3TLCA

Microcin c7 self immunity protein mccf in complex with microcin c7 antibiotic
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
molecule keywords MccF
total genus 116
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlcA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlcA02
3TYXA 3G23A 3TLZA 5F5XA 3T5MA 4IIXA 5K99A 1ZRSA 4INJA 4MI1A 4MJXA 5JYBA 2AUNA 3U1BA 4E5SA 4H1HA 1ZL0A 4EYSA 4E94A 3SR3A 2AUMA 5F9MA 4IIYA 3TLGA 3TLYA 4JVOA 3TLCA 3TLEA 3TLAA 5FD8A 3GJZA 3TLBA 3TLGB 5F1YA
chains in the Genus database with same CATH superfamily
2HSJA 2VQSA 2Q0SA 1GAWA 1IFXA 3U1VA 4MUFA 1KYQA 3FAZA 1DTSA 4BIMA 2PCNA 2VJQA 1L7DA 2GO7A 3AUAA 2HXGA 5AFSA 4PY2A 2C3YA 1F6BA 1ZCFA 2JKVA 2QL6A 2QZJA 3W6UA 3HCRA 3JAKA 1Q57A 4F7DA 4GOJA 1UJ6A 1NXTA 1CJCA 5I5GA 3SIWA 3JVVA 3IEIA 2HWWA 3QENA 2XWBF 1MQ8B 3LG2A 1GG9A 1FTGA 1NBWA 3PYMA 3K2IA 1CX8A 3QXHA 1BD3A 3KZKA 3O82A 2DQSA 5IKEA 5JAPA 3BGOS 1PR5A 4F3YA 4LF8B 1GGOA 5JAUA 4XSGA 5LYYA 5LQCA 1FMJA 1JG2A 4LRWA 5F1YA 5EIAA 2WYUA 3NMUF 2ET6A 2HNKA 1BDMA 3WNCA 1U8XX 2B8EA 4CMJA 2DXIA 3UEOA 4IIJA 1PT9A 3P4XA 2X7HA 1S89A 2H29A 3KZCA 3OOYA 1MZPA 1OZ0A 4MIEA 4KGVA 5C4GB 3UOGA 2D1SA 2OMKA 1UFKA 3ZE0B 1ST2A 2P4QA 5BNIA 5BUZA 5I5EA 1NTRA 4C9EA 3AYZB 2POCA 5JO9A 1JZSA 2P9GA 3PJEA 2HLDD 1UAGA 2VZLA 5KTRA 1PWYE 2OMEA 2PGJA 1M2VB 3ELWA 3NBYC 1L3BA 3KKZA 3CWCA 2ZKIA 3ND8A 3VJLA 1G59A 4ZYXA 4YT8A 3RHSA 2HF9A 3ANNA 3UMMA 1PLKA 2OPBA 1T24A 4ZOLF 4MRMA 4P4GA 4AM8A 3ADCA 1KBLA 1DGQA 4IIHA 2I03A 4ZTZB 2YS7A 4KAXA 4CCAA 4JYZA 3I5UA 1ZUHA 3IELA 1WUIS 1WQ4A 3IQGX 5FR2A 8ADHA 1X7DA 2HAEA 1BKDR 2YY7A 3I6MA 1HV8A 3QKSA 3CSDA 3SY8A 2JI8A 3VR5A 1JU9A 4YCDA 2XMRA 5KOYA 1IBMB 1TRKA 3G02A 1K6MA 1SD2A 2NO6A 1XYGA 2CL6X 4NJOA 1B1CA 2X13A 1DTWB 2R79A 4BB6A 1TJ3A 3RU3A 1NMEA 2DHRA 3DO8A 3C6YA 2XUFA 4GC9A 2W2KA 3Q9NA 3K09C 3VZDA 1J56A 1V8DA 1EX1A 3MA0A 4FZVA 4P4SA 2BFOA 5DBEX 4AZTA 3ML1A 2WHPA 1WDMA 1U0GA 2AWOA 3DZKA 2ZM5A 3OP4A 1DO8A 4Q1EA 1W5TA 5FOVA 2F8SA 4G0MA 3R3ZA 1XZCA 2JHAA 1N6NA 2P78A 2ZQZA 2R7LA 5C8VA 2EDCA 2B92A 5A4MS 1E4EB 2GZHA 3WGHA 1LLQA 4YUZA 3K15A 2GEJA 4JX9A 5H3CA 2IUSA 1O5TA 3AU8A 3FI9A 4D97A 1DKQA 4HPWA 4IRMA 4A4DA 2FWIA 1ILEA 1TZCA 2OAQ1 5CK4A 1NONA 1K9SA 4EB3A 1FZTA 3FCAA 2NP6A 4NYMQ 4UMFA 1N2EA 1FP2A 2HMVA 5K6RA 3L43A 3KQHA 1HFKA 1Q5PA 3F2IA 2AHRA 2MTBA 4WK2B 3R5HA 1P7VA 2EATA 3TJMA 3HHEA 3UUFA 1B26A 1XTPA 3WXBA 3G3EA 2BEUB 4J2OA 3RVSA 2OBFA 1R12A 1M1XB 3IP1A 4QQ8A 1LRKA 1NBAA 1TEVA 1FW8A 2ZTMA 5T5QA 5KDDA 3GT0A 2C7OA 3IAM6 2JCSA 3SBDA 3WLMA 2PCLA 3NBXX 5MGBA 3THYA 4OHBA 5IB9A 5HM6A 1DWOA 3O38A 5IEJA 1GGFA 3U16A 1JI3A 1MEJA 3WZ2A 1T36B 3ERCA 3KXDA 3G68A 2CMDA 3OPYB 3P9RA 2FWBA 3H2HA 3VU9B 3E05A 2QRUA 3K9NA 1KERA 2VPXA 4LXUA 4I9UA 3HTXA 5TT1A 2PMCA 3A25A 3D3WB 4X97A 2ZRMA 2JPDA 4BO9A 2ZZNA 2XUZA 3BILA 3ZBTA 1J1ZA 4CIBA 1LPAB 1OI2A 3WB9A 1ZX1A 1Q0QA 2RIRA 3G2IA 5EVJA 1SUSA 2H63A 1UKEA 1UDCA 5FTJA 5K2MA 1UKAA 4D46A 2UYOA 1ZC3A 2HWXA 4OSPA 3BBPA 4L8WB 4G25A 5D8DA 4F9TA 2OCPA 3DWGA 3L7BA 3ZXXA 5GJBA 1LVHA 4GW3A 3U0VA 3A6PC 4QOFA 3LHIA 3ZGZA 2PA3A 1TEHA 2GFIA 2Q5QA 1IK4A 1XDGA 5BSKA 1ULTA 4EY6A 1SBCA 1H8EA 2B3TA 3KUUA 4GQBA 5F33A 3OZWA 4OBBA 3OAAA 3OFNA 3OZBA 4X20B 3RVDA 2BP7B 2B8JA 2E49A 2MMGA 3PFFA 1EWKA 4FONA 3UJ9A 1IWOA 4C4SA 4CQLB 4CF7A 4BKQA 1HFJA 1OWNA 1Z0ZA 5AKYA 5JQGF 1IEWA 1JAHA 3CIFA 3CLVA 4YIKA 4R0MA 3A6DA 3PQCA 1GNPA 1QIKA 2OM2A 2VP0A 4FGKA 3OMWA 4IG4A 1WQ1R 2HF2A 2J9FA 4ZA2A 2XD9A 1BQEA 5C52B 3TTUA 3A8TA 1MJGA 3PGLA 5ETJA 4CKXA 1HDRA 4GM1A 4ZEOA 4KFCA 3P0EA 5M5BA 4DFDA 5TQ2B 4AI6A 3FSEA 3BB4A 2UUBB 2IHJA 1QTQA 3VDRA 1O77A 3MUNA 1SIBE 1JECA 4RABA 5BR1A 1P9OA 2RI6A 4MVJM 3RKSA 1JUDA 1R9JA 4W1QA 4XFJA 2C9DA 1PWEA 4C05A 1OFTA 2DWUA 2RC6A 3JXEA 5AVKA 3JQFC 4X93A 1V96A 2H1IA 2R6JA 3Q6NA 4OK5A 5DSTA 1RLJA 4Y2JA 3KDAA 5ELYA 3OOHA 4MW6A 4H6WA 1EJ6A 4PIMA 2PFSA 5T4BA 1RI5A 4DLVA 1QQ7A 1KMNA 1ISIA 1TMYA 1T2FA 1Z13A 3ZBUA 2EJWA 3ZLTA 2EOAA 3IIKA 1W2HA 3I5XA 4A8JC 4CQMA 2KHZA 1V25A 2AEMA 3ABIA 5IM5A 4QPDA 3JQFA 2AOXA 2C42A 3NVAA 2DZDA 3LCJA 1LQ2A 4KJXA 2XA2A 2RFLA 4B45A 5EJ8A 2WIGA 1JPJA 2NLOA 4H1TA 4MEBA 5HKKD 4DCUA 1L7VC 2ATXA 2FX3A 2O7QA 2ZQ5A 3L7YA 3QHPA 5FPQA 2EKPA 3I2YX 2BJVA 1CR1A 3P9PA 3EEOA 2I33A 3RYCB 2QORA 1R4NA 4JJFA 5LLSA 3TINA 1MD9A 1Z6AA 3U7GA 2JBJA 2AF3C 3STTA 2CJPA 3UMBA 4R2XA 3N7AA 4HWRA 5DTJA 4A27A 1O9BA 1AQUA 1RWVA 3WK8A 4B6QA 3FH0A 4B17A 2FPRA 3P0HA 3CUVA 1L4KA 2KX7A 5JD3A 3GZJA 2J85A 2CXRA 2Z0MA 2Z4TA 3OJCA 4OI2A 1LDMA 3E03A 3QEKA 1ANKA 1UMDA 4ZXPA 5CFZA 3K4IA 4JKOA 1PNVA 1ZW1A 2I2FA 3LPNA 1C1DB 3CNHA 4B47A 2O0LA 4PYKA 3T61A 4XH9B 4KQGA 3K9WA 3PTAA 3R40A 2H2HA 2H59A 5ESRA 4WKGA 2XYVA 1ZI9A 2CJWB 1H2XA 3WTCA 2PK3A 1PFWA 3JQBA 4XXHA 5EWMA 3ZWKA 2E4WA 3KRVA 1ZCJA 3VPCA 3TIIA 3VNBA 4ZMRA 5D3QA 1R61A 2DJ5A 3AL0C 4UD2A 3ENQA 2C54A 2XCUA 3P94A 3ROEA 5F23A 4RZHA 3KV1A 3VR3D 4FOPA 4BZXA 2ZSFA 3QUAA 5A9TA 3ZZNA 1V4NA 4H59A 4ZCPA 1YRYE 1YZGA 5AVTA 3USCS 3ZD9A 4E4YA 2NUPA 3O5AA 4DM7A 1N7HA 1IN6A 2ID9A 1H9AA 2ON6A 4B87A 3KLOA 2YW9A 4Q1BA 4ZCSA 2L0XA 3FFAA 4MUNA 1A77A 