3TLCA

Microcin c7 self immunity protein mccf in complex with microcin c7 antibiotic
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
total genus 116
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlcA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlcA02
2AUMA 5F9MA 3U1BA 1ZL0A 3TLAA 3T5MA 4INJA 4IIYA 3SR3A 3TLCA 3GJZA 5JYBA 4MJXA 5FD8A 3TLGB 4MI1A 4JVOA 3TLZA 4H1HA 2AUNA 3TYXA 4EYSA 4E5SA 5F1YA 1ZRSA 5F5XA 3TLEA 3TLGA 4IIXA 3TLYA 4E94A 3G23A 5K99A 3TLBA
chains in the Genus database with same CATH superfamily
2IYSA 3I0ZA 1S9HA 3LWBA 5KYKA 2CE7A 1KS9A 2XUGA 2XQKA 4IFIA 5HCNA 2P5TB 2AHOA 1CRLA 4L0DA 1KNXA 2J4CA 2VKQA 4DYVA 1EJ2A 1JAYA 2P41A 4QTZA 3FHOA 4Y2YA 1W85B 2BEWA 3OG9A 4RPCA 1PJ4A 3FPJA 4LZNA 4MUXA 1XX6A 5IVIA 4DCTA 3TINA 1YR7A 3MN1A 3DQPA 1RRMA 4AF6A 3PGA1 1DIOB 5TNXA 1XZJA 1QK5A 2OVBA 3OKFA 2Z2JA 4I5DA 3JAKA 2MSEB 1SGWA 1Z2NX 1WE2A 2Y9PB 1Z8FA 2UUOA 4KYUA 2C4VA 2IHVA 3RU3A 1NVKA 3H8VA 4E5YA 5B3JC 2ZYDA 3KVRA 4BEBA 1ONBA 1FDTA 3O95A 4GGPA 5KREA 2OOKA 5F7OA 3ICOA 2J09A 1GAEO 3NWPA 3ZE7A 4BNLA 1RQGA 2X19A 1GR0A 1QTQA 4Q1BA 3E7XA 2CYCA 4WOKA 4AZ3A 2VN8A 3PFGA 2YX1A 4G1CA 1SVOA 1PL6A 3NEYA 4RCYA 5KYGA 3LY9A 4C08A 1QZZA 1VE9A 5JWRA 1N9KA 1W49A 4C7JA 3CXRA 5TARA 1J56A 2J9FA 2Y0BA 1DI0A 1QB7A 4FEYA 3ZHXA 4BNXA 3MEQA 4X1IB 3DMDA 4CR8A 1QJCA 3HN6A 3VSBA 5HKLA 4RELA 4TM7A 4A0QA 4NBLA 4RKWA 2X0FA 3TLYA 4DLKA 2JLUA 4DSOA 2BGRA 4REQB 5DM60 4MVJE 3HV2A 4JT8A 2A1TR 4CQMD 2OB1A 1OH8A 4JK3A 1EQUA 4RV9A 2VH2A 1PJCA 5CEFA 4CZ1A 1IATA 4A0RA 3AU8A 1Z75A 1MJFA 1WMEA 2CJXA 3HY4A 5JHGB 4GD3Q 4JROA 1NDHA 6ABPA 2OUKA 3EVEA 4MVCA 3IE1A 4KR2A 1LBSA 2BFOA 3GJZA 1U2GC 1V71A 3X0DA 2RHOA 4RVCA 5DMHA 1FP4A 5BWBA 5IR2A 1GZUA 3HFJA 