3TL3A

Structure of a short-chain type dehydrogenase/reductase from mycobacterium ulcerans
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
243
structure length
236
Chain Sequence
AVAVVTGGASGLGLATTKRLLDAGAQVVVLDIRGEDVVADLGDRARFAAADVTDEAAVASALDLAETMGTLRIVVNCAGTGNAIRVLSRDGVFSLAAFRKIVDINLVGSFNVLRLAAERIAKTEPVNAEERGVIINTASVADGQIGQAAYSASKGGVVGMTLPIARDLASHRIRVMTIAPGLFDTPLLPEEARASLGKQVPHPSRLGNPDEYGALAVHIIENPMLNGEVIRLDGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain type dehydrogenase/reductase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium ulcerans
molecule tags Oxidoreductase
total genus 89
structure length 236
sequence length 243
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tl3A00
1RJWA 2VCYA 2YFHA 4YCAA 1KOLA 2XOXA 3KBOA 4GWKA 1KVRA 4TKLA 3VH4A 3QVWA 3ICCA 4BV9A 2B36A 2Q4BA 5JAIA 5BQFA 3ZZNA 3ZWWA 4FGWA 2NSDA 2O48X 1V3VA 4C7JA 1V8BA 2W90A 4BNVA 2VUUA 3EDMA 1CERA 1I10A 1QYDA 1PEDA 5CDTA 5I9MA 3U9LA 2GN9A 4IZIA 4WLOA 3M1LA 5FI5A 1YB5A 5I7FA 1W6UA 1NPTO 4MP8A 2P91A 4LSMA 3OFSA 5C37A 3RSHA 3OJEA 3OA2A 3FNHA 3GGGA 4N5MA 4OIMA 3W8EA 4J4BA 5U1PA 1LSJA 1U7TA 4DC0A 2I67A 3K2BA 4NHEA 4NFHA 4OAQA 3NTRA 1YWGO 4J0EA 1LSOA 3BMCA 2VRBA 2WM3A 4PLZA 4DIOA 3CKYA 3JQGA 2PLAA 3JQFA 1LXCA 2PZJA 3E1KA 3LC2O 1JU9A 2EW8A 3BMQB 4J1SA 2ZATA 5U9CA 1PX0A 3VH1A 1SPXA 1ENYA 5EIOA 3JQDA 2Y1GA 2EW2A 1HDXA 5F1KA 3AUTA 4L74A 2Y93A 4IDFA 1A4UA 2IODA 4MDHA 1FXSA 3OHSX 1LC3A 1UP6A 1Z7EA 4BNGA 4CLEA 1DFHA 1E3IA 2J6IA 1T24A 3UGKA 2YDXA 3F4LA 4GWGA 4OYRA 5DOVA 4H3VA 2DPGA 3PJDA 4FW8A 5DBGA 1C1XA 4BNTA 1GQ2A 1NPDA 3ZU5A 2C59A 2GYYA 3R6DA 4E31A 4I5GA 4BS9A 2H6EA 4Q3CA 1CQJA 1RM3A 2FR8A 2A9FA 4A10A 1I0ZA 3WTCA 3CINA 2HKIA 1JWAB 1K6JA 3DBLA 2NU6A 4R9SA 3PDJA 4GLLA 4DQUA 3CZMA 2ZTVA 4UVGA 4MOWA 4RF5A 4Y9DA 2J5KA 4DL9A 1ADBA 2HDHA 4B8WA 4EJMA 1GUZA 3EVNA 1HZJA 1P74A 2NTJA 1I36A 4O1MA 2VT3A 4TMFA 4XJTA 3V2GA 4OQYA 3RU9A 1XG5A 3DAGA 1FMCA 1VI2A 5EQFA 1HYEA 2XXJA 4M49A 1F8FA 5FEUA 2RHRA 5JYDA 2DAPA 2OOSA 1FF9A 2B5VA 3BHIA 3RUCA 2E6UX 1SEPA 3WQSB 1PL6A 1O94A 2JL1A 2BRUA 4I8XA 3ZWBA 1O89A 3PHJA 4U7WA 4EUHA 4RL6A 3BMCB 3JQGB 3ONFA 2CUKA 4PLCA 2ZTUA 3TQHA 4UVDA 4OSOA 4RDHA 2BMAA 4HKTA 4IDAA 4BO2A 1BXKA 1C0KA 3MCVA 1HKUA 2D2IA 1N1EA 4U8GA 2GERA 3VKUA 4YPOA 2BF7A 4BIIA 4J0FA 4PG5A 4Z9YA 4BNNA 1AXGA 4LVUA 3IAHA 2QHXA 1EMDA 1ENPA 1UZLA 1ZK4A 3KLPX 4IMPA 4BKQA 3OF2A 1UDAA 4J2OA 3A14A 5ILOA 3DL2A 4OHUA 5C7OO 1J49A 1TT7A 2QYTA 3P2YA 4PLHA 3IL2A 3HUDA 4R68A 1NQOA 3ONEA 2X0IA 4YEDA 2Q49A 2RBEA 3K73O 1TB4A 4UVEA 1GZ3A 3T4EA 1DPGA 1IPFA 1C1XB 1EVZA 3ROKA 4YYZA 3F4BA 5IG2A 1LQUA 3FWZA 1XHLA 4GX0A 1JKJA 3VPHA 5KVVA 3OETA 4BKUA 3RFXA 4XWYA 4UEJA 5HA5A 3RUHA 4QECA 4AJEA 5C7LO 4Z9FA 3U49A 3WOHA 4E2YA 3KM0A 1RM5A 4BO1A 4CM6A 1PJ4A 3WMXA 4PRKA 1M67A 3DBLB 2HMVA 4P4NA 4AFNA 4NQZA 3WWYA 1PS8A 5JS6A 4JCOA 4CMCA 5ILGA 2AMFA 2JCXA 2ZK7A 4YJFB 4G65A 3Q9NA 1Q7CA 4I08A 5JSFA 2I6TA 1DDOA 4L4XA 3NJ4A 1GQYA 5DOZA 2JFGA 2NV6A 3E5RA 3ZCXA 1DIAA 2YV3A 3LK7A 3ZWYA 3OEYA 4UREA 3SJ7A 4AL4A 3LC1O 4GVXA 1IYZA 1ONNA 4Y6PA 5DCWA 2BD0A 5BNFA 1NR1A 2V6GA 5KVQA 4U6SA 2PGLA 4XIJA 4R4JA 1N1GA 4UEOA 4NPCA 4YQZA 4A03A 5JFOA 1P1JA 3E6AA 3GHHA 3O38A 2EF1A 3GDOA 4GLOA 1E6UA 1NHWA 1LLDA 4RVUA 4YRDA 4Z6KA 2QRLA 1IE3A 4MP6A 1ISFA 3NRCA 1YJQA 3NDJA 2E82A 3PYXA 2AE2A 4RPHA 3BTUA 5T64A 3WNQA 1N8KA 1W73A 1JDJA 1ZSNA 2PY6A 3K96A 1KVTA 4PLGA 4E2WA 1ADCA 2NU7A 4B3HA 2DFDA 4IJVA 2IXAA 1JWBB 5EQDA 3Q1LA 3RASA 4HUJA 4CM8A 2OUIA 2WE7A 5CEEA 3TOXA 1WPQA 3JQFC 2RH4A 2X9GA 1S7CA 3PHIA 5ES3A 5HRUA 4R9RA 4QEDA 1V35A 2C0CA 3P5SA 3B20A 3FI9A 3GMSA 4INAA 2HK8A 5AXAA 4M8SA 1OMOA 5B1YA 3OSUA 3DZIA 3D7LA 3ZU3A 4DXHA 2HJSA 2VUSA 3CTMA 1RYEA 4FOSA 4NK5A 2BHLA 2DC1A 3W6ZA 3U3XA 3ASVA 3AWDA 1PGQA 4WLNA 3ZWPA 1MV8A 2UUPA 3DZBA 3H4VA 3JQ9C 3BYZA 3DC2A 3K92A 3KEOA 1YJ8A 3PHGA 4ND1A 1X1TA 2VRCA 2RCYA 3G17A 1MGOA 5COAA 1LBEA 1E5LA 4U5QA 4YDRA 2X8LA 3DTTA 3BA1A 4OOFA 1PJBA 4P22A 4HP8A 4HY3A 5DDIP 2QX7A 4Z3DA 5IFLA 3EAGA 2HMTA 1IL0A 5IDWA 3VAZA 2EJVA 1KVUA 2DUUA 4PG4A 5T67A 3RBZA 4XDYA 3WFIA 5H81A 4E5MA 3BMOA 1HDOA 4OOEA 2NU8A 1HWYA 1M66A 1Y5MA 1NNUA 4YJHA 2HO5A 2V6MA 3V1TC 4ALKA 1YBMA 2FZWA 1T4BA 4B3JA 4BKOA 3QVOA 2DBVO 4KTTE 2VHXA 1Z45A 1YOVA 5A06A 4MIEA 2HCTA 3JD1A 3JD3A 3ZW8A 4DA9A 4PLFA 5TSDA 3PQEA 4Z0TA 2VYND 5KJFA 2WD7A 4XIYA 4NR0A 1ISMA 1XKQA 4ID9A 5GZ1A 4JP3A 1WAMA 3AUAA 4S1VA 5IAAA 1VL0A 4DPLA 2Y0EA 4EEZA 4CM8B 2H63A 2CSUA 3UCEA 1J5PA 4A7PA 2GO1A 3JYPA 1F06A 5DP2A 1HDRA 4IQGA 1NWCA 4ALMA 4PIVA 5AQ1A 3M2PA 1UJMA 4E33A 1PU2A 5A02A 4ND3A 5ER9A 2C07A 3WGGA 1VJ1A 1TT5A 3I9NA 3WB9A 2EV9A 1DIBA 5T8KC 1TLTA 1Q1NA 3CMCO 4R69A 5ER6A 3DQPA 4YJGA 1KBZA 3EMKA 2AE1A 4OXKA 1LLUA 4G81A 4IUYA 4MVJE 4Q3EA 4DTIA 3IQDB 3ETDA 3H65A 4PZCA 3NT5A 2A94A 4MVJH 4TKMA 1TEHA 1HEUA 1ZK0A 2VNSA 4WK6A 4DQVA 1KY5A 5IN5A 3QVSA 1LTHR 1ZVMA 5JLAA 4NIMA 4BMNA 4CM7A 4UUOA 4B4UA 4R1SA 1I2CA 5TJHA 1I3KA 3GG9A 4BNIA 4BQRA 4F3YA 1WW8A 4K6FA 3ZU2A 1DC3A 4A26A 3WR5A 3AM5A 1BMDA 3ABIA 3AUUA 1K3TA 3L6OO 2GPTA 2DM6A 4R41A 1CRWG 4MVJM 4CQMA 4NBVA 4QFCA 4O63O 3OQBA 1XYGA 4FN4A 1HYGA 1AE1A 2X9NA 