3YASA 1KGDA 4GL4A 1E2UA 2WI8A 5DKFA 2ZTVA 3H11B 4Z0PA 2HHJA 2ABWA 4KHPB 2W2TA 1S5PA 1YSCA 1NZDA 1WXHA 3BJRA 1JE1A 3DR3A 4OLJA 2OCYC 3H5VA 1IOZA 3M4JA 4IJWA 4OYYA 4HOYA 2IHTA 3RYIB 3MEQA 1Z37A 2R96A 1TF7A 2VA9A 3ZOZA 1YIAA 5HXAA 3HRHA 3MT9A 3V8PA 5F3WB 3VBEA 1ZWKA 2W71A 2EC5A 3TL3A 4CCYB 4NBNA 3ZD8A 3SVZA 1FFGA 1I3LA 3A36A 3DJYA 3QLUA 4JT8A 4OYLA 5D7BA 3IP5A 4WY8A 3T3HA 2FSGA 1JQKA 3ZWPA 4D56A 2F4NA 2J45A 2ORED 5ADHA 1PDWA 2O8BB 3TKYA 4K9MA 4FQ7A 4WKCA 3ZW7A 1UC4B 4S2UA 4U2DA 1SUCA 4F0JA 2JCBA 2RBKA 4C0JA 4C07A 4YQEA 3FECA 3SS7X 2WILA 1YKGA 2IXFA 1MBZA 1I2BA 3JWJA 4FDMA 2OV2A 2PBRA 5I3CA 3L92A 2C3OA 4IUDS 3TMAA 3ABOB 3HDYA 3KT8A 4TV9F 4RIFA 1P6UA 1XAGA 5GP1A 4CKBB 3R3SA 4OI1A 4RTJA 2YUTA 2SKCA 5E8RA 4BNUA 721PA 5KNDD 1EH5A 4BN0A 2AI3A 2CLKB 4QPNA 2CFTA 2EHDA 3GDHA 1HQCA 1P1IA 2FEXA 3E5RA 2EJCA 3AEXA 2Z2XA 3L0BA 4JIGA 4RVSA 1P74A 5A3VA 4Z2AA 5A3RA 2E5LB 1Z8LA 2Q2WA 2PL1A 2F1OA 1W52X 1TW2A 1CY1A 2B0CA 3B78A 1K8QA 3H87A 3N7TA 1PJBA 4EF6A 3E9DA 2IYFA 2AD1A 3UB2A 4F5DA 5K01A 4LKRA 1EI9A 1TCUA 3FZQA 1SIUA 3OICA 2G9NA 4XYLA 5CAEB 3T5TA 4FUQA 3RIEA 4RSMA 3RTCA 3K5IA 3IH5A 4I0WB 4BZZA 1Q7CA 1AK2A 4LRQA 5B3AA 5T8KA 3ZNPA 2JGMA 3LWBA 5JH7A 3AM3A 4ZQCB 3EIQA 1VCMA 2CZCA 1U6IA 4C3ZA 2FQXA 1LNSA 4RZQA 1KAGA 3DEAA 3QVGB 4L5YA 2VKTA 2K4MA 4HFMA 2A35A 1WL8A 5FA5A 4BQOA 1N5IA 2FGKA 1JDNA 3CLKA 4J9VA 2O8FA 3D2BA 4IY1A 2QGZA 1IK6A 3CLTC 3MN1A 3O1LA 2OO7A 2I1VB 1WUKS 5DYNA 1KZ1A 1XV5A 3FBTA 3PR1A 3ILHA 1XJ0A 2HWUA 3JPYA 1VFPA 3R1IA 4CODB 1IBKB 3DD5A 4FHFA 1LPBB 3HDQA 3VR1A 3HNOA 2H4HA 1UOPA 1TA0A 3KR2A 4W1RA 3WLSA 2C83A 1ZQ9A 2WYOA 3AINA 4LWOA 4GL2A 1UM9B 2YOFA 4TL8A 1B2LA 2BFCB 4BGVA 1BMFA 1QDLB 4XGKA 3TH5A 2WLSA 2PN1A 4JA0A 1R5NA 2IIBA 1Y1PA 4UUOA 1FJXA 4LVNA 4NFYA 2G7MC 1UEIA 4FYPA 2RAPA 2F1HA 4BLRA 2VS1A 3CZ4A 4Z7OB 4MVJD 2OK7A 4D25A 1LU9A 1XRNA 4D0LB 4JHXA 4KP7A 2I4LA 2N0SA 5B1HA 1OY1A 2E4YA 1R6UA 2UZ4A 1FSFA 4PANA 1Q0RA 3C97A 4JWKA 2BHNA 4F3NA 4U2KA 4TTSA 1XZDA 3OM0A 2D6FA 4CEJB 3OKCA 3LDFA 2VDKB 3LQKA 5IS2A 4W63A 2ZUEA 1M7BA 2HSDA 2AZMA 1MVOA 3G0HA 2D0PB 3VAAA 2H1VA 1IEQA 2DPYA 1D1TA 2QSJA 3H2GA 4FJ2A 4K9DA 4NH0A 1I4LD 4QPZA 4RFLA 5GM2A 1AKTA 2BY4A 3PPIA 1QGUA 2X14A 4P84A 4QLOA 2C6CA 4DR5B 2J4FA 5FO1A 3LRPA 3MFYA 3W2GA 5EJ4A 4INPA 4H7FA 3WKEA 3ZNNA 4V39A 4WK6A 1P39A 4ETMA 3E1KA 1HDXA 3DKIA 2A5JA 4S1WA 5B1YA 1YJ8A 1YZHA 1PJSA 2L2QA 2A0KA 4YC7A 4BLQA 2V9ZA 4JC4A 4WERA 2RGYA 3BH7A 1J0AA 4X94A 3FOEC 3HMQA 4M21A 3OIGA 3DOJA 2YWFA 4MS1A 4BNGA 2OZKA 2OA0A 4TKVA 3RK1A 4K9SA 5TDHA 4WZBB 4GKBA 2JA2A 1QGZA 1VIAA 1FFAA 1NXOA 3NNSA 2QRPA 5B4VA 1IHUA 2Y0BA 2HRRA 2IDMA 1SY7A 2HQBA 2OT3B 3AETA 3WBBA 2HGSA 2XT0A 3NHSA 2AIRA 1WU7A 2YZMA 2ZSHA 1D6MA 1WZEA 3G0IA 2D2VA 5IANA 1WZUA 1RACA 2ZVJA 5ALSA 4W6QA 4JV5B 2WC1A 5J4YA 1PFKA 4UZEA 1FTQA 2DWPA 4NYJR 3VYTB 1PFQA 2Q3EA 4FBLA 4JSYA 1NQTA 3E4CA 4EENA 5CVCA 2A1UB 2XE8A 3GLTA 1FU4A 3IUBA 5EA2A 4FB5A 1CUDA 3OUZA 3SHFA 3GRAA 2GK3A 4KXQA 5H3HA 5A7FA 5LZ4A 4MQMA 1H42A 1U28C 3FLAA 2F7SA 1A9TA 1ZL2A 1J20A 3V1MA 2H1WA 1IIBA 1SVSA 3LOUA 4LYYA 4QUHA 3PJRA 4UUMA 3OZAA 4L7QA 4IMRA 2IYPA 1TYEB 4HQRA 3B1WA 4MDHA 3S5UA 1QPZA 2C2GA 5B4UA 2Q21A 4BECA 2YWCA 4RM3A 3WI7A 4UU1A 4W5NA 4HVCA 3L9WA 3V1TC 1JR6A 3JQEA 1UBNA 2X77A 2B98A 3NEJA 4PC2A 3LA6A 4O6VA 2VHTA 1PWXA 1SCUB 2IODA 1ORWA 3M6VA 2QYOA 4HRXA 4XGQA 4DDVA 2WYVA 1ZY2A 2OBYA 3CJQA 2EK8A 4URHA 3PYLA 3HJUA 2QU8A 4ZREA 4X3OA 1VGVA 5DNYB 3DMTA 4QTXA 4TLBA 1NY5A 2OHFA 4ZQHA 4X92A 5IN4A 3D5EA 3CX3A 3ZGOA 4EGCB 4Q4LA 3CPHA 1T2CA 1WF6A 1A82A 2P4HX 3EGIA 3G8DA 4AY5A 4X65B 2PSSA 5TSDA 1QO9A 2GNPA 4MS3B 3A6HA 5H4HA 4EB6B 4G0VA 4M1EA 2DYKA 3WIDA 5ITZB 2IZ6A 4X1KA 4ID3A 3DAOA 2OSBA 5LQDA 1DRVA 1MC8A 1V5GA 2B20A 2FN9A 2WHXA 3UENA 3VI3B 3TMKA 4CMCA 4LBVA 5T3YA 5ELMA 1ONOA 1H1TA 1XA4A 4HNTA 2GTPA 5FF9A 1WTAA 2CW5A 3MTQA 4UDOA 3I74A 4IICA 5EXEA 1DARA 1I33A 5AW2A 3FHTA 4CMIB 4CXMA 5J58A 3JASB 3PLAE 5A02A 1Z25A 2IW3A 2XRYA 3PBKA 3S2YA 1ISMA 1NVAA 3W6NA 2OYSA 3L7JA 4TJVA 4C30A 2C92A 1U1GA 5F73A 1CYDA 2C29D 5DH9A 2FFJA 1QKJA 2REQA 2X0JA 1DQPA 4RU1A 4TTRA 1ZBDA 4Y6GB 4IIGA 2WTBA 4X95A 3PC2A 3TS1A 2HMWA 4LYDA 3WE7A 2YRXA 4GUAA 3R76A 5KPDA 5C3MA 1G3RA 1TDJA 2X2FA 3KPWA 2C59A 2CLHB 1PFUA 2B1JA 4HLDA 5C8ZA 5F2EA 5KYNA 4F9EA 1LI5A 2PAAA 1RRFA 1W8IA 3O73A 2QT0A 3TNYA 4GLFA 3CMMA 3AI1A 3K16A 4LDZA 4WY2A 4YBRA 1KVQA 3CYFA 3EZEA 5JPIA 3L0YA 4HFNA 3ZNOA 4WPGA 2J33A 3H42B 2HXYA 3N53A 5ARDA 4DJTA 1PF7E 1QIGA 2BZSA 2AK3A 3DAFA 3MOSA 3EPRA 3I53A 5CX4A 1TIPA 1L4GA 4F7WA 4DLSA 4COGA 1ORVA 4YI5A 3AOGA 3KSAC 2R1TA 2F43A 3WDLA 5EKSA 4CKWB 2ZTUA 1D07A 1KS2A 9MHTA 2VHEA 4F5WA 5DPMA 3BORA 1K3TA 2OL4A 2ZUCA 3OCWA 1OQAA 4G2TA 1R0YA 3PZRA 3EJWA 2C4KA 3HSSA 5DXAA 4F4JA 4HMPA 1PV4A 1BXRA 2D5CA 2WT9A 1EVZA 1PQPA 2R97A 3G2KA 4RY0A 4XWGA 2NZWA 1AKQA 4MQBA 1PKXA 3TE7A 4WNAA 2JFVA 3L6CA 5TS3A 3URMA 4B3DA 3CISA 1WSDA 4B4WA 4EJSB 1KEUA 3TM5A 5A1JA 1DSSG 4RELA 2OAEA 1J2YA 3F3SA 4Q6BA 1C1YA 1MABB 1SK9A 4R1OA 1RHMA 5KCMA 3HWRA 1V5WA 1Y9DA 2OO5C 4XOIA 5ICEA 4FMPA 1TTHA 2CK3A 2HRDA 1W19A 1E9AA 2AXEA 3I9V6 