3TL3A

Structure of a short-chain type dehydrogenase/reductase from mycobacterium ulcerans
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
243
structure length
236
Chain Sequence
b'AVAVVTGGASGLGLATTKRLLDAGAQVVVLDIRGEDVVADLGDRARFAAADVTDEAAVASALDLAETMGTLRIVVNCAGTGNAIRVLSRDGVFSLAAFRKIVDINLVGSFNVLRLAAERIAKTEPVNAEERGVIINTASVADGQIGQAAYSASKGGVVGMTLPIARDLASHRIRVMTIAPGLFDTPLLPEEARASLGKQVPHPSRLGNPDEYGALAVHIIENPMLNGEVIRLDGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain type dehydrogenase/reductase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium ulcerans
molecule tags Oxidoreductase
total genus 89
structure length 236
sequence length 243
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3tl3A00
1N7HA 4LSMA 4CQMA 3DC2A 4IXTA 4WLEA 5JAIA 1LLCA 2NQ8A 3RUCA 1JTVA 1UDAA 1I2CA 1V3VA 3H6KA 3WNQA 3F1KA 3WMWA 3E9QA 1FF9A 2QW8A 4TQGA 1JWBB 4OSPA 4YT8A 2G17A 4NBVA 2FSSA 2VNAA 3ROQA 3PYXA 2WEKA 5ER9A 4LVUA 4C7JA 1PS0A 3UICA 5CDTA 1LLUA 1GV1A 4JN6B 4EEZA 4PLPA 2EWMA 5TX7A 3SBOA 3EDMA 5TT1A 2OP1A 2HMTA 3LSYA 2ZB8A 4PG8A 1NVMB 4HX5A 2PY6A 3PDJA 2X0IA 3OIFA 4GX0A 4RVUA 3LU1A 1PJ2A 4TRJA 3T7EA 5I7EA 4CJXA 2GD1O 2OGUA 2PH5A 3A1NA 1AN9A 4YT4A 4XA8A 2B4RO 3RBVA 4PLVA 4MVJG 1SCUA 3ZWVA 2GPTA 2X9NA 4XB2A 3Q3CA 3GZNA 1E1NA 3AUSA 4JK3A 1MFZA 3ON5A 2PV7A 4EI2A 3DTYA 3HZZA 4R3NA 1IL0A 1GTMA 2NVBA 2VUSA 3NTRA 5A04A 3D5TA 3DBHB 2VHWA 4H16A 1O95A 1H2HA 2ZJ1A 3GNTA 2A35A 2V6BA 4YJFB 4IDFA 1N5DA 2RH8A 4I5FA 4QEDA 2CD9A 1YXMA 1QLHA 3NGXA 1Q0HA 2SCUA 4AVYA 3DWFA 2VCYA 4RL6A 1BDBA 1X14A 4PLFA 4BNNA 5IXSA 2CVQA 1ISFA 4DYDA 3C7CB 2B5WA 3QQPA 4N5LA 2XXJA 3KM0A 4Q3BA 3RSHA 1Y8QA 4FCCA 4XGIA 1PR9A 3E18A 3ULKA 3FSRA 3KEOA 4PLYA 5AYVA 3PTZA 1JN0A 2VRBA 3I9LA 2D4AA 3OBBA 4JLWA 4U0JA 2Q4EA 4CMBA 5IDYA 3NX4A 2O48X 4E12A 4DGSA 2BFAA 2IXBA 2Y93A 5DDIP 1P1KA 2CZCA 2FY8A 5MDHA 1A5ZA 3D4PA 1SMKA 3WGTA 3IAHA 1M6WA 3I5MA 3CPSA 1Y6JA 1R66A 3IS3A 3WYEA 4II2A 3HDJA 1NXQA 4W6ZA 4IJUA 1EEHA 4QXMA 4FJ2A 2C20A 1HDXA 2ZB4A 3FTNA 5FYDA 3PJGA 5L40A 2QRLA 4IQGA 4FSHA 4UUNA 1U8XX 4FB5A 2DFDA 3COSA 4Y6RA 5EN4A 1J0XO 5AXCA 3I9MA 5L4NA 5EQFA 3GK3A 4AJNA 3WBFA 3KLMX 3HJAA 4J3FA 1EQUA 2IYOA 4WECA 1PJCA 4YRDA 5I8WA 3NV9A 5T64A 3JYQA 1BXKA 5C5IA 5K9ZA 3ZHZA 1UZNA 1I32A 4L4RA 3RFTA 4CM4B 4J7CA 4DA9A 4J0EA 3S1LA 3ZNPA 3OIDA 1EVYA 3SJUA 4GGPA 1DIGA 2R00A 4Q39A 3W1VA 1QLJA 4XDZA 1E7SA 1GFSA 1GQ2A 3ZI0A 3G49A 4FGSA 1T2CA 5L53A 4LISA 3AY3A 2B4QA 1ZNQO 5DBFA 1Z75A 3IC5A 3PHIA 2OP0A 1N7GA 3KXDA 4IMPA 3QVOA 1HDYA 2Q99A 4YEDA 1ONNA 2AEJA 4K6CA 3BMQA 3WR5A 3U4CA 4NBTA 3EVNA 1HZZA 4IIVA 3LLSA 4OKNA 1SEVA 1R6DA 2DUUA 4XYLA 4YWJA 2IRWA 3PJEA 5DOVA 1D1TA 2HCTA 2Z1MA 4J16A 3GN2A 4L4XA 2BD0A 5DCWA 1Q2XA 2WD7B 1RM0A 4YT5A 3WJ7A 1SB8A 3I6QA 1B8PA 1RPNA 4HXYA 4RV9A 3L0DA 3DBVO 4IZHA 3HDQA 3KUXA 2X9VA 4W4TA 3JQAA 5HWSA 1B0AA 2PLAA 2JFGA 4P4LA 3JQCA 4N5NA 4CM3A 1EBUA 3AFMA 2RIRA 3QWFA 1I0ZA 3DBRA 3NJ4A 1ADFA 4E5NA 2X0JA 4I5DA 1ONOA 1SO8A 1X0VA 4AJ4A 1I3KA 1I2BA 4J0FA 1DO8A 4B8ZA 4XB1A 3Q6IA 3PEFA 3ENKA 4MDHA 3QJ5A 4BO2A 3AM5A 4BO0A 2BRUA 4BKRA 4RDIA 1NM5A 5LC1A 5C7LO 3QHAA 1MC5A 1E1LA 3PPIA 5F5NA 3NTOA 4I08A 1NBOA 2YFQA 3MJEA 1GY8A 2XPCA 2P5UA 4AJ1A 4W99A 3QVSA 4PN3A 4CMEC 4XQCA 2CDBA 4OAQA 3L4SO 4UUOA 1WDLA 1SOVA 5JBIA 3ETGA 3V1UA 2PTGA 3K6JA 4MVJA 4A10A 3RC2A 1EUZA 1PJ3A 2JD1A 3UH1A 3W6ZA 1ZFNA 1CRWG 3DFUA 3F47A 4AFNA 1RKXA 3OSUA 1V6AA 3FD8A 1PJTA 2I3GA 2I67A 3FWZA 3GGOA 3PJFA 5TJHA 2X5OA 1E77A 4OMUA 1O9BA 2X8LA 4XGNA 2VHYA 1ENOA 5G4KB 1GDHA 3N74A 3GEDA 3ZHYA 4J9UE 2C2XA 1KVTA 4JNKA 5ICSA 4FFPA 1NP3A 4K26A 1A27A 4E5MA 3FN4A 3ZWNA 1LLDA 4Q9NA 2OMEA 3OFSA 3TDKA 1D7OA 2D0IA 2RCYA 4LN1A 4HP8A 2PKQO 2Q2VA 4CQLA 1DBVO 1NASA 3JQBA 1HDZA 4RPLA 2JHGA 1H9AA 1MGOA 5ENDA 1PU2A 1RJWA 1BTOA 2IZ0A 3OHSX 4EW6A 1RYDA 4IPTA 5JY1A 1P3DA 1XEAA 2BFPA 2FZWA 5T5QA 3JD2A 2VUTA 1KOLA 3WGZA 1N92A 3RC7A 3ZHBA 1XQ6A 3L4BA 1GCUA 1E6UA 1SAYA 1CJCA 3AM4A 3JQFA 3ANMA 4HFNA 1QV7A 3DB2A 4ZQEA 4DVJA 1ISHA 1B15A 2NTNA 3WLFA 1CERA 1DSSG 5K0ZA 2X1HA 3RVDA 3X2EA 4BNMA 2FHSA 5J23A 5BSGA 4HFMA 4HKTA 3UXYA 2FP4A 2PGJA 1FDTA 4FBGA 4ILKA 3TZKA 1F17A 1VL8A 4R5MA 1NVTA 3WX0A 2NTJA 4TRNA 4XYGA 5TF4A 1PEDA 2W2KB 4L4SA 4F3YA 5FF9A 4FFRA 2HMVA 5I7FA 4E0BA 2CNBA 1R4NA 3BTOA 4JROA 3A06A 2I99A 1PGJA 1BRMA 2UUOA 2Y1OA 3QWIA 1Q7BA 2Y68A 5EQDA 2FN7A 3FNGA 3FWNA 3GF4A 4MVJI 4YAGA 4BNTA 4BNIA 4GQAA 3U4DA 5IDWA 3ZU3A 3C7DB 2C7VA 4C4OA 2QZZA 4BQPA 1DFHA 3WFIA 5TS3A 3GEGA 2EGGA 5L4SA 2AW5A 1V35A 2Y0DA 1MX3A 1BW9A 3KO8A 1YWGO 1RM4A 2UYYA 4CUKA 1RYEA 2ZK7A 1E3WB 2UDPA 4OOEA 4BB6A 4H15A 2OXIA 2RBEA 1DLJA 4FR5A 3W8EA 1DIAA 3MWDB 2XXBA 4XR9A 3WIEA 4NMHA 3HN7A 4LVCA 4E2XA 1MXFA 3KBOA 4RO0A 2F1KA 5DNAA 1U2DA 5GZ6A 2EJVA 4IDAA 2O3QA 2Y1GA 1E1KA 4BB5A 5G0TA 3T4XA 2CMDA 5JXWA 1ZCJA 4U6SA 2IE0A 1MA0A 4EJ6A 5CEFA 1P1FA 2X4GA 4IDGA 4UULA 5TJ9A 1U3UA 4PLZA 3HWRA 1GEGA 4L74A 4HNHA 3BYZA 2NVUA 3ASUA 3IJPA 1H6CA 2ZCUA 2YHIA 3FPCA 4PLWA 1C1XB 1GEEA 1O8CA 2POQX 4I9NA 4NJMA 5KJFA 3EMKA 4NK4A 3BHJA 2JCVA 1W8DA 1BVUA 4RF2A 1XCBA 4Y9DA 4XX0A 2XF8A 3OH8A 4KDFA 4XQGA 2Y05A 4NFYA 4QFDA 3AOEA 4MKZA 4PLHA 2G0TA 