4J0EA 4TRNA 5L7TA 4IXTA 1V6AA 3VZSA 3Q2KA 4BUCA 1H0KA 4MJLA 1UXIA 3M2PA 3OSUA 3GY0A 3T7CA 2OO5A 1Y1PA 2VHWA 1YVEI 2I65A 1A9YA 5IXYA 3G79A 4NFYA 2QZ9A 1S6YA 1TT7A 2BHLA 4FOOA 4BNVA 5HWSA 3LF2A 1SZJG 3VH1A 4JXKA 4O0LA 2YFHA 4PZEA 4CV3A 1ML3A 4GVXA 4IQGA 5B4TA 1O9BA 1PGOA 1GCOA 1X13A 3L77A 2E49A 3QVTA 5T6BA 3ROMA 5TNXA 1T24A 4YT8A 1NHGA 2DBRA 2J8ZA 2Q4BA 3WGYA 4PLTA 3BA1A 3CEAA 4IDGA 4CR8A 2VUUA 5EJ2A 1Z7BA 3VTFA 3UH1A 2OP0A 1LSOA 4ALMA 3IC5A 1P1KA 4OQZA 5L51A 3ASVA 1J5PA 1TA4A 3I5MA 5K0ZA 4GL4A 5JS6A 1GZ3A 4XDZA 3GUYA 4UVEA 1DHTA 2AQIA 5A5EA 1X1TA 5HBRA 3HDHA 1JWBB 3RAJA 2CVZA 1PJQA 2LDBA 2VNSA 4BO5A 5JY6A 2NUAA 5KJFA 4M55A 3AY6A 3WMWA 3HADA 4GX1A 1LLCA 4Y6SA 3RWBA 2Q2QA 1I3LA 2QYTA 3CZRA 1B0AA 3L0DA 1LDYA 3GEMA 1RYDA 2DKNA 3D5QA 1R0KA 4B4OA 4EUFA 1E7YA 1VL0A 4YA6A 2DFDA 5CPBA 1Z7EA 5IZCA 3NJ8A 1QYWA 4AJJA 3JQ8A 1DO8A 4CR7A 3QIVA 3DBRA 3IQDB 4MKRA 5TX7A 4B7UA 4BL5A 1PJTA 1IPFA 3PJGA 4H16A 4KP7A 3WYEA 4M89A 4E2WA 4I9UA 4Q3BA 3F4BA 4YT4A 5CDYA 3ETEA 2PZKA 4RZHA 5ITWA 3JQGB 5FF9A 4CMEC 5BSHA 4LGVA 3LZ6A 2X0NA 1IYZA 3G0OA 3D7LA 1ZXBA 3K31A 1NBOA 3ZN2A 3DEYX 4DIBA 4PVDA 4E4YA 2HU2A 3VPSA 1E3WA 1W6UA 1L7DA 4OQYA 3PWZA 4IDDA 3Q0EA 4YR9A 4IJVA 2DUUA 2GNAA 3AUSA 3OA2A 4BNJA 3JQAD 1QKIA 3DB2A 4GLOA 1E6EA 3WSVA 5T64A 5HTOA 4F6LA 1EFKA 3GQVA 1Q0LA 4NU6A 4J7UA 3RKRA 1SMKA 3WWYA 4IZHA 1K0UA 2JCYA 1V3TA 1P74A 4FD3A 4ZRNA 5IDQA 2O2YA 5KCZA 4WCFA 1YL7A 2YUTA 2Y66A 3CKYA 2WD8A 4YB8A 3D5TA 5COBA 3TFOA 4XEHA 4LMRA 4QUKA 4BOYA 5G4KB 3HE3A 3SC4A 4L73A 1W0CA 4WLNA 1LX6A 4R3WA 3MJVA 1NFQA 4J6FA 5DBFA 3BMOA 3U62A 2X9VA 3PIDA 3A28A 4NK4A 3UUWA 2NADA 2O7QA 3GVHA 5T8KA 2BFPA 2ZYDA 2PZMA 4BNYA 4KUEA 2H9IA 4II2A 3WQRA 3PGXA 4DTIA 5HM8A 4NBUA 3MTGA 5G0UA 4BS9A 2VOJA 4DPKA 2VRCD 3B1JA 2WMDA 2PGJA 4XWYA 4PLYA 4N5NA 4R68A 2VCYA 4RV9A 5TF4A 1UDCA 3VC7A 4KUGA 1VC2A 4RLHA 4ZJUA 1YJQA 3F46A 2Q2WA 2FPGA 1WZIA 3HN7A 3NYWA 5TS3A 2AE1A 3AOEC 4YQYA 4WPGA 5G4KA 4JLWA 2GSDA 1UXKA 4GWKA 2C0CA 1NTOA 3JQBC 4EW6A 4RQUA 1XR3A 1PJ4A 1ZBQA 3KLMX 3UKOA 4LSMA 4UVIA 1XIVA 1UZNA 2B0JA 4DPMA 4CUKA 1KVUA 1MC5A 4TWRA 1I24A 3ONEA 4GGPA 4OH1A 5JLAA 1PJ2A 5CEFA 2WYWA 5DBGA 3AUTA 2EWMA 2OOSA 4P4NA 1CF2O 1BW9A 1XQ6A 4GBJA 4E30A 1PS9A 5BR7A 3HNPA 4PLZA 1PJLA 1I36A 3CE6A 1NFRA 4CLOB 2X4GA 3HZZA 1U9JA 1Y9AA 2BFAA 2ZYGA 4TZTA 4D3DA 4YVFA 1PQPA 2VRBA 5GY7A 1ZCJA 2WEKA 5J23A 5ENDA 2E37A 3PJEA 3H9EO 3MJTA 1NVMB 3V5NA 4RVUA 4BNFA 1ENZA 3LK7A 2V6MA 1SAYA 5A02A 2C82A 2VTDA 2RBEA 4E3ZA 1T26A 1H6DA 2AHRA 2OGUA 3OECA 2GN8A 2VQ3A 4J7CA 4ZQBA 3WWZA 1I3NA 3M2TA 2NU7A 1WLYA 2VYVD 3GK3A 2X58A 5G0VA 2AW5A 1YWGO 5I7FA 2BFOA 4MVJP 3WICA 1XG5A 4RORA 5KTKA 4BKQA 4IGFA 4YJHB 1X0XA 1Y7TA 3U49A 5FWNA 2X1HA 3EK2A 3WGTA 4HKTA 1NPDA 5ICMA 1K89A 1HE3A 2AE2A 2ZTLA 2GDZA 1UP7A 1GZ4A 2XOXA 1I8TA 3WGZA 1BDMA 5HRUA 3DZGA 1SOVA 4IXWA 5G0WA 3GVXA 4D0SA 2D2IA 1HE2A 1N92A 3PHLA 1Y9EA 3PYMA 4RQTA 3ZV3A 2Q1SA 3PPIA 3WJ7A 2PWZA 2O23A 3OBBA 3U0BA 4CMAA 1NFFA 2C5AA 2NWQA 3PVZA 4DC0A 3D1LA 3OEYA 4A5OA 2I66A 1DLIA 2BD0A 4FSHA 4PG4A 2J3IA 2JD2A 4RPHA 2AEFA 2EF1A 4W6ZA 1GUZA 2YV2A 1I0ZA 1HLPA 1KY5A 4GX5A 4YJFA 3GZNB 5T67A 3QJ5A 1CRWG 4YQZA 2FN7A 3ZNNA 5DP1A 1ENPA 1IHXA 3P7MA 3OIGA 5TGDA 3WYCA 2HO5A 4M1QA 5ER9A 1Y5MA 5G2OA 