4LSGA 1ZJZA 2XCLA 2G88A 4DC1A 1ACLA 1H93A 1JX6A 5JZBA 2PCJA 1J5PA 4TVOA 1OTYA 1TYBE 4R7ZA 2GYUA 2H07A 2IOFK 2IIPA 5MFZA 3PVCA 2G5CA 5EIFA 3U44B 2PVVA 3LY8A 5KBYA 2G72A 1OJ7A 3SK0A 1UMKA 1DS6A 2OECA 4JI1B 1Z7YA 3CX8A 4IMJB 1X2BA 3DCJA 1EK0A 2PKXA 3A1VA 3R3UA 4X7PA 3T3PB 4BP3A 1N2OA 3VYSB 1UUFA 1Y6FA 4QEDA 2B6HA 4IWYA 3WLJA 1G5IA 4RVNA 5HPYB 3IBSA 1FP1D 2H4XA 4BE4A 5CD1A 3LLUA 2VRCA 5HP4A 4TXNA 2LIPA 5J59A 1SKMA 4KGXA 3ADPA 4WE3A 2R8ZA 1ZH6A 1ZM2A 2O7SA 1FLNA 1WA5A 4JLWA 4LIPD 5J9FA 5LP1A 3AX6A 3D0OA 3RIMA 1V37A 3DOEA 2I4IA 1TJNA 2D8AA 1QIMA 2XBUA 4PGAA 1JDSA 3G59A 5BSMA 2O5RA 1NSFA 4RDIA 2FWRA 4LF7B 4F46A 4CEIB 3KUKA 2CXNA 4IIFA 5BV8A 2V6IA 4UU0A 4RLHA 1LK5A 2ZUDA 3SSOA 3QFTA 3TGPA 1SKAA 3VH3A 2V4MA 3MJRA 1Z4KA 2VXOA 2IPMA 5L9AA 3DLAA 2A1TS 1TCBA 1GM5A 3C7DB 1RWOA 2P2GA 3QFCA 3W06A 4Q02A 2YJTD 1HEUA 4PYIA 5HBGA 2WVGA 2I0FA 1JGTA 4YONB 2E87A 2HYIC 1V8PA 2EFCB 2VCHA 1PD1A 3D59A 4BY9E 4G1BA 1A5SB 4UZSA 4QUKA 4NMWA 4KUGA 2WU0A 3R41A 2PT9A 1U4NA 1QS0B 5AI9A 3UJ3X 1DT3A 3ZD7A 4Z0TA 1NW8A 3VSBA 1O7JA 2VRNA 3FWNA 4MXDA 5B64A 5JC1A 1RMYA 2W6IA 5JD4A 1E9CA 3LYLA 4R1SA 1F7VA 2WSYB 3JVUA 3NETA 1M1NA 4FWBA 4R3WA 5EJGA 3ICQB 1R6AA 4X1YB 2GN0A 2NGRA 3C3PA 3DCNA 1OJLA 3OQPA 3R6WA 1V9CA 1MTZA 1VGRA 4NLLA 4EPYA 5JSFA 2I6XA 3TTVA 2CVPA 1LSJA 2GS9A 2ACVA 2GXSA 2IYLD 3CF2A 3IRUA 4GGOA 4Y9UA 2QXYA 1EWYA 5TMDA 3A2LA 1EK1A 1CT9A 3AEYA 3BJMA 4RJKA 2JH3A 1INLA 3HACA 1ZMBA 3Q2OA 5GONA 5HKLA 5ALFA 5LVAA 3ICUA 1SC9A 4XJVA 3PQEA 4LNAA 2O3QA 3AEUB 4H35A 1RQLA 4NMMA 4PGMA 3OEEA 4TKLA 1XRPA 1EFPB 1YUNA 3A4YA 3DDWA 1L5KA 2ZJ2A 3MLBA 2NXEA 5EWLA 2BEVB 2R5FA 1U5BA 3L7AA 5GAJA 3ZHXA 3LCRA 4DNXA 3LK6A 5FWNA 4YBZA 3IQEA 5HIJA 3DXXA 2CLCX 3G23A 3OCJA 1E3IA 1XMSA 3EGWA 5I3ZA 1IWPB 1ENYA 4WLOA 3W2FA 1P4JA 1SCKA 4K9OA 3FTEA 2REQB 4HDSB 3O47A 3CUTA 1EUZA 4J9UE 4FYHA 3GNLA 3OAAD 2VJYA 4GS5A 5E95A 4A1FA 4EG8A 3FWYA 1ZJ6A 2RHOA 3S2SA 5H16A 5C8YA 3VC2A 3GHYA 2R7NA 3J81k 1TYCA 3NB0A 5JADA 5KTPA 1RLTA 1ORTA 3U80A 5HMMA 4A8HA 1WCIA 2ZYVX 4QDOA 1T5TA 3SMVA 2ANBA 3T52A 4LY9A 10MHA 2E3JA 4R1PA 4YJ2F 2P3LA 4WV3A 2PWBA 3FDJA 4N54A 1JBQA 1SCNE 1NW3A 1WVMA 3L8ZA 3T1HB 1O8BA 3IUYA 2G5TA 1XMQB 1E64A 2D0DA 3GLHA 2MJLA 4G37A 4MAFA 3KETA 1C4WA 1LBEA 3MRXA 2P67A 3K1AB 3MWDB 2Q4OA 4EMBA 2FN3A 2V55B 3J80A 5BN5B 3AHEA 4FMDF 3VPFA 2Z8ZA 3QE4A 3QKTA 3QVJA 1FP7A 2J59A 1U8CB 1NW5A 4HDAA 3K9FC 1VDZA 1BH2A 1P18A 4YUYA 3DMDA 3QVMA 2KE5A 3M6IA 5DYGA 3AR3A 3SKYA 1Z2AA 1OLXA 2NU6A 3TRFA 4IGAA 3DA8A 3AERB 2ZB8A 2OZLB 1U8ZA 4Q3LA 3SU8A 3TCNA 4L3OA 1T9GS 2FPIB 1VLQA 3Q7IA 4IVQA 4AECA 1OFVA 2DBQA 3EVNA 3ORYA 3E7WA 3GUVA 4PAQA 3RS5A 1C50A 3MS4A 3T94A 5KX5F 5GQSA 4MP6A 1U1EA 3CNEA 4DYVA 3U3JA 2FN4A 2XODA 1CEYA 1FYVA 1FVOA 4N9QA 2DH5A 3NXKA 3PDIA 4DC9A 1DL5A 2D1YA 1Y7TA 4PBRA 3M5CA 4WLEA 5DHAA 1U3TA 3UJDA 2EKZA 4QQKA 1C7JA 1TJ4A 1KKUA 5AKGA 5FUXA 2PZMA 4YUVA 1FDRA 1LFDB 1QK3A 3N1UA 3R24A 2IWHA 2V7BA 2BL4A 5C7OO 2XCOA 4ER3A 4N7RA 1JKIA 1E3WA 3E70C 1EFHA 1ZVKA 3OZEA 4IF6A 1FFXB 4IDCA 4I1SA 4LBZA 1FFHA 4MR8A 2PBLA 3ZE7A 2JIZA 4L5CA 1WHTB 2C03A 2G1UA 5IH3A 5C51B 1CULC 2EBFX 1JIUA 2E7ZA 2NAPA 2GJ8A 2I1QA 2B30A 2JI6A 5JH7B 3SLGA 1N5MA 3HGMA 5D6OA 3TSYA 2NQTA 4G0UA 1XAIA 2OXRA 4PPNA 1E7RA 3BMQA 2W8ZA 4RJIA 4Y2VA 2FEPA 4K40A 1GTZA 3E3AA 3GOQA 1XN1A 3B3JA 2JIBA 4ZIRA 1IULA 4COOA 2LRHA 2C07A 3N2IA 2C4HA 4DJFC 2JAWA 4B6GA 4PYQA 2J07A 1ZJJA 3O8RA 4KFSA 4P7JA 1KHHA 3QEAZ 2PO5A 3R9IA 2H5LA 4KBYA 2QW1A 3K0CC 4AYXA 2HYDA 4IDDA 4EVSA 1APBA 1JHRA 2E6KA 1XTVA 2OVFA 2ERYA 2V6GA 4ZT3A 3UA3A 3O83A 3WL8A 1BNCA 2ZUFA 2YN4A 2ZT5A 1TQ2A 2LPMA 3QBVA 1FFYA 1Z12A 3HN2A 1EWVA 3EWAA 4PHHA 5C2JB 2GN1A 3JQAD 1F60A 1EXDA 5HRUA 3KIPA 2MR5A 4G1VA 4O2AF 3X1ZA 4A0QA 1V43A 2JHPA 4TUYF 4Y6LA 4YMSA 1EA5A 1TQDA 4BBZA 2WV9A 4NOKA 1M1YB 3SX2A 3EF3A 3EC7A 3N74A 5CVVA 3T12A 1YC2A 4N7BA 4V38A 3TCKA 4U2GA 3RGWS 2I54A 2VHWA 2CNBA 3H7AA 1K7XB 3JQ9C 1JVNA 2V0GA 3C87A 1XVTA 3A1UA 4B2IA 4MS1B 2F9MA 4Z1MA 4EKNB 4CEJA 3K2QA 3GJ3A 1EGMB 5FNVB 3VA7A 3K71B 3G9QA 1KH2A 2W6JD 3TLGB 2QRVA 1LI7A 5FUWA 1BG6A 3TZ6A 1QYIA 5AKEA 2CUNA 1L4MA 2PD6A 2JBKA 3PC4A 3URKA 2WJ6A 5GZ1A 1PFYA 5B3LA 1XLUA 4PQYA 2WG0A 2ZYIA 3H18A 4U3JB 3IP6A 3DHYA 1L7NA 3GVHA 4Y2TA 3DPUA 1UWKA 4R5HA 3A4IA 3UQZA 4M36A 3PGVA 3RVPA 4RPCA 1EGVB 3EGDA 1VKJA 2Q99A 4W1SA 2P7HA 4O2BB 3NHRA 5GOTA 3FCCA 5CJJA 1ONSA 1UKYA 1P7WA 1PT8A 3OSUA 3WO1A 4PLGA 4XDGA 3RTBA 4EHBA 5HE8A 5AHRA 3UK7A 3G5UA 3OKPA 3B6IA 3U7RA 3X1JA 2PUBA 5BUSA 4OQPA 1A9PA 4P86A 1JHUA 1L9XA 2A14A 2ZREA 3V7NA 1N32B 3C24A 2DPGA 3SI7A 1TAUA 2O9JA 1OCEA 3A2KA 2YTZA 2I1LA 2HL6A 4MUYA 1BS2A 5ER9A 2HUPA 3ZTTA 1L8QA 4QBFA 3LX8A 4AN1A 4KWHA 3QKIA 4C01A 3WIBA 1NI3A 1XZGA 2XQGA 3W90A 2RH4A 3D8SA 1E2FA 1DV1A 5J2UF 4KODA 1UP7A 5TXGA 4BNZA 2A5YB 4IQ8A 3EYWA 2FUEA 2EKDA 1BKYA 1KY3A 2R7KA 3E22A 4ZJUA 4R3UC 5CMLA 1YQTA 4M9ZA 2PLNA 1H0HA 3L01A 1OA0A 5BN5A 3UJ7A 4MR9B 2X2PA 5I9NA 2RD2A 4RPKA 1KRWA 1Q1EA 3FXAA 1IMJA 4JZ0A 3CEJA 2C82A 4OUDB 1TLFA 4X1KB 1E4YA 1N0UA 4L8GA 4XQEA 3H5TA 2XF2A 1W75A 4JODA 1P3JA 4EBFA 3TIFA 1I6LA 3WLQA 