1ZK3A 3IIEA 1A4UA 3QRWA 3U9LA 1VE9A 4P38A 1OOEA 2UVDA 1D4FA 4R69A 2EGHA 5B37A 4O59O 3CIFA 1PGOA 1W0CA 1E3EA 2D5CA 3PVZA 3NDRA 2BELA 2GN8A 3I9KA 3WQSB 5JC1A 2VHXA 5CFZA 5KJ1A 3M1LA 3SLKA 1FDUA 1HDRA 5HA5A 5HRUA 4J4TA 2P68A 1PZEA 2VYND 3H7AA 4RF3A 1P31A 5JDCC 3VZRA 1T1SA 2HUNA 4XD2A 4ZVVA 2W4QA 1HWYA 1E6WA 1MV8A 3QY9A 4ALMA 3HQ4O 3NT5A 3PQDA 3W4JA 2YQ5A 1LDYA 1E7WA 5KJ6A 4BNGA 2JAPA 1ISGA 4KQWA 4ALKA 1LRKA 1YVEI 3H5NA 2GUGA 3K96A 4LRTB 2CF6A 4ALLA 2J5QA 2ZATA 5DF1A 5JCXA 4Q3EA 2PKRA 2I3AA 3B1KA 2DVMA 3UF0A 4B3HA 4RJTA 3B1JA 3ZV5A 3PXXA 1VJ1A 2FSVA 4BQRA 1BHSA 3JQ8A 3CUKA 5DP2A 4RLSA 1MG0A 2CSUA 1GQQA 1VJ0A 3WGOA 3L6DA 1FJHA 4MPDA 4R9SA 4KZPA 2JFHA 1QKIA 4WGGA 1R4MB 1Q7CA 3R1IA 3UKOA 4BO8A 1ENPA 1JAYA 4R1UA 4A27A 2ZYDA 2CVZA 3DZHA 3DHEA 2PZLA 2YW9A 1E1MA 4E6PA 2Z1NA 3AY6A 3SVTA 2EW8A 2FZEA 3F1LA 1E7MA 4CQMD 4FOSA 3MWEB 3RROA 1AUPA 2P9CA 1ADGA 4M8SA 7MDHA 1HSOA 4AJPA 3K73O 2GZ2A 3PFFA 1NQ5A 5C37A 5H82A 3DOCA 4RZIA 3RUIA 4GKVA 3U49A 1NPYA 3SXPA 4L73A 4Z9FA 1UP7A 4FC7A 1QXSA 1LDEA 1HKUA 4RORA 1U9JA 2HK7A 1C0KA 4QFCA 4IJWA 1GYRA 1E0DA 2BMAA 5DBIA 3GMDA 4BKOA 4BVAA 1IPEA 4QECA 3RWBA 3CZMA 4YYZA 1E3IA 3QA9A 5MGBA 4GX2A 4UAGA 2ZYAA 4UVHA 3EY4A 3AI1A 3WSWA 3MJTA 1H93A 2H1SA 3PQEA 4PG4A 3TPCA 5TQVA 5F3RA 1E92A 3RASA 1EUDA 4OHUA 1ZH8A 3STHA 3TRIA 1I3MA 3HSKA 2Q1SA 4P4NA 4ALJA 5L7WA 4M49A 5C7IO 1N2SA 3WS7A 4K28A 3ROMA 5C3MA 4JBGA 3RFXA 1FDSA 2O3RA 1MUUA 5ADHA 3OJFA 4WCFA 1JQBA 2ZB7A 5AXAA 1XU9A 2W8ZA 2GN6A 1F8FA 1VPDA 3D4NA 3GGPA 4KQXA 3FNEA 4UREA 4ALNA 1VKNA 4Z3KA 1XGKA 4MOWA 1VSVA 3KV3O 4HWKA 4BNHA 4XQEA 5BR7A 5JYEA 1NHWA 3K9QO 4MIEA 5ENVA 5U4QA 3EK2A 4XR4A 1ZBQA 1ZSYA 3O26A 3U0BA 5I7VA 3AFNA 3MJCA 2VYVA 4YJHB 1PGQA 2E37A 1R16A 1PS9A 2OFPA 4AG3A 4WNIA 2J3HA 4K1LA 4OGWA 3VPFA 4J1TA 2HDHA 1Z73A 3LC2O 1OMOA 5EPOA 2OUIA 3KRTA 4R51A 3S2IA 1KEPA 4DBZA 3KVOA 2Q2QA 4JP2A 1MFPA 4WEQA 3TL2A 2G76A 2JCXA 2BFOA 1ISJA 1ID1A 2ET6A 3AW9A 4DC1A 3GDFA 1U8FO 5F1KA 5T6BA 4RVHA 1X1EA 4FDAA 5JO0A 1A4IA 3ZW8A 5A5FA 4I9UA 4KWIA 3LF2A 5TNXA 4OJNA 2VWGA 3ZWPA 4EBFA 3GVCA 2GYYA 1ZMTA 5I7SA 3RJ9A 4ZJUA 5A03A 3DAPA 4ITUA 2O3JA 3H9GA 3KSDO 3ZV6A 5I9NA 3VAZA 3KSZO 4WASA 3DHNA 3S55A 1UXKA 1C1DB 3E5RA 1NWHA 4MIYA 4Z0PA 1YRLA 5BNIA 1HDOA 3I9OA 1XA0A 4CM8B 2HK8A 1KS9A 4R1TA 5JY6A 1Q0LA 3TFQA 4IDBA 3LK7A 4E31A 3KYDA 4OOFA 1XELA 3F46A 1HETA 1FXSA 4BUCA 3NKLA 2CY0A 4Z0TA 3TL3A 8ADHA 1LC3A 2QG4A 4LMRA 1LEHA 3VZPA 5CAEA 1YDEA 2GSDA 4GMGA 2Q1WA 3JD0A 5JAMA 1NFFA 2C0CA 4YRBA 1D3AA 3ZV4A 2E49A 5CEJA 5ES3A 2FWMX 1ZSVA 3AY7A 3KZVA 3QLJA 4J1NA 4C7KA 3ZWWA 4Z6KA 1LBEA 1YKFA 2EKLA 3RFVA 2P4QA 3H3FA 3K31A 3E1KA 1PJSA 1NAIA 2B4TO 4UEKA 2EHDA 3PLRA 5JPIA 3G17A 4B3IA 4AL4A 1R0SA 2EF1A 3TZHA 2JKVA 3Q1LA 5CDYA 4D0SA 4J4BA 3TZ6A 2VTEA 2FRDA 1JA9A 1CF2O 1F0YA 2E6UX 1AXGA 1DIBA 1T4DA 2ZTVA 3L9XA 1K0UA 3PHJA 1A7AA 1GCOA 3QVTA 4H7PA 3VZQA 3O03A 3VPXA 1LXCA 4H3VA 4O1MA 4WNCA 1VC2A 1R0KA 4D0RA 2V65A 4R9RA 4J49A 1R0LA 4E21A 1H2BA 1UZMA 3PYLA 3CZRA 3QV1A 3QWAA 2R00C 4MKXA 1PWXA 4E2ZA 1X1TA 5A3VA 3OM9A 3PGXA 3GQVA 4OQYA 2WDZA 1WP4A 3JYPA 1P33A 3IP3A 1TT5B 5A9SA 3DMTA 4CMIB 4E5PA 3E5MA 1YJ8A 4JJGA 1HLDA 3BTVA 3M1AA 4JGBA 4EJ0A 3H9EO 3DQPA 3CXRA 1JLLA 5DP1A 2X0NA 1H6AA 5JLAA 3LVFO 2EJWA 3CTMA 5ILGA 1GR0A 1AGNA 4E32A 2IDZA 4ND2A 4GVLA 1MB4A 3LT1A 4JBHA 2VZ8A 2P9GA 3PI7A 4D42A 2WM3A 3VTZA 1TB4A 2B5VA 3TWOA 4DQUA 1WLYA 4M55A 4Q3NA 2QRJA 1ZZEA 2G1UA 1YBAA 3EYWA 4EJMA 4YXFA 2DPGA 3E9MA 4FJ1A 2NU9A 5AQ1A 5FI3A 4OM8A 3OIGA 2DTEA 1U5AA 1Y8RB 3GFBA 1LDMA 5G4KA 2Q50A 2UUPA 2WYWA 4HBGA 1PIWA 1ZKMA 5EERA 3RUEA 4L9RA 2I9PA 7ADHA 2J3JA 5BNTA 1DFGA 3VH2A 3U4HA 4EUEA 2X5JO 3TF5A 4L76A 1BDMA 1RWBA 3GVHA 4KOAA 4RQUA 3CE6A 5AXBA 1HYEA 3P7MA 4LCJA 2R2GA 1DRVA 3L07A 3U3XA 3GY0A 1KEVA 1WWKA 2YUTA 2A4KA 2ZTLA 4O63O 2Y66A 3FR7A 3CH6A 1E3JA 4ZQHA 1PR3A 3DZBA 1UXHA 1HF3A 2O4UX 4J2HA 3KYBA 4D3FA 3RC1A 4FOOA 4CV1A 3RI3A 4TRRA 1P45A 1E5QA 3O9ZA 3AUUA 2ZQYA 1PQUA 5IDXA 3C3XA 1EK5A 1I36A 2UV8A 3JQGB 3MTGA 2EP7A 4J1SA 4ONEA 1UJMA 3BMNA 4R1SA 4G65A 5GZ1A 4CL8A 1EE2A 1EUCA 3EZYA 1I24A 2O2SA 4OXYA 3OICA 5TSDA 3B1FA 2BHLA 5GY7A 3PLNA 1YOVB 2PGLA 2OL4A 2Q3EA 1DC5A 2E82A 4RCVA 4R5HA 4MP8A 1HSZA 4MKRA 1N9GA 3BMCA 4D45A 4CMKA 2X7HA 2QIOA 3DTTA 3SLGA 2HJRA 1GYPA 1P44A 1E3LA 2Y0EA 3O8QA 5BSFA 2PD4A 1WMAA 3JD1A 3D3WB 3M6IA 2E4AA 5HS6A 4EITA 1XR3A 3R0IA 2O3TA 4GWKA 3HE3A 4YJGB 4J90A 4PFJA 4FQ8A 4QT0A 4U7WA 3JQ7B 1KERA 4E2YA 3L6EA 4LSWA 5EESA 4EUHA 4YPOA 3JQBC 2VZ9A 4BKQA 4D3SA 1E3SA 4DLLA 3DL2A 1S7CA 1O89A 1OAAA 2NACA 3ASVA 5TC4A 1DHRA 5LDHA 2PD3A 1GADO 3X2FA 4NK5A 1YO6A 4RQTA 3C85A 1M75A 4B4OA 3AUAA 2C59A 3A14A 2DT5A 2HJSA 3L4BC 3TJRA 4S3MA 3JQFC 1HZJA 4MIOA 4E2WA 4BS9A 2VHZA 3G1UA 3RC9A 4R1NA 4CLOA 3BMOB 3SJ7A 5IAAA 2CUKA 4DIFA 1BGVA 3ZCXA 4X54A 4N5MA 1U7TA 2C5AA 3PHHA 2J5KA 3GUYA 4NBRA 2W2LD 1V8BA 1BXZA 1AE1A 1FDVA 2HMSA 2W90A 1F12A 1NPDA 1MXHA 3FCOA 1NX6A 3GDOA 2D8AA 4GX5A 3RJ5A 4CQMB 2D59A 2AG5A 1DRUA 4QQRA 4JJFA 2D2IA 3ZGYA 2EP5A 4TROA 1V0JA 2GLXA 1NFRA 3QE3A 3A9WA 3Q11A 4R41A 1EFKA 1NPTO 4DMMA 2Y0CA 3ANNA 4ND3A 4D79A 1I3LA 2EKPA 1NR1A 4GLOA 2QYTA 4DWVA 4JCOA 