5IJZA 1GQYA 4KWIA 4J49A 4H7PA 1PS0A 2FWMX 4O6VA 1SPXA 3ST7A 1VI2A 1VM6A 2F1KA 2Q50A 2YDXA 4M87A 4Z3DA 4KTVE 3VPHA 3W1VA 4QFCA 1JAYA 3ZNOA 3DZHA 5GMOA 3ZNPA 2GERA 2X5OA 3ZU2A 3NEPX 1M6WA 2VHYA 2X23A 3HDJA 1ADGA 4BKUA 3M1LA 3I23A 3RBVA 3L6OO 2VZ9A 1CIVA 4S3MA 2RH8A 1HWYA 3ETGA 3PHJA 1P1FA 1HDYA 1P45A 1O5IA 1GEEA 1KVRA 4UUOA 2QRJA 5JCJA 4DA9A 1OBFO 4FJ0A 4L0QA 2GCGA 3MWEB 3K96A 4PFJA 1ZKMA 4DXHA 1U28A 2V6BA 2ZIZA 3ROPA 3L4SO 4OSOA 4RPJA 3GNTA 4RF3A 1WAMA 1YQXA 1YB5A 3MJEA 2DFVA 4R41A 4BGUA 4CMKA 1DDOA 1GPJA 1KOLA 3JYPA 4CM5A 3JD4A 1SC6A 1MG0A 2Y93A 1C1DB 5DOZA 4FBGA 1SEPA 3GN1A 3M1AA 1YL5A 3L6EA 3GGGA 4IJWA 4F6CA 3C3XA 4M86A 4BNMA 3I3OA 1A71A 3FTPA 4J0FA 4YPOA 3V1YA 1H2HA 2X0IA 4QFDA 2WM3A 4Y98A 3D4NA 5IXSA 5A04A 3UCXA 1RPNA 1P0CA 2B37A 4BQPA 1NAIA 1IULA 1Z6ZA 3PRJA 4FR5A 3OJLA 1QYCA 3H3JA 1U1IA 1KYQA 3K30A 4PZCA 3AI2A 5A3VA 4KZPA 4RVSA 4ND5A 2Y05A 1MLDA 4ALNA 3DQPA 1WMBA 3FF4A 2OP1A 4FFOA 2NVBA 5IDXA 1XWFA 4RVDA 1N9GA 4DPLA 3KBOA 4R54A 4ZU3A 4R1UA 1PZEA 3DTYA 4WNIA 3H3FA 2ZB8A 1VE9A 3WB9A 2QIOA 3H9GA 5B12A 3DAGA 1EVJA 5KVSA 1BXGA 5IFLA 2P9CA 4L74A 4R5HA 1HDGO 2FRDA 4Q9NA 2G76A 1QV7A 4OXKA 1U5CA 1U3VA 2ZCUA 4NBWA 3KO8A 4TRMA 4IDEA 1L7EA 4QSMA 5T8KC 4D45A 1IL0A 4NZ9A 2R6JA 3OA0A 2B4RO 4XA8A 4E6PA 3IIEA 4CMGA 1ZK1A 2HRBA 1PWXA 2X0JA 4XDYA 1XKQA 4B4WA 1C1DA 3K9QO 4BO2A 2AEMA 5THKA 3GUCA 1UZLA 1H2BA 2YDYA 5EPOA 1I30A 2QX7A 4P8RA 3RUHA 2GD1O 1GU7A 3HDQA 3TFQA 3QVSA 5JC8A 5A9TA 2PV7A 2YHIB 4YAIA 1ZJZA 2DLDA 2ZJ0A 4DWVA 4WCFC 2NSDA 4ZA2A 4XIJA 5IG2A 5ENVA 2YQ5A 2SCUA 4R9RA 2FZWA 4WASA 1P77A 3WFIA 4BGEA 3ZCXA 1TXGA 3JQFA 1DXYA 2W98A 1EBUA 3AI1A 4F46A 1DC5A 5MGBA 4X54A 2IRWA 2W2KB 2X9GA 4B3IA 1NQOA 3WGGA 5L95A 5BSFA 5JPIA 1YS4A 3PQFA 4Z0PA 1NHWA 1E1LA 1XCBA 4INAA 5EINA 4CV1A 1ENYA 1ISIA 1JW9B 3I9JA 2JFHA 4WNCA 1CERA 4YJHA 3GAFA 4YAJA 4AJPA 1JLLA 2WSBA 1VJTA 3OM9A 2YQ4A 1DRVA 4XKJA 5L45A 1YOVB 3FTNA 1KY4A 4XQ9A 1E6UA 1T2AA 4H15A 1X7HA 4ITUA 4MVJM 4G2NA 4G65A 4NH4A 3R3SA 3PHIA 4XRRA 3KUXA 8LDHA 4K28A 3AFNA 3FSRA 1RM3A 2OBYA 1NX6A 2YYYA 1RYEA 3T4XA 1A5ZA 1W4ZA 2YHIA 4UVDA 3VPFA 1DEHA 4XJTA 5COAA 3ZHYA 3ZWAA 4E2ZA 1GV1A 1YGYA 3T4EA 3WSWA 4EITA 2W2LA 4BO0A 2PGLA 5CEEA 4MPDA 3BHJA 2J6IA 2IZZA 3B6ZA 4RDIA 3PZBA 3WIDA 1U3TA 1UDAA 3AFMA 3GDFA 4J3FA 5AYVA 4AJKA 2O7SA 3WMXA 4GPD1 2I5PO 2V65A 4CLRA 2QG4A 3F3SA 1HF3A 1KETA 3BTOA 5DN9A 1E3IA 1GYRA 5U1PA 1NWCA 5ES3A 5C7OO 3V1TC 1H94A 3FCOA 4J16A 3GDOA 3GMDA 2D0IA 3HB4X 1LQTA 4HADA 1WVGA 4XYGA 3DTTA 2V6FA 2UUPA 5DF1A 4OJNA 3WLFA 4S1VA 1EVIA 2Q4EA 4OAQA 3WQSB 2HKIA 1A27A 2UVDA 3ZHZA 1HRDA 5TJ9A 1HDZA 1PJBA 4GLLA 5HA5A 4BMNA 1Z73A 3U3XA 2Y1OA 2WE8A 4XGIA 1H9BA 1ONOA 2J5QA 3IMFA 3JQ6A 4M49A 3WX0A 1E7QA 4PG5A 3EMKA 3UVEA 3LVFO 3TDKA 3WNQA 2EKQA 3H5NA 4XGKA 4A10A 4CLOA 5GZ3A 1WWKA 2QRLA 3I4FA 4DQUA 2Y1DA 1C0KA 4CL3A 4NI5A 3ROQA 2DU8A 1UR5A 5TT1A 4CL8A 3ROKA 3KOUA 1EUZA 5AQ1A 1WXDA 3KXDA 1VJ0A 2J3HA 3EZLA 4AJNA 1I2BA 4FIZA 4YRDA 4I08A 4CLEA 3TNLA 1C0IA 4Z9XA 3Q9NA 1YH3A 4GSKA 3UF0A 3W4IA 5IZ4A 2BI7A 1P31A 3JQFC 1XU7A 3S2EA 3HQ4O 3UHAA 2C5EA 3FD8A 1VLLA 3TOXA 3TRIA 5DDIP 4YAEA 4PG8A 4N5MA 3MOGA 1S7CA 1WPQA 3H4VA 4OM8A 2Q1UA 3PFWO 1OI7A 3JCZA 4DMLA 4W7IA 3G3EA 5G4LA 2YW9A 3OFSA 3S55A 1I01A 3F5SA 1GDHA 1P3DA 3MJ4A 4J1QA 4OGWA 3SJ7A 3NT5A 5C5IA 2GR9A 4CLRB 1NNUA 3QWFA 4TZKA 4IDBA 1GADO 4U6SA 4LVCA 3QVOA 3GGOA