4EZEA 4WKNA 2OXEA 5JJBA 3DFIA 1ABFA 4Y0AA 3IPLA 2K2WA 3LFHA 5KTTA 3MCVA 4TLAA 4MEAA 2DKNA 5CFRA 1HBJA 1PZHA 4V24A 1EBFA 4O1IA 4AWAA 3R5TA 3U61B 2MSNA 1SEVA 2FWMX 2OR3A 4CMBA 2FDRA 2VAWA 4Z2YA 5TPWB 4CR8A 4OHFA 4U3JA 2XDYA 5DTRA 4DUYB 2XEIA 1SIWA 3GDOA 3JARA 4G9GA 3OTGA 2YWDA 4N3GA 3ZDBA 1NMQA 5DRTA 5KC9A 1DPFA 2GUGA 4GLLA 3PFBA 2ECFA 2ILTA 3M6FA 1AKYA 3PHBE 3OFVA 2HDOA 1B2RA 2WF8A 2ZUUA 1UBHS 3QYAA 3SKXA 2R00C 3WKAA 4C08A 3NIBA 5BWCA 3AVOA 3FHLA 5D00A 3SYMA 2FPKA 3BMOB 1TZKA 4C9VA 1U0HC 3WSWA 1ZSVA 3EARA 3I01A 4JWTA 1YB2A 3L8HA 5FTMA 1CR2A 2NVBA 2Z5GA 5HTOA 2UVQA 2O2XA 3PU6A 5BO5A 4FSXA 2XTZA 5K6AC 3K1TA 3TW6A 1U7PA 2IHZA 3PXBA 2XR1A 2YVUA 1ZGGA 4GOOD 1I5OA 5EESA 3DFMA 1N6OA 4JBXA 1PTJA 4U6SA 4PG6A 3OC6A 3L1IA 1CW2B 4PZ9A 2XZDA 1D7OA 3E48A 4OTZA 5CHYA 3PT5A 2A0UA 3EG5A 3I9LA 5DM0A 5ECWA 1Q74A 5TT0A 3W9UA 4UOZA 4EEZA 2CHVA 2P5YA 1T5BA 2YBEA 1LH0A 4E5VA 3CLTD 4A6EA 4LZLA 4UNPA 3ISTA 1U1IA 2BP7A 4MGIR 1J8VA 1BEUB 3K0BA 2WIFA 1NASA 3K9QO 1WMDA 4NABA 4RD6A 4XLZA 1JXAA 2WUEA 1E6CA 2RAVA 4LTNA 1LSSA 1FJHA 4N5HX 1CIVA 3S6JA 5CVUA 5K0JA 1PJ8A 1MXFA 2VNJA 1MB4A 1ULZA 3H9CA 3I45A 4RZSA 3C8MA 2JAHA 1LRJA 2Y76A 1GL6A 2O3UA 3HXPA 3ILSA 3NP9A 2VRCD 3QYJA 4R7GA 3IQZA 2FPGA 4LYGA 3GNQA 2BGRA 3WQRA 4F1KA 2NO1A 1CEXA 4XASA 4LZOA 4MQ5A 1SVLA 2GF9A 3C3DA 2QNBA 4LISA 2Q9UA 1G3QA 4MI3A 4IHJF 4BLSA 1BIFA 1NBOA 1OKKD 2VTEA 2FWAA 2AC4A 4N0DA 1I3NA 2P5UA 4J0IA 4G2NA 3CCBA 2NU8B 1HC7A 4N8DA 5KTOA 1TECE 1TUBB 2QK4A 1UMBA 2O05A 3U56A 2UXCB 2NZ2A 1CNFA 3BGWA 4ZRDA 1NHWA 2Q8PA 4FS8A 4O0LA 4UDYX 4BXOB 1P5FA 4OGLA 2V1UA 1UBEA 1TJYA 3EFOB 1W2WB 5HIAA 4YRIA 3G5MA 1G2IA 3QV2A 2E55A 5JAQA 3KSBC 3AF1A 4DTCA 2CJWA 5CLGA 3OEED 3SPXA 3L6RA 5F5XA 3CT6A 2J9RA 2G71A 5DJ5A 4MW7A 1T1JA 1EUQA 1I10A 1RXEA 1TFUA 1MMFB 3PL1A 4FEAA 4HGPA 4Q9JA 5CIWA 4J3FA 1PO7A 3ER8A 4FLFA 3CT4A 1EXNA 2YVAA 2BGUA 3JRNA 3TR0A 3K6SA 1MTOA 1LDEA 3IUJA 1UAAA 1L5HB 1XQ1A 4DIMA 5DMXA 1NN0A 1TJPB 1Q22A 5A06A 5LA6F 3TPFA 1SA0B 2C0PA 2P68A 1ZNWA 4MLCA 5IJ0A 3FZNA 1U4SA 3IEUA 2VDJA 3NATA 3SXUA 3O4IA 4YMUA 3S2IA 4AY6A 2QYHA 3CRZA 3CU5A 4PNEA 4ZCTA 4PLVA 4CLDA 1NXQA 1PV1A 2W6PA 4RK0A 1E2PA 4ZHQB 2H65A 1IJKA 3Q5GA 5CVJA 5BN4B 2Q1XA 1J5EB 1G6KA 4D41A 1UJ4A 1OZHA 2YQ5A 4IQ4A 3DP9A 4KHZA 2XNDD 1CZKA 3QMPA 1ZK3A 4Q3AA 1IVSA 2ZS8A 1XZKA 2QHXA 4YP5A 1Z88A 2YZ7A 3ETNA 2VYNA 3HKDB 4H9GA 1I0ZA 1M66A 1PN3A 4MJLA 4MUBA 4U5QA 1GNRA 3VSDA 4BNXA 1QE0A 1EZAA 5I7UA 3CLUD 2OTCA 3ISVA 5A4KA 1J9GA 4QHTA 2HREA 2Z2ZA 1PE0A 3GROA 1KI1A 2WYWA 4DCNA 4RNCA 1NDHA 2H4WA 5COBA 3CTPA 3PSHA 4ZV9A 4L6CA 5I7HA 3GQBB 3EAGA 3OQHA 5F09A 3D9QX 4LCJA 2FPMA 1H9CA 1JF8A 1R2QA 2O2ZA 3DBRB 5K8JB 5AK0A 2I8LA 1TFRA 4WBXC 1PL6A 2RG1A 1S6YA 1AKRA 2VWHA 1F06A 4HQKA 4DADA 1DBVO 2GD0A 1D8TA 3IAS1 3HDJA 4J7UA 3SOPA 1JKFA 2C7PA 5JHGB 1C2TA 5AKZA 2GM9A 2W8BA 5JYCA 3K6KA 1CQJB 2Y27A 4E03A 5ITWA 5KC8A 1JAIA 2XNHA 2JLAA 1CJTC 1TQ8A 3Q85A 4YS6A 2YVQA 2CY0A 3THWA 3B8EA 1Q3TA 3ND6A 4OCZA 4D8WA 3KPVA 1XLVA 5MN6A 4XWWA 2HHHB 2YV1A 1CY8A 3V9AA 4HRAA 2FI1A 2ZSDA 3NHJA 4R2MA 5JVDF 3W8FA 2QAGC 2IS1A 5LIPA 1XZEA 3GJ7A 1N5OX 3OWHA 4JP1A 1IE3A 3V2HA 3PX3A 1B0UA 1N2JA 4UMDA 2XXAA 4J90A 1L5SA 2NV2B 1TC2A 2FLWA 4ND4A 3ZY3A 1E3MA 3AHGA 3BK7A 3PJGA 4P3YA 5HQJA 4AULA 1LA2A 4C06A 4LXTA 2SBTA 3L1UA 1EFPA 1GV1A 4M1KA 5ALWA 2AJCA 4K1XA 2FW1A 4KSBA 3KSMA 1GKLA 5BOVA 1P6QA 2J3KA 1DRWA 3QMVA 3GI1A 3KLNA 2BEUA 4GMKA 4OXQA 4YPFA 2FR8A 2AN4A 4CLHA 1NXWA 4NPHA 3MC1A 5IXYA 3AL2A 3SNHA 5JZVA 1QNFA 2B4TO 4M9UA 4NBSA 5L3SA 4M7OA 4OXRA 3TLZA 1CB7A 3HL4A 3M9XA 3WBJA 3F46A 5JEDA 3DDOA 4LYFA 3ZWWA 5A9SA 1EHCA 1F4PA 4XFKA 5AKLA 1QX4A 3FBWA 2GLUA 1BA2A 1DMRA 5DI3B 1Z2CA 4KWCA 3NDJA 1ZJ4A 1AUVA 1L3IA 3JTMA 4COKA 1DBSA 1GVNB 1I2DA 3PNVA 4H1HA 5EKXA 2GP4A 2NAFA 1AHPA 1RLMA 1NF8A 3GZNB 4XLTA 1AHNA 3QP9A 3PICA 2W42A 3F6SA 1LF0A 2H08A 1Z0UA 4HNRA 3W8NA 4AO6A 1GQRA 2WHPB 1MV5A 1OX5A 4ENUA 1OD6A 3BX1A 4S1NA 4IIJF 2XSZD 5CITA 1MCZA 1CXZA 2OV4A 1HDYA 1A27A 1PQUA 3A9CA 4JT9A 3M9WA 1QR6A 3RUFA 2N3ZA 4DSAA 4MVJP 5BW8A 1FJ2A 2ZUVA 1T4CA 1HDGO 4B4KA 1XTIA 3H83A 1BEEA 3T4UA 1JHPA 1WVIA 3T7SA 1J3LA 4YLEA 2HHLA 3VR6H 3HLTA 4O59O 4YP0A 5JSHA 4HAXA 4EWLA 3NYIA 1E3QA 3T9EA 4NG5A 4EL0A 3CRMA 3HMKA 2GD1O 4RMHA 5CT9A 1Y8QB 1MPTA 3AWIA 5FD8A 2W8BB 5B6JA 2V74B 1V8OA 3H1PA 1OGIA 4P4FA 1WB9A 2YWJA 1A4XA 4B34A 3NFRA 4UAGA 5FFMA 5DHTA 3FTQA 4FBGA 4MLZA 1IHXA 1G20A 1XTSA 2BM1A 1FLAA 2EFYA 3KZ1E 4UHKA 5IK2D 3RSCA 1EWTA 1EBBA 1S4MA 2IXGA 2C4MA 1M2EA 2HU8A 5ALXA 3KEOA 4W4TA 4Z9BA 1QKIA 2ZI5A 5C8XA 2A1IA 2BHTA 1I1QB 1V9LA 2PUJA 3I3SR 3AR8A 1WCWA 3LBIA 2DBVO 1TO1E 1VC2A 3DZHA 3KU1A 2QMQA 2QV7A 3CH5A 1U04A 3JQRA 2W4QA 3OZRA 5HFJA 4A5SA 4ALKA 3KAQA 4XWTA 1YAHA 4EPTA 1IU9A 1DIRA 1H66A 5EQTA 1HFEL 1DJMA 2WTEA 3E7DA 4C99A 2W6QA 4I6GA 1XYVA 4D9JA 1PR2A 2NT4A 4H0CA 2L19A 2O8DB 5JCJA 2BZGA 2O59A 1MQSA 1UT8A 1ZNQO 3I6QA 5LA6B 4H77A 3S7ZA 1ID8A 1GR0A 2PKQO 3CZAA 3MUFA 5K99A 5L6LB 1NQ5A 2DHEA 2WYHA 1HNXB 4LUCA 4TGLA 3VKFA 1FE8A 3HP1A 4B48A 3PDJA 4Q7EA 1PSWA 2PSEA 1SAYA 3QVTA 4ZVRA 4BASA 4JLUA 3SR4A 3W79A 5HG0A 