4OXNA 4XB2A 2D5AA 3VVCA 3AK4A 3ETEA 2OP0A 1HE4A 4WEQA 2HSDA 5CG2A 1PJQA 3M6IA 3TZCA 4J49A 3BMOB 3TPCA 1PJ3A 3DFUA 4M1QA 4YJHB 4DUPA 2CZCA 3PK0A 4K6CA 4BOYA 2Y68A 3AFMA 4FFLA 3DBRB 4B7XA 3Q2IA 2E49A 1ONOA 2BH9A 3JSAA 3PIDA 1DLJA 1VJ0A 3GHYA 2IEDA 1C14A 2RH8A 2X23A 3DHNA 2UV8A 3DMTA 2WSBA 3SLGA 2BELA 2VHWA 5TC4A 5A9RA 4TRMA 1ZIDA 2Q1WA 1P1IA 1U3TA 3IOYA 4RQUA 4XD2A 5DNAA 1SEVA 2POQX 3DHEA 2Q2QA 3H2ZA 5COBA 3CMMA 3IC5A 4YXFA 3PWKA 5G2OA 1E5QA 4WLUA 4ZD6A 1O6ZA 1LDBA 1KVSA 2FRDA 3K2EA 3DR3A 2BGMA 4DBVO 3B1JA 3JYLA 1GQQA 4YJGB 2X0JA 2VHZA 1SAYA 4GGOA 5F3RA 2G5CA 5IXYA 3PLRA 5I8ZA 1H6BA 1PJSA 2I66A 4RF4A 3D4NA 4NH4A 4I1IA 5JDIA 4CM5A 4LMPA 4PN3A 3GNSA 3D4OA 1Q0QA 4MINA 4PLYA 1LA2A 2PNFA 4ZQGA 5H82A 3ZV5A 1E1LA 3GEMA 3AM3A 3N58A 1XA0A 2HAEA 4FFNA 2HMWA 1U8XX 3S8MA 1UDCA 9LDBA 2AQKA 1YL6A 4RGBA 5AXCA 3NYWA 2UAGA 1BDBA 3ZWMA 5KTKA 4E2ZA 3C7CB 2P68A 3H2SA 3PHHA 4CQMB 1EFKA 2Q1TA 3BTOA 1I3NA 3OECA 3AFNA 4NJMA 4E30A 3RIHA 4R1UA 3ETGA 1DRVA 1NBOA 5JY6A 4HFRA 4NJOA 3F1KA 3AI1A 2Y99A 4CLXA 3LYLA 3B70A 3GZ4A 5DBFA 2FY8A 4HFMA 3ZDFA 3ICPA 1OC2A 1ADGA 1YQXA 3C24A 4FCCA 4XYEA 4RPJA 1NAHA 4ESOA 3TN7A 3NTOA 1RYDA 4MVJA 1SNYA 5G0UA 1DFGA 2NVBA 1MXFA 5ITWA 1HSOA 2Z1MA 3T7EA 3TZQA 1R4NA 3SC4A 3BMNA 1LX6A 4O5OA 3VDQA 1SMKA 1ID1A 4GX1A 4RVFA 1O8CA 4YAGA 1WWKA 3QWIA 4CMIA 4IJKA 1MXHA 2YHIA 3ZWXA 1EUCA 4DPKA 3WSWA 2IE0A 5L3ZA 1BW9B 4TZTA 4II2A 4FQ8A 3TRIA 1E7MA 5AYVA 4P38A 4ZJUA 1YRLA 1E1KA 2VOJA 4HX5A 4HNGA 1AUPA 1IB6A 1F0YA 1WXDA 2DU8A 1U1IA 2DKNA 3FWNA 1K6XA 4J1QA 5IDXA 1Y8RA 4H7PA 4BNHA 1C0PA 2Q1UA 3HFSA 1D7OA 1K5HA 3X2FA 1ZMOA 3JQ7A 3U4CA 2BI8A 4R16A 1LSSA 2AXQA 3G79A 5A5EA 3O03A 4ZRNA 1NFQA 3A4VA 3GEGA 3WJAA 1EDZA 2OZPA 4NJMB 1MP0A 3G49A 4BB5A 4QT0A 4NBTA 4I9HA 1GCUA 3ZV6A 1PZGA 1IZ0A 1E7YA 4D42A 3QSGA 1NFRA 2Q4EA 1Y9AA 4X54A 3OJ0A 2X5OA 4Q3DA 3BIOA 1U2DA 3DOOA 1NX6A 1I33A 1ZFNA 4W7HA 1XQ1A 4B4WA 1NFFA 4OGWA 2ZB7A 2D3TA 2ZTLA 1A72A 3O4RA 4YACA 5EINA 4JK3A 4IJUA 4MIOA 1LRJA 4EW6A 3RUDA 3U0BA 4E32A 3ZNOA 1PGJA 4XX0A 2DTEA 3HADA 1R4NB 3BMNB 1U7HA 1ZZEA 1QMGA 4WNCA 5FYDA 3I6IA 4MVJF 4EGFA 5JMWA 1T2CA 4CMIB 2E4AA 1ZK2A 4YAJA 5ICMA 5KIAA 1WDLA 2XAAA 4WCFA 4O0LA 1FJHA 5CFZA 1C1DA 3BAZA 4S3MA 1LDNA 3L07A 4GH5A 4EI2A 2QQ5A 1BSVA 3MJCA 3TNLA 3SX2A 3AI2A 1E3SA 3JCZA 3NT2A 2LDXA 4JBIA 3ZI0A 4I5FA 1B3RA 1QYCA 4CV2A 3D1LA 4L8VA 2JJYA 5LC1A 1QLJA 4OQZA 1VM6A 3WJ7A 4B7CA 1I32A 1VL8A 3R0IA 4N7RA 1KEVA 1Y8RB 2HRBA 1T2FA 3NUGA 4EEXA 3SXPA 1T2AA 4KUGA 4RLHA 3GRKA 3PRJA 1NVTA 2P5YA 3JQ7B 3KOUA 4MVJG 3GH3A 1CETA 4J7UA 4LSWA 3UHAA 3ZWVA 3GVIA 3GAZA 4EITA 1NVMB 1Z6ZA 1WDKA 3LT1A 3VTZA 4W9NC 1JTVA 3QE3A 3OIDA 3RU7A 4HWKA 5I7EA 4OKIA 3QP9A 4OM8A 2ZQZA 3X2EA 3L4BA 4GSLA 1R16A 4AICA 3U5TA 1ZBQA 2IZ0A 4ONEA 5EPOA 5FI3A 5JDIC 2DVMA 4HADA 4H15A 2NUAA 1YDWA 4AJIA 1CWUA 3U09A 1KC3A 3GGOA 3LZ6A 1B8PA 1NVGA 4KUHA 5FFFA 5TS3A 2FPIA 4CMHA 5L9AA 1DRWA 1OBFO 4ITUA 4WKGA 2BKAA 1EVYA 4ALNA 4J7CA 3PWZA 4JGBA 3RFVA 4L4RA 4DLLA 3PXXA 2NQ8A 2X4GA 3C8MA 4BNUA 1LQTA 2ZYAA 4J90A 1NYTA 2PD3A 4W4TA 2VYVA 3FHLA 4J3FA 3VVBA 2IDZA 1DIGA 4BO0A 1VL6A 4IINA 2PD6A 3ZHYA 1H5QA 2CF5A 3PFWO 3OIGA 4ND2A 2JFFA 2J5RA 5KNLA 4RLSA 3KZVA 4WCFB 1C1DB 3GLQA 1QYWA 1HTBA 3KEQA 4BGUA 4BV8A 1PJ2A 4JN6B 1KC1A 4NMHA 1I8TA 3OQ6A 1E3WB 4OL9A 2Y1FA 3WYBA 2DBQA 4YT4A 4CMGA 1P33A 4RVDA 4IGEA 2ZB3A 3OH8A 2ZIZA 4AJOA 4NFYA 1KEWA 3B1FA 3UAGA 1GPDG 4YR9A 2P4HX 1I5RA 4Z0HO 3FTPA 3AI3A 3T7CA 3NAQA 5U4QA 2Y66A 3C85A 4CM4A 3GNTA 1GEGA 2XXBA 5DCUA 1MC4A 3C7DB 3QW2A 2HMUA 1PTJA 1A9ZA 1ENOA 1K2WA 3JQ9A 3OM9A 2WYWA 3OJLA 3QV1A 4ZQBA 1GFSA 1XU7A 1LEHA 1MUUA 1DRUA 3SBOA 2O4UX 1UXKA 3FPCA 1TA4A 5I8WA 3RC9A 2YHUA 3WYCA 1XEAA 3JD0A 3LF2A 4R3WA 1DJQA 3WSVA 1T25A 2PD4A 1ULUA 4IDCA 1GCOA 3KVOA 2C5AA 4FS3A 4D45A 2NQTA 3GUCA 1T2EA 2PKQO 4MO2A 1JW9B 4N5NA 3A9WA 4UUMA 4AJKA 4K28A 3D64A 2P9GA 1ZXLA 1LDEA 4RDIA 2Z95A 1QKIA 3ZN2A 1XQ6A 1EBFA 1OOEA 5A1TA 1LSUA 1QLHA 2UDPA 2V7PA 3IDSA 4Q3NA 4RV9A 2GD1O 4AJNA 1EK5A 4YJFA 1P1FA 1B16A 1Q0LA 4P4LA 4NNJA 1VLLA 3MTGA 4YT2A 4L73A 5L7WA 4Z0PA 4WPGA 1E7RA 2Q2WA 5CDGA 3K9QO 3CSDA 4RPLA 2AEJA 3FN4A 3VPXA 4J9VA 1I01A 4FOOA 4XYBA 1HDYA 2OP1A 2EJWA 5T5QA 5A5FA 5KVCA 3GG2A 1OFGA 5FF9A 4W99A 3VTFA 2VYVD 1RKXA 4WNIA 4LN1A 5GMOA 4FJ1A 4RCVA 5TT1A 5A04A 1PR3A 4JJFA 2HQ1A 4CMJA 1PR9A 3JTMA 1EUZA 1ONPA 1U3UA 3JQ6A 1YONA 2ZCUA 3EW7A 1GPJA 3CH6A 3NKLA 2PWZA 5JXWA 5T8KA 1BTOA 1YL7A 4M55A 2J8ZA 5BNIA 1E3LA 4FFPA 4JNKA 1SB8A 4FPXA 1EEHA 1L1FA 2NM0A 4N5LA 2O3SA 4E5NA 2F1KA 4CM4B 4BGVA 4I5DA 3N7UA 4WCFC 4O6VA 3JYQA 1AHHA 3GUYA 4YRBA 3LLVA 3RUAA 3FR7A 1C0LA 2YY7A 2UVDA 4J4TA 3JYOA 2ZKLA 3MJTA 3W4IA 3WYEA 2YDYA 2CNBA 3QA9A 4IQ8A 1A7AA 4Y67A 2RAFA 4DRYA 3QWBA 2EG9A 4TSKA 4EJ0A 3I9MA 3SEFA 4A27A 1Z82A 1F17A 3FRJA 4Q3BA 1JVBA 1I2BA 3WIDA 3INGA 2O3RA 4BUCA 2X6TA 1QORA 1XR3A 3GPIA 5B37A 3GZNB 4YT5A 3PQDA 4CMEA 2QZ9A 4HXYA 2W98A 1PSDA 3G0OA 4PLPA 1B15A 4D7AA 3L4BC 4PLTA 2I99A 3E82A 1G1AA 1DSSG 1LRKA 5KCZA 1NHGA 2YJZA 4MKXA 1D3AA 1X1EA 1Z75A 3I9LA 4DREA 1GR0A 1XLTA 2WD8A 3KTDA 1P31A 1O95A 2GZ2A 4NBRA 4WJZA 2NTNA 2D4AA 1B26A 2H5LA 1HDCA 1MFZA 2FPGA 3W8DA 5A4DA 