chains in the Genus database with same CATH superfamily
1YCHA 1M2OB 4B31A 2ERXA 1Q7EA 1JQJC 1UEIA 3ULKA 5TE9A 3T5DA 2PKCA 1EAMA 3P2IA 2VUSA 2YR0A 4V0ME 1A2OA 5KI6A 1VIVA 4QOFA 4YUYA 2OHGA 4GMDA 3K9HA 1IAVA 5EIBD 4RL4A 3ICWA 1CQWA 2B4YA 3D0KA 2BMWA 5CIQA 5E6SA 4GWGA 2BUAA 5T5QA 3T35A 3SY8A 1KIAA 1LSSA 2PO5A 3VNSA 2XCOA 2XVMA 4V3CA 3JZDA 1EM8A 2C8LA 4QOJA 1R00A 4IHJB 1WCWA 5BV0A 3OFJA 2VKTA 3QF4A 1LRKA 2B20A 1XZPA 1JHMA 4BO8A 4ZMSA 1XVVA 2HMUA 5KVQA 1R8YA 2CDRA 1K4YA 1WNTA 4R2HA 4RJKA 1UKEA 2MU1A 4S2EA 3VYVA 2GLTA 2UKDA 4JR0A 2QLLA 5INTA 3WNZA 2GEBA 1T13A 4YMGA 3Q7PA 3RNLA 3RK0A 2R1VA 1Z38A 3DAFA 3GJ5A 3EWSA 4QU9A 3FUCA 2XLBA 2Z2JA 3IOMA 1U8AA 3B3QA 3WOVA 1DUSA 4L8FA 5FIUA 4CM4B 2HBQA 4AY6A 1R8XA 3H2SA 5EGSA 2XEDA 1NURA 4CNBA 1W5SA 2GF2A 3HH8A 1EK5A 2Q49A 3SN6A 3GGDA 4DMRA 3K6SA 2JH9A 5DBEX 1I5RA 4KYVA 5FOVA 1JLHA 2W2TA 3R09A 3GFVA 2UYYA 3DKIA 2C2XA 4DCSA 1EQUA 4UAJA 2VPYA 1OI3A 4O2AF 2B92A 4WTOA 1Z4KA 3NT4A 2OAP1 3G1TA 3F6PA 2OV8A 4NESA 5C53B 4Q6WA 5BW8A 2PWAA 4BVHA 1T3TA 3MXTA 1I4TD 2EARA 5LXTF 3SQOA 1N2XA 1HNNA 2ZDQA 3OIFA 4U2DA 3UFXA 2BSXA 1W44A 4RHXA 4IVPA 1OPRA 1XRPA 3JVVA 1KP2A 2ZIFA 3DTVB 2AC2A 4O4HF 1U5BA 2Y77A 3AJRA 3I04A 1XQWA 1LC3A 3SFTA 4C6SA 1IE3A 5KJ1A 1XYYA 3O3MB 4I14A 4BYMA 4LYJA 1WXFA 5B58C 2ATVA 5F9HA 2J0QA 4RH3A 1YOBA 4R51A 2ZANA 3I37X 5FI3A 5JG7A 3R6WA 5JNWA 2ZXFA 4BB9A 5JZSA 2GJ4A 3DE7X 3QY0A 1EX1A 1MCZA 2UUOA 2C07A 3CX3A 4V24A 1LPOA 1XNGA 1QE0A 2R1TA 3K1AB 4OKIA 2GK3A 3HP7A 3W8DA 1DAFA 3C24A 3OZBA 4EQ6A 5DP2A 2FG5A 1ZK0A 2P6PA 2WWIA 1CB0A 3CIOA 1AGNA 4Q3NA 1A4IA 3EBLA 2VAWA 4INJA 3RSZA 4KACA 2UYHA 3OE1A 1V4VA 3PDJA 5FBKA 1W73A 4WNYA 1T9GS 1XWIA 2ZT6A 1H93A 1KDRA 1C9KA 3ENNA 1KEVA 4K5QA 4N1AA 4D0RA 3A6GA 4MULA 4NX2A 1VSVA 2QQEA 2V6JA 4TWJA 1ZA1A 3EVAA 4M0FA 1LS6A 4S1PA 4ZEWA 1U0SY 2DUJA 1SM4A 1ODTC 1NYTA 5AKZA 4CEHB 2YJ6A 2PT5A 5LLTA 1GTL1 4ECEA 1XNHA 2Z2IA 5LP6C 2VWGA 4B84A 4FKMA 3TE7A 2P0EA 3EPLA 2BTOA 1K5GA 1P7CA 4F9TA 3MILA 4RK7A 4W8OA 1EXVA 2PCJA 4D74A 1MBZA 1BEZA 5AXDA 1L7NA 1MAWA 3KT0A 4MVYA 2FQQA 1GRCA 3WDSA 2C2MA 4JLSA 4FYVA 4EK9A 2B2NA 1K2WA 1N2BA 1W94A 2H2FA 3PF9A 3AILA 3CUTA 3L4EA 4R69A 3R7FA 4G2TA 3ZHQA 4B4KA 5BR8B 3T3NA 1D7AA 1RHMA 4PZAA 4QM7A 1E7MA 5M7EA 2XOKA 4Y9SA 4JT2A 1Z9BA 3UJ7A 2WM2A 1JFVA 3CF4G 4OHZA 2BJHA 2BMFA 1KKMA 3LLMA 1W581 3ER6A 5IDVA 1V37A 3JSXA 3RC8A 5AKIA 4ZGBA 4ND2A 4RZSA 1JJVA 5A3RA 1LQUA 3P9ZA 1QTQA 3LT0A 1UWLA 4ZODA 4RF2A 3EGCA 3JU3A 4O2LA 6PFKA 5I5GA 3CMCO 4GH5A 2YJ4A 4BJHB 5C52B 3CVJA 5JMPA 4QICA 3WR5A 2XNDA 1KC1A 1ZOIA 4NIMA 1OA1A 1ZM4A 2P9HA 3D8SA 1BA2A 3IV9A 4FX5A 4LYGA 4NFSA 5D3MB 3QLUA 4TMKA 5K20A 2B94A 3KEFA 1BDHA 1H69A 4OXYA 9LDTA 1DKQA 3KQHA 4E09A 4YYZA 1YNOA 4DLNA 5AW9A 4ZTUB 1P1CA 3C7AA 3EQ2A 1OAKA 4W99A 3FMOB 4L51A 2HLDA 3GPDG 4KWEA 3S1AB 4E31A 3A2KA 3JTEA 4PFQA 2IYNA 4BDSA 1GPKA 1YRYE 3G2JA 3OZTA 2BEUA 4AFNA 2UUBB 4AL4A 5LZ9A 3RHZA 1RLUA 2CLEB 1FRVA 4HEQA 4OHMA 5IM5A 1TOAA 2FQYA 2QI9F 2IW1A 2J46A 1SHTX 3KQNA 4IO0A 2IX9A 1O96A 4K9QA 3WP0A 1G8SA 3BWDD 1YCDA 4MVJH 3Q87B 2WFMA 4C6TA 4F4DA 1F1JA 2HTEA 1OXVA 4KVGA 3LGAA 3EQ6A 1P4GA 4KR0A 