1Z3CA 4HH3C 2V0CA 2IIVA 4N3CA 3G89A 5JIBA 4C9UA 4OHYA 2EG9A 1DOHA 2DSNA 3HCPA 3LUJA 4MVCA 4LX0A 1QH1A 2R8YA 2BKEA 1KC1A 2P1ZA 4L6IA 4ENQA 2XWQA 2C98A 1K98A 3ZVMA 2G6BA 3GIWA 1IUKA 3GJZA 1DDGA 4XD7D 2ID4A 2AW5A 3R3JA 4KXWA 5T6MA 1FX1A 5AXCA 4HDQB 2ST1A 2Z1NA 1K7YA 5CLQA 3GA5A 4BVHA 1YA6A 4HVTA 3OIVA 1M0TA 1ZN9A 3DTVD 3QGMA 2GRUA 4EW1A 3UUWA 5LQKA 4V1CB 1UZLA 1R9NA 4D99A 1ZJYA 2YW2A 3LF1A 4N3NA 4HEQA 5CPBA 3OBIA 6PFKA 1DBIA 1JSRA 3R9XA 1E6KA 1KBOA 3QUTA 4HLUC 4Y2UA 4DLKA 3ANMA 4K9QA 4HS9A 3UJ8A 1I4EB 4IEFB 1WMFA 2D5LA 4LXGA 2J8ZA 5J5VA 3OLYA 3RASA 4N0QA 5KKAA 3A28A 3RRMA 3QVUA 2AX4A 4AX8A 3C3KA 4D5GA 4HNVA 3H84A 2GF2A 5BN1A 5EHZA 3T7KA 3O94A 1PG0A 4EKGA 1PGNA 1XB2A 4LQCA 4BJHB 4D74A 5HX7A 1Z22A 4LZAA 1UBMS 1SOWA 1YU6A 2J6BA 4UPEA 4YJDA 1P5JA 1JYSA 2PR2A 4G0OA 3EZXA 3TB4A 2QMOA 2RHMA 3SEAA 3L9XA 4G5RA 1E4OA 2VUUA 4PSDA 4I5FA 3DDUA 1NVVQ 5HUQA 1VLMA 4LOJA 3CW2A 2AHOA 5BMVA 2HTEA 1E2LA 1WLYA 3LKVA 3O21A 3O3NB 4PLCA 1P0MA 2B34A 3U7EB 3U1BA 3VUFA 2P9JA 3EXHB 1IY0A 5AXDA 1K0UA 4K86A 3V8NA 5EHXA 1FQJA 3C7CB 3P71T 5BNFA 4NHOA 3EXG2 3L8DA 1ITZA 4UW9A 4E07A 5F2OA 1T1GA 1OBVA 2GD6A 2IK8A 1HURA 2M1ZA 2HEGA 3AGPA 3LCUA 4S24A 1L5NA 3WYGA 3R3HA 2J9XB 3AVWA 1LPSA 1QWOA 2RGNC 4JR1A 3L77A 4EY4A 3O4FA 2EGGA 3AR5A 1P31A 5E6RB 3HK2A 3NTLA 4DXAA 2RI1A 1GGHA 2ONJA 2AJTA 2YOHA 4FJ1A 3PEUA 2QD3A 4CKWA 3PUYA 4AS3A 2BUBA 1HY3A 5CEEA 1VL2A 4MX8A 2I62A 1SUWA 2ZSAA 5CB8A 1ATZA 2JFYA 5DVZA 2C0CA 4ZXFA 1IN1A 1PS9A 3GCDA 3JQCA 2EXXA 4G1CA 1EM8B 3ZTWA 4OKSA 1Q95A 2QPLA 4ZOEA 1ZSYA 3EQ9A 4DR7B 3WG9A 1YE5A 2J6IA 2ERXA 4GU5A 4QREA 3PXEA 1WO8A 4NI5A 2H4FA 1T0PA 3KOYA 1JLHA 3GUUA 4PTLA 4AJJA 3REGA 1KY2A 3IXQA 3HEMA 4PRZA 1NVMB 5K51A 4V03A 3T7RA 5CPFA 1GZDA 1M7GA 4BP9A 3AJDA 5HKAA 4Z3DA 4GOLD 1VRVA 4Z53A 221PA 2ZRDA 4IQFA 4UATA 1D1PA 2ZIXB 4WFKA 4YRNA 3EGVA 5K3EA 4COBA 1MC4A 4H31A 2A84A 4FFBA 2B1GA 1KU0A 2UVDA 2ZROA 1MGPA 2PLRA 4XIIA 2HV8A 2NTJA 3FJ1A 2O6LA 4KYIB 1MAWA 2R5WA 3P27A 1QYXA 4GMDA 4QG7A 4XPZA 1CIJA 2V7UA 3V4PB 4OPMA 2UU9B 4ND3A 1Y3IA 2BGTA 4NS1A 3Q8XB 1YK1A 3K31A 3K9GA 1JALA 2CJYA 2UYGA 1ZNXA 3FLBA 1WZCA 3W7VA 4QM7A 4M1SA 3TSCA 3N58A 3LHFA 1KDPA 2BI7A 3LY9A 2JGFA 3HJRA 1HG0A 4S0XA 2BDTA 2H51A 2H4ZA 3B12A 4K7JA 4RADA 2K7FA 3IIIA 4NKRA 1YUBA 3QOXA 2O8CB 1BFDA 3FKSD 4K9PA 1L4HA 2QTWB 4QGFA 1K4MA 3MJTA 3B2QA 1ECFA 2GLTA 5JCZA 1X74A 4Q9AA 1IZ9A 5CB4F 1CQIA 4E5SA 4Q1AA 2J3JA 4C4XA 5T3UA 2I76A 3ENWA 4U7JA 4CW7A 3FRJA 3Q8LA 3UAVA 4KW7A 1G98A 2XMDA 1II9A 3O9MA 1T6XA 4DQKA 4G24A 1OU4A 1PZGA 3I1FA 4HH0A 5L3QA 1AXRA 2QYSA 2WWHA 2ODQA 2BSAA 5AK5A 3VNRA 2H2GA 3P4YA 4F3KA 5B7NA 3LM8A 4IXMA 5ADWA 5B3KA 5IJWA 1CK4A 2A5FA 2A7QA 2FG5A 1NYRA 3K73O 2ZDHA 1E98A 1CZRA 4OQQA 1UINA 2D7DA 4LJKA 3F4LA 3K5WA 4JL8A 4BS9A 2GZMA 2PMWB 1PEYA 3SE0A 1UZUA 2JAQA 3F49S 3KU4A 4JZYA 4S3MA 5JFOA 1E2MA 5T57A 1AJEA 4RPLA 5CG1A 1PBNA 2WWGA 4C14A 5EMMA 3C3BA 3F73A 1L7BA 3SJXA 1TF2A 4OMDA 5ILGA 2OHOA 3C8UA 5C4MA 5IJ9B 3A2NA 2AC2A 3NBAA 4CQMD 4ETWA 3I8XA 4UPVA 1ZI8A 1CTQA 1K5HA 3V5NA 1CLEA 5J3JA 3BFKA 2IIQA 1KZHA 3IERA 3IEVA 2XBLA 5H9WA 1FNBA 2R68A 2ZRFA 2MT9A 1YZNA 3GH3A 4UM5A 5ALGA 1GFSA 1QX3A 4GBGA 1NMXA 5K4AA 1XVIA 3ZHYA 3MJVA 1JB1A 5A04A 3T1OA 1BXGB 1PUJA 1BHO1 1KR5A 4FGWA 1YQXA 2GBLC 4C78A 4WBSA 2CJFA 3I52A 1AKVA 3L4BA 4RMNA 2LCIA 4OJYA 4WKPA 4YTEA 4J0JA 1YIDA 3ZZMA 1U81A 4RTKA 3GLGE 1FDIA 1HDIA 2XGOA 1U3FA 3CC8A 2B0JA 4JLKA 1C0LA 4M3NA 2QL9A 4YDHB 4E33A 2V7GA 4WZ6A 2ZYAA 3ZBPA 1Y0BA 3M6XA 1WMBA 3OF3A 4CM8A 4MCPA 1LC0A 3M5WA 3W8RA 3CRVA 3AVUA 3F67A 4AJEA 2XUOA 4AIRA 4KL8S 4DCCA 2HK6A 1E9FA 1F2DA 4LHWA 3ETGA 4PNHA 3LBYA 1IXKA 4IEIA 5ENVA 3P20A 3RD5A 4CE6A 2R0QC 4KVAA 1CPYA 4BVEA 3M7IA 3E18A 3IKJA 2D5AA 4G01B 4I50A 1QAOA 3PRJA 4DIDA 1V48A 2WWYA 3O2JA 2DWOA 2YFYA 3TW8B 4LMRA 1AD2A 5H3LA 1ST3A 4J91A 3NC0C 4H1WA 4MVJI 1OXXK 3FWPA 3PRKE 2X9NA 1QHGA 2RGUA 4C22A 4WXRA 3DO5A 2QRJA 4JC5A 3ON5A 1OX6A 2IYXA 4PSKA 4PZCA 2W0SA 3TR6A 4EFNA 1YFJA 1VCHA 4BZWA 3HSYA 1UP4A 1QCYA 3RANA 3GJ8A 1E9BA 1VL5A 4ARAA 2I7VA 4KMRA 4W1PA 3FMPB 3G5TA 4DCTA 1YHNA 2FPUA 1WUYA 3ZU4A 1R15A 1V3UA 3KKQA 4WOBA 3QSYA 2K5UA 2REXB 2EX1A 3BSYA 3QSGA 4CI0B 1YVPA 5AW5A 3BCUA 1RTKA 4Y9DA 1KFKB 4MKRA 4C89A 1PWZA 1IOWA 1Z6PA 3DOCA 3PWKA 4EF5A 3NFYA 2ZYRA 4NBTA 1X14A 1KZ6A 1W46A 5HF5A 2Z1MA 3DS8A 4A82A 4LRSB 4EVQA 1T3SA 4HRYA 4S12A 1RQPA 5JVDA 3E22B 2BTEA 2CMHA 3A6LA 1UPTA 4OHXA 4GI2A 4GT1A 4D8TA 4NGRA 1O97D 2BR5A 4FN4A 4KO2S 3JVIA 3D3QA 4E5UA 3RHFA 4UTRA 2X6RA 1FS6A 4HVLA 3C3YA 2GM3A 1XR3A 2NPOA 1RXYA 3L8MA 4JB2A 4RS4A 4ZI2A 2D06A 1L6IA 2N9UA 4U6QA 3H4VA 5LL6P 1AS2A 2JD0A 1Y8AA 1Y4DE 2B69A 1AGXA 3N86A 5FI0B 3SJ7A 5AIBA 4JU8A 5L3SB 2A9PA 1QO7A 1D4AA 2LD4A 4I9NA 4M0PA 4R2WA 4TTJA 3BI0A 3DLCA 2FDXA 4QPCA 3ANTA 4Z7QB 1L4YA 1RCUA 1YRAA 4XR4A 5BUQA 1XMOB 3BA6A 1FTNA 3PQFA 1ZM3A 3UANA 3MXOA 4JITA 3G0BA 4JD5A 3LL7A 5L8VA 1AUQA 2R8EA 4L73A 3PIRA 1SXJA 1DO2A 1ZP6A 3CEHA 4A92A 1KEVA 3AFOA 1MAVA 2JGRA 4MR9A 3AZPA 1FLVA 5I4IA 2OILA 4LV6A 1C0EA 3L04A 3V1UA 1SXJC 2PPLA 3ID6C 1CFZA 3H0CA 4MS4B 1ARZA 2HRCA 5M2QA 4PO3X 4Y1EA 