2Z5LA 2YYYA 5L7YA 1DC4A 2VYNA 1VRWA 5C3MA 2B35A 3OEWA 3O9ZA 1YL5A 4OO3A 3DHYA 3DZFA 3E48A 4K9DA 2W2KA 1LJ8A 2VTDA 1ARZA 5MDHA 2AG5A 4IIUA 4HFJA 2QRKA 3TDKA 1DEHA 1MX3A 3AOGA 3VPSA 1FDSA 4CLHA 2OXIA 3EC7A 5TGDA 5LDHA 1S6YA 3PQFA 1GZ4A 4BL5A 1KETA 3DOJA 8ADHA 4AG3A 4XCVA 1N5DA 4WEOA 3ZNPA 1PZFA 1GUYA 4DMLA 4CR6A 3U62A 4FGSA 3E03A 4B4VA 3SLKA 1MG5A 3HB4X 4GX5A 4E5PA 4RVGA 1RWBA 3G3EA 1D1SA 1I2ZA 5TNXA 5JNLA 2BFOA 3HN7A 3ONDA 3F9IA 3RROA 5AXBA 1K0UA 6ADHA 4B4OA 1FK8A 3VPFA 3MOIA 2OMEA 1G0OA 2IYOA 3IS3A 5JAMA 5BSHA 4XYGA 4E4YA 3T4XA 1VKOA 3GVXA 3HG7A 3AU8A 3DO5A 2EP5A 1DC6A 3AY7A 3GDGA 1B14A 4LRSB 2EERA 4D79A 4PFJA 3PPIA 2QRJA 4FSHA 1HYHA 5LCXA 3E9QA 3ANLA 3HSKA 4IS3A 3FNEA 3MJEA 2GCGA 3DDNA 2OL4A 3GY0A 2Q50A 3OQ1A 3DBRA 3FTNA 4XQEA 3FD8A 1SBYA 2OGUA 3QRWA 2W2KB 4M89A 3IUSA 3KSDO 5L40A 2NTVA 1ZO8A 4JQCA 3WQRA 2YUTA 1NM5A 2ZQYA 5DN9A 5DP1A 2YFQA 3PYMA 2VWQA 1H9AA 4GVLA 4WOJA 3DFZA 3ZV3A 3I6QA 3WS7A 2ZYDA 3E8XA 3ZU4A 4C4OA 2B69A 4ZGWA 5BR7A 2PGDA 4KOAA 4F45A 4XRRA 1DJNA 1YB1A 4GKVA 4E6PA 2VQ3A 5KKCA 2JD2A 2R6JA 1GZ6A 3QVXA 4BGEA 3V2UA 3LDHA 1Y8QB 1RPNA 4YQYA 1BXZA 1AHIA 3H9EO 2Y0CA 4BHTA 3B6ZA 2IZZA 2JCYA 3H3JA 5DBIA 4TWRA 1DAOA 1R12A 3KYCB 1VC2A 4D44A 4HBGA 4PZEA 4TRNA 1QV7A 4LMRA 2PR2A 3VH2A 4E0BA 4FC6A 5ENVA 3MOGA 2OBNA 1YS4A 1UXJA 3AW9A 2VN8A 3RKRA 1NWHA 4LW8A 3WBBA 1H2HA 1H9BA 3FNGA 2CFCA 3H5NA 4MIYA 3RBVA 1PGOA 3VH3A 4DWVA 1J6UA 3HE3A 3GA0A 4IPTA 3EUWA 4KWIA 4L76A 1QXSA 4CJXA 1LC0A 2DBRA 2NVUA 3EVTA 1M6WA 3D3EA 3E18A 4KQXA 1X15A 2PV7A 5TLSA 3ANNA 1LDYA 2X0RA 4AJ4A 2W2LD 3GVHA 2AHRA 3ASUA 3UN1A 4CMEC 3DONA 3NGXA 1DHRA 3INRA 1ENZA 1V0JA 3KHUA 1HT0A 3LSYA 1UXGA 3S2FA 4FJ0A 3BHMA 2Y0DA 4DLBA 1X0VA 3O26A 3KV3O 1ZSVA 4C7KA 2EIHA 4BNKA 5CEFA 3GMDA 1WNTA 1Y81A 3IIEA 4LISA 1ZXBA 2F00A 2D8AA 2C7GA 4BMVA 1H6AA 3DWFA 3JYNA 3TWOA 3HNPA 3TZKA 5H83A 4FFMA 4D0SA 4CM9D 1Y5RA 3MWDB 3GT0A 1BW9A 1SOVA 3W4JA 1YQGA 2Y1EA 3V1UA 4W9NA 1V3TA 2BFPA 3PEFA 1GV1A 2WJPA 2VZ8A 1FDVA 4E21A 1UDBA 4FJ2A 1ZKMA 1PGNA 3FR8A 3O8QA 4R54A 1UXIA 5B4UA 2E48A 4OMUA 1A9YA 1X7HA 2RIRA 3INTA 5TQVA 3JQAB 2WEKA 3D0OA 1I30A 2G82A 2JCVA 3NV9A 3OP4A 2Q1SA 2VNAA 1YGYA 4F6CA 2P9CA 4CLOB 5L4NA 2O3QA 3RKUA 1YDEA 2Q2VA 3PWSA 5A3JA 3DZGA 2CY0A 3PHLA 2Q46A 3WQQA 4BNLA 4FFRA 3AOEC 3JQAD 1LLQA 4AJHA 5THKA 4LRTB 3ROMA 4WASA 1P44A 1U28A 3R3SA 3WGYA 1I3MA 5ITVA 4XEHA 1B2LA 3PLNA 5JCJD 4P8RA 1Z74A 4NU6A 4E5YA 2NVUB 3H5RA 2JAHA 1PQPA 3JQBA 1ZCJA 2TMDA 2I76A 5L45A 3S55A 1JVSA 3SC6A 2OO5A 1YE3A 1X7DA 1JKIA 3UCXA 4LCJA 5CPBA 5TX7A 3GN1A 2GRAA 2TMGA 3OJOA 5A9TA 2PTGA 1N7HA 2V6BA 3KLMX 1K89A 3DB2A 2IZ1A 4CQLB 3A28A 2XF8A 3UICA 1PS0A 3RQSA 4GI2A 4CMBA 5ADHA 2GGSA 3C1OA 4E2XA 5ICSA 4U0KA 1F8GA 4ZQEA 3UW3A 4BNXA 2BGKA 2QG4A 3TZHA 1BG6A 4GSKA 4M86A 3S1LA 4R5HA 4UEKA 2W4QA 1PQWA 1HE5A 2QW8A 3N74A 3H5AA 1UP4A 4BO3A 1IHXA 5L53A 3H8VA 4XJSA 3ZWAA 2HK7A 3WBFA 2JAPA 1LI4A 1IOLA 1JQBA 3GF4A 5TJ9A 2HK9A 3I9KA 4YAKA 4EBFA 4XRGA 1HRDA 1JA9A 1Z7BA 2H1SA 3K31A 1YBAA 4RJTA 5B12A 3O8QB 1GU7A 1VSUA 2ZJ0A 1LRLA 4ALJA 4YT8A 3JQ8A 1P9LA 4WUVA 1BVUA 4NFSA 2ET6A 5G4KA 5IDYA 3FNFA 1R0LA 2VWHA 3R1IA 4PG7A 1HLDA 3ROQA 2X9VA 2VTEA 1OC4A 3FBTA 1N92A 4MP3A 5J23A 3GQVA 2PKQP 1L7EA 3VKVA 1Q7GA 1EZ4A 1IHYA 4ZHSA 3GK3A 3H9GA 4D46A 3ZH2A 1DOHA 3LLSA 3RFTA 5IJZA 1WVGA 1B8UA 5L7TA 1O5IA 2ZCVA 1W0CA 1XGKA 2A92A 1ZW1A 2RHCA 5EERA 4GQAA 1N9GB 1NQTA 5JYEA 3HWRA 3M1AA 1UAGA 4D3FA 2CVZA 1YH3A 4QSMA 4PG8A 3S2IA 3ULKA 3D5QA 3JD4A 3LU1A 4LVCA 4IBOA 4CM1A 1H93A 3E9NA 4IDDA 3ZNQA 1D8AA 4Z3KA 3JQCA 3G1TA 1ZSYA 4P4GA 3F46A 3L9WA 4NBUA 4DYDA 3BHJA 3EZLA 1T26A 2FR1A 2GDZA 2VOEA 3H9JA 5JC8A 5HM8A 2A4KA 1HF3A 3DTYA 1NAIA 2VT2A 1DBVO 3K6JA 3AJRA 4D41A 1XSEA 2P4QA 4K1LA 2O2YA 4B7UA 1E6EA 3WDSA 1M75A 3ON5A 3PGXA 2J3KA 4BB6A 4HNHA 3IP3A 5I9NA 1E3WA 3A06A 1B7GO 1BRMA 2EXXA 4KZPA 2VHYA 5G4LA 3PZBA 1BHSA 1E6WA 3OMLA 1IPEA 4XQ9A 4PLVA 1JLLA 3ADOA 2V65A 4GGPA 2NNLD 3JQ8B 3DZHA 3I4CA 4NDNE 2IXBA 1E92A 3RC1A 2GF2A 3UF0A 1X14A 4WECA 5G4KB 1DXYA 4R5MA 4IDGA 4MKZA 3PJGA 4JJIA 1WDMA 2HUNA 4RZIA 3W4KA 2OBYA 1HETA 3QVTA 1AN9A 4PLWA 2NADA 1BDMA 2O7SA 2FSSA 2PZLA 3EY4A 1QG6A 3BZUA 4UAGA 4W6ZA 2DLDA 3F47A 3FBGA 1I3LA 4IIVA 5JO0A 5L95A 2FMUA 2Y67A 4FBGA 4E13A 5F21A 3PTZA 2ZB4A 4CODB 1LLCA 1VE9A 1YVEI 1M2WA 2PK3A 2OORA 2Y1DA 1B8VA 4M54A 3V2HA 2QIOA 2VUTA 1O0SA 4DVJA 1E7QA 3DAFA 4BO4A 3IKTA 1P3DA 2ILTA 4TVOA 1UUFA 3PI7A 4UULA 1A5ZA 4A2CA 2I3AA 5A03A 4RORA 4MVJI 2YV1A 4IS2A 3L9XA 1ORRA 1WP4A 4KDEA 4IMRA 1UR5A 3IMFA 1X13A 4JP2A 1PL8A 4UUNA 1P0FA 5CHEA 3WMWA 1V3UA 4ZN6A 4GL4A 4J9UE 1DFIA 4FFOA 4RF2A 3WGIA 5IZ4A 1JAYA 3ZGYA 4DPMA 2VZ0A 4RVHA 1OAAA 1F14A 1K6IA 3W1VA 2DFVA 2EGHA 3UFXA 3JQBC 2IYPA 4MVJP 4XR9A 3RWBA 2EKLA 1AGNA 3KYBA 4RO0A 4BNFA 4N54A 1E1NA 3AM4A 4J6FA 4FR5A 3GC6A 4A0SA 3EYWA 1GTMA 1HDGO 1NR7A 3OBBA 3Q11A 5GZ6A 2B37A 4D43A 5B4VA 4LK3A 1HXHA 1H0KA 1Z73A 3MZ0A 4U0JA 4BQPA 4EJ6A 4RPGA 1SCUA 2JHGA 3WLFA 1NQ5A 1U5CA 4XGKA 4HV4A 1PS9A 2YZ7A 4B3IA 3E5MA 2D0IA 3OICA 4ILKA 1RM0A 5DT9A 1BWSA 3RC2A 4RVSA 3GEDA 1KEUA 4PVCA 4QFDA 5EN4A 4KMSA 4ZA2A 3F5QA 2FR0A 4J16A 1PJCA 5B4TA 4BGIA 2WYVA 1JN0A 2PZMA 