3WL7A 5KQRA 2W8BA 4O3FA 1AN9A 2Q2VA 4XGQA 2G3YA 4DUPA 1VIAA 3D4IA 1T9AA 3FDFA 4BIIA 3GJXC 1YA6A 5E7MA 4PZ9A 2GRUA 3VKVA 4BLOA 3G5LA 5C4GB 1ZHOA 4IHAA 1H22A 1H5UA 2EERA 2CJWB 3IDQA 4CUZA 5CB4A 1HZZC 2ZT7A 2J5RA 2WVHA 1V8FA 4Q3CA 2MDTA 3DM9B 3NH9A 1RKBA 1TEHA 3PEUA 4LYHA 4YRKA 3HGTA 3OCWA 3B70A 2ZR7A 2D06A 5JSYA 2L82A 3K0SA 2FQWA 5LL6P 1U7TA 4LQLA 1DIRA 3H99A 3URMA 1B00A 3PNKA 4PGFA 1BVUA 2PKQP 3NGMA 4DIMA 2BUBA 1S8OA 1TO2E 2C1XA 1W88A 3NWPA 3OICA 3QX8A 4JEMA 4QRDA 2X19A 1LI7A 1XTIA 3A1SA 4GAEA 2ZWVA 3D3WB 5JO9A 2IGBA 5K8UA 3TOVA 1UBFA 2OD7A 5TMPA 5FR1A 1R18A 1MORA 2H7YA 2VJDA 2XD9A 1MQ8B 1QP8A 1T36B 1U0NA 3D4OA 4GI3A 4MW4A 4DNFA 4P36A 1KMNA 1SKQA 1YSCA 1ZOSA 5HTKA 3M6IA 4K0KB 4Q4JA 1UIRA 4UHJA 1IN1A 1X7ZB 2P69A 4DLVA 1CQXA 3L01A 2JVIA 1Y8ZA 1TEZA 5AVUA 4IICA 3BB1A 2R48A 3JYOA 3JV7A 4KXVA 3QKRB 2H2WA 4E51A 1GTSA 4PHFA 2CXTA 4PX5A 4GDMA 3GJ4A 1C5KA 5B3JC 5JH7B 2ZIVB 4JJGA 4WXYB 3FH0A 3O21A 3OEWA 4TTQA 1QCCA 1YR9A 3FHOA 3QLVA 5CA1B 1W48A 4A3SA 4HDMA 2MSKA 4OTZA 5AI5A 3PD7A 2DERA 1H3EA 1SQ6A 1IQPA 2RHMA 821PA 4UREA 3HR8A 3TLAA 3KWLA 4D5GA 2FCRA 5T4HA 2IKQA 2AOUA 4E5SA 1KS2A 2Z08A 3K0CA 5AIBA 5M5BA 4DUYB 3CNLA 4JYMA 1YA4A 5H82A 3TJRA 3QPWA 4G1VA 3WGMA 3ML1A 1HMPA 1I1NA 1VPDA 3FN4A 3DDSA 3FVRA 2ZI5A 4LHXA 4M0LA 1WBDA 1WMSA 3IQGX 3FBGA 5ADHA 1ZJ4A 2XF8A 1W9MA 3FCXA 3KT6A 4YRCA 5L3ZA 4BAZA 2VDPB 3WLJA 1LBHA 4BRUA 1OR8A 2RGNC 2A9VA 1HLDA 2CJXA 2EGHA 4YMIA 4UAVA 1UQRA 2O8DB 4ZQEA 4ZU1X 3HCOA 3TZQA 4PIPA 1FP6A 1T1SA 2RGCA 2RGEA 2CDCA 3AHFA 1BDJA 2Q3FA 2XVYA 3NHWA 4GNKA 5I4KA 1E5DA 4UU8A 2YZKA 4TTRA 3F5DA 1M0WA 5DBHX 4HUQA 4F3CA 3NCHA 3AVXA 5JASA 1A2BA 2JKVA 1TZ2A 3I0ZA 1XALA 2ATCA 2G28A 1DIGA 2V4ZA 3IQXA 4XYBA 1GDTA 2NYVA 4KQ1A 3SQMA 4P93A 3TNFA 3QX9A 3K9LA 1QVRA 4BNLA 5EL0A 1MHTA 2JAUA 4A0RA 4ESHA 4QBIA 4YP5A 4CKZA 3KWFA 4AF7A 2D0OB 1M8GA 4X7RA 2X8LA 1UQUA 3URKA 2LKCA 2JGNA 2UAGA 1Q77A 4QAQA 3ZZ0A 2NZVG 3NONA 3IPYA 5AJWA 1QQ7A 2IPAB 5JU6A 4L8GA 3WNBA 4IX1A 4TQ9A 3C1OA 1J1UA 3IBFA 1YE3A 4MQ6A 4ZC1A 3DCNA 2Z0MA 1ZX1A 2CNNA 4R8SA 1JB9A 2H31A 2E21A 1KJYA 1N1DA 2C9MA 3DDOA 4P32A 4PZPA 3SC6A 3WHLA 4V3BA 1MO6A 1W8DA 3PJDA 3SNHA 2O8BB 4EZIA 1VLQA 5J1SB 3Q40A 2JB9A 2J9FA 1LWNA 1PR9A 1T4CA 1UC8A 2IEGA 2BHRA 1ZGHA 3EIXA 3ELBA 3IXLA 3DE4X 1PU2A 4EUHA 2F00A 1QX3A 1GQFA 3L07A 5C7YA 2GOYA 2JC3A 1JV2B 3DBHA 1L1FA 4HAZA 5AOVA 3ZCQA 2X9NA 1XU9A 2QT9A 3A9SA 3L6DA 5FTWA 4PO1A 1GV0A 1U2QA 3A3PA 5IN5A 1HETA 4HNHA 1JVNA 3R7WB 3R0IA 1EHCA 4BNZA 4CG1A 5FLEX 4I4NA 1ZNYA 4LMBA 4ASUD 1VG0B 2HPZA 2WLSA 3PPWA 1DKRA 2X22A 3F4KA 1T3SA 4J0CA 6ADHA 2BBOA 2POCA 3KSRA 3DE1X 4AO6A 2A0XA 5I47A 1M75A 3VXKA 4ERNA 1UP6A 4H6XA 2GX6A 3LVRE 4BMCA 1M2NA 1N2HA 1U2TA 4JQZA 3KYBA 1U8CB 2AYXA 3UHFA 1E9BA 2VA9A 2ZJ2A 3K9GA 1E5LA 3ADPA 4BP8A 2ZI6A 5JQGF 2TMGA 2PIDA 4IG9A 5GGXA 5HPYB 2WTUA 2NSHA 3EPJA 1ZICA 1WF6A 2E55A 1XF1A 3F67A 3MUOA 2YIVX 4UULA 2CMGA 3O8LA 1PUJA 2AUTA 3L02A 2ACVA 4IIHA 1BOFA 4YJ2B 4HTAA 1AKVA 3PE6A 1CY2A 3AEZA 3LGSA 1E3TA 3OMXA 4YCAA 2RCYA 3RS2A 3GU3A 4CF5A 3QEBZ 3H2GA 1DO2A 1Z2DA 2FN4A 2Q3DA 3ITNA 5D7NA 3RTGA 3VJRA 1PHRA 3HL0A 1SZDA 3RNOA 3W8RA 1EGVB 3Q3HA 4G23A 3UQZA 4GE3A 1V4NA 1YS1X 3V4ZA 4DDHA 2IUYA 2W43A 5A7FA 3TCKA 3DHNA 3VU3A 1DUIA 3A9WA 3FNHA 