5ALKA 4R01A 3GLFB 2B5VA 3K7EA 3QVVA 2QV0A 2ZEJA 1Z7WA 2O52A 5JNTA 4JLMA 2E21A 4YJ3F 3K8QA 1Z82A 3I9FA 1WSWA 3H4MA 3L0DA 5U9CA 4PU0A 3CZ9A 4QECA 3N3AC 3RSGA 1LLDA 3TSWA 3W4KA 3THWB 3HABA 1JHVA 2CB0A 3ILVA 4JVLA 5HEKA 4D96A 3THYB 4HYEA 2E28A 2OESA 4KMMA 3WB1A 1DT5A 4FDLA 5JYDA 1EM6A 1SVIA 2ATEA 3O8CA 1NG9A 4XW2A 5DM70 3JQ8A 5IKPA 3DD1A 2VUHB 1Y7PA 3DTVA 4D7AA 4RKFA 3LPDA 1DXHA 2C5LA 5A4DA 5CB4B 1UJ5A 2PWZA 1Z62A 2GVZC 4YRCA 2BGWA 3CVOA 3WMRA 5GVSA 3AVVA 2CNWA 1PL8A 2GASA 3NIFB 1BTOA 1YOVA 4M87A 2IE0A 4R54A 2C8JA 3JYLA 1UK9A 3H2KA 3K5HA 4CF5A 4HZGA 1IN7A 1RLIA 2C1XA 3F3MA 4M9RA 5EP2A 4BO6A 4C6RA 1OC2A 4LV8B 1LC3A 1ZISA 1KDTA 3LXXA 4DA7A 4HDSA 4KITB 4OGGA 1WXFA 4EYEA 2HDHA 1LNZA 2VQDA 1U65A 4YUXA 5L40A 1NHGA 2LZ0A 4HDMA 1YB7A 3PUWA 4ZRNA 2LIVA 2C5AA 4MDFA 4L5AA 3EMKA 3QX7A 1Q1BA 4M7PA 4BWVA 3ACDA 2CUZA 4AUEA 1FIUA 4NTZA 3RYCA 3RVQA 1XX6A 3I0MA 3WWOA 4ZMBA 1F0NA 1JPVA 4U7DA 2X22A 1J1UA 1BDBA 4O8CA 1D6SA 3EOBI 2VZ0A 3G0DA 1OF1A 5C37A 2GHIA 1XFAA 5KOHA 3JALA 2JFGA 3C14C 1U2ZA 4X6YA 1TU0A 3PUHA 2IYNA 2FLKA 2I7CA 4PC1A 5EKUA 4ZAWA 2G9RA 3GRRA 3GRCA 1HT2E 2ISQA 3ZC3A 2Q50A 2A92A 3CG0A 4J75A 4Q18A 1GA1A 4B82A 2BFBB 4DKJA 1G5TA 2I29A 5F9FA 4NFLA 4YRGA 4IOJA 2B9EA 4QVKA 1JQJC 1RC1A 1E5QA 2CWDA 3PA6A 4OF4A 5K3FB 2XDQB 1USUA 4RA6B 3ZXYA 3BM5A 3TPCA 3OJEA 3PR2B 3ZCUA 4ENWA 4QUAA 3B8HA 5IAJA 3I2GA 1CVIA 2Q3HA 3N8HA 1WF3A 1U0LA 2IEGA 4RK6A 1BDIA 2CJXA 4OH7A 4L9RA 1VA5A 4CDRA 5AVZA 1IN8A 5F4ZA 2NZJA 1Z07A 1T9DA 1QUEA 1ELOA 4S2EA 1IPHA 1NJ1A 2OSVA 3R5FA 1IATA 2WF7A 4P6VF 3F97A 3B9QA 4D9KA 2HD4A 2WAYA 4DAOA 3PDIB 1EK5A 1R9GA 3OH8A 4OUKX 5FORA 4ME6A 1UMBB 5IASA 4GLOA 1Y8QA 5AT1A 4DYHA 3BE6A 3IAXA 1XMJA 3VRHA 5HSGA 2X6QA 1GKYA 1RS0A 5JD6A 3DLTA 2EL9A 2IF2A 3RUEA 1P2BA 4GNKA 1XUOA 4GOMD 4MWBA 5KI6A 3HI6A 1GPBA 3RAGA 2O2HA 1Z6ZA 5BXYA 1TYZA 1VPEA 2EZ9A 1A8IA 1COWA 4ED9A 1X1CA 4TMVA 2C84A 2P4EA 2Q5FA 4WX2B 4HBGA 4LRUA 4BFZA 1VG8A 5AUPB 4Y9SA 4R8KA 1Y3CE 1CP3A 2H4YA 3UAYA 2G36A 1A5ZA 4B35A 1RSZA 3HR7A 5FWYB 3SZRA 4J0QA 1GO2A 2JLVA 1L7RA 2O2CA 4K9KA 1KOJA 2YJTA 2FE4A 4C2UA 4JMLA 4KWIA 4NFHA 4U2EA 5J2TA 5A9RA 2WAAA 4R9RA 1ZIXA 3IIJA 4NESA 2BFFB 4PQGA 1Z5ZA 1DC8A 4RUKA 5E8JA 2D00A 2WJJA 2WKWA 3ESAA 4HI0E 4F2HA 4NGTA 5LMNB 2XUGA 3H3XA 1BSVA 3Q88A 1USGA 3D4LA 2FZ4A 1D2CA 2PLFA 3HH8A 3PFHA 4UBIA 2VJAA 3BD8A 5JSQA 5KINB 4P3NA 3SHWA 4MNTA 1I6MA 2C9BA 2FPPA 3IMCA 2WF5A 3AKCA 1UFRA 2JJQA 1JA9A 3AY3A 4BGUA 5IBCA 3HXMA 5BSFA 4PLPA 1BCRB 1NXPA 1VLZA 1E0JA 3NAZA 4IVPA 3M1AA 3TLEA 4B2LA 2G7ZA 2BVNA 2D7CA 5AQ1A 4GGPA 3HDTA 1FTYA 3M33A 1YT5A 1CQWA 4CTJA 3TTSA 1SC3A 1TKRA 2PX8A 2MIIA 1T29A 2FR0A 3QU4A 1DX4A 1VKRA 4OKNA 1GZHB 4N41A 4ZO4A 2QQGA 4V2IA 2ZGVA 5IKOA 2AVNA 1V45E 1Z0JA 3V3TA 4DQ0A 3R23A 4NZPA 2DULA 4RANA 4HWTA 3IUNA 8AT1A 4KEAA 1V8BA 3OQ6A 1P44A 4LFAB 4C2BA 4EI2A 3I4LA 4WXMA 2FW0A 3LIPA 1PT5A 2VDRB 1H5QA 3KTAB 1NJ6A 3NTVA 4G36A 4NXMB 4XAQA 3FPHA 1QH9A 1G5QA 4IEEA 5D6NA 3WK6A 3TIXB 3WYCA 1VKZA 4CEHB 2B6NA 5DT2A 4FCWA 2Z6VA 2WWXA 3LWNA 3LX4A 1QONA 1ETHA 1WW8A 3COZA 4ZT5A 5CA0A 1H1LB 2YHSA 3MGAA 4G63A 3O92A 1J2RA 2OCIA 3N7UA 4TKZA 4UQOA 5DSXA 3WHKA 3IVXA 3EISA 1XCJA 3R20A 4LYAA 3RREA 4MCQA 3UB3A 2I55A 3D6HA 5HOEA 4E08A 2FP4A 4D9FA 4IVNA 2GXUA 1QHYA 2HQOA 2O0HA 3G9UA 4JENA 4L0CA 2XCTB 2JANA 1HZZA 2ZG6A 3M3HA 3OD1A 4Q3DA 5D1HA 1JV2B 1P2FA 3PK0A 4MYTA 3FB1A 4OHCA 3EBPA 5LP6F 1NT2A 1RAEA 1YR2A 2CN1A 1NQAO 4BTLA 1Z5OA 4DJEC 4C84A 1YNOA 3EQZA 3JQGB 2QRHA 3OEHA 2XD4A 1P7PA 3ICOA 1DHRA 4L07A 4EH1A 2ZRHA 4WCDA 3FF3A 1EVEA 1MX9A 1NU6A 1TT7A 1ISSA 1U7WA 4I8XA 3I62A 4XUCA 1ZIDA 3AHJA 1G5PA 3DOOA 4CDMA 5L53A 2PX2A 3A9TA 5DEOA 5M3BA 1L1FA 3HR8A 2B99A 2H92A 4V0ME 3I76A 4FYXA 4C9RA 3E2PA 2R8BA 4TQGA 2QIOA 1ZH2A 3W5UA 1ZGHA 4BN4A 1UBRS 4BGDA 3KFLA 5EUQB 2VAVA 4Z54A 5E0OA 1VL1A 2QP3A 4OL0A 1Q2UA 2F17A 2XMBA 2XUDA 3B3GA 3T3GA 5D5PA 1ZGAA 4ZCLA 4X8HA 1X7YA 1EINA 1VE6A 2WSIA 3EIUA 4XQCA 2FEAA 2F8TA 3JWIA 4JA2A 2XOKD 1NVTA 3DL2A 2JI9A 3P9YA 3QU9A 4YDRA 3N5CA 4MICA 3ZGLA 3FMOB 3NBZC 1YA8A 4MRRA 2QNIA 5H7XA 3WA6A 4Q4CA 2RHCA 3HXKA 1MRZA 4IUYA 1DKOA 1Z2NX 4IH4A 1JA0A 5E1MA 3TQHA 2I8CA 3M49A 1WOYA 3SYLA 1U0OC 3GLHE 1XZJA 4AG6A 2BGGA 4MAMA 2WM3A 3C7AA 1KSFX 3FG9A 5CHEA 4N0PA 4XUEA 1XXHB 4MYHA 4MI1A 3DAHA 2VNIA 3ZUPA 2V58A 4UFPA 1RXWA 3S9MA 3EZGA 1RMQA 1NURA 3ICPA 5B12A 3AMVA 4FJ0A 2OR4A 5KTNA 4FZ5A 3HJAA 3NCTA 2XIJA 2ZIAA 1XJWA 5SV2A 1RWMA 4G0WA 3I9KA 4KZPA 1Q7BA 3W2HA 1GCGA 3MGBA 2B7LA 3KE9A 1FDVA 1VBFA 1B42A 4AMUA 3PL5A 1OV6A 3EWSA 1NVXQ 2AN5A 4HWSA 3TQRA 3IT3A 3GLVA 1FRFS 1MLDA 1M0WA 3NR2A 3UPDA 1G2QA 4CM4B 1OXVA 1ONBA 1XCGB 2D5IA 2H00A 3OMXA 3NTQA 2PX0A 4XYMA 4URVR 5KVCA 4J16C 1VKHA 4F6RB 2VSNA 3HG7A 1MAUA 4G5YA 4FXPA 5EVCA 1X1BA 5I9TA 1SQGA 3BTSA 4EYQA 1Z17A 4KR6A 4J7XA 2PYZA 2ZIGA 2H17A 3A6FA 3G5LA 4OHMA 5L3ZA 5TARA 5BWLA 5JXIA 1Q0TA 2NSLA 1NKTA 2J6CA 3CJRA 3WR5A 8OHMA 1NX6A 1JFFB 2AT1A 3NAMA 2BRUA 4IO0A 3KAKA 4L3VA 3FIJA 3HJNA 2SKEA 2RSLA 5FOTA 2C6GA 1S9DA 4M0KA 4RFVA 1HWYA 1SKQA 1B8OA 5KKCA 5KNBH 1JR4A 2BV3A 3NAGA 3HO1A 2WW8A 4WNIA 2G40A 3CKKA 4Q3KA 