3UCEA 5C7OO 3JV7A 4Y8VA 4YAJA 5IFLA 1SBYA 1T1RA 3H9JA 4A2CA 3WLEA 1LJ8A 4ALIA 1FK8A 1U1IA 2I76A 2DBQA 3OEYA 1LA2A 5U9CA 4J6FA 4U8GA 1XIVA 3AWDA 1ISIA 3P19A 3VPHA 4PZDA 3TZCA 1U3TA 3H9QA 4J43A 3AK4A 1T2EA 1P1RA 2P9EA 4BO1A 4BO5A 4QTZA 3IUPA 3GZNB 1BSVA 3ZNOA 1DB3A 2O2YA 2O23A 4J2OA 3H9UA 4NJOA 5G0SA 4IS2A 1JVBA 1U5CA 4J91A 3LF1A 1GPJA 3GVPA 4IY1A 4ZRNA 5ITVA 1ZK2A 4QO8A 1I01A 4AJLA 4CR8A 3D1LA 5KVQA 4IGFA 2BI7A 1P1HA 1DC3A 2YDYA 2BGMA 4RVDA 3IP1A 3GVXA 4J1QA 4J7UA 5JYDA 4B7XA 1PJ4A 1DPGA 1JW9B 2XOXA 4UEOA 1AXEA 1OBFO 1Y8QB 4M54A 2V6GA 1H6DA 2CFCA 1GD1O 4QUKA 4WUVA 3ZV3A 2AE2A 1R4MA 3WTBA 3GFGA 2Y1FA 4A7PA 4BGVA 4CM1A 4CLEA 3S8MA 4IIUA 4B3JA 5A9RA 3AOEC 4KDEA 1MC4A 3S2EA 3ONDA 2PWZA 1R37A 1NVGA 3H2SA 4LGVA 1TXGA 3JQDA 4I5EA 1IPFA 4IZIA 5KWEA 1ORRA 4RLHA 4WPGA 1B16A 4IDDA 3U4IA 1I3NA 1K6IA 4HFRA 2FR0A 2I66A 3C7AA 1P1JA 3H4VA 5JDIA 1A7KA 1EVIA 1X15A 4XGKA 3ABIA 3IOYA 1GPDG 1A71A 3DHYA 4B4VA 5GZ3A 5G0WA 4D44A 1M2WA 4U5QA 1EDZA 4HADA 1UP4A 4RPKA 1LSSA 3GZ4A 4DXHA 3K92A 5F21A 4D46A 2AQ8A 4BNFA 5L7YA 2E48A 4GX1A 5U1PA 1ULUA 5L9AA 4BO4A 1T4BA 4AJKA 2EIHA 2FR8A 3I52A 4JQCA 4NBWA 3UGKA 1ML3A 3EUWA 1AHHA 2D1YA 2B35A 2O3UA 2X86A 3U5TA 3BTSA 3WMXA 4CV3A 2NWQA 4UVIA 3K8ZA 4CUJA 3M2TA 4YT2A 4PGFA 3WXBA 4E30A 1Y5RA 4WCDA 2O7SA 3HB4X 1IE3A 3QVWA 3DMYA 4W82A 3W8FA 1FDWA 1X0XA 1UDBA 2QQ5A 3RCBA 4NR0A 3CKYA 4YRAA 3VPGA 2X6TA 3GAZA 1LNQA 3U62A 3LC7O 5H83A 1T26A 1IY8A 1M66A 3I3OA 5EJ2A 5CDUA 2DAPA 2GZ3A 4KWHA 1H9BA 1YDWA 5L7TA 3FRJA 3UAGA 4AJOA 4OL9A 5A3JA 4AJ2A 4XEHA 4F6LA 3ST7A 2IZ1A 4WK6A 5KOIA 5L45A 2BI8A 1Y5MA 4XRGA 3O4RA 5G2OA 2GDZA 3JQ9A 1NYTA 2DC1A 4Y6SA 1DEHA 4LW8A 3JQAB 2VOEA 4MVJE 1R15A 2Z5LA 2V7PA 4HV4A 3IKTA 3DFZA 2VYVD 4ZA2A 3ETDA 4BGUA 1DFIA 4NQZA 4PZCA 1P0FA 2BGKA 4FS3A 3LC1O 1XYGA 5G0VA 3UOGA 3DBRB 4DMLA 4NU5A 1I2ZA 2DQ4A 3AM3A 3F5QA 3FR8A 3UN1A 5FEUA 4JP3A 1J4AA 1GZ4A 1P0CA 4O5OA 4P8RA 3WICA 4XIJA 1VRWA 5AVOA 4CM7A 3L77A 2HMUA 3GMSA 3ORFA 5I9MA 4CR6A 1KBZA 3VH4A 1GQYA 4CV2A 2NSDA 2VRCA 4OYRA 4E33A 4DREA 1UAGA 1LDGA 1ZEJA 3NAQA 3VKUA 1GAEO 2VTDA 1UP6A 1ZK4A 3E03A 3B6ZA 4A5OA 2HMWA 3F5SA 1C1DA 1W6UA 1WPQA 3H8VA 1NTOA 4WCFC 3JYNA 2DTXA 3ZU2A 4W7IA 3JSAA 2GR9A 1MLDA 4CM8A 1ADBA 2IYPA 1J6UA 2NNLD 3FNHA 2R6JA 1DRWA 3LDHA 2NV6A 1JKFA 5CG1A 2X22A 4YB8A 1Z7BA 1ONPA 1LSJA 4ZN6A 4URFA 2ZTUA 4BMVA 4A26A 2BH9A 1UXJA 1Y81A 1ADCA 1VJTA 1YGYA 5BT9A 4N54A 4ESOA 3FNFA 2Y1EA 4NPCA 1YQDA 3PIDA 3UVEA 1EFLA 1QSGA 3OQBA 3AU8A 1KEWA 3ICCA 4IQ0A 2WE8A 2PNFA 3GC6A 2H5LA 4DIBA 1Q0QA 1BG6A 4FFMA 4FIZA 1LRLA 4TSKA 2PGDA 4CLXA 4CODB 1I8TA 4CM9D 2YV1A 4BL5A 2VT3A 1L7DA 3PIIA 1RM3A 4CQLB 4II3A 1BMDA 1Z6ZA 1L7EA 1QYXA 2IEBA 3OA0A 5ILOA 4ND1A 1X7DA 4E4YA 1HLPA 1DIRA 2HRZA 4XIYA 2DKNA 3TOXA 2NU8A 3VOSA 4K6FA 1CETA 1WZIA 2GF2A 1C14A 4ND5A 2C29D 3DO5A 3I4CA 4IBOA 5BSHA 4MP3A 2H63A 2PZKA 3NUGA 3LYLA 4UVDA 5HBRA 1CEQA 1WAMA 4KUEA 4WLUA 3GH3A 4IQ8A 1PZFA 5T8KA 2QRKA 2GO1A 1PZGA 4I9HA 2B69A 1LSUA 3T7CA 5CEEA 1B26A 1WZEA 4PLCA 1ZMOA 3MCVA 3TOZA 1IZ0A 2GCGA 2ZTMA 2X5KO 4CLRB 1UUFA 1HE3A 2LDBA 3VC7A 2PK3A 4OO3A 4PLGA 3V2GA 5FI5A 4BKUA 4JJIA 3DEYX 5IDQA 3QVXA 2VOJA 4LMPA 2HO5A 5TRTA 3DBHA 2WE7A 3DOOA 3INRA 1DOHA 1Z45A 4JBIA 4PG6A 1YL6A 3WGYA 4YJFA 2JL1A 1VKOA 2Q45A 1SB9A 3JQEA 3QWHA 2X9GA 2OORA 4B4UA 4BOYA 3S2FA 4CMCA 5A05A 1K2WA 3I83A 3GHHA 3UUWA 1SPXA 3N58A 5CG2A 4I5GA 4F46A 2QHXA 3WJAA 4GGOA 1PL6A 1R12A 4GSKA 1ZUD1 4TVOA 2A92A 4DLAA 5F5LA 4B8WA 1QV6A 2WWRA 3G0OA 2ZJ0A 1M6HA 1BW9B 4OXNA 3F6YA 1YL7A 1G6KA 3CEAA 3PFWO 1S6YA 1B8UA 2PFGA 1HE4A 4BGEA 2WTBA 4J7XA 4I8XA 3AI2A 1EK6A 3IMFA 4BO3A 3HDHA 1TVEA 3ZW9A 2Y99A 3ITKA 4L0QA 3P5SA 4U0KA 4DBVO 1IULA 5A1TA 3DR3A 2OO5A 4G81A 3DMTC 1U28A 3EC7A 3FI9A 4BHTA 1PJQA 2Q46A 1IHYA 2HKIA 4OXKA 4GAEA 1TA4A 4ZQBA 3SEFA 1NAHA 2V6MA 3AOGA 4R54A 5EIOA 3ADPA 4UUMA 4DQXA 3K2BA 1XDWA 3WWYA 3ZU4A 2JHFA 4BMSA 1ENZA 3ZWOA 1WNTA 1G1AA 4CM5A 3JQGA 1LX6A 4OH1A 5JCJA 4F45A 3ROPA 3QIVA 3E9NA 3Q2KA 4L75A 4M86A 2NVUB 4XZ3A 2YHIB 4DPKA 3DZGA 3E8XA 3DOJA 1KC3A 4CM4A 2ZYGA 1ARZA 1ZK1A 2BFMA 1HEUA 3I9NA 2J8ZA 3H2ZA 2CVOA 2NU7A 5AOVA 2QX7A 1A9ZA 2DPHA 5JO9A 2IZZA 1YJQA 4XRRA 4FPXA 4BNYA 3U09A 3HB5X 4QO7A 5H81A 2YJZA 4NZ9A 3OEWA 4O0LA 2DUWA 1C3VA 3D3WA 5ITWA 3DZKA 5KVCA 4XJSA 1WXDA 3TQHA 1PWZA 2VYNA 3MOIA 1SZJG 2YFHA 3VPSA 3BHIA 3JQ7A 1YBMA 4R4JA 4O6VA 1Y9EA 5ER6A 3ONFA 3PWKA 2B36A 4FGWA 2GASA 4XYEA 5K6AA 5A02A 2C5EA 4PRKA 1V3TA 1B14A 2O50A 5A5EA 3KHUA 5JS6A 3F4LA 1QP8A 4RPGA 4CMGA 3ONEA 4IDCA 4OIMA 2FPIA 3RU9A 5IJZA 1HTBA 2VT2A 3ZWXA 2AMFA 3VVCA 3NDIA 5L4LA 2WD7A 1GZ3A 5L95A 1YQGA 3DONA 4B79A 4WEOA 1LDBA 2VWHA 2F00A 3DBLB 4WE3A 1DAPA 4YVFA 1OC2A 4Q3CA 4PLTA 3ZWBA 4Q3DA 3OQ1A 3PP8A 5DULA 4UEJA 1XSEA 3KEQA 2XAAA 3F4BA 3GGGA 3OECA 4YR9A 5IZ4A 5KIAA 3RQSA 1U4SA 4PVCA 4RVSA 1XQ1A 3CMMA 1Z7EA 3JQAD 2P91A 3GOHA 1WMBA 1CIVA 1MG5A 5F1OA 3INTA 2DLDA 3IL2A 2B0JA 4AICA 2J5RA 1LRJA 4XJTA 4LCEA 1W4ZA 5HTOA 2AQHA 2PKQP 2QYSA 3MJSA 2X23A 3OJOA 1T2DA 1JDJA 3GHYA 4UVEA 4ID9A 4FD3A 2X0RA 4NIMA 3PZBA 4YQZA 2GN9A 1YB5A 3NTQA 2ZIZA 2J6IA 2P4HX 5COQA 3WBBA 1GUYA 4MVJM 3ZWMA 3TFOA 1B3RA 3BA1A 4BNZA 4NFSA 