3R2JA 5D5PA 3EZNA 3FYUA 4QOJA 4CKYA 1SQ5A 6PFKA 2F59A 1E98A 3BD7A 3OHMA 1VHDA 3JD2A 3PR2B 4UDOA 1ZSNA 4ND7A 1F4VA 3K70D 3PJEA 3IDQA 5FOUA 3VYUB 4HBZA 4X54A 1GPJA 3GAZA 4OMEA 3MOSA 2W2MA 2OAEA 1SOVA 3EZAA 4GQIA 4CG0A 1UPXA 2O9JA 3E22B 3F78A 3JQ8A 3SC2A 4Z4CA 3RS0A 1NNI1 2QRMA 3UENA 2BZGA 3WYNA 3ZD9A 1UKCA 1YS2X 2OUIA 3QVSA 1UFQA 1G5QA 3EIHA 1QH1A 1TM7E 1P72A 4PGAA 1V5GA 4R1PA 4BQRA 1IH8A 4NATA 2O2JA 3AEZA 5E7IA 4EX6A 5BYAA 1RWKA 4GG1A 4LHSA 2CV2A 4QBFA 5JPIA 5FAXA 1GGOA 2C59A 4E21A 3MTEA 4WACA 1Z73A 1M54A 3A14A 1RJDA 4KQEA 3NUQA 1NT2A 3OJFA 4LZOA 3SJUA 4HRYA 3OSUA 1DFGA 4MEJA 3NMUF 1AV6A 5GGYA 2J07A 4R8RA 5CVDA 1FYEA 5IJAA 1TXGA 1J0AA 3KLOA 3P2YA 1N6NA 3DB1A 4NYIQ 1BYUA 3EGDB 2G7ZA 1NXTA 2YMQA 3WRVA 4AUNA 2HWKA 2CB9A 4W9RA 4B85A 3IQEA 1Y3IA 4XJTA 3CLRC 4GGOA 4F3YA 1A9SA 2E6UX 3F3KA 1AIPA 4G0UA 1RM4A 2QVYX 3DCIA 3U5ZB 2QRLA 3CH4B 4UU0A 4CKEB 2O0LA 2P0YA 5M2QA 4HTAA 4CL3A 2CF6A 2DR0A 4XLZA 1L0BA 5K0GA 2XDYA 3LUHA 1HTWA 4DLRA 2QV7A 1RWXA 2B35A 4LWOA 4RDHA 1YZNA 2OZVA 2Y1KA 1SU6A 4D81A 4YUAA 3AP3A 2C8JA 1E1QD 1RHQA 1AXRA 1X80A 1Q7RA 2GRUA 4KBGA 3HNRA 4K40A 3W6ZA 4CIBA 5HIIA 2AX4A 3HHEA 3DE1X 1A4XA 1G7CA 3BJRA 3D6TB 3MCAA 3TOXA 2O1WA 2B99A 1T29A 1UBNA 3QOFA 5ITSA 3CQ9A 3B9QA 4QRIA 3GPIA 5KTPA 2NSYA 2BGGA 2OCKA 3K2IA 1Q0HA 1ZJYA 4U6QA 1ADCA 1T9BA 4CU2A 5B6JA 1B0UA 1E5XA 4FMDF 3PSAA 2IEGA 5CJJA 5BSEA 3ICQB 3V9PA 3M1LA 3KAKA 3B53X 1TU3A 1RI2A 4I1YA 2BUAA 3PXDA 5FOWA 2JJMA 4MWTA 1FFHA 3KTAA 4QXOA 4G67A 3R3ZA 3FXAA 4QQKA 5CYPA 4FZ3A 3VI3B 1C9MA 4PVCA 4RZXA 2B25A 4UM5A 5B30A 5DVZA 2BGKA 1OXMA 3SVTA 1QBKC 1VECA 2DQKA 5AW1A 1OC2A 4MWEA 2LIVA 5DX0A 1SIBE 3PC8A 3DE5X 3F4LA 3PEFA 4ZAGA 4EWLA 4MP6A 3QGMA 3AFNA 3GP3A 1Y6RA 2LKDA 2CEKA 