1KERA 1AXEA 2BFMA 2DQ4A 3D3WA 4NG5A 1XWFA 2DTXA 5TT0A 1E77A 1NASA 2EKQA 3ZHZA 3ORFA 1PQUA 4J91A 4XYMA 5G0WA 1GAEO 2JFHA 5A3VA 3ZW9A 1W8DA 2EGGA 1MLDA 1PGPA 5K0ZA 1EVJA 1V6AA 3UH1A 1P1HA 1GEEA 2X5JO 4YVFA 4QO8A 1EQ2A 5CG1A 2HJRA 4D0RA 3TL2A 1NQAO 4WLEA 3PDUA 4W7IA 3I9OA 3U4DA 3DEYX 4EUFA 5LDGA 1QYXA 3C3XA 3UKOA 7ADHA 1MB4A 2G0TA 3VDRA 3AU9A 3GZNA 1U3VA 1EUDA 2C2XA 3TL3A 2ZB8A 3HJAA 4IXWA 3I9JA 2BGLA 4NI5A 1E7SA 2AQHA 1DLIA 2OHXA 3WGTA 5CDUA 5CEJA 2VHVA 1E7WA 3TFQA 1U4OA 2GZ1A 3HDYA 3GVCA 4JROA 3HDJA 3WFJA 1QSGA 1HE3A 1J4AA 2O2SA 2UUOA 1M6HA 2O7QA 1YKFA 2WE8A 2X86A 2HMSA 4CLDA 3HN2A 3NTQA 2D59A 1A71A 5AOVA 3HFGA 1T1SA 3DZJA 4U6QA 4PRLA 2O23A 3H7AA 1ML3A 2FHSA 3EGOA 1N2SA 3U4IA 1PZEA 1GDHA 5G0VA 9LDTA 2FPPA 2UYYA 1GD1O 3E9MA 1E1MA 4PG6A 4URFA 4M87A 5JDCC 2VWGA 3C1AA 4DIBA 5CP8A 4Y6SA 3GPDG 3MJ4A 3GFBA 1T4DA 5K9ZA 4GPD1 4GX2A 4QX6A 4PVDA 3ZHXA 1Y7TA 5A05A 2O4CA 3L4SO 4RF3A 1DHTA 5JAZA 3D3WB 4BO5A 4IZHA 3RC7A 3RCBA 3WXBA 3PVZA 3L0DA 3MEQA 4BVAA 2J3HA 3QJ5A 3PP8A 1QR6A 4FDAA 3WTBA 1Y1PA 4WGGA 4BNWA 5DZSA 2I3GA 4CPDA 1XCBA 5THQA 2X5KO 1TVEA 5G0TA 2EP7A 4AJLA 5JW6A 3H6KA 2PA3A 4ZRMA 5TIIA 3SVTA 1A4IA 1EQUA 3HDHA 5BSGA 1DIRA 1NP3A 1B3BA 3RUIA 3D4PA 5F1PA 3W8FA 4YBZA 4J1TA 4DQXA 1U2GA 4I9UA 2R00C 5K6AC 1OI7A 4ALIA 1EFLA 3FSRA 2FSVA 5AXDA 3BXXA 3PYLA 4EZBA 1UXHA 2GLXA 3MJSA 3JD2A 4L75A 3PZRA 3NJ8A 3IKVA 5AVOA 1O9BA 1P0CA 3KXDA 4OKNA 2EKPA 4JXKA 3GGPA 1BVRA 1YO6A 1Q7BA 2EHDA 3QHAA 3VHRA 1U4SA 1GUFA 5I9LA 4MJLA 1Y9EA 4ZQFA 3UUWA 3UXYA 5JC1A 5BNTA 2SCUA 2HLPA 2BI7A 3W6UA 2O3JA 5IZCA 4NBWA 3H9QA 4G2NA 4TQGA 4N18A 2AQ8A 2EEZA 4Q3AA 1Q2XA 3F6YA 4YRAA 3UVEA 3GN2A 2GUGA 3C7AA 1RM4A 2A35A 2C54A 4XGNA 5DCYA 4XDZA 2E37A 2B5WA 3QLJA 3P2OA 2GN6A 3KUXA 1A27A 3STHA 1X7GA 2PZKA 2B4TO 3GDFA 4A73A 4J4HA 4YA6A 3PFFA 2XPCA 1HSZA 3CXRA 4L9RA 1DAPA 2V6FA 4PZDA 3WG9A 4BO7A 2YW9A 2DBZA 4TROA 2I5PO 1GADO 4D3SA 4GMGA 4DYVA 2CVOA 1QRRA 3AOEA 3WX0A 3ENKA 3FCOA 3RAJA 1Y8QA 3I4FA 4JBGA 4BO8A 2GN8A 1MA0A 2IRWA 5JCXA 4DBZA 2P9EA 4DC1A 4CR7A 3IP1A 4ND4A 1ADFA 2NU9A 1R15A 1HZZA 3QIVA 3KYCA 1E3EA 3I52A 5HS4A 3KRTA 2QZZA 3RUFA 1T2DA 4IGFA 4KP7A 3DBHA 1ISGA 1PL7A 4ZQHA 1CEQA 1ZEJA 1I24A 1NPYA 2C7VA 4TZKA 2C5EA 2GNAA 3VPGA 7MDHA 4EUEA 4XB1A 1HDZA 2W2LA 2GN4A 4FIZA 1VPDA 3TZ6A 2AQIA 4OSPA 4YAEA 1DIHA 2Q45A 5BT9A 2PH3A 3K5PA 4CUJA 4CL8A 4QUKA 4ROSA 4E3ZA 4CV3A 3LQFA 2BLLA 2GR9A 1SO8A 4XYLA 4II3A 1WZIA 2CVQA 3LVFO 4KQWA 4DIFA 2I9PA 1VKNA 5G0SA 2O3UA 4ZVVA 2C2YA 1WZEA 2FWMX 3GOHA 1ZUD1 3P19A 4E5KA 1IULA 3DAPA 4TRRA 2WWRA 2GASA 3F3SA 4L0QA 1PJTA 4CM9A 4CV0A 5BSFA 4BO6A 4GBJA 3RJ5A 2ZYGA 5L4LA 2O3TA 3OA0A 3AUSA 1EE9A 1KYQA 4Y98A 4CL3A 3L6EA 3P7MA 3V5NA 4TRJA 1D4FA 1HE2A 1P1KA 5CPFA 4AJ1A 1Y6JA 3KYDA 4YTEA 4CM3A 4XZ3A 4NK4A 1N7GA 4FB5A 5DULA 1U5AA 1EE2A 2QYSA 4BKRA 3WGOA 2Y1CA 3GVPA 2HU2A 4IJWA 3VOSA 4ND5A 4AJ2A 2GZ3A 2B4RO 3PGJA 2X1HA 2O50A 4BO9A 3GAFA 3NDIA 2AW5A 5KJCA 3Q9UA 4DMMA 1ULSA 3ANMA 3I1JA 1GYQA 2X58A 3JQAA 3OJFA 3WNVA 4WLVA 2AEFA 4L4SA 1IUKA 4CLRA 4RPKA 4CUKA 3HZZA 1PJLA 1ZH8A 2OFPA 1P45A 4JBHA 4F6LA 1PWZA 3DZKA 3V1YA 1D1TA 3DBHB 3DXFA 4CLOA 4Y8VA 5JCJA 4PCVA 3IJRA 2YQ4A 4RZHA 3UCFA 1UH5A 5JAQA 3WICA 1HLPA 5EL0A 4YWJA 1ISHA 3TFOA 1EK6A 3VC7A 3GNQA 2DTDA 2PGJA 3LT2A 3PIIA 4NU5A 1W4ZA 3ZNNA 5JE8A 1H94A 1L7DA 1E3JA 3EZYA 1M76A 4TVBA 4BMSA 5L4SA 3FPLA 4J1NA 2ZTMA 4CUZA 1XDWA 3ST7A 4QO7A 4QQRA 3CEAA 3M2TA 4Q9NA 4B79A 4BNMA 2P5UA 3MWEB 4QTZA 4I5EA 4I9NA 1A7KA 5ENDA 1TI7A 2JKVA 4XKJA 4CMAA 2WMDA 4JJGA 2Q99A 4BKPA 2DUWA 4F46A 3ZWOA 3G1UA 1CDOA 1BGVA 2Y05A 2VRCD 1UAYA 4FD3A 2EWMA 4NZ9A 1NTOA 3RI3A 1YQDA 3GRPA 3RD5A 1V9LA 4Q39A 3HDQA 4CQLA 1ZK3A 3KSZO 3WWZA 4E12A 4BNJA 4R1TA 3OIFA 3TOZA 1NXQA 5IZCC 1KVQA 4IM7A 5CDYA 2AG8A 5C5IA 1JAXA 3KYDB 3WGQA 3VZSA 1LDMA 3F5SA 1YOVB 3QQPA 4JLWA 1LDGA 5KVSA 3CZRA 4KDFA 3JQEA 4MPDA 4UVIA 5HWSA 1EDOA 2YQ5A 3ZWNA 3MTJA 3NDRA 4CV1A 1MC5A 4J43A 1QV6A 4W82A 1GYPA 2WD7B 2DPHA 3NT4A 3ITDA 4GMFA 2DT5A 4AJPA 4LGVA 4B8ZA 5L51A 3TF5A 4CLRB 5IN4A 1ZJYA 1U3WA 1YBVA 2FZEA 3CPSA 3H9UA 4EYEA 4XQCA 1TT5B 1EVIA 1GV0A 2C82A 5COQA 5F1OA 3HB5X 4A5OA 1J0XO 5C7IO 4J7XA 4WOKA 1TXGA 2JHFA 1DC5A 3WLEA 5HTOA 5F5NA 2WDZA 1WMAA 2Q3EA 3V8BA 1CQIA 5KWEA 1XIVA 4JIGA 3SJUA 5KJEA 3NEPX 1VJTA 1ISJA 1R0KA 1XU9A 1H6DA 2BFAA 4Z9XA 4IDEA 1N9GA 3BTSA 3H3FA 3ZV4A 3I3OA 3RBXA 5F5LA 2GSDA 1OZAA 4R1NA 1E0DA 2P2SA 2YV2A 5T6BA 3LF1A 2G76A 5HS6A 5DF1A 5JBIA 3K8ZA 2D1YA 2CF6A 4OJNA 1ZK1A 4ZU3A 2J5QA 4XGIA 4GKBA 1T1RA 3COSA 4YJDA 3VZQA 1R4MA 5GZ3A 3WGHA 1KIFA 3QY9A 3LT0A 4YB8A 4CMKA 1WMBA 1G0NA 1GYRA 4K26A 1LU9A 2VZ9A 3ZHBA 4IQ0A 1FDWA 3TSCA 4CQMD 4BNYA 5IXSA 2G17A 2X7HA 4WCDA 2WYUA 6LDHA 2VWPA 4CR8A 1MG0A 3PJFA 2R2GA 1BXGA 1UZNA 3CIFA 3ITKA 3QWHA 5I7VA 2D5CA 3I23A 5EMHA 5KOIA 3KO8A 3IUPA 2B83A 2W8ZA 3CUKA 3HQ4O 4DGSA 4XR4A 2X0NA 4WLFA 5HBRA 4KUEA 2C20A 2CDCA 3IJPA 1H2BA 3Q0EA 4MKRA 4YAIA 4OH1A 2ZJ1A 1SB9A 1HL3A 4AJJA 5GY7A 3ROPA 1ZJZA 3D5TA 3TJRA 5TRTA 3VZPA 3EK2A 4HFNA 3WIEA 3KETA 2X22A 4G5HA 4QXMA 3UOGA 4XA8A 1R37A 3QWFA 3A1NA 3L6DA 4IY1A 2FOIA 3VZRA 3FF4A 3KSUA 1JKFA 4KTVE 5EESA 1R6DA 2CD9A 5A9SA 2C29D 2HRZA 