1OI7A 1E5LA 2AQKA 5FFFA 5IZCA 5IN5A 3LT0A 4TZKA 1ULSA 2VWPA 3ZHXA 3NT4A 2OZPA 4HY3A 3GVIA 3VDQA 4DLBA 3C24A 3GR6A 3WIDA 1ISMA 3ENNA 3E6AA 3H5AA 4QSMA 4DQVA 2PD6A 2VNSA 3FBTA 4GL4A 4MVJD 2VUUA 1JKJA 3GT0A 5THQA 1SOWA 1VLLA 3I9JA 5HS4A 2CDCA 1N1GA 3Q9UA 1MP0A 2YHUA 4YDRA 5IG2A 2YV2A 1QYWA 5A4DA 2O3SA 4BNLA 1NFQA 3JYLA 1WDKA 4D41A 4HUJA 3HHPA 4GPD1 2CDAA 1QMGA 3F9IA 3VH1A 4WCFB 5DCYA 2AG8A 4W9NA 2WSBA 3PRJA 3AUTA 5A9TA 1EDOA 5JMWA 4RDHA 4IXWA 2B83A 4I1IA 4GWGA 5IF3A 1VL0A 4FN4A 1BWSA 1PGPA 2J3KA 2RH4A 1DHTA 3IKVA 3QP9A 4NI5A 3F3SA 4P4GA 4CMAA 1DJQA 3IJRA 3K2EA 4TKMA 4GKBA 3BAZA 1C0LA 2X58A 1T2FA 4DL9A 3WGHA 3INGA 1ENYA 4J4HA 3WFJA 1E7YA 4YA6A 1KVSA 5B4VA 3KOUA 5JDIC 3CINA 5KVVA 3FBGA 4BNXA 1IOLA 2AEMA 4LK3A 2FPPA 3IUSA 1PX0A 5KCZA 1EBFA 2W2KA 4BKPA 5IXYA 1W73A 3I1JA 3RUHA 1HT0A 4OKIA 4CV0A 1CYDA 3G3EA 4J9VA 1G0NA 4IJKA 3TNLA 1BXGB 1DC6A 4M1QA 1ZIDA 3VH3A 2P5YA 5I9LA 4E5YA 1A9YA 2FR1A 4KP7A 2WMDA 3IDSA 3GNQA 5G4LA 1YBVA 4NDNE 4HNGA 2YQ4A 3PZRA 1B7GO 2ZCVA 5DN9A 1P1IA 1K89A 1TI7A 2BGLA 2ZKLA 3PJDA 1M67A 4QX6A 3WQRA 4ZQGA 3H5RA 4XQ9A 3GG9A 1E3WA 1NQAO 2NVWA 3MOGA 1YQXA 4XYBA 1OC4A 2GNAA 2V6FA 3KYDB 4E3ZA 4A73A 4YACA 2DTDA 3KTDA 2JD0A 2NU6A 4D43A 4Z0HO 4R01A 5DCUA 4BNUA 5HM8A 4WLOA 4GLLA 5KJEA 3OMLA 2YDXA 3GA0A 4K9DA 3KYCB 4CR7A 2EEZA 3B20A 4DPLA 1CQIA 2VN8A 4EDFA 3ZWCA 4RPJA 4EEXA 1KVQA 2ILTA 1Q7GA 5B4TA 2C54A 4IUYA 3TSCA 1PL8A 3BXXA 3LZ6A 5THKA 2C2YA 4FC6A 1YE3A 2NTVA 3DAGA 3ETEA 3GRPA 3HNPA 2HAEA 4PCVA 1YONA 4NFHA 9LDTA 5KKCA 4DRYA 1ZXLA 2DU8A 3ADOA 3NJ8A 2OBNA 2CF5A 1ZSNA 2Y1CA 3ZH2A 4EYEA 4GI2A 4PIVA 1T25A 3AI3A 1C1XA 5B4UA 3WGQA 1NQOA 3NT2A 4EUFA 1VM6A 3PDUA 2B37A 2AA3A 4CL3A 1UZLA 4BNJA 4RZHA 2RHRA 1M76A 4FW8A 1IYZA 2EG9A 1YS4A 2IODA 3WWZA 4DPMA 1SEPA 1J49A 1J5PA 4MINA 4BO7A 1GU7A 3RUDA 3UW3A 3V8BA 1ZW1A 1VSUA 4PRLA 3AJRA 2TMGA 1UXGA 8LDHA 3D3EA 2Q2WA 1QORA 1HDGO 3RUFA 1BVRA 1QYVA 4RPHA 4ZHSA 1T2AA 3NYWA 4YTEA 3PQFA 1CWUA 5I8ZA 1O0SA 3RKRA 2EXXA 1JU9A 1XU7A 4Q3AA 2OBYA 5A9SB 5TLSA 1KVRA 3W8DA 1F14A 4FFLA 4PVDA 3VHRA 2DBZA 2C07A 1GUFA 4NBUA 2VRCD 3V5NA 3UFXA 1D8AA 1EE9A 1LI4A 4CMJA 5JNLA 4CLHA 4GVXA 1LQUA 2NLOA 3HUDA 4CM6A 1RM5A 1K6XA 3EGOA 2C7GA 4PG5A 4U6QA 1EQ2A 3RKUA 3JQ6A 2DFVA 3GG2A 4P22A 2ZQZA 3P2OA 2TMDA 1ZJZA 4MO2A 4N7RA 4AJJA 4YBZA 3I23A 5B1YA 2RHCA 5EINA 1X7GA 1QYDA 1E7RA 3JQ9C 3D4OA 1DDOA 3D5QA 3HDYA 5AXDA 3WQQA 3PWSA 9LDBA 3Q9NA 4ZICA 3B70A 3WOHA 1Y7TA 4KTTE 2I5PO 4D7AA 5JE8A 1EVJA 2RAFA 2WD8A 5T67A 4CPDA 6ADHA 3OETA 3HN2A 1H0KA 3MTJA 3V1TC 1WVGA 3RD5A 2IXAA 1PS8A 5DT9A 5G0UA 1PSDA 4BO9A 1NHGA 1TEHA 3KB6A 1Y1PA 5EMHA 2PH3A 1P74A 5JSFA 3D0OA 3GN1A 1U3VA 2ZB3A 3RUAA 2HQ1A 5KJCA 2AE1A 1Z82A 4OSOA 4AJHA 1YB4A 1PL7A 3JCZA 1CQJA 4MP6A 3VTFA 3EAGA 1XG5A 3R6DA 4R68A 3QWBA 5JC8A 2Y1DA 1X13A 3OP4A 3D7LA 1YH3A 2BF7A 5TT0A 4GSLA 3BMNB 3MEQA 1AHIA 3OF2A 4CLRA 1F06A 1TLTA 5CDGA 1IZ9A 1LUAA 3LLVA 3DZJA 3A4VA 3W6UA 3WGIA 2OOSA 5JAZA 3WGGA 1N9GB 1DIHA 3RBXA 2NADA 3BMCB 4JIGA 1DC4A 3WYCA 1A72A 3EHEA 1DXYA 5L3ZA 1XKQA 1I33A 3O8QB 2UAGA 2C82A 4MJLA 2Q1TA 1NWCA 3MZ0A 5F1PA 5JAQA 3VKVA 4BIIA 3E48A 3I6IA 3WNVA 4CMHA 3A28A 3WDSA 1PGNA 2Q1UA 5DBGA 4HFJA 2Z95A 1QG6A 3UHAA 2LDXA 4DUPA 1HRDA 4E13A 3GPIA 4WKGA 2WJPA 4CMEA 3BMQB 2O4CA 5GMOA 3V2UA 4WLFA 1X7HA 3JD4A 1E6EA 3M2PA 3NEPX 2DBVO 1HYHA 1D1SA 3PWZA 1K5HA 1KC1A 3HG7A 1HE5A 3DXFA 1GZ6A 4YJHA 3HADA 4IMRA 1ZK0A 1JVSA 1G0OA 2W98A 2FMUA 2W2LA 3RU7A 4CLOB 5T8KC 3LT4A 4BV8A 1K6JA 3JD3A 3Q2IA 4G2NA 5JFOA 1B3BA 1P9LA 4NU6A 1UDCA 2VQ3A 1O5IA 2AHRA 3OA2A 4BGIA 4B4WA 2HU2A 4TMFA 4BV9A 1N1EA 3LT2A 3EZLA 3KLPX 1GV0A 4WOKA 1O94A 3WB9A 1KY5A 1LLQA 4BNVA 4CLDA 3ICPA 1JWAB 3BIOA 4BNWA 1PQPA 2Q4BA 4TRMA 4MVJF 4ZQFA 4DC0A 3HFSA 5JCJD 2JCYA 3UCFA 1EVZA 1SNYA 3G1TA 4GBJA 4JXKA 3QW2A 4UUPA 3VDRA 1QRRA 3WYBA 2AXQA 1HYGA 3BHMA 2VHVA 4R16A 3UCXA 3ZN2A 2Q49A 2YV3A 1CDOA 2EV9A 5FWNA 1I10A 1NQTA 4EZBA 1JAXA 3PHGA 1UXIA 1C0PA 1PJLA 1GYQA 4TKLA 3NRCA 4UVGA 3GRKA 3W4IA 1O6ZA 4MVJP 1KVUA 4YCAA 4RF5A 4D3DA 1T24A 4B7CA 3IQDB 4ZRMA 2QZ9A 3LQFA 2HK9A 1U2GA 3JYOA 3P2YA 1YL5A 3VVBA 3H3JA 2NQTA 3VZSA 2GZ1A 4PG7A 4WLVA 5KKAA 1PJBA 2HSDA 4GMFA 3I4FA 4RGBA 5KNLA 3NGLA 2WYVA 1U3WA 1DLIA 2A94A 2YYYA 3W4KA 5TIIA 4GH5A 4Y98A 1LSOA 2IEDA 5BQFA 3KETA 4FFOA 3JTMA 4S1VA 3WG9A 4BO6A 3DBLA 1IB6A 3L9WA 3FPLA 3K30A 2NUAA 3QSGA 2GN4A 4Y6PA 3DDNA 5DZSA 4Z9YA 2NM0A 5JW6A 1XHLA 2BKAA 4BNKA 3E82A 3GDGA 5B12A 1LQTA 3O38A 2DBRA 4XYMA 4YQYA 4KTVE 1OZAA 3MJVA 3WTCA 3ZNNA 5IN4A 2PR2A 1HE2A 1KETA 1N8KA 3GLQA 3PGJA 2G5CA 4ZD6A 3ZDFA 3N7UA 1TT5A 3C1TA 1HL3A 4NH4A 4Y67A 4CMIA 1HDCA 1LU9A 3V2HA 3EVTA 4CUZA 1FMCA 4ZGWA 1C0IA 3NDJA 1VI2A 1VL6A 4XCVA 5TGDA 2GRAA 3ANLA 3HFGA 4FFNA 3RIHA 2D3TA 1PZHA 1UR5A 4WLNA 1I5RA 5K6AC 5KVSA 3ZZNA 1DJNA 1LTHR 1F8GA 2HRBA 4L8VA 1R4NB 1PQWA 4RVFA 3Q0EA 3H65A 1NR7A 4IINA 1HXHA 3L6OO 4OQZA 3SX2A 3TZQA 5BSEA 3EW7A 2GERA 1IUKA 4IJVA 2FPGA 1DAOA 2WYUA 1K3TA 1TT7A 3RAJA 3OJEA 1ZVMA 3C1AA 3PHLA 2O7QA 4XDYA 4YJDA 3MJ4A 1Y8RA 2J3IA 4A03A 1ZEMA 3OQ6A 1P77A 4EGFA 4F6CA 4DIOA 3FTPA 3OJLA 4ND4A 5LCXA 4RVGA 2PZMA 1KEUA 2P2SA 4XKJA 3S2GA 4YAEA 4KUHA 3G79A 5CPFA 4M89A 