2VJMA 1R0BA 3GVHA 3IAM6 4OG2A 4BQOA 6REQB 3LG2A 2ZUFA 3ZV3A 2PMWB 3HU5A 2IH5A 1YBHA 2Q5HA 5A9TA 2I4NA 4A2PA 3NONA 5AHXA 3H9UA 2E1PA 5H68A 1U1CA 4JZYA 4D6PA 1ZKDA 4D0LB 1A82A 4D8UA 3K1AB 3G02A 3OBBA 4D3ZA 4PTZA 2DPMA 2RGNC 3LCVB 4BB9A 5A0VA 2QLLA 2ZUEA 1ZGGA 2X0KA 2DFNA 2OHFA 3GT0A 4UBLA 3T7IA 4B0OA 3NBZC 2OXTA 3E70C 1M76A 2AK2A 2REXB 3BIFA 1EM8A 1QYVA 2BI4A 5T6BA 5GZ3A 2PQ2A 3DLHA 5E7QA 3WL4A 1SUFA 1VL0A 4O4IA 3I74A 1YJCA 1D4ZA 2IZ5A 2R84A 1JDZA 4JDUA 5LB4A 1TVEA 1Y5RA 3PEWA 1NLUA 2C7OA 3R9XA 4NGRA 1W87A 4AI6A 3ZHQA 4R71A 2YWBA 3RABA 3PC2A 4QPZA 2A6PA 3AEQB 2XECA 2MINB 3BXGA 3E9YA 3FM9A 3G8DA 1I7SB 1JR6A 1ZYMA 2D59A 3E03A 2CFTA 4LMAA 4D4JA 4MRPA 2V97A 1EGVB 4FR5A 4I50F 2V6MA 2JCXA 1UXKA 3R5TA 5A03A 2RB4A 1RCUA 1O3YA 5E2AA 3CLUC 1J00A 1MGOA 1GTL1 1Y8RB 3NUGA 4TRMA 4TTVA 1I3NA 4ZRMA 5TQ2A 2O06A 3ACDA 4KQ2A 2JBWA 1N8NA 2O5VA 2BLNA 3C3WA 5ADUS 2DULA 3S5JA 4WOPA 4OJKA 4HATA 3BFKA 5K6AA 4FTWA 4LJ8A 5FQNA 2QTVA 3GRFA 4BB0A 4ZTUB 2UZ1A 3G7UA 4COBA 2X5NA 4MQFA 4QQFA 4Q00A 1TTQB 3EVDA 2E5FA 4RA9A 3MUOA 3T95A 1JEQB 5CLGA 3CZCA 3OQVA 3R74A 4E5DA 3NXSA 1M8KA 2CLSA 3BWCA 2C29D 4US0R 1QG0A 5H5JA 4QJBA 4M0KA 1T2NA 1SCAA 4F96A 1XJCA 4D7AA 5JSQA 1G6KA 3SQMA 3GLIE 1CUXA 3T1OA 3FCEA 3PT9A 3IMGA 5GMOA 2W2QA 3RLFA 3KQHA 4XM0A 4GICA 4PAOA 1VMEA 4TYMA 5CYOA 2AFHE 3PNOA 1JR3E 3IR7A 3JQQA 5BV1A 2A9RA 3OZWA 1RHMA 2KLBA 3P4XA 3B3FA 3RTCA 2GHRA 3MGKA 3PGVA 4MP3A 4E5PA 4GQBA 4W99A 1JRLA 3RVQA 3SR3A 2E4YA 2ZANA 3ZOKA 4RJTA 2PT7A 1O6ZA 2XJ4A 1ZONA 3AR8A 4CTNA 1IULA 1FU8A 1ZUD1 2ZJOA 4H15A 1CDZA 3I9MA 3STUA 3U3MA 3GFPA 4E09A 1J22A 2X0JA 1WABA 2WMNB 2WWFA 2BFPA 1K7YA 2FSSA 3DZHA 1HFWA 2GBLA 1JT2A 3GB9A 3HZRA 4RADA 3RVMA 4YRPA 4D46A 4WADA 1W5TA 5CX4A 