2C4HA 3SHVA 2NOAA 2GFIA 4KRGA 1VE6A 4BO4A 2P9GA 4MP3A 1QC5A 3LJKA 4OAOA 3W7AA 5T7BA 4HNUA 2XGGA 1U7ZA 4BKOA 3UENA 1IB6A 3HCAA 1XWWA 2Z95A 3GPBA 5CA0B 2PS1A 2WTBA 1YB1A 4R3UC 5JXHA 5LZ2A 1A04A 3KQLA 2JFYA 3OI7A 4XWTA 5CVUA 4YT5A 1YB7A 1E18A 4PHTA 1ZW1A 4XASA 3BQMB 4AY2A 3BFJA 3FGPA 2HXYA 3DMDA 1AHNA 1RJ9B 1GA6A 1NBAA 1V16A 1L7BA 3COVA 4KAFA 4IQ0A 4JMLA 5DTRA 2NVUB 3S44A 4LI3X 7MHTA 3QNUA 2W00A 1G63A 3WNCA 1OFUX 3O91A 4GSYA 1W5TA 4IDPA 3AB8A 3BXZA 2DY0A 2ZE6A 2Z6AA 1R37A 1J06A 2WSIA 5HILA 3QYPA 3OC0A 4TKLA 3HCNA 5D5QA 3NBFA 3NALA 4OHUA 3VAZA 4F92B 2RGAA 2HYDA 5K0LA 3COWA 4IIVA 4HYTA 3U7JA 5KIAA 3E5HA 5B6JA 3VGJA 4KDFA 2IDZA 3D7RA 5FCDA 4ZZ3A 4LKOA 4LJSA 2W0SA 4QNNA 4LDZA 1I3KA 2DH6A 2VWHA 2HEGA 4URHA 4Z1OA 3BM5A 1ZU5A 1CUAA 1AS2A 1TM1E 3F8WA 1GPNA 1FSSA 4QPJC 2I4IA 4HS9A 2KS6A 5BQPA 4L3VA 5CD9A 3M5PA 4PR0A 2VF8A 4QGAA 3LXUX 3OQOA 2HUNA 2OV4A 5KCMA 1R9GA 2BDTA 4JOCA 4B3CA 2XDAA 5IBCA 1CRZA 4UASA 1UWCA 4FN4A 3OHPA 4RVNA 2FZKA 4J0IA 5K8VA 3PFBA 2DXIA 4FYPA 2DPHA 3E5MA 4K05A 5HIIA 2IEDA 4Q7JB 5EFZA 4WUVA 1GYQA 1YJCA 1ZMTA 4U2KA 4DR2B 2VQFB 1IN5A 3F6RA 4D4IA 4K7JA 5A6VA 1Y7LA 3C5EA 1UCFA 4K6OA 4Y8VA 1VG8A 1S3SA 3NATA 3M9XA 5JS7A 1KNQA 4CM9D 2DVMA 4MGEA 1NXSA 5JFTA 5A62A 1N2EA 1U0EA 2DFNA 1DIOB 3RC1A 4KXYA 4Q12A 4LNUB 2M2IA 2O3QA 2P5UA 3T1HB 4EX6A 5BQOA 3FDIA 4MVJA 2V7WA 1XJ0A 1CUUA 2Z58A 2P4HX 4QFMA 1J25A 4F6RB 1Z29A 4MQ4A 5L3QB 2QTBA 3DOJA 1OBHA 4XPIB 2X1MA 3HFRA 1UKZA 5KYGA 2QTCA 2P65A 4PU0A 4V0QA 3ZCUA 1G9TA 4GL2A 5K3OA 4W82A 2GN2A 5TVKA 4JLPA 2WJPA 4AY5A 4DBVO 4D6YA 5JS1A 3D2LA 2O2GA 3UG6A 3EGDA 6CHYA 1AKMA 1CRLA 1Z7YA 3WTCA 4DUZB 2F64A 4UOEA 1WULS 2DPXA 3KZNA 2Z5LA 5IF3A 4ARBA 3P9KA 1LU9A 1YS2X 1P4HA 4GW3A 1P73A 4KR9A 1NKSA 1FLDA 4TOIA 1A7KA 2WFLA 3CE9A 3DEIA 1BOOA 2J6CA 4G1BA 1VCNA 1ZDMA 3BXHA 1P8JA 1Y5RA 1AZSC 1ZRNA 2NV6A 3PC3A 4E12A 1NBIA 3QHAA 3WWYA 4X66B 1BDBA 3QHQA 5DHUA 2HPVA 1T4CB 3C16C 1BS1A 2E4XA 4I5EA 2EBHX 4UPVA 4MDFA 2BW0A 4L95C 4B6OA 1LY1A 1MFZA 3RROA 5DNVA 1RWNA 4EY6A 1S96A 4BZZA 5LQMA 1E6KA 2AXEA 4Z3KA 1YR7A 2BRUA 2GBFA 1WCIB 3MJRA 2PAFA 4WBSA 2BLLA 2O2ZA 3RSOA 4R1TA 2GEVA 4I4LA 3SQDA 1YF3A 2CXPA 2P4SA 5KX5B 2J3KA 4M1WA 1QIEA 3COZA 4OLHA 1RXYA 4V0RA 1FJXA 1T25A 1MB0A 5A4MS 1ZJYA 3R24A 1FUUA 3IGFA 4JK3A 4XARA 5FBHA 5I51A 1X19A 4ROSA 3KWMA 5FHRA 1A5SB 4IDFA 3T0IA 1G18A 4BNGA 4EHKA 3E7DA 4RV5A 4UXIA 3BMNA 4B6FA 5J5VA 2WF5A 2C4WA 3G7NA 3QY9A 1JA0A 2G17A 2OSBA 2P90A 4I2NA 2VOEA 1UT8A 4L78A 1X86B 2CUKA 3WKDA 2Y0BA 1SEVA 2ZB3A 2FXVA 3C70A 3GB9A 1XEWX 1TJYA 2UZ0A 2ZAGA 6Q21A 1FQWA 3AR9A 2I2BA 4AZ3A 1JTEA 1N6HA 1YFKA 3FW1A 4D6PA 3GELA 1HFKA 1B8VA 1QBGA 3OT4A 3ZWMA 2C58A 1PJ8A 2VLIA 1VTKA 1FTQA 3M6UA 2FWJA 5CBKA 2IYAA 5JADA 1GG9A 1W6RA 2IWHA 2F17A 1TAGA 2PA0A 3B48A 4NZNA 1HI9A 4GMHA 4U4AA 4PEVA 1UKBA 2PH1A 1KDVA 5THXA 2FZEA 1O95A 2XTNA 2XYPA 1A5TA 1EQAA 1J8QA 4HRVA 1JHYA 1PBNA 1Y3HA 1ZRSA 4QUGA 1R0RE 4WOBA 3PNPA 1DKOA 4MUFA 6NULA 3MMNA 3B1XA 1L5RA 4WKPA 2G1AA 3NFYA 1GTJ1 2A5JA 3BXPA 3GLFB 5EIAA 2ZREA 3RLFA 3ME5A 2A3NA 4LDAA 1L5NA 4GICA 5LKRA 1IWBB 1E2FA 4MLZA 2G0TA 2Q6VA 3H1TA 3KKMA 2BKEA 1N78A 5KYVA 1A7JA 3EDCA 4KMSA 1P60A 3PSHA 3IV7A 4YFYA 3NKLA 2GDJA 4KXWA 4RJTA 4ZMRA 3IEMA 2Q1TA 1BFKA 2P5YA 3N2GA 5J4KA 