5CHEA 1ZXBA 4B7UA 1LC0A 2I65A 3WSVA 3R3JA 3ZU5A 4NG5A 1Q1NA 1KYQA 1V3UA 1KY4A 5JDCA 3DZIA 2AQIA 4ROSA 2EKQA 3RBZA 2HLPA 1LDNA 3SC6A 2H9IA 4JX8A 3OJ0A 1EZ4A 5BNFA 4DYVA 3C1OA 3AU9A 4LRSB 3C8MA 3GNSA 1E7QA 5L51A 2PA3A 1U4OA 2YY7A 3T4EA 4TWRA 4E5KA 4M87A 4W7HA 3ROKA 5A06A 4YAIA 3D64A 2I6TA 1EMDA 3ZNQA 4AJIA 3ITDA 1Z74A 5EL0A 4NJMB 2EW2A 1ZJYA 1XLTA 1ZO8A 5LDGA 1OFGA 1WW8A 1H5QA 1YOVA 2H6EA 4IDEA 1I30A 5IZCC 3BTUA 2PZJA 6LDHA 5ICMA 1SC6A 1Y9AA 2FOIA 5KTKA 1YB1A 3GEMA 4AJEA 3K5PA 2EERA 1JKIA 2JD2A 3FHLA 1BXGA 4TVBA 1KIFA 3KSUA 4TZTA 1GL3A 3CMCO 1QR6A 4INAA 4ZU3A 4NHEA 4G5HA 4YJGA 3PYMA 4R3WA 1V9LA 3CSDA 2OHXA 3ZWAA 4Z9XA 2GGSA 2JFFA 3FF4A 4MVJH 1B2LA 4WJZA 3GPDG 5CP8A 2Y67A 1U7HA 5T57A 2YZ7A 3R3SA 5COBA 4PZEA 1L1FA 3V1YA 1XWFA 2AEFA 4W9NC 5COAA 3TN7A 1NNUA 3GUCA 4FJ0A 2VWQA 1H6BA 4DTIA 3ZWYA 4IM7A 3DZFA 2BLLA 4NNJA 3GAFA 4KMSA 4IGEA 4KUGA 3DAFA 4WOJA 4BMNA 1UH5A 4Z3DA 4RF4A 3KYCA 1GUZA 3BMOA 5JMPA 3SC4A 1H94A 1WDMA 3BZUA 4YAKA 2G82A 5DOZA 1PTJA 1IHXA 2JAHA 3JQ8B 2JJYA 5CDSA 3PK0A 2DM6A 4CM9A 1QYCA 2VZ0A 4XWYA 4A0SA 1B8VA 1UAYA 2D5AA 5CPBA 4N18A 4IS3A 2A9FA
chains in the Genus database with same CATH superfamily
1N7HA 4LSMA 1GPUA 1T0UA 2OENG 3DC2A 2AJBA 2OUKA 1ZI6A 2RGGA 3BWEA 3OE4A 4KAAA 5JADA 5JAIA 4OFZA 4A0FA 3H6KA 1MQ9A 4RD2A 2BJVA 2H7VA 3E9QA 4YRMA 2QW8A 3L6BA 4TQGA 4YT8A 4O4JB 1X19A 2G17A 4QBTA 1XA3A 1YB7A 1JHYA 1T6BY 2FSSA 4LVUA 4QM6A 4ZO4A 1NBME 2WYOA 4A36A 2HWUA 1XK6A 3E8MA 3LS2A 4MGYR 4JN6B 2HT6A 4C29A 3ZY6A 1BKYA 5CB0A 2EWMA 5TX7A 1Y6GA 2Y2UA 2A59A 3QPCA 3CLHA 4FP9A 3ZIDA 3BDVA 2OP1A 2GCPA 2HMTA 3D7RA 3O3OB 2QNIA 4RELA 4PG8A 3IIIA 4HX5A 3PDJA 5IULC 2H1IA 3H2GA 4E1VA 3IDOA 4FZ3A 3DNPA 1PJ2A 2FWPA 1SXJA 4NZMA 4GE3A 1W36B 3OTIA 2OGUA 4MVWA 2OILA 2RHLA 1T6YA 5HMMA 3O93A 1LVUA 1FJGB 4YJKA 4WINA 2NP6A 4K81B 2IY8A 2JZNA 3ESQA 3CM0A 3L18A 4OX9Y 4AZ0B 5G02A 2G71A 2H59A 3AUSA 3WIVA 3A1DA 2IP4A 1U99A 2H06A 1OB5A 1MFZA 3ON5A 1B2RA 3EFOB 2CHUA 4UPVA 1L0BA 421PA 4F0JA 3HZZA 4IIJB 1PFQA 2OAGA 1IZZA 4LF7B 1GTMA 2NVBA 3LHKA 4JLMA 3QMPA 5FR2A 2VUSA 4JLUA 2PX0A 4QG7A 2H8KA 3JX9A 3NTRA 3VNRA 5A04A 4LFBB 3PQ2A 2C94A 1V11B 2UZ3A 2XWPA 4HNAB 4BFZA 2XKKA 4FUQA 5CB4B 4QG3A 1N5DA 2Q5CA 3K70B 5DMXA 6Q21A 5JCPA 3LL4A 3PXBA 4QEDA 3TRHA 3EXEB 1XYYA 2C9MA 4LDAA 1QLHA 2Z43A 1K4KA 3NBQA 5EUCA 3DWFA 1CQZA 2CNWD 4AVYA 2VCYA 4INZA 2XGMA 4RL6A 2K87A 3TW6A 4RKQA 3FZQA 4BNNA 3NHYA 1OHHD 4DYDA 3C7CB 4JUBA 4YMTA 3QQPA 5AKJA 2VAPA 2XXJA 4YI3A 3KM0A 1NN3A 3MGGA 4XGIA 5DI3B 1PR9A 3E18A 3P52A 5AKZA 1KA9H 2MU1A 4BC1A 4CMBA 2I03A 1P8AA 3WI7A 2H5EA 3AB8A 4G5RA 4EZIA 3NX4A 4X8MA 4E12A 4P2BA 1R6TA 5EXSA 4AUKA 1UBFA 2Y93A 5DDIP 1U04A 4DGSA 4RA6B 3L8MA 4J0GA 5H4HA 4TV9F 1GTSA 3AL2A 4LHZA 4LSZA 1N5RA 5CM2Z 5AK0A 1IEVA 2KWIA 3K1TA 3IUYA 3WGTA 5DEOA 2Q5HA 3WK7A 3ZX4A 3JVDA 2QAGB 2BFCA 5HQJA 1JSRA 2HSZA 4RTRA 3ELDA 3EXHC 3IS3A 1R66A 3K1JA 3UGTA 3E1GA 3LZCA 5C51B 2AJTA 3EVCA 4NCNA 3VJMA 1TA9A 1Z4PX 2X0KA 4LNHA 2C20A 1X7YA 1GG9A 2ODQA 3PJGA 3GA7A 5DASA 3SOZA 4FSHA 4S04A 1A96A 2YHBA 2DFDA 2G88A 4PE5B 4C0HA 3V4VB 5LM3A 1X42A 4KYVA 2DBYA 2YJ4A 4A3SA 1IMOA 5EN4A 5B2EA 3C8ZA 4X65B 3W5CA 3IYLW 4XASA 2YJTD 3EFHA 1K06A 2IPOA 1G66A 3IHTA 2P4EA 3H2HA 2VSFA 1FZTA 1KRWA 1Y1TA 2V9ZA 3V7NA 3E70C 2IYOA 4MMXB 4FHEA 5AVXA 4TTIA 5T64A 2IS1A 3WKBA 4Q1VA 1VMAA 3KYIB 5FNVA 4P08A 5KTRA 1VE5A 4HDAA 2CXNA 3K9HA 4L4RA 4CM4B 2XJ4A 2JKZA 6CHYA 5FADA 4DA9A 2K6GA 3AETB 3A9SA 4B48A 1EVYA 2XEDA 2QJOA 3UHFA 1KI6A 4JBLA 4MI9A 3TECE 4U9IS 1CFJA 4XDZA 2F3TA 1GFSA 1M34E 2RGDA 3CB2A 4IKPA 3WDKA 5K3OA 3DS8A 3CR3C 1CY7A 4DLZA 2J07A 2HR1A 3AHGA 2JJQA 5FBWB 1XI2A 1DV1A 4DW8A 5L53A 1R0RE 1R9GA 2NO0A 3KKKA 1DTSA 4KRGA 4BVLA 4QTYA 2WVAA 3IUNA 3L0BA 3SK0A 1M1NB 1W29A 2OVBA 1YIOA 3V4LA 1Z75A 4Z2AA 1K75A 3Q72A 4N9WA 2EWVA 3IB3A 2O2GA 2DP4E 2ZYUX 2PWYA 3KXDA 5AJUA 2OWDA 3M0EA 1CB0A 4RYDA 2ZTHA 3SNHA 1ONNA 1XMJA 5T7BA 3Q5DA 2AEJA 4K6CA 3BMQA 2W0MA 1R6VA 1RJGA 1KSGA 5K0BA 4NBTA 3GJZA 1Q0TA 1UC9A 1FJ2A 2JGLA 3LLSA 1TM4E 2FW8A 4YHBA 3TPZA 1RAIA 3IEKA 4RA9A 5JZVA 1IVNA 2V74B 4YWJA 1NBAA 2P6OA 2X2OA 3PJEA 3IXLA 4M99A 1WUKS 3HACA 3LWDA 2BD0A 1D2HA 3SM3A 3AR4A 2J4DA 3MUFA 2PSSA 2ZR9A 3L0DA 4HZGA 4WTOA 1T1IA 1UIRA 1AT1A 2FE1A 1EP3B 1IN5A 3KJHA 3JQAA 4HF7A 3DVAB 2PX8A 3ETLA 4RV4A 5DM2A 3SZUA 3AVWA 4CKEB 1Y3AA 4JJAA 3VRHA 1M34B 5AIAA 5HDBB 3ZDBA 2YVLA 1WUYA 4CG3A 3AFMA 5I51A 4F1KA 1NRIA 1QNFA 4DLKA 4IIBA 2XD9A 1W0JD 4HWGA 3TI9A 3TTYA 1ADFA 4E5NA 4RS4A 3IP9A 4R31A 4TWAA 2YWJA 5EZYB 2W4IA 3L93A 4I5DA 1WZUA 1GSIA 1GZHB 4M37A 3RKSA 1XTVA 2BCJQ 1I3KA 1I2BA 3AUXA 4O3FA 1VI5A 4ZYXA 5F1YA 2QJWA 3R7WB 3AL0C 1M8JA 2R3SA 3LAWA 4YP9A 4F2HA 4C3ZA 2FMHA 4DIEA 4MDHA 5DVZA 1O94D 2HIMA 1REQB 3O3MB 4QBIA 4G8BA 2BRUA 5ALFA 1XJ5A 2AOTB 3L4EA 3PUHA 5LC1A 3WLHA 1C4OA 1E1LA 1HFWA 1FNSA 3IVCA 3NW9A 4LYJA 1NQUA 4Q4AA 1VB5A 2XZTA 3OX2A 2QTBA 3MUNA 2XPCA 1E2DA 3OZ7A 4B87A 1H4SA 3DD5A 4LZOA 1J9ZA 1C3LA 1TZCA 3QVSA 1FTYA 2ZUWA 3F6CA 4CMEC 3U5ZB 2CDBA 1THGA 3E3NA 4OAQA 1V3QE 4FZRA 3L4SO 4JXJA 3H6HA 1R6BX 5DYWA 3ZD7A 4RDCA 4MVJA 4A10A 1YA6A 2JH9A 1DUVG 4X3CA 2JD1A 1ZFNA 3FFBA 3F47A 3N5CA 