1B0AA 4R51A 3DBVO 1MFPA 3Q2KA 3R3JA 5JO9A 1YXMA 2H9IA 5CDSA 5MGBA 1C0IA 3DMYA 1VSVA 2J3JA 4PGFA 3GR6A 4XQGA 1LNQA 2JD1A 2PFGA 3RUEA 1U9JA 2Z1NA 3LC7O 4O59O 1LUAA 1C3VA 1IY8A 1Q0HA 1ZMTA 4ZICA 2NACA 4R01A 3B1KA 2B0JA 2JD0A 1P1RA 3RVDA 1FDUA 2J3IA 3KB6A 1R4MB 1GY8A 5JPIA 3I5MA 2NVWA 2IEBA 1X0XA 2AEMA 4RQTA 5JDCA 1CF2O 1YB4A 1IZ9A 4UVHA 1KY4A 4KWHA 1CIVA 1DB3A 3S2GA 3ADPA 3QWAA 3HHPA 3U4HA 3I83A 3PJEA 1BXGB 3Q3CA 3MJVA 4J2HA 3NX4A 4LCEA 3S2EA 2AA3A 5T57A 4BNZA 3RJ9A 5FWNA 3JV7A 4FC7A 5EJ2A 1CYDA 1KS9A 3K30A 1CJCA 5KJ6A 3CE6A 8LDHA 5KJ1A 5I7SA 2YHIB 2B4QA 1QYVA 3L77A 4MVJD 3WGZA 4GAEA 3AY6A 1XELA 3Q6IA 2PH5A 4ALLA 5IDQA 1DO8A 1F12A 1PIWA 1R66A 2CMDA 1QP8A 1GL3A 2NWQA 3GFGA 4AVYA 1ISIA 1FDTA 2WTBA 3LT4A 2I65A 3BTVA 2R00A 2Y1OA 4DLAA 4IDBA 5K6AA 2G1UA 5A9SB 1H6CA 2FP4A 1SZJG 2LDBA 1U8FO 2NLOA 4EDFA 1UP7A 2FN7A 3DMTC 4WE3A 1UZMA 3BMQA 3NGLA 4Y6RA 5JY1A 2CDAA 4R3NA 1KEPA 1R0SA 4UUPA 1ZNQO 1P77A 1PWXA 5KKAA 1PZHA 1SC6A 4OXYA 2PKRA 3ZWCA 4H16A 5TF4A 4IXTA 2CDBA 5JMPA 3C1TA 1G6KA 1SOWA 5BSEA 1ZEMA 1WLYA 3DOCA 3EHEA 3AY3A 5IF3A 4JX8A 1EBUA 3F1LA 4D3DA 3ENNA 5CAEA
chains in the Genus database with same CATH superfamily
1GU0A 2R751 1UFKA 2Y92A 3SR0A 1CVLA 1SQSA 4AB1A 3H1FA 2FHPA 4MYRA 1AIPA 3FH0A 4MQ4A 4MQMA 4GWKA 3V34A 1BCRB 2XVYA 3OCUA 3ZS9A 3ICCA 2HI0A 3ECCA 4INOA 4OJKA 1NT4A 4KNYA 4FGWA 2O48X 1A8QA 2WSYB 2X42A 3PQ6A 3QVLA 4QUDA 1RE0A 1XRRA 1QVZA 3RSOA 2I8LA 4R1QA 4BNVA 2H57A 5J1SB 3HCWA 3MBIA 1NVXQ 1LI7A 1CERA 1I10A 3CUVA 1TM5E 3EB9A 3HXTA 5IC6A 1PEDA 4AY3A 1ODIA 2AJTA 1ECCA 3DM5A 3MB5A 4QBHA 4BRZA 3U9LA 2AFRA 4RMIA 1T6ZA 3D7SA 1QUFA 3KEMA 4K6KA 4AF8A 2Q5IA 2JIDA 1XZEA 5KYVA 2V74B 3EQ6A 5IANA 1ODTC 1NPTO 3HR7A 2OGTA 2HA0A 2REQA 3OJEA 3OA2A 2YHAA 3IT0A 1YJBA 2GBFA 1RMTA 1U02A 4OIMA 3W8EA 1RI3A 4F86A 3URMA 4KR0A 5ALMA 3REFA 3JX9A 4QGAA 5EC8A 4YRMA 3JZIA 2IH2A 3K2BA 4WY5A 3KQMA 2QY6A 2OBMA 3GH1A 3R0ZA 4J0EA 1LSOA 1P72A 4K5QA 4TV8B 4CIAA 4QPJC 2HDWA 1Q77A 2VRBA 4PLZA 3UBMA 3JQGA 3GLRA 1NV8A 1ZONA 4YRFA 3TLEA 3EF3A 1LXCA 3C74A 2I2AA 2PZJA 1BFUA 2WJWA 3E1KA 4I8DA 2W6OA 3BMQB 4J1SA 2QRVB 2OE2A 1YKGA 4U00A 2D06A 1NUAA 3KL4A 5EIOA 4Q19A 4DY4A 1UM8A 1Z4NA 2P4SA 2ZE6A 1O0CA 3WHLA 2ZG6A 3IQXA 4C4ZA 3OQNA 3A37A 5F1KA 1TLLA 2Z8YA 1QIIA 4L74A 3KQLA 1FXSA 5ALJA 4FINA 1NDUA 1U2PA 4KRXA 3CZ4A 2YDXA 1WBJB 3F4LA 4OYRA 2XVXA 3PQCA 1W93A 5AUNB 1VXOA 3VU0A 5I7HA 3UT6A 2O8BA 3MJHA 3KU4A 1UADA 3GLTA 1QNLA 3JW8A 1GSOA 1EI9A 2GN1A 3IOMA 1WOMA 3PRHA 1R5OA 2GYYA 3KTAA 3P9ZA 4HOYA 1L1RA 4BQSA 2Q0HA 1XNQB 4DLXA 1YK0A 1GZUA 3FOWA 2FPIB 4MYSA 2A9FA 2BM8A 1W6RA 2BEVA 2CJPA 4MKGA 3HR4A 1Z39A 4RELA 1VLJA 2H59A 3EA0A 4H17A 1T6YA 1F3OA 2H48A 5E7JA 3C8ZA 3VAYA 5LZ8A 1XAGA 4NYMR 3CJTA 2X8AA 1OE0A 2C9ZA 4N7JA 2OZVA 3CZMA 1JHXA 3L1VA 1OV6A 4UVGA 3WKEA 2FJPA 3WQHA 5I48A 3O84A 4DL9A 2PLWA 4P3PA 4Y2RA 1RAIA 3MFYA 4XWWA 1NG9A 1E1RD 1EM8A 1ZYUA 2BT4A 2IBMA 4TQ9A 5BSUA 3KPWA 1EX7A 2Q2OA 3FTQA 4ZTUB 1Z7WA 1J90A 2A9QA 2REQB 3HCFA 4WDQA 5HE9A 1XG5A 2XXJA 4M49A 5FEUA 2DAPA 5AW5A 4K40A 4RK6A 2QU8A 4NDAA 1PL6A 1O94A 2CBXA 3JSXA 3JWPA 1KBQA 3ZWBA 4U7WA 2AYYA 4QUIA 1L5RA 4FQ5A 4MK4A 1R18A 3JQGB 3ENZA 5A6SB 2J85A 3PF8A 4C22A 3TVYA 2ZTUA 4ENQA 4IV8A 4DDMA 4OSOA 1IY9A 2BMAA 4ZT2A 3SIWA 3W2FA 5C4MA 4IRXA 2X0DA 2GNOA 4DMGA 4C87A 5KOJA 2VA9A 1M2VA 2ZITA 3VKUA 2FF7A 1ODFA 2QTRA 1D2CA 2WYHA 3JASA 2JJQA 1JRLA 1KPIA 2KE5A 3NRBA 4LBVA 3KJGA 1CUGA 4KG7A 5IKPA 2QHXA 1UZLA 2I1LA 1DKUA 1AF7A 3JZDA 1KGSA 2JCGA 3IOCA 3T1NA 1JE1A 2MJLA 5ILOA 3TXYA 3UK1A 4ZJPA 3P2YA 4ZVPA 4QNMA 1WD5A 3KT6A 3ONEA 1NZJA 3T9EA 4F9GA 5CFOA 5LQKA 1G98A 2ASEA 2A33A 4QIHA 4LF6B 1GZ3A 3T4EA 5A5VA 3ROKA 7ABPA 5IG2A 1R7RA 2J3MA 3B6EA 3DPIA 2ZYRA 1FQWA 1NV9A 2A78A 2G71A 2PVCA 3DG9A 3OETA 4LXHA 4QXPA 4RE6A 3CT6A 5IMSA 2YY5A 3ILVA 1C3LA 1SKBA 1E59A 5HA5A 1FC0A 1MIOA 4U7PB 4Z9FA 1SVIA 3U49A 3SQMA 2PQMA 2IV2X 1JDUA 1TIBA 1M67A 4MUHA 1MT0A 3LE8A 1F6BA 3WRWA 2Q3HA 4FKZA 4XH9B 3A8TA 2VXOA 2PFSA 4OM7A 5LZ2A 1GZ7A 1PS8A 4HSEA 1J8MF 1E1CA 3OE4A 4V0NA 2SKEA 2JFZA 2OCXA 2ZK7A 3BIXA 4GYYA 4G65A 5A4AA 4N6NA 3F7MA 1Q7CA 3A9SA 1EM8B 2IYZA 3KDAA 4PO1A 1HYBA 1O4WA 3IBSA 3R7FA 4F1KA 3IIKA 1MO5A 1ORDA 1QCCA 1RMYA 1GQYA 2VP5A 3W5UA 2JFGA 2WKSA 1JDNA 1S2LA 2EZ9A 4IO1A 2K4MA 3UJ8A 4A6PA 5AVTA 3A3PA 3KAPA 4KVFA 2PIDA 4DIMA 3OEYA 3SJ7A 4RABA 3GEEA 2OXFA 1T6XA 2MYPA 1ONNA 2XZDA 3B3QA 4GVXA 4Q1CA 1NR1A 4V39A 1QS0A 1A9RA 2NYUA 1P73A 1GG5A 2WA1A 3JARB 4M98A 3MSXA 2YR0A 4EGSA 3F8SA 2H31A 2JGAA 2HM7A 2P2CA 4GRAA 4IZOA 4NPCA 5CLQA 3KKZA 1CHDA 2B1JA 3EVFA 5DGTA 2EF1A 2GXQA 1NL3A 3GDOA 3NBXX 2W48A 2JZCA 2QG6A 3N8IA 2HIAA 3U7GA 3A4YA 1P1BA 4TWZA 2RJNA 4YCMA 3PXGA 1A1SA 4N8SA 1VTKA 4ZI2A 1NVWQ 1M2VB 2NG1A 2Q07A 2RGCA 3CCBA 5DXAA 4YMVA 1N8KA 3HJBA 3LX6A 2C8KA 2ZI6A 2AZXA 1ZSNA 1M8KA 2PY6A 1QO0D 1V43A 4O4HF 3OC0A 4L3OA 3R7LA 3S1AA 3QITA 1ADCA 4BB0A 2HQSA 4I50A 5C8YB 1QFSA 1JL3A 2AD1A 2B92A 3IP7A 5HQTA 1SBQA 3NKVA 5EQDA 4D96A 4HVCA 2CXQA 1W52X 3U39A 3PQ7A 1P9WA 3LCVB 5CH3A 4XARA 3DH0A 2PU5A 3TOXA 2QZ4A 1G8PA 1Y82A 2GCEA 4BE9A 1UFOA 3RS4A 2ZSBA 5ES3A 2B8WA 1RACA 5E8JA 4FMCF 3GMTA 2D2XA 4QEDA 4DDVA 