1RPAA 1E6WA 1FCJA 1W9MA 2Y0EA 2YZKA 3A32A 3ESCA 1EDOA 4QGAA 4XB6B 3SWWA 2Q3FA 1CF2O 3UK6A 4GLJA 3V8EA 1LTQA 5AKXA 5CRIA 2JZOA 3DZIA 3AY7A 1WXGA 2A8YA 1TMOA 1KZ9A 1MV8A 3IWWA 5CLFA 3F74A 5DOVA 2OCDA 1WEHA 4I1YA 1YASA 1PR3A 4JEUA 1YB6A 5CDFA 2ERCA 4X5OA 3LS2A 1G41A 3NDBB 4JP3A 3U3DA 1K9VF 5GGYA 4QXAA 2ZR8A 4TSRA 1N5LA 1JS1X 5AW9A 5HK9A 2BTQA 4Y0NA 3ORHA 2WDPA 2NTNA 3C3WA 4ZYYA 1C14A 3CO5A 2ZLBA 3UXHA 3PKIA 1PT7A 3NWJA 3F5QA 3I09A 3PCRB 5EXSA 1YZ3A 3VZBA 4ARSA 5HVNA 1NVGA 2PD3A 2GOYA 3KEMA 4NOJA 4OJQA 2I2XB 4OQNA 1YCGA 4LMPA 1P1CA 2CDBA 5K4GA 2NUTA 4BHTA 3WWZA 3EXHC 5LP6B 3FTPA 1G8YA 4CCSA 3KOZA 1YTLA 3CLHA 2Q7XA 1XQYA 3AU9A 4RQTA 2NO9A 4XI9A 3MAAC 2Q7OE 5LDHA 2R82A 1T2EA 1KWGA 2X41A 2HDWA 4EIWA 3KHSA 3BMOA 1PJCA 1XEAA 4XM0A 5IF3A 1J99A 5DXFA 1QHFA 2FR1A 4EX6A 3NUQA 1Z34A 3L79A 1G9SA 3WWYA 4CNQA 1K86A 3T9FA 1XZFA 4E6PA 4F2PA 5LM3A 2APJA 2OAP1 1GKIA 2VSOA 3FD8A 3EFHA 1E99A 3GGGA 4YT2A 4ZOCA 4CTNA 1S7GA 3KQUA 1T4GA 2FCAA 2X23A 3C70A 2PL3A 3O4HA 3RYIA 5AW1A 1N1GA 3KTOA 1P2UA 3IVAA 1QZTA 4LG1A 3F4KA 5IVPA 4WBNB 3D02A 3ZE9A 4YP9A 1Y89A 2WM9B 1U98A 1YK0A 3T4PA 1ZOOA 3CR8A 4MVJF 4N0MA 5DGXA 1UXKA 2NYVA 3OUTA 1T10A 2C1EA 1FQOA 4XGIA 3ZW8A 2Q5IA 3NBMA 2PUGA 3DUWA 4L4ZA 3SP1A 1JP7A 3FZYA 2C3PA 2X4GA 4Q0MA 1UXOA 5B4TA 1KIAA 1TKCA 1F8YA 3TUZC 3VO2A 4JLJA 1J0DA 1WB4A 4RL4A 1AE1A 4LE1A 4TRJA 2BGLA 4WDQA 4RZUA 3FAKA 3FCOA 4I08A 4OOEA 4Z0HO 2WUFA 2REBA 3MT8A 5ALUA 1UBJS 4BTEA 2WMOB 1QZ3A 3PXDA 2ECQA 4QASA 5JJCA 2B8NA 4P4NA 3VQTA 1N2XA 3O8DA 4F11A 5GMOA 3UV6A 3ZWXA 1EX7A 3GJTA 1JYFA 5EL0A 3UPUA 1PT6A 1CJVC 3SAJA 1X8JA 2Q1WA 1U02A 1H69A 1GWNA 4KAAA 2BH2A 9LDTA 2XA9A 5EHNA 2I2AA 5EYPA 2KM1A 3K30A 3HE3A 4LHVA 2B36A 4OQDA 4NP6A 5K45A 4TZ0A 1K08A 3MCAA 4WJLA 2G83A 4IKEA 2Y1FA 5EUCA 3OQOA 1XQ9A 3EEFA 4PHCA 3WLIA 2VDLB 3BHMA 4YCAA 2FOIA 4EHLA 4EG4A 3H1GA 1QF7A 3VTAA 3GJ0A 2C5FA 2VDQB 3TXYA 4AY4A 1VG1A 1T6YA 3L7CA 4J0GA 1QORA 1QPBA 2WUGA 4HEA1 4RQAA 1I7SB 3IHKA 4ZVNA 5B58C 5K4HA 5LKAA 5IRCD 3ZJ5A 1CVRA 5FPTA 4WDRA 1VJ1A 2C3MA 2GZSA 3FRIA 3HRIA 3DXYA 1QGDA 3RSOA 5HJ7A 6AT1A 3K0KA 3LFUA 4PYRA 3KFVA 3F78A 3O93A 2AFHA 5SZIA 1KL7A 1KHTA 4WESB 5CA0B 2C2KA 2YN0A 4WZAA 3TDKA 3L0IB 3VH2A 4P4BA 3ZDXB 1EX9A 3H05A 3QVWA 3IQIX 4ZT2A 1RQXA 2EWWA 1GPWB 3E7FA 4ER7A 3S7TA 1P29A 3ZS8A 1W0JA 4ISBA 2ID7A 1G9XA 2G28A 1DJOA 2X5JO 1YRQA 5DP1A 4QDUA 5IDQA 2F3SA 4EYSA 1C8LA 3UOAB 4D98A 3K32A 1RYDA 5IZCC 3DXFA 2I91A 2NSJA 1J5XA 4Z6KA 3HZOA 4KO1S 2A94A 4PTYA 4D4IA 2BUCA 1JJBA 1GQ2A 3BQNB 4WLUA 4AO8A 1BMTA 2B94A 1EQAA 5BVGB 2V59A 1XTZA 2G04A 4M0UA 5JPCA 1U5CA 1S3GA 1H2RS 2DHCA 4Q82A 1ODLA 2D0OA 4R8VA 5AMXA 5FV7A 5K09A 1RRMA 4NMXB 5HOQA 2QVBA 2R8PA 3VKVA 4LNUB 2O23A 4AJ4A 2H85A 2X0DA 1D9ZA 1WCXA 4ZU3A 3QOYA 5KTSA 1QIJA 3DE6X 1QDEA 4N6OA 2C77A 1W5AA 5EY5B 4WGGA 4B9AA 3H19A 2JDIA 1X87A 2DR3A 1YB4A 2NPIA 1C2YA 2BFDB 1JKMA 3CW8X 3I12A 3MAGA 4HB3A 3H9GA 4JB8A 4XYBA 1OBFO 2HA5A 4RIGA 2Q3LA 4MUKA 5CP8A 3ELDA 3I2JA 4QOIA 2EJUA 2BOVA 4KPFC 3PYXA 3WK9A 4PQEA 4CF3A 2CHQA 4ZO7A 4AJ2A 3QM1A 4GYKA 2VDOB 4BJ6A 4A7PA 3PEFA 3EZBA 5JROA 3CWQA 1LPNA 4PYNA 3DFFA 5KS2A 5L3QB 3L8EA 1PLLA 1QHNA 2PRYA 4CMKA 1IZ0A 4L27A 3ZX5A 2Q9CA 1OFGA 3D1JA 1NJ5A 1NRWA 4TYPA 5LZ8A 5TQVA 1O4VA 1GPDG 2P1DA 4X20A 4RW0A 5E3IA 1CEEA 1KQ3A 5BQ3A 4JQCA 3T0IA 1SZDA 3HJFA 4JLDA 2FXIA 3U3RA 2JC3A 3GK3A 4WMLA 1IM2A 2OORC 4GVPA 2FMXA 2QG4A 1DJLA 4PNZA 4AF8A 1XPOA 3VFDA 3KHTA 3FF1A 4P36A 5D3ZA 3WVNA 4DLAA 3WL5A 2CZGA 1VMIA 4YFYA 2GK7A 1CNEA 3LY7A 1BMQA 4Y6SA 3OQIA 2XMGA 2A0YA 3B1KA 4B6SA 1O6ZA 3MG9A 1EJBA 3NOOA 1G0NA 3GFVA 2ZRKA 4X7RA 5EP4A 4LFCB 2ADFA 1LY1A 2KI5A 4BMVA 3V4OA 4I55A 4N49A 3SM3A 1US8A 2MYUA 5IZCA 4OX9Y 2IY7A 1GDTA 4L74A 4PX5A 5JXGA 1GXSB 4KUEA 5TLSA 2ZRPA 1M75A 1QFSA 4KYUA 4QARA 3D8HA 3T35A 1D0IA 3A26A 4MVJA 3T4XA 4D8YA 2RE8A 3B7PA 3K6RA 4US0R 2HNAA 4OBWA 3ZCSA 3D5TA 4P3KA 4DZTA 4F8EA 2IP2A 1NV9A 2V8BA 3ZBQA 1VKOA 4EKEA 3EPLA 3PNQA 5CFMA 4XWKA 1TAQA 2BM8A 3ULKA 4JJZA 1E92A 4NCIA 3MTIA 2POQX 1RYMA 3E0QA 4BKOA 1H4VB 2AD5A 2W83A 2DG2A 2V97A 3L6DA 3B6JA 4XDYA 3SC4A 1F1JA 2AMVA 3L4SO 3T9AA 2PRSA 5K3AA 5DN6D 1N36B 2UZ1A 4EG3A 2XEFA 3WRXA 1G7SA 2VJDA 4IWNA 5TJHA 2B8TA 1KOLA 5D87A 3RF7A 3QBTA 2GKGA 1TPYA 1ADGA 4KIUA 4HG2A 2BFWA 1I4DD 4HEA6 1N2CE 2WJGA 4C6TA 4DMHA 3EGXA 5KJCA 4CQMB 1IY9A 1NE2A 1OWMA 2ZANA 3GCWA 3OJOA 3L7IA 2VZ8A 4RHCA 1C8VB 1IQPA 1NLMA 5FBKA 3UWPA 5LN1A 4ENVA 3QU5A 4HQ6A 3BK2A 1E18A 4WXPA 1D4ZA 3LP8A 2Y67A 4LYJA 3HXOA 2BGJA 3DLBA 3PWTA 4Q01A 4C3OB 1TAHA 2JAXA 3ZVKA 2SNIE 4HN2A 3NBFA 3I23A 2C9OA 3VSEA 4EO4A 1U1DA 3GT4A 4X63A 1RJFA 1HRDA 3B9BA 4TOIA 2Y05A 3ESDA 2CNWD 2GCNA 4DZRA 1O89A 1R27A 1HMYA 4MDYA 3BFVA 4OV6B 1LDBA 2C4WA 4KQ2A 3E9RA 4G23A 1Z75A 1P2GA 4MWEA 4FNMA 3FHJA 3S99A 4P45A 1UFQA 2EZ4A 3LHSA 2UYQA 5IWAB 4CWAA 4PLFA 2CD9A 4G86A 2HPVA 4IXWA 1TTTA 1VBGA 1FYXA 2F48A 3BSFA 4FINA 4L4RA 4C0HA 4EY5A 4QJIA 5HQTA 2C2OA 2W2LD 1Q12A 5BYKA 1J2TA 4BP8A 3NHBA 1BZYA 1FP4A 2Q29A 1Z56C 1SG9A 1OH7A 3D4OA 1ZI6A 4NVRA 2HJGA 4MKHA 3ZV7A 1VECA 4RXTA 4WA8A 1PR9A 1RFLA 1UM8A 1KI2A 3R77A 2IZOA 