1E6LA 1IUKA 1OYVA 2I33A 1DAHA 1AY0A 1G6HA 4ZJZA 5KPJA 3U44A 5CA1A 4KAJA 1L5OA 1KZ6A 1U6JA 3BIXA 1BMDA 4ND1A 1OKKA 2BY4A 5DCYA 1ISJA 1OOEA 1ZN2A 4AX4A 4DJTA 2VJYA 3A27A 1FS5A 3JALA 4C30A 3RUFA 1E6WA 2FX5A 1PDWA 2RIRA 4QBHA 4HVLA 2QUHA 4YDHB 1MG5A 2X0RA 1SKYE 3FG9A 3O2SB 2H1IA 4MUKA 1IY2A 4AJHA 1RQ7A 1MB9A 3DEZA 3IAHA 5DHQA 2BBSA 3QE2A 2CK3A 5GGYA 2WT8A 2VK8A 1G2QA 3ROXA 3HABA 1CUWA 1QDLB 2WJ3A 3NFRA 3TSOA 4DWJA 3UK2A 4EDFA 4LISA 3TECE 2ZAIA 2H3EA 2WOJA 1FDTA 1WTAA 3BD7A 1JQKA 2HSDA 2ZWOA 3GLKA 4K88A 3OQPA 3QQ5A 4CN9A 3LPLA 2H08A 5EESA 4MYDA 2Y67A 4JB2A 3FYUA 1XJWA 3CLUC 4GG1A 4BKRA 4B7CA 1AMUA 2MSCB 3QXSA 1C9NA 2IHZA 5EYPA 2QE7A 1DXOA 4R2XA 4CM1A 5DLYA 1RNLA 1K8QA 2DCMA 5FOUA 2ZVDA 4UD6A 2J7PA 3SM3A 4D9NA 4GI1A 3O84A 4JBIA 2AOTA 1KYVA 1GCIA 2I4TA 4NJMB 4PZDA 1SG0A 1JKFA 3DZDA 2XZDA 4RIHA 1JA9A 3S1SA 2DJ5A 1OYWA 5CM2Z 2A9QA 4MGZR 3K73O 3E7WA 4TSKA 4YYEA 1EXWA 3VA7A 4J1SA 1TIBA 5EP4A 4EHBA 4EVSA 1NMZA 1Y33E 2Q6TA 2SHKA 1IG3A 2VDNB 3ENKA 4K6FA 4L4ZA 1OSNA 4YP1A 1P81A 4B17A 1H2YA 1V43A 1G66A 1BCRB 3PNMA 3ZGXA 3BH7A 1TJNA 1XTVA 1QB8A 1SCJA 1TM7E 4Q3KA 2A14A 4F7WA 3O4HA 4C4SA 1JQBA 3KAKA 1FP2A 2ZYRA 5CP8A 4BMSA 1BQEA 4EUEA 4V0SA 3IYLW 3AVWA 2ZKLA 2ZYIA 1XYGA 1ECLA 3FI9A 2QTTA 4OFZA 3DDNA 3AEKB 3MLEA 5FOTA 4KSBA 4BASA 4QKQA 2RGNA 2F8SA 4JP1A 4LHSA 2V7UA 3BRQA 1UMDB 2O52A 3TSCA 4XYEA 2OT3B 3OTIA 5BSTA 3UGTA 3DULA 4J1TA 2D62A 4P7GA 2VZLA 4LHYA 3PITA 4XR9A 2BFNA 3KIPA 2J0VA 2XNDD 4NCJA 1MX9A 3O3OB 4ALKA 4DJJA 3R40A 4KXFB 2AH5A 2Y4OA 1DV1A 3RANA 1OY1A 1JDTA 2I2WA 3AW9A 3QLEA 4NS1A 1H1TA 1KPHA 1P39A 3F9IA 3WWCA 4EH1A 3KTFA 1GQQA 2PTHA 2R5NA 4JBHA 5HS6A 1F2VA 1RM0A 2EKDA 4RABA 3ZY5A 5HUHA 3HWRA 5JDCA 4JI6B 5E95A 5SV2A 5CIYA 1L5QA 3OAAA 3K8YA 3DE0X 4F1JA 5CT5A 2ZAYA 4GFDA 2FOIA 3KOXA 3WRYC 4RACA 1Z07A 1P2VA 4KCGA 1UPBA 4NV1A 3OF2A 3IVRA 3VNBA 1HLFA 5KYKA 3V7YA 2J1LA 4MUBA 1DDIA 1RI1A 2A5GA 4PC3A 3ZGOA 1WJGA 2Z1DA 3A6HA 3OCVA 1QUFA 4XJXA 4QG3A 1AZLA 1BXGB 1RI2A 2COKA 3NTQA 4JHLA 4C29A 1QIHA 4LOJA 5KWVA 4MB0A 2B99A 3HNRA 2OPHA 2PSFA 3KXPA 1BN7A 4TMVA 1VMDA 4MWCA 4AG3A 4XE5A 2NU8B 2C2GA 3MD9A 3EJWA 4R2JA 1YB6A 2FETA 1M8KA 4K2HA 5EKTA 3TMYA 3T41A 4EA9A 5IT4A 1OXUA 3T1NA 4D3FA 1IVSA 1H2FA 3LP8A 1Q20A 2IEIA 3PG5A 4CCYA 5I7VA 3UB2A 3O4GA 1G20A 2SKDA 3KHUA 4D9EA 5I7EA 1JEYA 3JWEA 4QBKA 3GJQA 1WOYA 3RFFA 2BTEA 2K7ZA 3Q0IA 4CM7A 1JKJA 4Q3AA 3IP8A 3F73A 3IQZA 1ZC4A 3R3ZA 4PNEA 5LMUB 3AUUA 1R0SA 2AJDA 3A6JA 2QRGA 3WK5A 3Q7TA 1YR3A 4L9AA 4DRZA 4ZK2A 5L3QA 4Z9AA 2W6OA 1XZAA 1K92A 3I1FA 3MWGA 3NYQA 1I80A 4HDRA 2FUG6 4BV9A 2BDEA 4WEOA 2OBLA 1HZZA 4S05A 2OLJA 2G9UA 1GPYA 3P9SA 3IULA 4NHEA 4V39A 1U0OC 1G38A 3H4IA 5JAQA 3A6DA 4D57A 3GAAA 3SBOA 3AF2A 5C1DA 4MYSA 1CF9A 5CG1A 5DXJA 5LOVF 2RGXA 1LTHR 2CGEA 4YC7A 1T1JA 1E4EB 3IVGA 2Y68A 4PNZA 1P5JA 1F7VA 2J45A 1Y4SA 2QMEA 2Z43A 3C2QA 3D1VA 2VYND 3N8DA 1PDVA 4AJEA 5AIAA 1FNSA 1KFEB 5ICSA 3SNKA 2QNBA 4Z4FA 3L7YA 4ZT3A 3S8MA 2CFTA 4FOPA 1Z12A 5B53A 5BWOA 2J6BA 1DI0A 3PENA 1QYRA 1IVNA 2BLNA 2DBVO 5B30A 1I10A 3I9KA 5BUQA 2F4VB 2PUTA 2IOFA 1ZIPA 1P1HA 1W9HA 3ICCA 3MJCA 4ZEMA 3VR3A 2W6QA 5KVVA 2B8TA 2HK7A 2N46A 3NHFA 4LJRA 2QRKA 1X7ZA 3R5XA 3WGKA 1PNRA 1P3JA 4BE7B 3OEED 3WYGA 1MW9X 2P79A 3P97A 5LC1A 4P5DA 