2F8LA 3EGIA 3K0HA 3QF7A 1MIOB 3C4JA 1TTHA 4JEMA 3UHOA 4KXNA 1Q11A 1LK0A 2XRZA 2HK8A 2H8GA 5AXAA 2ZBGA 4EUSA 3CNHA 1E5XA 2HJSA 1J0AA 3HJGA 1YQEA 1XCPA 3JRNA 5JVDA 2UXDB 1I94B 1RYEA 4N7MA 4NK5A 2EJBA 4WMLA 3K20A 4NICA 3W6ZA 2IHNA 3M6WA 3ZJ4A 4BUZA 1K8RA 3V1NA 4P33A 1U3FA 3AWDA 1PGQA 1RLIA 5CVVA 3ZWPA 4F04A 1IRXA 1MV8A 3DZBA 3JQ9C 1K6EA 3BYZA 3NM5A 1QRAA 1P7VA 2AF3C 2IQIA 5KWVA 5M34A 3G17A 1LNZA 2RCYA 1CY6A 4G36A 1PLKA 4RIEA 1LBEA 2C5FA 3R7DA 2WPDD 1KBOA 3COPA 4OOFA 4HP8A 4Y1GA 2QX7A 5TV2A 1M1YA 3DD1A 1L9KA 4JLKA 5JXJA 1JA0A 2E7ZA 1KMMA 1ZC4A 1QS0B 2OTCA 2X8JA 5G40A 5IDWA 4IHQA 5B55A 1KVUA 1QGUA 3F6CA 3RBZA 1FTWA 4D92A 1EVLA 2XB6A 3CH4B 5I7WA 1CY2A 4JDUA 2H7YA 2JFOA 3BMOA 2FV8A 3CIOA 1HWYA 1G8JA 1VIAA 1Y5MA 3ESAA 3TB6A 2H11A 3OLZA 4YDHB 2QN2A 3SR4A 1ILWA 4XVRA 3S2UA 3UK7A 3ANSA 3WWOA 1ZY2A 4CIDA 5FL7D 2CKMA 5LD2C 3QVOA 3T7IA 1L8XA 4CKCA 1MORA 2BCGY 1YOVA 1O95D 1VGRA 1CLUA 1FRVA 2IYVA 2VHXA 1OASA 3F49S 3QXJA 4KAAA 2A9OA 3P0FA 3JD1A 5GQSA 3RHZA 3ZHCA 4BTEA 1CUWA 4I3GA 3N0XA 3CF6R 4HQKA 4PLFA 5D6OA 1NUTA 1T0JB 2XVAA 3MK31 1VE1A 3OEHA 5EWJA 1UT8A 1G2OA 1X3LA 2VYND 2BMJA 2PQ6A 4JC5A 5ICFA 1MH1A 4PC2A 4IIBA 4I50B 3TVTA 5K0TA 2FJUA 4B75A 1KJYA 4DANA 5LP1A 1W5AA 3OOEA 3HXLA 1BD4A 4FCTA 5JYBA 1O94C 2CDRA 1TM3E 4WVFA 3ROEA 3NHKA 3RVOA 3DQZA 4H7HA 3O7MA 3DULA 1RBZA 1FLDA 1A4XA 1Z0JA 4ALMA 1ZH4A 1NWCA 4F8EA 1CD5A 4PIVA 2UXCB 3EXHB 1SC1A 1UJMA 3A2NA 5FH9A 5E4TA 5ER9A 5DHUA 5HKBA 1SHUX 3BUSA 3VHXA 3WGGA 4B73A 5B3JC 1SU6A 4G9BA 1T91A 1DIBA 3CN9A 2RJ3A 5T41A 4C0XA 5KX5A 3O4IA 1EG7A 2G09A 2I33A 1M6NA 4JT9A 5JVDB 2MINB 3ETDA 2V9CA 3IQDB 1JV2B 4QKQA 2FWJA 2QAJA 1VPEA 1TEHA 4MVJH 4TKMA 3Q15C 2VNSA 1N2JA 1DQYA 2X3UA 4J3JA 5I3ZA 2DQSA 2QRMA 4M21A 4DILA 3I2GA 4HDRA 5H5JA 4L0CA 4QEZA 3THYB 1ICEA 1LTHR 1R0BA 4NIMA 5AJTA 4KXMA 5J9FA 3V97A 4UUOA 3L18A 2V7BA 2X9QA 3KT8A 3WLHA 4KPUA 1QHYA 2RHGB 1I2CA 5TJHA 3KKKA 1QCYA 2C78A 3B1YA 4AY4A 1JG6A 3TRDA 1Z83A 4LWQA 5IAOA 1Y5IA 1XVTA 2HXSA 1M1YB 1K3TA 3AUUA 2GPTA 2DM6A 1G20E 3NOVA 4PNZA 1CRWG 1CR1A 4XLTA 3RF6A 4YLEA 1CVRA 3TXXA 4JH0A 1FXWA 1XYGA 4DE5A 4GL2A 5DYYA 1I51A 4IFEA 4XB2A 1QGUB 4N47A 3VVCA 3AK4A 3HXPA 1GAJA 2G1JA 4NAUA 4WEQA 1GKKA 5FOWA 2KHZA 1SOUA 3TW4A 5IVHA 2JHCA 3WB0A 3T5TA 3BMOB 3GUHA 4LYGA 3TPCA 5E7IA 4G67A 4CU2A 5IYZA 4M1QA 2FRXA 4DUPA 3PFIA 2B78A 4FFDA 4BOYA 3JALA 2Y68A 3AFMA 3EWNA 3T3DA 1JG7A 4CKCB 2V98A 4FYKA 2P2GA 2HPAA 2YVLA 3AMVA 2BH9A 4Y1RB 3PIDA 1DLJA 4UHCA 3RIMA 1VJ0A 1F2TA 2IEDA 4QGFA 3GUUA 5EWJB 2ZOSA 3DHNA 3ANXA 1E2PA 2XGOA 2WV7A 3ESXA 1QH1A 3GA7A 3L40A 4FQ7A 1X1DA 1YZNA 1UBOS 2R97A 1ZIDA 2HCRA 2Q1WA 3MUEA 4M9SA 4YRLA 4NC9A 5BYAA 4S12A 4MHSA 2YWRA 4C4YA 2DECA 5EE9A 2OCKA 1UJ5A 3DHEA 2Q2QA 2GVDC 4RU1A 3OIYA 3GMIA 3Q72A 1GP2A 3MGCA 4R98A 5ES4B 1E2LA 1NATA 5G2OA 2PUTA 4U02A 3AZQA 4ZD6A 2VJOA 2WUVA 1JDBB 4GI7A 4OBEA 3NAGA 5KX5B 4NCHA 4JBWA 1ZJ5A 3A11A 3IOBA 4RXMA 1XXHE 4ZT4A 3B1JA 2PMBA 2Z2JA 1FYDA 4AT1A 4PM4A 4W9RA 3RKSA 2Q3FA 1W29A 1GKUB 1QQ7A 3I05A 3QX7A 4FYWA 4G8CA 4MPRA 2H5EA 5I7RA 2WB2A 1PJSA 1QIHA 1V5WA 2W6CX 2PXCA 2ZULA 4P2BA 4Y7CA 2R1UA 4EQ6A 5HIMA 4CM5A 4FHGA 4CTMA 1OVGA 1JEAA 3A0RB 3D4OA 2PNFA 1SULA 4TTJA 2W93A 4HDRB 2Z30A 4HS9A 1RFLA 2I3BA 2J9FB 2X41A 3GEMA 2Q0SA 3AM3A 5HK9A 1YACA 6PFKA 2WM8A 1PFQA 4KPUB 5DGCA 1J99A 2I4LA 1RXIA 2OV1A 2QM3A 4FFNA 3VX3A 3VSDA 3S44A 2GHTA 2HMWA 3CRW1 1X7XA 1Z6YA 3C3WA 3EXHC 5G02A 4JI3B 3MYYA 3S8MA 3CWQA 4JC8A 1KEZA 3VUFA 9LDBA 1YL6A 2UAGA 1G16A 2XUQA 2P3QA 4MX8A 5DK6A 1Z0FA 1SVWA 3OECA 4G85A 3EVBA 4US0R 4WHMA 3WGJA 4DNXA 4R1UA 1B23P 1EXWA 4OY3A 1K8YB 3ETGA 5FOSA 1DRVA 4ZCTA 1KJNA 4BVHA 3W0LB 4UXJA 3SQXA 3E8MA 3CWZA 4EGQA 5IYZB 1RJ9A 3ML1A 3B70A 1O03A 3ELYA 3L5OA 1JDVA 3GZ4A 1BWPA 2WFMA 5DXJA 3JALB 4CKYA 4A82A 2FY8A 3TQQA 1BDHA 1XQVA 4LNUA 1BS2A 1WKBA 2OLEA 2C00A 3ICPA 3THWA 1ADGA 2GCNA 5F52A 3IQZA 4I55B 4GMDA 1F2TB 1VGVA 3O75A 3OAAD 4RPJA 4EY5A 5BUSA 3TN7A 1TNDA 3FCXA 2H06A 3DP7A 1TJPB 4KMMA 3K94A 4AUKA 2GAJA 1DFGA 2NVBA 4YO8A 4ZCMA 5CB4B 5HRAA 3TZQA 2ACEA 2AJLI 4HEQA 5G1OA 3T7EA 1SUIA 3PR2B 2XRYA 3VR6D 5HKOA 4TZ6A 4O5OA 4F9EA 1R2QA 2A57A 3EXEB 2H1VA 3AF4A 4KN9S 2AX4A 2YHIA 2VYFA 4UAJA 1VPWA 3ZWXA 3T3GA 4JLPA 3WSWA 2IWRA 2GEFA 3EPHA 1GOTA 4NKRA 4JEHA 3SG0A 2P1DA 2CHVA 4P4UA 1OH5A 4AZ3B 1AKNA 3HI4A 3T1OA 4HNTA 5EPEA 5KWJA 1DUSA 4EMSA 4EVRA 4U9HS 3L06A 5AYVA 1UJNA 2ETVA 2GPSA 4P38A 5AJXA 1X19A 1B93A 5I9SA 5H02A 2VOJA 3OTIA 4HDMA 1GAXA 1QC5A 3DEFA 3F3MA 4HNGA 2EDCA 4X71A 3ZJVA 2F1HA 3PGA1 2O8DB 1Y9ZA 4Q4JB 1RPAA 4B44A 2WILA 2I3DA 4BO6A 3FWNA 2P75A 2E85A 5IDXA 1Y8RA 1EP1B 3BULA 4FNAA 2C9MA 2AFHA 3AKEA 5IW8A 4FZRA 4BNHA 1K5HA 4MV5A 5DK4A 1IY1A 3UQZA 3HJRA 4GW3A 1T43A 2OPBA 4DJ5X 1X7XB 3Q7IA 4BXOA 3MS7A 2XD4A 2AOXA 1P4HA 5AR1A 4MV8A 1LSSA 2AXQA 4ZOAA 5FADA 2FDCA 1JDBC 2B8EA 3H1GA 4YHHB 1NFQA 1G8MA 2OZPA 3GYGA 5KQLA 4H7DA 1MP0A 1C9NA 3AR4A 4UEWA 3G49A 2WY2D 4GR9A 1NLFA 2JLYA 1FY2A 5EHZA 1NIPA 1ZX1A 3WBJA 4QT0A 2X9LA 3PC4A 3ZV6A 3OE7D 4K05A 4J0JA 2LVBA 1E7YA 2BEWB 4IGKA 4J07A 1CJUC 1RJ9B 3QSGA 1NFRA 3M33A 4II7A 1PWYE 1SIWA 3QLVA 4HH0A 4LE0A 1JBEA 4OQXA 1KMHA 5FOTA 3MT8A 3W7AA 