3QVLA 2OXCA 2Q7DA 1KFEB 1TA4A 1RJGA 1U9ZA 2IEYA 3M5CA 3T3NA 2RKBA 4LYFA 2AV6A 1IZZA 4M76B 4MV7A 1XZCA 3AWDA 4V0QA 1U2TA 1PHRA 3OPVA 3PVZA 2NVUB 4U9UA 4QFBA 1VJTA 3T52A 2QRPA 3SF0A 2JNWA 4OLJA 1E2BA 4XKJA 5EQTA 4JKIA 3S1LA 4EZBA 2ZXFA 3W04A 2FYTA 3K9GA 1PQPA 4I9HA 2H00A 3STVA 3WIUA 4Z3KA 1GUZA 2PZJA 1Q7GA 2R1VA 1M34A 2EJVA 2OXEA 5F12A 4D6XA 1KFJB 3LVFO 3OP4A 1IK4A 3BKWA 3GFFA 5K0LA 2OHOA 4JKYA 4OB6A 1LPBB 5ICGA 1Y82A 4PG7A 2W9XA 2ZAIA 4WCFA 1COWA 2R7MA 5HKAA 1T1GA 2B7BA 3KB1A 3PDIB 3QBVA 3HXQA 5ETJA 3Q1LA 4YV1A 4MVJM 1EAMA 4US2R 5F4BA 2PU5A 4KE9A 3JAMA 4RK5A 1BGXT 1YUNA 3FSEA 3CZRA 1GU0A 4BMZA 3WA6A 1YHYA 3FHCB 4HX5A 1UC4B 2O8DB 4IEIA 3EIOA 2ORVA 5FNZA 1SN7A 3M2TA 3G2PA 1YDWA 1ZVJA 3PJGA 2V7VA 2Q5OA 1IN7A 2LDXA 1U8UA 3KKQA 3N2EA 3KQTA 1E5DA 5DPMA 2B1QA 5IUNC 4CEJB 2GCIA 3LT4A 4R1NA 3IWWA 4JJGA 1ZK4A 4NJEB 2QZJA 1J4AA 1VI2A 3HJGA 3TMAA 5HHTA 1BKDR 4YRJA 4XM1A 3JQAD 3TW4A 4YAKA 4A0HA 3QEMA 1YUMA 4FNGA 1SFRA 4QSMA 2CYBA 2NUTA 4HS4A 3T7AA 5BPFA 5CLIA 1OLSA 3RVOA 2QLFA 3HI6A 1A5BB 2W90A 4W5QA 1E1CB 2IPOA 3LKVA 5K01A 1IZYA 1U80A 3D1VA 4RMJA 1ORVA 3SZUA 2RK6A 2AOUA 2P5UA 2Z5GA 5AOVA 3UWOA 2FPGB 1G3MA 5GJCA 1IY9A 3LM8A 3W5BA 3QWBA 1JFLA 3L41A 4ND4A 1V26A 2WWIA 4QBIA 4BECA 2HLHA 1GPMA 3HL0A 2H08A 1D5WA 1F60A 2VC2B 4Y6LA 1STOA 3UAYA 4DM3A 2BTEA 1XHFA 3M7IA 5G2OA 2I2CA 4JYMA 4CDKA 1UQRA 2H1CA 1ZA1A 3W0LB 4Z51A 2ALJA 3UK0A 5IM4F 3HU1A 2BFFA 5D1HA 1F9AA 2VT6A 3H3XA 3MOIA 4MPDA 4NOMA 1HMPA 5F21A 5TQ0A 1J06A 1AKUA 1KBOA 1J0XO 2ZSEA 4P86A 1XTBA 3LPLA 3ZXXA 3O8RA 1NL3A 2PGJA 3CS3A 4K05A 2XQIA 3BGOS 4Q4AB 4BO1A 3WDMA 1OOEA 1S2IA 3LT2A 2KQUA 4P5PA 3WJ7A 2XB9A 5EYPA 2IOFK 5DV9A 4P44A 5BXQC 1PQUA 4MPRA 2BP7B 4IVQA 3IJPA 3TM4A 3COSA 4LOJA 