4OQDA 4LHEA 1V1RA 1XZHA 4PFSA 5LJIA 5K1ZA 2OZVA 1A97A 2AW3A 1WB4A 2I67A 2O1EA 3GGOA 2WJGA 5E8JA 3LD9A 1JG4A 3SXUB 4Y1GA 2ZIVB 1GWNA 3NM4A 4ENUA 2VHYA 1QG2A 3T9FA 4PNHA 2F1RA 1FYWA 3N74A 2R7KA 3TZBA 2W83A 7ABPA 3KVYA 3ADBA 4HD8A 3EVBA 5HQTA 4DE5A 1JKJB 4G1CA 4F1JA 4RJKA 1UM9B 3M9LA 4HUTA 3A4NA 1BE6A 3IPLA 3F8WA 1YV9A 2SICE 4ZVNA 1PZXA 3ACDA 3PQ5A 4DVGA 1AK2A 1MNAA 7REQB 2RHMA 3M49A 3P0EA 1T9HA 3R0XA 4MWDA 5CNKA 5CTAA 1HE1C 2HCRA 1NASA 4PCAA 4X66B 1K3UB 4B6OA 1O94C 2DQZA 3Q12A 5KQMA 1CLEA 4RPLA 5CNIA 2PMCA 1JFTA 3RFFA 5K8UA 5IHPA 1MGOA 2J1LA 3BREA 3OD5A 5PNTA 2A9QA 4QRDA 4EW6A 3B60A 4UHKA 3JD2A 1I5OA 5IKMA 2JFNA 2WPNA 3EAFA 2VUTA 1QRDA 1MDFA 2V5VA 1UIMA 2VP6A 4HLUC 3ZHBA 3L4BA 3AXSA 4GI7A 1SAYA 3FVRA 3JQFA 4Y1EA 3ANMA 4ZQEA 4RENA 1EWQA 3M89A 1YTLA 2QM8A 4DVJA 1I2AA 3GGCA 2R47A 2QROA 1QFMA 3KKNA 4NV3A 3LA6A 4G0XA 4HXEB 3QLVA 2R6ZA 2C3MA 2YN4A 4URVR 4KQ9A 3HH8A 4QYIB 3LCVB 4NYIR 4DWOA 2G6BA 2FK8A 2R1TB 3VMMA 5J23A 1PYGA 2D0PB 4JP5A 5DGTA 4ENQA 5CD9A 4KQ6A 3B51X 2J0QA 3TZKA 3V3KA 1M6VB 2X8AA 1NVTA 3CLVA 3ILYA 4R5MA 1YFZA 1PDVA 3S8EA 1XTUA 5TF4A 2VHUA 3EXG2 3CLUC 4L4SA 4F3YA 4F85A 3RVLA 2W00A 1X1QA 3A06A 3BQMB 2JLSA 5IWAB 1PGJA 1WL8A 4YIHA 1RLMA 1GNVA 2FQWA 3BL8A 3PXEA 4CI9A 4BNIA 1J7JA 4HG2A 2J5XA 1GRVA 4B31A 4D74A 3SY8A 3C7DB 4Z51A 4H59A 2C2GA 3QVJA 4DCPA 1CX9B 1II8A 3VZBA 1DFHA 3LXUX 2AWNA 2A0XA 3CWZA 3WFIA 2EGGA 3AM1A 1NNLA 4ARZA 3I8SA 2Y0DA 3LFHA 4BTLA 5KMGB 5CVVA 1MZPA 4KREA 2HF7A 1NXPA 4I66A 3G1WA 1VBMA 3ELUA 8ATCA 1DBIA 1RM4A 2AZXA 2UYYA 1Z8HA 1RYEA 4H7KA 4HZUB 3DEAA 3TQOA 3VR2A 2QTLA 4JHXA 1HRKA 1RYNA 1YZVA 4H15A 4LEIA 3X1KA 2RBEA 2ZRFA 1W48A 2PX5A 4R7TA 3AUFA 1DLJA 2SKCA 2AR9A 2H2IA 5H1YA 3BFJA 2XXBA 2WKRA 3ZZ1A 4F92B 3QA3E 2H31A 2L42A 2J7PA 1E0SA 4AW9A 1F5NA 3HN7A 4TL6A 5EJFA 1MXFA 4E2XA 1QQBA 1JH8A 5DGIA 4RKWA 1ECBA 3BIFA 4IDAA 2GESA 3IPAA 2CL7X 4BB5A 1U0RA 1H42A 5JXWA 3M3PA 1F48A 1DCMA 2ZSBA 1QIHA 2E5FA 1M72A 1SCAA 2I1QA 4U6SA 2C7QA 1EWYA 2IE0A 2IDKA 3D6UA 2WU3A 3CLSD 3ELBA 1ZZGA 1MORA 4LDQA 4TL8A 5GOZA 3RF6A 3DQZA 4X8HA 2X0FA 2RGUA 3ZVRA 4IDGA 2CT8A 4DRXA 4R9UC 1XXHA 1C3OB 2AYZA 2W71A 1GEGA 3JR3A 1L8AA 2H4YA 3BYZA 3ASUA 2CYCA 3DF7A 3HNRA 3IJPA 5KNBH 3B48A 4HAZA 4IR7A 4OUDB 4TMVA 3T9DA 2POQX 1ESZA 3SFZA 4L5YA 4P9NA 5DM0A 5AKIA 4X6XA 4R0MA 5KJFA 3H16A 3EMKA 1KGSA 4FR0A 4NARA 3U3JA 2FXVA 4RF2A 1JR3A 1XCBA 4G36A 2BF4A 1KFEB 4HJRA 1QP4A 1BQ4A 4Y9DA 2XF8A 2VYQA 3OH8A 2FSIA 4KDFA 4NFYA 5HUHA 4MB6A 4S2UA 1ZXXA 4MKZA 4CT0A 3R5SA 4MQFA 4XUDA 1V1MB 1MABA 1Y80A 1A4UA 2YV4A 3A1UA 1IXKA 3BB1A 3IIEA 3QRWA 3RV3A 2CJYA 4RFVA 2A0WA 1OOEA 2UVDA 1IONA 1EFRA 2EGHA 2V4UA 5FWYA 3PVZA 3LIIA 4H4EA 3HJTA 1UMBB 1K8ZB 3NDRA 4OB8A 4ZVUA 5AVSA 3EXHB 3G2NA 3IP7A 2PX4A 3NAGA 4MRAA 1NSYA 1U02A 3HYLA 2VHXA 3WQSB 5CFZA 2HCJB 3UYLA 3DE1X 3V8NA 3LQ1A 3DLAA 2OAQ1 2GRUA 1JJFA 1DC7A 3A1VA 5EFZA 3V8EA 3CUUA 4F38A 2RB5A 1TZBA 3AG5A 3H7AA 5JDCC 3WWZA 2HUNA 4E51A 4XD2A 3I6MA 1VCMA 4F2PA 3RG2A 1GTZA 5AD1A 4KL8S 1MV8A 1GLVA 1S3SA 3N9IA 1L4EA 3QY9A 2OV1A 2W11A 3VR3A 3PQDA 3RPEA 3W4JA 3KXLA 4XW2A 3WL5A 3R5JA 2RI0A 3WRYA 3ZVLA 4AP9A 2PXHA 3DT8A 4QKQA 5EHZA 5KJ6A 1BGXT 3JXEA 4OKSA 4MUFA 5DHUA 3VBEA 1ISGA 1WZNA 2Q8NA 1JXOA 3E58A 3ND8A 3FDIA 4TMXA 3I1FA 3OPXA 4BLVA 2GUGA 2CF6A 3IUBA 1T2UA 2ZATA 1V8DA 1N3BA 2V55B 3ABOB 3EVEA 2GAIA 3B1KA 1ATIA 3UF0A 3WLAA 1KRXA 3VV3A 5GADl 3A36A 5EE3A 1Z26A 4MA4A 4B71A 4DFDA 1DBQA 2FSVA 3H9BA 3HY3A 4FEAA 4QATA 2M2IA 5AKXA 9ATCA 1Q7TA 1JB9A 4RLSA 2FMFA 1W5SA 2X9LA 3QUSA 1F3LA 3ZCPA 2NOAA 1G5PA 4D9CA 3TB4A 1QKIA 3WGMA 3R6LA 4QU5A 2KQUA 4MUKA 1J0EA 2FETA 2JIOA 2WTUA 1IN7A 2XWBF 3R1IA 1QV9A 2OCKA 4BO8A 4R40A 3TZEA 1PN3A 2ZYDA 4QD3A 3B3FA 4FZJA 3DZHA 4WWHA 2OHGA 2PBZA 2PZLA 2CXHA 2O2ZA 2YW9A 4E6PA 5FCDA 4ZMSA 2A1TR 1U65A 2X19A 3W2HA 4G24A 5EXPA 3F1LA 2VDPB 2F8LA 3EPRA 4F11A 1JKXA 5HRCA 2JK0A 3TR0A 3MWEB 3RROA 1AUPA 2I8CA 4M8SA 5IKEA 4XFKA 1E8NA 3JAKA 2W6CX 2Z0MA 1XK7A 4HGQA 1G38A 2CMGA 3H5WA 3OY2A 4DWJA 1QS0A 3WLLA 5C37A 4RZIA 3A6PC 3QEMA 1CQJB 5A4FS 5LZ5A 1MDBA 1DQYA 3EASA 2RGCA 1KQFA 1SH7A 3RJMA 1GUAA 1CULC 1KJNA 1P7VA 1PG2A 2B92A 2RG1A 3PTLA 4RU1A 4WA8A 5CT5A 1KP3A 1U9JA 5TQ2B 1NJ8A 4MQMA 1C0KA 2VAXA 3ZYCA 4EL0A 5A4AA 4D8UA 2D7JA 1WEHA 2ZCJA 3ZVNA 1ZWLA 4D4KA 4JFAA 1Z9BA 1F9EA 2QUZA 4NE2A 2O2EA 1E3IA 1EZZA 3GGJA 2CZGA 4GX2A 4LWZA 3CN9A 3GRZA 5C7YA 3I8OA 4AWAA 3AI1A 3TOSA 1DUSA 2XGGA 3FY4A 4YRQA 4BLQA 3MJTA 4H7EA 4ER7A 4FMCB 3TPCA 2I6UA 2PJUA 3EBPA 1DDGA 3JS5A 1KU6A 1EUDA 1W1WA 2WP0A 3TRIA 3WK8A 1I3MA 4GDMA 3PXAA 2Q1SA 3K8OE 3QXSA 3I28A 4OYHA 5EZ6B 3T5DA 3WB1A 5L7WA 2K7FA 2ZR7A 4QSHA 3T5PA 4D0LB 1D0SA 2OFXA 2JBWA 1G4UR 4K28A 4UTOA 3SAJA 3VHXB 2YNMA 4JBGA 1ZITA 2O3RA 2P35A 1A5SB 3CNBA 1L5WA 2C4KA 4KE8A 3DMDA 2ZB7A 5DSZA 2PZEA 2QP3A 4Z8XA 4JDUA 5EQJB 2W8ZA 1F8FA 3N8HA 2G07A 3VNBA 4NECA 4C3OB 3GFTA 3D4NA 1U9YA 4KQXA 3FNEA 5J2TB 3DL0A 1VKNA 3N2KA 3RT1A 4D4MA 4D9HA 4RQAA 4HWKA 5DLQC 4TS4A 4P31A 4MIEA 4C05A 3TW0A 2A0UA 2R9VA 1AA9A 5U4QA 2Z5VA 2BC9A 3MINB 2PSJA 2C2ZA 1WXHA 2PR7A 4OK3A 3BXEA 5I7VA 1KHHA 3MJCA 3CVUA 3FM9A 3WLSA 4RTQA 1FOEB 4R0NA 3R41A 4PPQA 1R16A 1QGUB 