1NX6A 2GPNA 3GLIE 1N5OX 3THWB 3LQ1A 1SHLA 3ECSA 4B4WA 4P5EA 1Y3DE 3E35A 3LDUA 4OGWA 1LY1A 1EFHA 2ZTLA 3NWPA 3N7AA 3FTEA 3VYRB 2R1ZA 3NG1A 5EINA 2F59A 4IJUA 2R4UA 4BATA 3RQIA 5CLIA 5K8VA 2R66A 3M8KA 4GECA 2B2XA 4E32A 1E2DA 2RAUA 1DWQA 3PC3A 4XX0A 3FOFC 4V2IA 3CCCA 3USES 2IH5A 2FN9A 3K7EA 2IP2A 3WLQA 2FW9A 2J9XB 2UYGA 3I2KA 3LY7A 5HF9A 2C2GA 1ZHOA 4YAJA 4EY4A 1D2EA 2QBYA 5J1TB 1DX6A 5H70A 2W2PA 4JASB 2H7XA 3E1SA 3TTVA 2DPLA 1HGXA 2ZRAA 2WJ3A 1I6MA 3FTCA 4PO9A 1U63A 1LDNA 4LHWA 5JBQA 2BMWA 1S9DA 2AZDA 2HHCA 3DMDA 3BE5A 2NPFA 3CLKA 3TBKA 3SX2A 5J63A 3NT2A 3I30X 4R40A 1L5OA 1QC5B 4MPPA 4URVR 3D1LA 2BBWA 2JFBA 1DI0A 1Q7TA 1CS4C 2HJVA 3DNMA 4IF4A 3T3IA 5LC1A 4AF7A 2YWBA 5E3JA 2D7JA 3UMJA 2F1IA 3PUIA 1JG3A 4N7RA 3KOMA 1WA5A 1Y8RB 1Y89A 4H6PA 3SNHA 1E8NA 1QANA 2AFHB 2ESRA 3NUGA 4Q9IA 2AN3A 1MABA 2JAQA 4XAQA 1SVKA 1QU2A 1H2RS 4ZCLA 1BJTA 3IAAA 3GH3A 4IXDA 3N6RA 4WRRA 2M1XA 4EMBA 4QD3A 4ZREA 1E3MA 1L8QA 2AN5A 5LVAA 1E98A 1XMJA 3LT1A 4Q0MA 4W9NC 3WVNA 1Z6TA 4C0QC 4KGVA 3SSMA 1AU9A 3RU7A 1XPJA 4BNDA 4MLZA 5I7EA 5AM3A 2ZBRA 3QP9A 3O8NA 2R2AA 3X2EA 2ZQZA 4GSLA 3AEKA 1R16A 3YASA 2QUAA 1ZBQA 4UUAA 5LUAA 2IZ0A 4ONEA 5FI3A 1EFDN 3IAS1 2OOKA 3Q12A 2NUAA 1YDWA 1OX6A 4NENA 4AJIA 1CWUA 3U09A 1Z16A 3GGOA 1PSWA 1NVGA 3CF2A 1GA1A 2G4CA 1V11B 5JZSA 1DRWA 1BEEA 2NGRA 4ITUA 5DMHA 1G2QA 2HSEA 4X1YB 4B47A 5A1JA 4JGBA 4R9VA 2BGUA 2QY9A 3UWSA 4L4RA 4NG4A 4C4TA 2NQ8A 1QONA 1TJYA 1NE7A 2ZYAA 3U37A 2P7HA 4XX0B 1ACJA 5CH8A 4RK0A 2O0KA 1JB1A 5GONA 5JCOA 2FMKA 2A7XA 4LV6A 3L7IA 4BO0A 5AW6A 1WY7A 3DLCA 4IINA 3T5PA 3E84A 2JHPA 3LVBA 4CKBB 5KZMB 2Q3BA 1Q44A 3EWIA 3PGMA 4UHKA 4CETA 2QBYB 3QPDA 2B3TA 1H85A 3KZVA 4Y6OA 3SZMA 3IEIA 5FNVF 4GGMX 4HWTA 1G21E 3KEQA 1OBVA 1T9GR 4JN6B 3E3LA 2Z5VA 2XUIA 5LQMA 1I8TA 5J5CA 1C29B 2FPLA 4O8CA 4PX3A 4ZVUA 1OWMA 2Y1FA 4JJ6A 2Z6AA 3T06B 1P33A 1W5SA 2YMQA 1YE5A 1QDLB 2HQRA 3WISA 4AY6A 4NV1A 2QMOA 5DM0A 5LR6A 2DSNA 5EY5B 5CFNA 3JRXA 3AUXA 4PAGA 3B1FA 1G8GA 1I7SB 3WV5A 3PA8A 3UT5A 4BASA 2P4HX 4JYZA 3R23A 2H52A 3WGLA 4Z0HO 4Z4CA 3AI3A 4I1SA 2IU3A 1Q0PA 5DHSA 5PGMA 1MABB 3G2QA 4CKZA 4PPGA 3GJYA 4KLCA 3H4IA 4RXTA 2Y66A 1OXSC 3GNTA 5D3ZA 2BVNA 1Y63A 3JVVA 3INYA 3QW2A 2V45A 1A9ZA 3CLTC 2YVUA 4AMBA 3VJRA 1P3JA 4Y18A 4ZQBA 4BNDB 4HNVA 5JQGF 2QLBA 1LEHA 4DCNA 4DJTA 1TTTA 1UXKA 2PGIA 3FPCA 4EA6A 1TA4A 5B1EA 4AS1A 3RC9A 2YHUA 1BEUB 1MEJA 1HFKA 1JUDA 3JD0A 2O6LA 3DE4X 1L5HB 2OBBA 2WWXA 2XRMA 1CQXA 2NUAB 3ROTA 2Y4NA 3HHEA 4NENB 3AILA 1SUEA 3H2HA 3P0RA 2PD4A 3QTTA 4C21A 3GEIA 4BE4A 1RLMA 4EB3A 2QMUA 3E5HA 2F1OA 4IGIA 4IDCA 4FS3A 2PX2A 3F67A 5BQ5A 3EJ6A 4A36A 4AJKA 3A9WA 3G2NA 3UAVA 1GG9A 2VJMA 2P9GA 1LDEA 5FV4A 1JHPA 1W5FA 3WRXA 3SZRA 1XQ6A 5J47A 2PGNA 5A1TA 3QSYA 1ID8A 4Q3NA 4RKWA 4RV9A 4WFQA 3EFOB 5AP9A 4AJNA 3WLLA 5F5XA 2HC9A 1B16A 1Q0LA 5CVEA 1YZGA 1KI1A 3IAEA 3MTGA 3P27A 4L73A 4PPYA 5GONB 4YT2A 4B6EA 5L7WA 3U7HB 2IYQA 1E7RA 1RXUA 2XTMA 2JIPA 2PSEA 3P4UA 3PUXA 2HNKA 2XVZA 4NYIQ 3FN4A 3NH9A 3SGLA 2PWAA 2Y2UA 3T54A 3TLBA 3CZCA 3BRSA 4L6CA 4EPTA 3IBTA 1FS5A 1FDRA 1V9SA 5C18A 2QQEA 1Z12A 2GJKA 2BGTA 1OFGA 2IPAB 2ZIUB 3AB8A 2AFIE 4IW3B 2VYVD 3AR2A 4M6WA 2VIIA 4WNIA 5JXGA 4LN1A 3LO8A 2UXBB 3C15C 2QB5A 2WWTA 2MSNA 3LWDA 3P9PA 2GHRA 4G25A 5A04A 4QXQA 3UMSA 1EUQA 4OQMA 1FW8A 1PR9A 2HX1A 3D6JA 3JTMA 3PC7A 4KXYA 4M0MA 2IYTA 1NBIA 3ZHRA 3F4KA 4F5YA 1YTUA 1G4UR 1YRYE 1U3UA 3TTYA 1YONA 4PPNA 3HCAA 1YZTA 3EPKA 3RC3A 2PWZA 3UT5B 2YNMC 3QBEA 3E15A 5T8KA 1BTOA 4PTYA 1JIUA 1VLVA 4OGLA 2IVZA 1DQNA 1YZUA 2J8ZA 1E3LA 2PEZA 2PS1A 1SB8A 3GV0A 4FPXA 4KYTA 2NM0A 2WWFA 3HJFA 2O3SA 4AP9A 1GZ5A 1DCTA 3W9YA 1Q91A 2WVHA 3QMMA 3N7UA 2FW1A 3GUYA 2GQ0A 1YR3A 4DSNA 2ZIXB 5F2OA 4GR5A 2OGZA 5DI9A 5C1IA 1KA9H 1NBWB 4GR4A 4AUNA 2WU3A 1RCUA 3RK4A 2YY7A 3ZJYA 5JVDF 1H4SA 1SG0A 1TL7C 1BGXT 1EFVA 3MSCA 2ETXA 4GQIA 2VDOB 4LDPA 3IBCA 4RKRA 1MOZA 2ZKLA 1JVNA 2R7AA 1DKOA 3VR2D 3ZEAA 1TZMA 2J30A 3WYEA 4K8OA 4BGDA 3RYIA 1QHHA 1KK1A 2WIAA 2M6KA 5DW0A 3TIGA 5L3VA 5LDDC 1H2ZA 2P67A 4GMXA 4TSKA 1RDFA 2PPVA 1T0HB 3CF0A 3OP1A 3RG8A 3SEFA 4A27A 3PF9A 2VJMB 3CZ5A 3FRJA 2QUKA 3E8SA 4ZPJA 2H16A 1MC8A 4JYPA 2O5RA 1JVBA 1J1IA 3WIDA 5AW8A 1RVV1 1U7UA 2X6TA 1QORA 3WL4A 5DLYA 4CT5A 4DCGA 1E0AA 3GZNB 3DL4A 1DV2A 3RRXA 3B7WA 3W2TA 2J0SA 3PR3A 2QZ9A 1RKUA 4HXYA 2W98A 4LF7B 1PSDA 1F8XA 1OU4A 2IITA 2XMQA 4TVKA 1C7QA 3NDPA 3ILXA 3CXUA 1IOZA 2OO7A 3GO4A 1OIWA 3UV7A 1G1AA 2PZ8A 5FFMA 1DSSG 2YCBA 4B09A 2YJZA 2JBHA 1D3AA 1I6LA 3I9LA 3IQWA 3ET4A 1QHXA 2R6HA 1GR0A 1BFKA 1YQQA 1CY7A 4ZVRA 4TN1A 1P31A 1IBCA 3G59A 1F5NA 2BUBA 1OI3A 4BQQA 4KREA 4G8DA 4IILA 1HDCA 3NVDA 2FPGA 1TYBE 2OQ2A 3W8DA 3PNVA 3T3EA 1KI6A 3P9SA 1ATZA 4N3BA 4QM7A 2PUEA 4PAOA 1HE8B 5L3SA 1U9CA 2C1ZA 3P2JA 5JH7B 4YXWA 1QWSA 1IJKA 2GJ4A 1XJ0A 3DHYA 3TGLA 4MGYR 4H6XA 5JS2A 2HWUA 4DZTA 4TPKA 4DCTA 1D6JA 2N1MA 5AKLA 4KKXB 1KDZA 1TW3A 2FH5B 3GLGE 1PBTA 1DOZA 4L6IA 4TL7A 5CDGA 3CO5A 4HEA6 1DEHA 4MQBA 3DNPA 1DUVG 2VDJA 4ZCSA 2JCSA 1GITA 1OGIA 1FDSA 3IXQA 3MMXA 5MGNA 4WZBE 1MHTA 2FZKA 4Z9AA 2DFNA 1AKYA 1L8LA 1AK2A 2NW6A 3HJHA 1S6YA 3PEUA 3TFWA 3A6JA 4F3NA 1UDRA 3NPMA 2C98A 3AIIA 4B3SB 4QQKA 