1MJNA 4IPTA 4JFRA 1S4MA 3G7SA 3TL2A 2ZRGA 3KELA 3PTZA 3Q7RA 3IOBA 2NU6A 3GBPA 2HPHA 1YOVB 3NNDA 3BWVA 4GNRA 4IV5A 4O25A 4WK0B 3V6LA 4JITA 4D3FA 1NP7A 2E4WA 3QE0A 5CLJA 1H93A 2P75A 4NEGA 2VUIB 2GB4A 3ADOA 3OP1A 4W1PA 5DP2A 4B1FA 3QELA 1ZH4A 1DWQA 5IVKA 1G3RA 2RB5A 3I6ZA 4MVXA 3AFHA 3AFMA 4UJ5A 3WX0A 4ALIA 4I8DA 1K88A 2PPVA 3K1JA 1DDGA 2RAFA 1PNVA 4HUQA 4FCWA 4KE7A 3TSYA 5IMSA 1Q15A 3QENA 5AI5A 5CA0A 1V1JA 1MTOA 1QQ7A 3K92A 4BTLA 3DAGA 3VSDA 4F91B 1SR8A 1SXHA 4UMVA 3PFBA 1VLVA 2VDMB 3AR2A 3NTUA 2I8AA 5DM1A 3KAPA 1XCLA 1BA2A 1P2DA 2GHTA 4IL5A 4DA7A 4UQLA 3PL1A 3MJ4A 1T26A 3CF2A 2OD7A 2VP9A 1BD4A 4XYEA 5TMPA 4OHWA 3GHHA 4KQIA 4AY2A 1V1RA 4EPRA 5JC8A 1WPGA 3F6RA 3G1WA 2PAFA 1IBSA 4JL5A 2ZUCA 3DOCA 1M8PA 3U7IA 2BGWA 4L27A 1LSUA 1K7SN 3DT8A 3R0ZA 1PR4A 3FDJA 1M0TA 4TJXA 3AQ4A 3K4HA 1ZJ4A 5E3IA 1A69A 3WB2A 4L8WB 3C87A 1PFYA 2GCOA 3RIGA 1YOBA 1R5OA 2PVCA 2ZJ7A 4G63A 4MUAA 1L4BA 4LJ7A 2IU6A 5EAIA 5EJAA 3G8BA 3UJ7A 3KOWA 1Q77A 2LBPA 1GLNA 3BMCB 3GEHA 3B78A 4JODA 1LVUA 3ONWA 4KXXA 1M1XB 1VL2A 4A7PA 4Z4FA 4FSDA 4DB4A 4RKEA 1DRJA 5JAIA 3RVLA 1VG8A 3JQEA 1MHTA 4J6FA 3CZAA 5TSDA 1P9NA 4FFLA 4JQOA 2GK3A 4OA5A 1USGA 3QX9A 4J8PA 4JBWA 3STWA 2FP3A 1R0RE 2J7KA 3X2SA 1GRQA 3FGZA 4D5EA 4Y1EA 3IHWA 4IX1A 5DYGA 1ZJ5A 1TF7A 3W8RA 1NR1A 4G1FA 1GTVA 3QNUA 2YWXA 4EQ6B 2AFIE 2LV8A 1T9DA 5FI5A 5T6MA 5KKAA 4V03A 4UBKA 2VDWB 1VI6A 2R60A 4RVUA 2WFLA 2HA7A 2B8TA 5EWLA 2B98A 5HZMA 2VJYA 1JILA 4RWEA 3AVPA 3PPXA 2CNDA 1NULA 1CY2A 3D6AA 3KEQA 3VHLB 4MR9A 2FF5A 1EFPB 5FJIA 4IIDA 2YWHA 1FC0A 5K3BA 2OV8A 3O1HB 1L8XA 2HU2A 4NS1A 4M1SA 2ZZNA 1XDWA 3QYAA 2UDPA 4MULA 4WNAA 2Q9UA 2WD9A 3BD8A 4CV1A 1IBRA 3TKLA 3W8EA 1CZLA 1W6UA 4JXXA 4HFRA 1U7PA 4WLFA 4JWKA 3HC7A 