4DG5A 2XAUA 1SXJC 4TWJA 2OT3B 4HH3C 5SYAA 4OGWA 3AEKA 1GL6A 5WRFA 4J1TA 1N1DA 3L41A 4PX5A 3B52X 5KU7A 4JI0B 3LC2O 1T2VA 4NPAA 2I29A 5IMBA 2ENUA 2Q7OE 1KEPA 1E0AA 2EW1A 5CD1A 2G9RA 1M7GA 3HKBA 2QTWB 3F67A 3L6RA 1ZINA 1JJ7A 2ZJ7A 2UXBB 2BFOA 4TLDA 3C3BA 2DECA 4MKIA 3W5UA 4UFPA 3AW9A 1NXVA 3GDFA 1U8FO 5T6BA 3W05A 4LYAA 1X1EA 3F7MA 3JQQA 2VIIA 4C0BA 4CEHA 3O2SB 3H5TA 4D99A 3VJRA 5A5FA 4W5NA 1S8FA 4I9UA 1HG1A 5TNXA 4OJNA 2VWGA 1GGMA 2MMGA 3ZH9B 3R5KA 4PBRA 3DYIA 4ILEA 5HKOA 3FROA 2GYYA 4EA7A 3T7TA 1P3JA 2QVGA 2PGNA 1C41A 3RYFB 1CRZA 1LW7A 2ACEA 3ZLUA 4EW3A 5CA0B 2OKGA 2QI9F 1ZUHA 2LV8A 1CCWA 3GCDA 5ESXA 2WKQA 5FD8A 1TVKB 3ICWA 5C8YF 5EWLB 4Y2XA 5J9FA 1YRLA 2WPDD 3EVZA 2GLUA 3KD3A 3VR5H 4BFTA 3F78A 3NASA 4R1TA 1ODTC 4YP0A 2VSQA 1GPNA 4A6XA 4OQQA 1T91A 5ED0A 1KRHA 4XE5A 1GSHA 3TFQA 4E31A 2HFJA 2F1OA 2Z08A 4M9XA 3F46A 2VKQA 4O2BA 1DTEA 2AUNA 3C7KA 4HH0A 2JAUA 4BUCA 4F8YA 1NVEA 1LC3A 4ANFA 3PD0A 1FDRA 3EA5A 1LEHA 4ZMRA 4BJ1A 5BVGA 2GSDA 1NFFA 3OFND 2CSXA 3GCWA 3CNHA 3THRA 2YTZA 2WIGA 1B1CA 2E49A 1JNXX 1H2FA 5GJBA 4AULA 1L4BA 3CCBA 3MWFA 4QVGA 4B6SA 2HNKA 5EZSA 4EJ2A 2EKLA 1II9A 2EFDB 5EHQA 4QHSA 4HWSA 4M9UA 1N2EA 2NZYA 1CUSA 1XUOA 3DOIA 1C9NA 5BN5B 2HF9A 4B35A 3K15A 5ARDA 2I6XA 1L4MA 1TUIA 1IFXA 1XTKA 3E3MA 1AZLA 1H2EA 3NBKA 5KNCH 1FFEA 4KR7A 3HO6A 5H4GA 3OT1B 1T5IA 4N40A 4HQKA 4HRVA 2WWWA 1BKSB 1QCYA 2FRDA 1NLMA 1JA9A 1EH5A 2XDYA 1CF2O 2QJFA 3AF2A 3G5LA 3MD9A 3L9XA 3QVTA 4V38A 1K0UA 3PHJA 1A7AA 3U7JA 1QRUA 2ZJBA 4WK2B 3ZXXA 2G67A 3B9PA 3QEJA 5CFLA 1KS2A 5P21A 2Z5GA 4DSNA 5LU8A 1N3YA 4GI1A 1OB2A 2XB4A 3W5BA 3AUKA 1APBA 2XSZD 3H11A 4U2EA 1R0LA 4E21A 1ZRMA 1H2BA 3AFIA 3BF7A 3CZRA 3PYLA 4MKXA 2F3UA 3QE0A 4E2ZA 4X1YB 5A3QA 1CIPA 1CR6A 2OHOA 3CRZA 1TVMA 2WZDA 4DANA 3DPIA 3UWMA 1Y3DE 2WDPA 1O96B 1AQLA 2OV8A 3WLTA 3GQVA 3ZUPA 2UUBB 1KYWA 1WP4A 3DYVA 3JYPA 3QF4B 5D3MA 3LX6A 2A9OA 2IX9A 1OW3B 3TTTA 3U9SA 4CMIB 4YX9A 1G8PA 3UT5A 2O8NA 2MYTA 4JEMA 1E5TA 3HNOA 3WGJA 4F4JA 1RE1A 2GHRA 3PQ6A 5BO5A 3DQPA 3V46A 4CIDA 3GEBA 3KR9A 1N5KA 1TU4A 5JLAA 1FSGA 2G1KA 3MT9A 3QMMA 3R24A 1NW4A 1AGNA 1YKGA 4F71A 1VRCA 4ZCSA 2A5GA 4I8IA 1MB4A 3LT1A 3QI2A 3DE7X 2ZBQA 3QKWA 4JBHA 1KJJA 1JBKA 3PI7A 2AD1A 5ISMA 4IIFA 2XUHA 1XPRA 3R0QA 2N0SA 3TWOA 3VTZA 4M55A 2GYUA 2QRJA 2VK8A 1LX7A 4Q3NA 2G1UA 1YBAA 3EYWA 1J0BA 1E32A 5CDFA 2WJVA 4D80A 4Y1RB 5LQAA 2VF4X 3K16A 4OM8A 3KTAA 2WAXA 1QDLB 5C1OA 3THXB 1U8TA 4OHXA 2Q50A 3CRMA 1ZVJA 2BEUB 2WYWA 3CNNA 3O84A 4JZKA 1S4MA 1UDXA 4QREA 4EHAA 1A2OA 1QHSA 3BQ9A 3VUEA 3CO5A 7ADHA 4AYWA 2AMLA 2P3OA 2J3JA 4EJSA 4JI7B 4IRXA 4HQLA 5KSOA 2N75A 3K5IA 4OY3A 3FVQA 4HSEA 3OE7D 4XVRA 1ZD2P 2IHZA 4ZTUB 1PR4A 1T0BA 3CZPA 3WMEA 1U7WA 2AR7A 4MV9A 1FXWF 4M8IA 4QDUA 3U3XA 2FN3A 4DOMA 1OXKB 4BX3A 1ODIA 2ZSIA 4O63O 2ZTLA 3OLCX 2Y66A 5M5BA 3FR7A 3CH6A 4LFCB 1E0JA 4KR0A 1PR3A 2IH2A 3G82C 3SEFA 5KHOC 5HHTA 2QX4A 1GNRA 2BRUC 4KHZA 4D3FA 1AF4A 1HFKA 5ADUS 2O19A 3PKZA 4OJYA 2QN2A 1AN0A 2PO5A 5BYJA 3RC1A 2PT6A 2WU1A 1WQ4A 2E5LB 5BOVA 1Z0KA 3MTEA 4R1SA 4G65A 2DGDA 4JB8A 4CL8A 1T6NA 3CH7A 3ZR4B 2YZKA 621PA 1FLNA 2XRYA 2O2SA 2O7RA 4BVEA 3JALA 2BHLA 3GLIA 1N5MA 4BVFA 5LYJB 4KV7A 1M5RA 2NUPA 3VYWA 1DC5A 2E82A 2W37A 4KDCA 4RCVA 3PC2A 4Y6LA 3DLBA 4G26A 3NHKA 2J9GA 1N9GA 1CQXA 2QL7A 3DMHA 4FMDF 2CHVA 3N87A 4BLOA 4D45A 5JYBA 3ESRA 1GYPA 3DCJA 3O8QA 1KJQA 1OLXB 2FLWA 2PD4A 4YH1A 5ALKA 3DTVB 5E7IA 1OI3A 1WMAA 2EFJA 3JD1A 4MA5A 1YZHA 1E2HA 4ZT6A 1XR3A 4EITA 5C5CA 3R0IA 4X8LA 4KQCA 1YI0A 3G2MA 3EVAA 3HE3A 1ODSA 1UBHS 4PFJA 4U1RA 3AV3A 2A0YA 4A92A 1FVOA 1MN6A 4G3XA 3KQQA 1YACA 5F2OA 3T99A 4ZI5A 5IJWA 2IS4A 1P4RA 1C2YA 4YPOA 4G1EB 4KH0A 1DJPA 1GO2A 1V5FA 4OQNA 4BKQA 4C4RA 1NVXQ 4DMCA 1MKYA 3T61A 3PICA 3RHTA 4DLLA 4HL6A 5EWMA 2EFGA 2X4LA 2C0PA 2QN7A 1WDWB 3IDFA 4FXPA 3UBTA 2PX3A 2REQA 4GICA 3C85A 1M75A 2OCAA 4U2KA 1L3IA 2C59A 2DT5A 3L1HA 3E81A 2WIKA 3L4BC 3JQFC 3N2GA 4QYSA 1LS6A 4MIOA 4IDOA 5HK9A 2RHWA 2Q4DA 2XA1A 2VHZA 1D6JA 5CT6A 1SXJE 3RC9A 4CLOA 3MTDA 1YA8A 1M2OA 1T15A 2ID8A 5A4JA 5IAAA 2CUKA 1RHRA 3Q88A 3QLVC 4X54A 3IOEA 3SSNA 4KE9A 1AKVA 1KYVA 3PHHA 1MAUA 3KWMA 3SKVA 4TM8A 7GPBA 2JBAA 1QJCA 2J5KA 2X1MA 4JU9A 1BXZA 1GRCA 1L4UA 1IXZA 2QTGA 1JHPA 1TKAA 2GAOA 5EZ5A 3N6VA 1F12A 1KFJB 2W9XA 3FCOA 1NX6A 3RRMA 2D8AA 2OHJA 1AKRA 3FWYA 3STTA 1KAGA 2BFBB 1Q77A 2O7NA 5LJLA 4MPTA 2JHAA 1NJ1A 3FUVA 4Q5IA 3TLGB 1CG6A 4IG9A 4CDRA 4EKNB 4URUR 4ZHQF 2GLXA 3Q2OA 1NFRA 4QBKA 4XOUA 3ZZ0A 3HJRA 4CKWA 2HC9A 3LHSA 2C8VA 4RK5A 3OX4A 4X1KA 2Y0CA 1W2WB 4DMMA 3ANNA 1I3LA 2EKPA 1NR1A 4GLOA 4EHDA 5ED4A 3UCEA 2GK3A 3UJ7A 3IO3A 2Q0XA 2CB9A 4Y8VA 4YAJA 2GXAA 3IULA 5IFLA 3ZWDA 5AI8A 2H92A 2I76A 2DBQA 1LA2A 2X4DA 4JBYA 4Y6OA 5U9CA 4U8GA 4L2IB 3SQNA 4BFWA 3DLHA 4KIJA 3VPHA 1MJGA 1JIQA 4PZDA 1ESCA 2VC2B 3TZCA 1UOEA 1CQWA 1GGEA 3QPWA 4RFSA 4IV0A 1MO5A 2OECA 2CUNA 2P9EA 4RH1A 2UYCA 1EA7A 4AG5A 3BKXA 4BO5A 4QTZA 2HH9A 1PNRA 4YCMA 1BSVA 2XDWA 3VC2A 2ZRHA 4ARBA 3GUHA 3HDGA 4Y2QA 4I14A 4TUYF 3D2AA 2GN2A 3FTDA 3TLKA 1AG9A 1JVBA 3CEMA 5K3CA 4ZOCA 5CCEA 3PR3A 3NOOA 2WF8A 3LF1A 4J91A 1I9GA 1TPYA 4OHFA 3ZDXB 4AJLA 2GUWA 1Z15A 4W8GA 4ZJZA 