5CVTA 3UPUA 1ZITA 1P7ZA 3OM1A 4MIYA 3THSA 1SIOA 4JBYA 3PGKA 4MB2A 1TRHA 4MTLA 5H70A 1HEUA 3HJBA 3ZDQA 3U1BA 3D43A 1THTA 1OWOA 1TW2A 3FZQA 1ESCA 1GGEA 4Y1FA 4DMMA 2P9BA 1C81A 4Q1DA 1OH6A 4MUAA 1JDPA 1ZUNA 4QELA 1PNOA 2RDMA 1VB3A 2PHZA 1V0JA 3WNVA 5AWFC 1Q7GA 3PLAE 3KYJB 1SUIA 1QZ3A 3WMEA 3TGPA 1G0OA 1UT6A 1PO7A 1ZQ9A 2O0LA 2R751 4XEUA 2CDAA 2GAIA 2J7KA 5FI5A 4L76A 4L8WB 4QWMA 1JDVA 2B9EA 2IYSA 2YTZA 3F3KA 1P2GA 2XD4A 3KEGA 2XAUA 4QYSA 3C4VA 2RGGA 3CXRA 5IXJA 3SS7X 3NRJA 3KWJA 3EX7C 5KOIA 1UAAA 3PC6A 4A2PA 1WM1A 4H2DA 1EM8B 5BWMA 2B1IA 5EHQA 5F52A 4HEJA 4KIUA 4D43A 3EGEA 1FUEA 1P6XA 3GFTA 4X95A 1K4MA 4DDTA 2V58A 1DG9A 5EMHA 2HRCA 4AK9A 1ZK4A 4AS1A 3GHHA 3KVYA 4LDRA 5B7QA 3CVYA 2C61A 2A9FA 2EP7A 5EIOA 3M8KA 2OMKA 5ALUA 2PXAA 1QQAA 4AYWA 5A2GA 3G7UA 2ODWA 3IUJA 4LXHA 5LYJA 3W06A 5JZOA 4IXNA 4WWHA 1KH1A 3T7EA 5CFPA 3A3KA 3AHGA 4GKVA 1TUEA 4J0HA 1XZGA 2F1IA 2XBLA 4AG6A 3GROA 2OECA 5ESDA 2QAGA 5BN3A 2YY7A 2N1BA 3ES9A 3GFPA 4G9BA 1JWLA 2HWXA 2PL5A 3R3YA 2GN6A 4WBXC 3WIEA 2PCLA 4DIOA 2F67A 4ZO9A 4LX0A 2D1RA 1WQ3A 4EBFA 1HFJA 5K8LA 3K0FA 3ONDA 5I9MA 1NAHA 1OF1A 2B4TO 4R98A 3N2KA 3M70A 4Q1FA 1X15A 4IGEA 5K03A 4OI0A 3HKDA 3O9MA 2ZIXA 2VH5R 1CJTC 3ZZ1A 2XUQA 1L7XA 3GAZA 5E9AA 3D8BA 3VR4A 1ULHA 3S2ZA 2FX2A 1PFQA 4L8YA 4C0AC 4TUYB 4AMUA 4ZVKA 3N0VA 4DREA 1XL0A 1U7OA 2BZ0A 2ZS8A 2O8FB 2F3TA 1ADCA 3R41A 1C7ZA 4HAXA 2FHSA 1V6CA 1VL6A 2OCXA 4W5JA 5B1YA 2EHDA 3MCZA 3HN6A 4P0PB 4HFJA 1EFPB 1L2TA 4ND6A 3NOQA 1QR2A 3RFXA 2OVFA 3MTIA 3AR6A 3MWEA 4B2YA 4OQQA 1QRRA 5LOVA 3ABSB 2P4QA 2W6IA 2FFBA 1P62B 2JCXA 3GFRA 3QJYA 4UM7A 4XGNA 5FUBA 2CKMA 3P71T 1ISFA 3EOAI 3B2QA 1B3BA 1GQ2A 4Q9LA 3JQCA 1W75A 2BKAA 1P0IA 2Q5EA 1HY3A 1XPJA 1ZAKA 2VNAA 3LKDA 4K9OA 4MXDA 1D2RA 4LCJA 1E99A 1VG9B 3RG2A 2Q3JA 5U9CA 4EENA 3EB9A 2WMNB 3BD8A 3FKSA 3OMLA 3DVRX 1KHHA 3CJRA 3U3MA 4C06A 1U94A 1KDYA 4E2XA 3OG9A 5JY1A 4CXMA 1D1SA 5DXAA 1LC0A 4A23A 1SH7A 5I9IA 2ANBA 1X1EA 1XCOA 1IEWA 2OZLB 1OTYA 3KSZO 2QTGA 5CCDA 4C78A 1S5PA 4CIXA 2BFMA 5AXCA 4CODB 3K35A 1R0ZA 1NI4A 4BO9A 3SKYA 1QX4A 1RR6A 1JUDA 1Q91A 1XDSA 3ADOA 3HWWA 5E2IA 4YJ2A 1O8BA 1JG6A 1TC1A 3BE5A 3ETDA 4D46A 2IYZA 5EE0A 2EKLA 2ZQ5A 1BHSA 1F3LA 3GCZA 2RC6A 3BCRA 3LU1A 4KTTE 2J0UB 3U4MA 3A1EA 3RB8A 3WFJA 4W1SA 6REQA 2OXIA 4IJ5A 4C4RA 2NZWA 4QULA 1HORA 3T7DA 3ETHA 4G1EB 1W0KA 2D1FA 1XELA 1PAUA 3CN9A 4RWZA 4DYDA 2IPOA 1FSGA 1CY1A 3HFGA 4RGQA 4WJZA 3WL4A 1VHLA 3Q9LA 2EFGA 4G4IA 2QRMA 4OG2A 2ZR0A 1DJQA 4XX0B 1WVIA 3S7ZA 2FSIA 2WK1A 2BEWB 2CSUA 4MQFA 4TS9A 3IUSA 4B2LA 5J58A 2VT7A 3EH1A 1ZPDA 4I4IA 3RU7A 4BCBA 1EE2A 2NVOA 3OZVA 3E0QA 1UBUS 1KEPA 1L5SA 3AEYA 4R81A 3JWPA 5BNWA 4C89A 1MIHA 2VRWA 4GPIB 5HIKA 4FEAA 1FFXB 2PUDA 2G63A 5A7HA 1ZD4A 3M82A 5KQPA 2HN9A 1JXMA 3BSFA 3CF4A 3EJ6A 5TS2A 5EQTA 4POAA 1RI3A 4CMEA 5AOBA 1IEQA 5FAKA 1Q0TA 1KOGA 4F3KA 4EY7A 4IXDA 4IILA 1MC1A 1NQVA 3HB9A 1GGMA 4AAYA 3U7IA 2PGDA 4LA4A 4DLSA 3M49A 3VNUA 2G1JA 1UH5A 1IN8A 1B76A 3KKOA 3MINB 3GEBA 4LRTB 4BN4A 3T7RA 4DCNA 3EEQA 4LBWA 3B12A 2G8LA 3R5TA 2REXB 4JDUA 2M98A 3TM5A 1E79D 5BQXA 4UJ3A 4Q1CA 2QAIA 1TJPB 4RGBA 4E2FA 4KPEC 3GLHA 2X0FA 1I2ZA 3HXMA 2H07A 1V1RB 4KFUA 4J29A 4C2BA 2IUUA 4IP0A 1LJ8A 2VCHA 3TXXA 2RHJA 2JHPA 4FU0A 3EVTA 3ITEA 4PPQA 