2PTHA 1DXQA 2WG0A 1P5ZB 3T99A 4UNQA 4HLUC 1C9MA 3C7KA 3PXUA 4LYJA 3RYIB 1GG8A 1RAEA 2NO9A 3KB2A 4G6ZA 4HNAA 1PKEA 1UOOA 1XTJA 2FOLA 4DMLA 4CR6A 2RC5A 3KXPA 2IUFA 3E03A 4RETA 4B4VA 2CYAA 4BQOA 4JYMA 2O6HA 3G3EA 3LC0A 1D1SA 5TNXA 4KLZA 1Q3KA 1QV9A 3HN7A 2VF5X 1MR3F 3D7RA 2O0MA 3TTSA 5AHKA 3WY9A 3WLEA 4PQGA 1W34A 3TJMA 1D5WA 4TS1A 4LOKA 3A3NA 4KQ2A 3UAYA 2OR3A 2DSTA 4QDOA 5BQ3A 3WNBA 2O8EA 3VPFA 2PJRA 2DKOA 1G0OA 2OMEA 2GBPA 5JAMA 2IXEA 4XYGA 1N57A 2E55A 1PFVA 2NAFA 2QUZA 4LXIA 3T4XA 1VKOA 4PZ0A 1G7CA 1LPNA 3GVXA 1KAQA 4RSHA 1DTSA 2B6HA 2YKGA 2DXIA 4NOMA 2XYGA 3O8BA 1C1YA 1FPMA 3JVDA 4R2IA 1DOAA 1ZLYA 2GJ9A 4TTVA 1P1CA 2EERA 2FEPA 4WKNA 4D79A 2A9JA 4LC9A 3SZ3A 4FSHA 2FPGB 2QRJA 4Q47A 4R2HA 5ALWA 4AMVA 5LCXA 5F7OA 2DR2A 1YRHA 1XYVA 3MT9A 3G2OA 1R10A 1XZ8A 5I4BA 5L3SB 1YU6A 3WV4A 1XA4A 3GY0A 4YP1A 1KPGA 4M37A 3W5BA 1SBYA 2C4UA 3RSQA 2WK1A 3MJFA 3K2QA 3KSDO 1MQ9A 1BD3A 4BEVA 3KQUA 5SY4A 4E07A 4NHOA 1SKUA 3QH4A 5AJVB 1WXEA 1UMKA 2NTEA 2EZUA 5DBOA 2VWQA 4CW7A 4GVLA 2BC9A 4WOJA 1G7TA 3H5LA 1CZKA 3ZU4A 1X39A 2ZYDA 3E8XA 4OQQA 4RAOA 1VG0B 3BCRA 3SSNA 4D9FA 3OMWA 2B69A 3A70A 3RTCA 4F45A 3AUKA 1VLHA 2JJ2A 2QJFA 4GKVA 1G19A 4E6PA 2GVNA 2O0HA 4CFYA 3H5TA 2JFYA 2JATA 3V6MA 4RHCA 2R6JA 2HHHB 4ZHQF 4XSHA 2FEKA 3U44A 2C7QA 3B5IA 2YOGA 3QVXA 4FSDA 4RL4A 1QYIA 1RPNA 2DKFA 5H7XA 1NXPA 3ESBA 4CIYA 4LHSA 1LS1A 4D9GA 4C30A 1WR8A 1HLFA 1NN5A 3S4YA 2NYVA 4NU0A 1O3YA 2JCYA 1ZD2P 5JAPA 4TWRA 4LE1A 1JQEA 1KI7A 2H1CA 2QROA 2MYTA 5IC4A 1YNOA 3IODA 4LDNA 1Z33A 4HBGA 1KNXA 5E9WA 1OWOA 2PHZA 4NABA 2QT1A 3PPXA 5EFOA 3TLGB 1M9NA 4LJ6A 4BQIA 3QFCA 3B9BA 5TMBA 4JUBA 4FC6A 3CNEA 2OSVA 1PHRA 3IDQA 4JB8A 5B1DA 4G0VA 4ZYXA 1UT6A 2A88A 2V97A 2IH4A 1GPNA 4INPA 4ZZ1A 1ZS9A 1VE5A 3T9AA 4M9ZA 3HU3A 3DT9A 1VE3A 3Q7PA 4HH4A 8MHTA 2JARA 4BZQA 1OXMA 4L8FA 3IVMA 4J0CA 3EGWA 2VC2B 5K3CA 4AJ9A 1XP8A 4NMLA 4BV3A 4G4SO 3P9XA 4EZIA 1N2OA 1N8TA 2PSFA 2PXAA 4IPTA 3EUWA 1NRIA 4LRUA 4WESA 5SZJA 3R7WA 4L76A 5LJIA 4CJXA 4U7GA 2WIGA 1DBRA 4M7WA 1T9DA 3H8WA 4G4JA 3ET5A 3DTVD 3E18A 1RQPA 4KQXA 2VXYA 4YX9A 2PV7A 1VHJA 3UMFA 1KDVA 4FZVA 1FLNA 2OESA 4M2LA 2CVPA 1T6BY 3ANNA 3P71T 4ZO7A 2X0RA 1S89A 1KI8A 2XSZD 1QVVA 2AHRA 3UN1A 1ETUA 1J1ZA 3INRA 4OA8A 1RAGA 1ENZA 2DLCX 1HT0A 3HLYA 4UTRA 5K03A 4FJ0A 4FE4A 1DVRA 2ARKA 2OAQ1 3K32A 3HJCA 4OFBA 3OQIA 4Y2XA 3TTUA 2P77A 3O26A 5HZMA 1ZNZA 4JQSA 4MYTA 4C7KA 5DGDA 2UYHA 1Y1SA 2EIHA 5CEFA 2J7PA 2V5UA 3GJ0A 3GMDA 4PQRA 2RC6A 2P6RA 1V1JA 3U48A 5JJBA 1YCGA 4NXNB 4E0BA 3DOUA 1PNTA 3TWOA 4EUNA 4Z4IA 4FFMA 2YZMA 1Y5RA 3N2ZB 4ECEA 1T2UA 2EF0A 2BEUA 2MMGA 3A31A 2AI1A 3U44B 1QHIA 1BE8A 1ODSA 1SOVA 1YQGA 1IZZA 3W4JA 2QE6A 4UBLA 3V1UA 3DDWA 3ZLBA 3LHFA 2X19A 3CVOA 3HWSA 4S1WA 1V3TA 2G8LA 3PITA 1GV1A 4FUTA 1JPVA 1YA4A 4HRAA 1XQ9A 3AVTA 3OLYA 2JIMA 3BM5A 4EYGA 5TARA 2B34A 4XPZA 4BEWA 4LWOA 3M3PA 2X2FA 3NVAA 2F17A 1X7WA 3BORA 1GFIA 3O8QA 5I5EA 1ZUWA 4R54A 1UXIA 2JIBA 4OMUA 1X7HA 4E4RA 4MQUA 5KAMA 5TQVA 2BKUA 2WF9A 3V8VA 4FEYA 2V5AA 3D0OA 3FNRA 2G82A 3PL1A 4Q3KA 1G59A 1UBGA 4OFWA 1U6KA 1EVKA 3GZJA 4GG1A 2BFEA 3LAWA 2VJBA 4JGIA 3LW7A 3E9EA 1S2DA 1A88A 1D8TA 2PS0A 3BICA 3BG5A 1SD1A 2Q2VA 2Q5JA 3ZGXA 1XYYA 2CY0A 2G83A 4RY8A 3TQTA 3WQQA 1ZLXA 1G3IA 2QAIA 2XHEA 4FFRA 1Z88A 5F35A 3QG5A 5GJCA 5HF8A 4A23A 4AJHA 4YPVA 5CBPA 1ZD1A 2ECPA 2NVOA 1YRBA 3LNTA 3U17A 1U28A 1A3CA 2IEGA 3VR4H 5ITVA 1O6BA 4YAFA 2DPXA 2BTQB 2G25A 1NBAA 1VLMA 2HSGA 4LUCA 4WZ6A 4E5YA 1BRTA 4LBWA 3V4RA 2QR3A 1U1FA 3UYLA 2AOVA 3PVCA 4S1TA 2OCBA 5LQUA 2FCAA 2JAHA 1PQPA 1RHRA 4DA0A 3OLVA 3Q5DA 1DKQA 3I1FA 2TMDA 1Y4UA 3N28A 3P52A 5L45A 2Y71A 1C5KA 3QX9A 2Q8NA 3OZVA 4X64B 2I03A 1Z6GA 2OO5A 4UHDA 4YQFA 5CNKA 1JKIA 1RPJA 5DFAA 4LCJA 4PBRA 5CPBA 3JVUA 2GBLA 4KQ9A 4KODA 5IAJA 2FW7A 2RH9B 3FI0A 4Z99A 5AVUA 2PTGA 3QUQA 4D9HA 4ZZ2A 3OQIB 2PX3A 2QRNA 3OQPA 2BHSA 2ZT5A 1FBTA 1WVMA 2WHRA 3NXSA 4QJ3A 4FE3A 3PUVA 3E4CA 3C5VA 4JLNA 1LPMA 4GI2A 3UICA 4OTZA 1QF7A 4KHPB 4O0MA 4E2XA 5ICSA 4U0KA 3UW3A 4AKGA 2BGKA 2QG4A 3TZHA 3MGBA 8AT1A 2WB4A 2JZNA 4BDSA 4H6VA 5CDFA 2CEAA 2RKOA 4UEKA 2BEUB 4MICA 3JZMA 3WRYA 4BO3A 4C3ZA 3H5AA 4ETMA 4RHUA 5L53A 4CF4A 3PRYA 1CR6A 2RG1A 4EG3A 3ZWAA 2R62A 2HK7A 4JJEA 2GO7A 3WK4A 5JPCA 4JR1A 3R8CA 4A9AA 1IOLA 1DCMA 2IEYA 1IVSA 3GF4A 1U2SA 5HX7A 4KIGA 3I9KA 4TM8A 3DVLA 3WXMA 4Z2AA 1Z7BA 3K31A 1X7WB 1YBAA 3KOWA 2Q3DA 3HYRA 3O8QB 3QKSA 4UMVA 4EHAA 1GU7A 3GRVA 1VSUA 3ZCPA 1MJGA 4JR0A 4YT8A 1JLMA 2FB9A 3NYRA 4O02B 2ZU0C 3I28A 4DLZA 1UL1X 4NFSA 1FUKA 5A5DA 2CXNA 3R4VA 4ZZ3A 2VWHA 4QGSA 4B34A 2XCUA 2X9VA 3IUEA 3HRKA 4NJEA 1SN7A 1T1IA 3ZS8A 4E14A 5AK3A 1L7EA 1SQGA 2IXFA 4KO8A 1QCDA 2W2QA 3P94A 4QXOA 3GK3A 4FEEA 3CNNA 4MH0R 3LLSA 2HT6A 3BK1A 1CQIB 3G2MA 1DKLA 4XUCA 3F2VA 1U7XA 1XGKA 2A92A 5GGYA 4D8VA 2QLTA 4MWZA 1U0HC 2ABWA 3S1SA 4R1OA 3AC0A 4UATA 5HK8A 1RYMA 1H3EA 3RT9A 1HE1C 5T4FA 3K0EA 4E11A 3VTAA 4A6EA 1R1DA 1EK0A 5KQRA 4NNPA 3C39A 3WO0A 2WW8A 3S2IA 4PG8A 3PS9A 4Z4QA 1ZGCA 4EW1A 2ACKA 2FSPA 3C3DA 4CM1A 4EY7A 1NU6A 1OWLA 5EP3A 5CX1B 3SNKA 3PGKA 4DWJA 5JASA 3OZDA 3IE1A 1IUOA 3ZNQA 1MNQA 1EIWA 4F3KA 2Q7OE 3BSFA 5TVKA 1ISPA 1OX5A 1TO6A