3D1LA 1AGXA 5KVQA 4KAJA 2HHAA 2YUIA 4DV6B 2B25A 3IR6A 1ZD1A 2BGMA 1Y4AE 1I4WA 4LX8A 5ALUA 3WGKA 5KWJA 3LLUA 1BU5A 1G9TA 3EEQA 4KXUA 1DPGA 1RJFA 4RLQA 3SDSA 4CG1A 4WL0A 6PFKA 4DDMA 5M7EA 3C70A 1LF0A 1EUYA 3ENZA 4LOKA 3ERCA 8MHTA 2V6GA 1Z5ZA 1H6DA 3C3KA 3ZV3A 2AE2A 1I51A 3FJ1A 1A8HA 4UAVA 2ZS9A 4GU5A 2Y1FA 2QY9A 5D00A 5IBPA 2ZRDA 4IIUA 1YMVA 1LKZA 4RVCA 5A9RA 4I0WB 4GC9A 3P9IA 3UEOA 2W2PA 3LUBA 3BWXA 2BPOA 3U2QA 1O9HA 4I5IA 4M83A 3VAAA 1PZMA 2A5JA 4D9FA 1RBQA 1TYCA 3D8SA 1QFSA 3X1MA 2BFCB 4AK9A 3U4IA 2E4XA 4NBLA 1K6IA 2JAOA 3BM5A 4EY4A 3DDOA 1ITZA 5LB4A 3NU1A 2QMEA 3RK1A 4JSYA 1A7KA 1EVIA 1GPWB 1KSFX 1NUAA 1X7YB 2CLMB 2WHEA 1MQ8B 1GPDG 2YXPX 3BDIA 3DFIA 4IFEA 2WTMA 4IVRA 5FWXA 3RTDA 3MJRA 3O4GA 3R7BA 1UFKA 1JRLA 4ESHA 5C1IA 5G0WA 3KLOA 4LDPA 3S29A 1QU2A 5DHAA 4MR9A 2P2YA 3SYRA 4LG1A 1UP4A 5DK6A 4K86A 1QPGA 1SHJA 3UKDA 1LSSA 4DXHA 1HY3A 3IAM6 4ZAVA 3WRYC 2RHDA 4JIMA 5BMVA 5BW5A 3K92A 5FNVB 1I3OA 3B6IA 3IBSA 1KAMA 5L7YA 4JI2B 1VCOA 2RGRA 2WHQA 2E48A 2NQ2C 4KU4A 5U1PA 5CBPB 4NQRA 5JZBA 3UHJA 1H66A 4AJKA 3I52A 3RS0A 2H2WA 1VSBA 4NBWA 2QUHA 2YWCA 2ZIGA 3ZUGA 1YVPA 1KI6B 4HAIA 4QUIA 3O8RA 2X86A 2WT4A 1SKAA 4RXUA 2FSVC 3U5TA 4BY9E 2C4UA 5JXIA 4X44A 3DMFA 1XFDA 2XB9A 3K8ZA 3DDHA 5EP1A 4IP0A 4YT2A 4EG5A 4F60A 2GJ8A 1B23P 2A9KA 2DSNA 1JU3A 1XZMA 4RHEA 1Y6QA 4HRYA 5JSHA 4JI4B 1GQSA 1FDWA 3LT5A 3OM8A 3MCAA 1ZN7A 3SEQA 4NR0A 3CKYA 5GTDA 2YIMA 5CBKA 4CEIB 1LNQA 4FHZA 3LC7O 5HZHA 2W4MA 4FKZA 5H83A 4JT8A 2PX2A 4Y3UA 4TL7A 1IOVA 1NXXA 4TN1A 4U7GA 5EJ2A 5BY2A 2OB1A 4KWHA 2YNMD 3KJZA 3KX2A 4TWIA 5JEDA 3FRJA 3O1JC 1W94A 3GFFA 4NWIA 2ZWPA 3QKRA 4FYHA 4RA9B 1L5QA 4YASA 3ZE2B 3OQIA 4AJOA 5A3JA 1QAQA 4CETA 4F6LA 1RWXA 3K6SA 1OE0A 2GZRA 2IZ1A 2X7JA 5EJIA 3ST7A 1EGHA 2M6SA 1VCHA 4XRGA 2DUMA 1RLJA 1XLUA 5AKLA 4EYQA 2WOOA 4EI7A 4DQLA 2C7OA 3BORA 3W7AA 3JQ9A 1CZLA 3T54A 3JARA 4KFUA 1VMDA 3JQAB 4LW8A 1H8EA 4MNTA 1R15A 4MVJE 4DN6A 3SS7X 3AEXA 2V7PA 3KPUA 1XE3A 3VPCA 4HV4A 2ZVDA 3S6JA 2Q9UA 2QX6A 3EIEA 1GPH1 1MO2A 2BGKA 2Q3CA 4J0CA 2MSWA 2GSWA 3E8SA 4ARVA 1S3FA 3C3EA 3UOGA 4QGSA 1CUYA 1NY5A 1OYVA 3CVWA 3CX8A 5HK8A 3TTSA 2DQ4A 3AM3A 2NZ8A 2L69A 4K0KB 4ETNA 3WICA 5LIRA 2VJDA 2AJ8A 1SVIA 1VRWA 2D1SA 4IILA 1Y9ZA 3BC1A 3BCSA 4LHVA 4NU8X 2CUZA 3WO0A 4CM7A 3KHTA 3GMSA 1X8LA 3ORFA 2C7BA 4L5AA 1ZY2A 1GQYA 1KZ6A 4E33A 2VRCA 1HQKA 1NQXA 4OYRA 3R8CA 1LDGA 1NVVR 1QM5A 2JHPA 3HXLA 3D4LA 3RR2A 3VKUA 3MT0A 5DN6D 1UP6A 1VXOA 4QULA 4DA7A 1QZ3A 3CYFA 2YNMC 4A5OA 3F5SA 1C1DA 1P91A 1WPQA 2IF2A 3H8VA 1NTOA 3PNBA 1P5RA 4GF5A 3K1AA 2DTXA 4MQ5A 1O4VA 5GWXA 4D81A 4CM8A 5I7OA 2GD6A 1E62A 3UFXB 5F9HA 2NNLD 2EYUA 1L4YA 2E1PA 5H8WA 2YBDA 1E3QA 3HABA 4TSFA 2I4IA 2PEZA 2IVZA 1H1LA 2P0AA 4P5PA 4WACA 4B3BA 4ZN6A 1LSJA 3W78A 2X8WA 4A26A 1GIAA 1JUDA 3HUEA 4S24A 3V1MA 1WPXA 1W1UA 2Y1EA 4NEGA 3LKBA 3T1NA 5C8YA 3UVEA 4RZUA 4O8CA 4UU8A 4XCXA 3HM2A 1SU7A 1ESNA 3ICCA 3QKUA 2IOFK 3CT4A 4O4HA 3GC6A 4D8VA 2FZKA 3O8BA 1RWWA 4DIBA 3NXSA 2GPAA 1UPXA 1DX4A 1Z88A 1EVKA 4N1AA 4J1TC 4F7WA 1T13A 5CCDA 1C9KA 1C3XA 2OO5C 3HS3A 2PGDA 4CLXA 2DX7A 2XZPA 1YA4A 4PAMA 2EF0A 2FK7A 2IXGA 3FHOA 2JJ2D 4WZ6A 4BL5A 1L7DA 3PIIA 1FX1A 2IV2X 3ZDAA 4ZIRA 1XLVA 1BS9A 1KI8A 1KP2A 3T3IA 5C8VA 1EI9A 1L7EA 3FUUA 4CCSA 5FO1A 2ZT8A 1J2EA 3GJYA 4W1SA 5E9AA 4C2UA 2ZRGA 4ZT2A 4AMBA 4ND1A 5JYCA 3FX2A 3K09A 3NTLA 4C07A 1HLPA 1JX6A 2W58A 1DXQA 5C8DA 3C6ZA 3VU9A 1RZVA 4A82A 4QT4A 3B1WA 5EXTA 2G9NA 1E3MA 5JD4A 2NU8A 4A6EA 1MVLA 4K6FA 2YWFA 4KIFA 5LL6P 2CJPA 4QICA 4JMPA 3U3ZA 4XFDA 1MVNA 2VDUE 3I4CA 2GEKA 1G8FA 1XTJA 3JPYA 4WBNA 4MP3A 2AEEA 3DVSX 3RIMA 2PZKA 4K6KA 4D92A 2GB4A 4EG6A 4L51A 1CEQA 1WAMA 1XN1A 2X2FA 2YHAA 4NDAA 4BU1A 3GH3A 2O8FA 4IQ8A 1PZFA 5LWHA 1PR1A 1QVRA 3Q8MA 1YR2A 4C0JA 2GO1A 2IOHA 4LBYA 3MLBA 4OP1A 5IUNC 4L3OA 1B26A 4PLCA 4FD2A 4HMOA 2E18A 4PBSA 1KHTA 3TOZA 4BIMA 1OIXA 4WVFA 3L0YA 4YXWD 2GCGA 2ZTMA 4TYNA 4XTCS 4AKHA 1HUQA 3H87A 4Z8YA 1HE3A 4NYJR 5H80A 3CJRA 2VJAA 3T0FA 2PM8A 3DOFA 2WIDA 4K5QA 3DEYX 4D3ZA 3QVXA 4Q4HA 3MQ2A 1IDN1 4Q9DA 4D4JA 1SC9A 4PZLA 3DBHA 4ETWA 1UKCA 3KOXA 1DOHA 2IFTA 3LY9A 1Z45A 4QRIA 2IIVA 3Q15C 4JOCA 3CUYA 3OTGA 4YJFA 3VO1A 3WGYA 5CFNA 2Q45A 2W6QA 4KLNA 4U2CA 3OZWA 1E1RD 1Z5VA 5AHKA 3S2FA 5A05A 3UA3A 4CMCA 1K2WA 1XXHE 3H5OA 1H2RS 3MJFA 2ZRBA 5LKAA 2A88A 3UUWA 5GPBA 1ILWA 5CG2A 2QHXA 3CVVA 1SBHA 4GGOA 4XSHA 1MAWA 3SVLA 1ZUD1 1V39A 3QMVA 3U37A 1Y1SA 4REQA 4E6EA 2FRDC 2EWWA 1PT7A 1U7ZA 4XTRA 3RTAA 4M98A 4ARZB 4JCCA 2WRZA 2ZJ0A 1JR3E 3KFXA 4HB0A 1NNSA 1L5NA 4DEVA 1DIOB 1N9ZA 5M04A 1RTKA 3F6YA 3FTEA 5F51A 1HE4A 3A2MA 3N3AC 3MA0A 1WIWA 3TW8B 1DL5A 2WWVD 1UDWA 3ZLTA 4TKUA 4W5WA 5DISB 3HDHA 2GBGA 4URYR 3ZGLA 4A23A 5BNWA 1EKXA 2G3YA 3AERA 3I6YA 5AI5A 4W5RA 1FQWA 3P5SA 3NVDA 4DCSA 3CZAA 3DL4A 4NL4H 3R7NA 1AA6A 4B76A 5K8TA 1XAJA 4BMZA 1U28A 4LZJA 3SMVA 1QE0A 2Q46A 2QK4A 1IHYA 2HKIA 2PMKA 4FLMA 4GAEA 4ZQBA 1HEYA 4R7ZA 5FKJA 4DQDA 5BOSA 2PUFA 1BHQ1 4NKRA 5KCMA 4D4GA 2XNDD 3K2BA 4TT3A 3N76A 1XDWA 3GLHA 2RHOA 2VP4A 2JHFA 4XGQA 3UK6A 3VZDA 1JXMA 3ZU4A 4CM5A 1XXHB 3VSBA 3JQGA 2BV3A 4LYYA 2ISCA 3MMXA 4F45A 3OAAA 2AHOA 3U1VA 2Q41A 1YZFA 2A2ZA 1Z0UA