4X20A 4JXZA 1UDBA 2QIPA 2QTZA 4S24A 1R8JA 2YHAA 4JEUA 1E0JA 4YDRA 4X85A 1OH5A 3OUUA 3R3VA 2PMBA 5CURA 3F6SA 5DTJA 2VN8A 3D2CA 5MN4A 2R6HA 4TVBA 2M1ZA 4M7WA 9ABPA 2CEAA 1WU7A 4LWQA 2ZRFA 4MDYA 4OOFA 5ALHA 2QMUA 1XA3A 3NQ41 5AUNB 5BNZA 1SXPA 2X7XA 2BI8A 5BNIA 1JIVA 2FPSA 2W4QA 3KPJA 4LFBB 3R6LA 4OQMA 3SVLA 2J30A 5KNCA 3PEYA 2HL6A 3C97A 3OTGA 3I04M 2ZSKA 1KYXA 2PD6A 4TLEA 1E0AA 2C3PA 5KBYA 3QXHA 4L22A 1PE0A 1REQB 2WSYB 5E4FA 4N47A 3HRHA 4UE2A 2ZRDA 4NU8X 5HXAA 2PMFA 1D7OA 2X7HA 2D7JA 2ZIWB 4IOMA 4OJMX 5HFAA 2FMTA 4U3JA 3MNFA 1HNZB 3SR3A 1Y5NA 3WADA 1ORDA 2A92A 1QGZA 3AXTA 2G9VA 4N6GA 4MPTA 3ZU6A 3H65A 1QJ4A 2PSDA 1K0FA 3RSLA 4EKIA 2X1LA 5BO5A 1P2FA 1RS0A 2H1VA 3BZBA 3BMQA 1J42A 3HDYA 2NT4A 3PE4A 4O5AA 3T3IA 1V9SA 4KR3A 3V1NA 4IH1A 1L8OA 3NETA 4NPAA 3NBZC 2HRQA 1GSHA 3K92A 1T2FA 5IJAA 1Z0JA 2Q2OA 1BRMA 3N6RA 2XMRA 1ECGA 4RESA 4YQFA 3W2FA 2DFLA 4RO0A 1LZLA 5KQGA 1DIAA 1H8EA 5K6AA 2C5SA 2YXEA 3H5LA 1FBTA 3JD2A 4PC1A 4PONA 3THRA 4TKVB 3BAFA 3BIOA 4G5QA 5BMVF 5LLDA 1U98A 5DMXA 3SJZA 3UHPA 1AQIA 3HZHA 4DV3B 2R66A 4OYLA 1DPGA 3FYSA 3T3DA 2C8JA 1YQEA 1Y89A 5F1KA 4CKWA 4XUCA 1CDZA 5JC1A 1P9WA 2P62A 5F4ZA 3I83A 5L3SB 1M83A 2A86A 1L4HA 2RAFA 2OK8A 3I73A 3FPJA 4JN6B 2WJZB 2HZ7A 4LE1A 4P1ZA 4P34A 2RCNA 5AXBA 5KX5F 2N9UA 4JBWA 2YMLA 1FRZA 2Z5GA 1O95C 3K6RA 3RYFA 4ZIRB 3LX6A 5BNFA 1QF7A 2ZRAA 4RD6A 4EUSA 3OWHA 1VMAA 5GV7A 2D54A 4F2WA 1QO0D 3ZHVA 4CMHA 5HUJA 1E7SA 4MLDA 4BB5A 2XTJA 2CL0X 2GXSA 3I4CA 3JPWA 4WOJA 3ZWXA 3CH5A 4A0HA 5JDIA 4ZT7A 4GKBA 4IS3A 1U2DC 3K8OE 2Z3WA 2VQSA 2X0KA 4RL6A 5ED4A 4F72A 2VDQB 2YZGA 4NYIR 1SC1A 1VL1A 3KLBA 3NHJA 3TRKA 5GTDA 1QZXA 2ZSHA 3IAXA 4YJ3F 3LIIA 5K4GA 4II7A 4L5IA 5DTQA 2P2ZA 3RREA 5KTNA 1NN1A 4C0KA 4KRFA 2H17A 1CZNA 3ZD8A 3FCSB 3GRPA 1O5TA 3AUYA 2NPFA 4MCIA 5EUBA 4NXNB 1E2BA 2ZDGA 3OJEA 3T1OA 4A2WA 5JCOC 1OH8A 4ZHSA 1Y3BE 1XCGB 2A94A 2Z9CA 3GZJA 2WMOB 3IDZA 4QIHA 2ZU0C 3ICOA 5KTPA 1B8PA 1I6WA 1UBLS 4KR2A 5DCWA 1PYDA 3LT5A 3TIGA 1SUWA 2WU1A 3IOEA 3PC2A 4PPGA 5LA6B 4G56A 2QA5A 3U4QB 1D2NA 2X5NA 2AFHA 2XXBA 5DGCA 2OA0A 2P68A 3MPOA 5GZ6A 2HIMA 1QE3A 4E3ZA 3H83A 2WWHA 4BBPA 3Q1KA 4WBNB 1GR1A 1JLRA 1F6BA 1HL3A 3P9NA 5D3KA 4CKCB 2DFTA 2GRAA 2CLMB 4Y9TA 2GHRA 1ZN9A 1NATA 2D2XA 4Q3DA 1T6XA 5BSRA 1II9A 3DT8A 4UU0A 5AOAA 4Q82A 3SJCA 5L4SA 4M8NE 1GSOA 1HRKA 4P4SA 1PD1A 4CCSA 4NBRA 1SD5A 2ZWMA 1K6JA 1WW3A 1CY6A 1EINA 4HLUA 4OUKX 4ABYA 2Z8YM 1D1PA 2FGKA 1JT2A 2FUNB 2ZIEA 3O47A 4BV3A 4EQ6B 3UPTA 2G04A 1T0HB 3O8QB 1OIXA 3ZWCA 2EGUA 3KZMA 2DPGA 3B1FA 2IBMA 4MWSA 1EX7A 2PD3A 4P83A 5DI9A 5HE9A 3E9YA 3HFJA 4X1YA 3ESDA 1ZRMA 4XQGA 3K4QA 3R44A 1QANA 2HAEA 2EJUA 2YZMA 3VSCA 1A8QA 1ARZA 2NNWB 2UVPA 4M2LA 2OGTA 4LSWA 3RS0A 2O7RA 3KVOA 4RIIA 3VZDA 4EB3A 4NZMA 4QDJA 1EUQA 5DNCA 4IWYA 1ZD8A 2QRZA 3K8ZA 3N9IA 5EJEA 1WV1A 2WDZA 1L3CA 3OCXA 4J9VA 4RCVA 1DBIA 1R9NA 4ZCMA 2FRXA 4O5OA 2XGJA 3SHOA 3FUUA 1F6WA 1EU1A 2XLCA 4HFRA 4Q1BA 3RC9A 5DGDA 2FSHA 4DLTA 1P7YA 1RXSA 2PX0A 1UINA 5E6RB 1SB9A 3LCJA 2CEKA 2Q3LA 4U7FA 2NXCA 1I7QB 1S2NA 1PSDA 2OEPA 1ECCA 2CW5A 1K5HA 4IJQA 2GA8A 2WRZA 5LDHA 3GQBA 3EY4A 1IQ0A 2AUNA 1Z5ZA 4EI9A 3K8QA 2JFZA 4QYXA 2PL9A 4QYTA 1K63A 4CWAA 3C1UA 4WHMA 5FPYA 2QJRA 2X5JO 4HAYA 4JJZA 2B78A 3DUFA 3GG2A 1DARA