4GBJA 1F5SA 1VB5A 5AYVA 2Y6UA 3P97A 4R8MA 1KBQA 4DG8A 3KHKA 3MINB 3E61A 3MTJA 1M74A 3UJ6A 3VV3A 2HCJB 3G2NA 1KFCB 2TMDA 4FYKA 4OGKA 2ZB2A 4M1MA 1UPXA 3A7EA 2AR0A 1KJ8A 4LCBA 2GF0A 1M6WA 2FGJA 4LWPA 5BR8B 5GONB 2VPQA 1OV4A 1SXJD 5CT8A 2F1KA 3TXAA 3CXUA 1RKUA 2ANCA 2EV9A 1GTSA 2Z4RA 1UXGA 3CPJB 1SA0A 4K05A 5K0EA 1X9GA 4LA4A 4TZKA 3E2IA 5ED0A 3NZEA 5J5AA 3C2QA 4CRWB 4EL5A 3G2LA 5EZSA 1RXVA 2E4XA 3CR7A 1RI4A 2OOKA 5GM1A 1Y5IA 1K7EB 2FN7A 2QD5A 2FVXA 2JIZD 1SCQA 1JG7A 1QFZA 2GR9A 3D4PA 1XZ8A 1GPYA 1NNSA 3F5DA 3FOWA 3H9BA 3MBIA 1P1FA 5DNEA 1MOSA 1GSAA 2VJKA 5CVTA 4RTNA 3EXFB 2CNKA 2CSUA 4OREX 5SZKB 4RH0A 4QZVA 4H3VA 3O1IC 1ETUA 2LWIA 3LF2A 4IXNA 1H65A 3EQ2A 3X2SA 4H7JA 2X1HA 4M54A 4MW1A 4BU1A 4PIPA 4C86A 5DU2A 4PINA 4A8TA 3Q5EA 2XEXA 1L5LA 3R0XA 3RIYA 3SQLA 3OX2A 5J2UA 3ZV4A 3C6XA 4YCBA 5ALJA 1L2TA 4PFKA 1L1QA 3E1GA 3E9MA 3KYBA 4M2LA 1TT5B 5FR1A 2ONZA 2VAMA 5LA6A 3AB7A 2A3RA 3CEAA 2ZBFA 1YI8A 3OFND 4RD2A 5IU6A 1UDXA 3PITA 1CIPA 1JPUA 1JKJA 1YRLA 1RFGE 4B6OA 3WHPA 2XUKA 4B1FA 3K9LA 2OQRA 3IJRA 2X9VA 1J6UA 3NUGA 1YF3A 3BTUA 4BGIA 2NTYC 1JQBA 2CV2A 3TPZA 1T26A 4PV7A 2OZLA 3ESYA 2PGAA 3AEQB 4FKZA 4GMXA 1G20E 1LV8A 2BMFA 3WY9A 4FZRA 4A1OA 1X6VA 1ZCBA 7GPBA 2FPWA 4HUQB 4DV0B 1V26A 4HO1X 3GBSA 4JGGA 4M6WB 3AR6A 4N3AA 4WAUA 1XRSB 4E32A 3LPCA 2P9YA 3D3KA 4Z99A 3VU8A 4R2HA 4XYEA 4JQSA 3ZQ6A 2BTQB 2BBWA 3V1NA 3DZGA 3K05A 4E31A 3DE7X 2VWPA 1U2DA 5CM2Z 3OU6A 4P38A 4LOHA 3WMXA 4WJZA 5AKHA 1U9IA 1MORA 3QX8A 1D2NA 4JNKA 4C7MA 4GE0A 4P22A 4C7JA 2MSEB 2FXVA 5IVKA 3ER6A 1E5XA 4QM6A 1O2DA 1DC3A 4G1EB 4K6GA 1QZZA 1K97A 1ODJA 3HKBA 4BQSA 3C1UA 4C7BA 1JJFA 1G21E 1D03A 2WPNA 3JQQA 2DBZA 1FTWA 4EG5A 4OGWA 4QYIA 1U8FO 3U4MA 1ZJ5A 1M83A 3O2SB 5CLHA 1HNZB 4M9XA 1JFLA 1NNEA 2G25A 3F9RA 1JDJA 4IVRA 3AW9A 2R00A 2Z56A 2P6OA 5IMSA 3DJFA 2PKCA 3B38A 5EGNA 4EVIA 8GPBA 3ZHSA 2I4NA 3FLMA 5FO0A 5CCXA 4QOEA 2FN8A 3BAZA 2C96A 4LY6A 2ZJ1A 3TAUA 1D2AA 3ZEAA 1NBHA 1Z7BA 4B09A 1E32A 4NBLA 2XYPA 4EJMA 4UNQA 4GWLA 2I2CA 2GBLA 2ZWMA 3DHNA 2IZZA 1MKYA 3DTVB 3WGLA 1A4RA 4ZQBA 1V16A 3LP5A 1QFXA 1VYTA 3M81A 1REQB 1SZPA 2Q62A 2QW0X 2AEEA 3I34X 3KOWA 4Q21A 3RFVA 2J0UA 2HI0A 5HFNA 4AZSA 3ZQJA 5B2EA 3C5HA 1M54A 3TYXA 2ACWA 2LV8A 2LXNA 4J1QA 2REOA 3ZIAD 1DIKA 4ER0A 3QOFA 3SIPA 1O9HA 2YOGA 3BMCB 1QV9A 2WFAA 1R1DA 4QSMA 2AG6A 3KQSA 3DE1X 3X0DA 4FE4A 2O1WA 1TMGE 3DT9A 1VLHA 4CIYA 1NW7A 2H1OA 2FPPB 3OUUA 4PXSA 5H68A 2P11A 4MQLA 2E4VA 3G1TA 1M6VA 1R4AA 4UVIA 4ZK2A 3R5XA 2ZU0C 1DEHA 4AJOA 4B7CA 3PFGA 1VA4A 2WAMA 3A1CA 3BCRA 2BCEA 3FGPA 1JWAB 4EI9A 1E3WB 1PR1A 1X8LA 2Y1GA 1P1HA 3OD5A 1IN5A 1F12A 5FBLB 4AY2A 3RU9A 2B4RO 2JGDB 4HGNA 3B1XA 3IE1A 2PFGA 5BMOA 3RLIA 1PZMA 3EBLA 5CA1A 4ZANA 3P7MA 5FBRB 3ZI7A 3UCXA 1O94D 3BREA 1UH5A 2H16A 4GPTA 5F1PA 4D57A 5JYEA 3C48A 5EZ5A 4UBJA 2XADA 3ITNA 4QEZA 3AHCA 4PRKA 2NZUG 5JS1A 3T3MB 1T3HA 1ZKMA 2CV0A 3UJAA 1Q1ZA 1Z33A 2I3AA 3GEPA 1QMGA 1OMOA 3QX3A 3GGSA 3VNUA 1LSOA 2QBYA 4CTKA 5TB5A 5I7WA 2RI0A 4LC9A 3K20A 3FPBA 5AM1A 3SEZA 4ZI7B 1UADA 1AGNA 2YXLA 3T34A 1TK2A 5J1SB 4YQFA 5EIOA 3X1DA 3ZGYA 1RZRD 2VYFA 1Y4AE 2IDZA 3T7JA 2CCKA 2PX5A 2DETA 3KBOA 4I6JA 1F3OA 3LHKA 3OESA 1U9ZA 2JJ2D 3B6EA 1Y63A 3D4NA 3OCXA 1PJTA 2XXJA 3R2JA 3VVCA 3GAMA 2PZAA 1KO7A 1G7RA 4GOKA 4TRRA 4PZAA 5FJJA 4C76A 4YALA 3MB8A 1M2OB 1IHDA 2ZAOA 1BS1A 1HT1E 1OYOA 3FYSA 4PTZA 5GJWC 4ZC8A 1KS9A 1Z38A 4DS3A 3AOEC 3F2VA 3GZTB 1Z36A 3WYBA 4G1FA 1VRWA 4FOTA 4KACA 1ML4A 1Y1TA 3MCZA 4NSNA 4OHPA 5AVVA 3IAEA 1ZZEA 3BWMA 1C7IA 2C1ZA 3LVRE 4FW9A 4L4XA 4DV2B 2CK3D 2ICAA 4CKEA 2PVPA 3NH6A 2OWEA 2RH5A 3WJ7A 4BRWA 2D2FA 3RSZA 4BQQA 3AEKA 1U7DA 3LBFA 2H0QA 3PSAA 4QU5A 2QTHA 1D3AA 3RYFA 5E4TA 4CV0A 1A04A 1G8AA 4I2NA 3CF4A 1UEXC 3KKEA 3CEMA 3BGVA 3LT0A 4HGZA 4PGHA 4XKJA 4KDEA 4V0QA 5DMHA 1KJYA 5JVDB 1SM4A 1I7DA 1UMCA 4P7FA 1S4QA 3W7BA 4W5HA 4CGZA 1VI2A 4OC0A 3A2MA 1EFLA 5JJ5A 4C21A 1NG1A 1DCTA 1TF5A 3S4YA 3KSZO 4UM9D 3DB2A 1RPZA 4Z9YA 2C7QA 2ADOA 2DEUA 1PK8A 2XT6A 4BNJA 1C7ZA 4FC7A 1FUIA 1Z18A 3WV4A 3OO1A 4EKDA 1C1XA 3BS4A 2CE7A 2H48A 1NTOA 1OR8A 3ZD6A 1N5JA 4L7VA 1SKYB 3GD7A 2P6PA 4YRQA 5FBVB 2R1TB 3GFSA 4L0MA 2Z5FA 4YXWA 4DR2B 2HJHA 2JHCA 4KR7A 4Q34A 5HKOA 3PRYA 3PRHA 3LVFO 4FZ3A 2EZUA 3WK7A 2FVYA 2Y77A 2ZJ4A 4YT4A 5A03A 4AIIA 1RI1A 5I01A 1JT2A 3DM5A 2ZAMA 4GZ5A 1XQ6A 2OG2A 4IMIB 1H2ZA 3O3OB 4GE3A 3VMFA 1I4TD 1O03A 4R69A 3TTTA 1MRNA 3C74A 4WZAB 2B4KA 2Y1OA 3NDIA 4B79A 3WFZA 3HVRA 2UXDB 4M46A 1PVVA 1RJEA 4X00A 4V0LA 2JFBA 1ZMOA 1WMAA 1M5TA 1DZIA 5E3JA 1E0KA 4AK9A 4A8JA 4MI9A 1RM5A 4BRSA 4GPZA 3DYVA 2O0KA 1V5FA 3TLCA 1ORRA 5MN4A 3GFQA 3BWDD 1URPA 2G1AA 1QUFA 1N34B 4M1ZA 3AVXA 1JVSA 2F59A 3A37A 3QLTA 2YWBA 1N5RA 5TE9A 5H83A 3RDPA 2YC4C 1IXYA 1U3UA 3COWA 2R1VB 2H4JA 4R98A 5FPYA 5IDYA 1A8QA 1W87A 2IPXA 3GMDA 3V4FA 2IYAA 2SHKA 3DDHA 3B9RA 2CXPA 2GPAA 3RUHA 3L4KA 5FI3A 1L8AA 4JS0A 1QWSA 1FYEA 5KWJA 3WO0A 1WLSA 5JZ9A 1ZK2A 5DYIA 1XG5A 4DRZA 3NC4A 3NJ8A 4HQNA 3VDXA 5K05A 4DNOA 5JMTA 1PP4A 4FMCF 5EERA 3GUCA 2JFQA 2ATVA 5KX5A 1C7FA 4QKQA 3IKTA 3T7CA 2EZAA 4G9BA 1X1QA 1GAQA 4HXFB 4OJMX 4YCSA