5J23A 1C7IA 1NVVQ 3PUZA 4RF5A 3UFBA 2CXXA 2XMQA 3QU9A 4KLCA 1U2RA 3GD7A 1L4GA 2GBGA 4P3XA 4UBJA 2YV4A 4EIWA 4GKJB 5KQLA 4YO7A 4Q4HA 4EUSA 2EFEB 2VT7A 5T57A 1TIPA 1V6AA 1Z34A 4XOIA 2VVTA 1BS1A 4NBNA 5E8RA 4ZJPA 2BFCA 1IEWA 5IK2A 4DLTA 1WCXA 4C9RA 1JZQA 1H2ZA 1ORRA 2ZJAA 3C1TA 4DIKA 3EOBI 3V5NA 5BUZA 2E18A 5F2NA 4YJHA 3D2AA 1K7XB 2NUPB 4JJ8A 3WGTA 1YGPA 1JJIA 3A1UA 8GPBA 3ONNA 3L4BA 1N36B 1T1SA 2IKQA 4D4IA 1Z6PA 1QOQB 4RE5A 2FUG1 1BS2A 4U3JB 2OHXA 4IGFA 1KHTA 3VDRA 2P7HA 1A3CA 4PBTA 2BDEA 1QLWA 1XU7A 2O0JA 4P35A 5EUQB 4JVLA 5YASA 3OZXA 4X97A 1NVAA 1VIYA 3BFVA 4NVRA 3ISTA 2PS0A 4CU5A 1RHUA 5AKEA 3LI2A 4D4KA 3NGXA 3ROZA 9LDTA 3SC6A 4ZVTA 4HGOA 1X87A 4G0OA 1G20A 2NTVA 5HQTA 3T1TA 3QVMA 1QM5A 1PL0A 3HYNA 1M1YE 3SKXA 3OC6A 1UZNA 5DGTA 2OPHA 1ATZA 4WBXC 1IHYA 4CODB 3HM2A 3BFXA 2XWPA 2D5CA 3DXZA 1Z13A 3RTGA 4IDGA 3FNQA 3L8YA 1JFVA 5AVVA 1E66A 2WTUA 3U4AA 4RTJA 2I1LA 4EJ6A 3ECCA 3DEIA 4G0PA 1A8UA 2P35A 3X2EA 1YFLA 4Q47A 4YONB 1GDDA 3DBOB 4L4RA 3UYKA 3WIOA 1UCFA 1N8SA 4FVTA 3UO8B 3T5BA 3OQJA 4FYIA 1QTNA 5LQDA 3FDXA 1DC6A 1V5WA 3TB4A 4TYWA 4ARSA 2LDBA 4NV0A 4B47A 1Y7HA 3RDPA 1NKSA 3FG9A 4OLAA 1XMVA 1T4DA 5GP1A 5LUBA 3A4YA 2ZE7A 2PHZA 3L8FA 2VYNA 3GCXA 5EP4A 5F2OA 3TDNA 1ISMA 3PUYA 1Z7YA 4PONA 2WU4A 1Y0BA 2IHKA 3PKIA 4M88A 5BVGA 5BQ5A 3V4VB 1NM5A 3HABA 3HUFA 1FNCA 3NBYC 2XYQA 4D02A 1QYXA 3L6RA 5AXAA 4EGSA 5A02A 1PVVA 1L8AA 1H5NA 1KYTA 1N2BA 3HB0A 4H6PA 5TXGA 2QSZA 1EX6A 2HBQA 1MH9A 4Z0HO 4EKGA 5JSUA 5TPWA 4AF7A 2GTIA 4R1TA 2W8BA 2NU7A 4GC9A 4C4YA 2WF6A 1UJ2A 2JIBA 3PE4A 1DKLA 3LQ2A 1FXWA 1UT8A 5GPBA 2X0EA 3RVJA 4ALNA 1P3DA 4JUBA 1UM8A 4WINA 5EMHA 5I8WA 2H2IA 4HWSA 2NVWA 4AJHA 4AUEA 1OAOA 5C7LO 4HDRB 3K9NA 2Q5QA 2R7KA 1XD2B 4MYSA 3VHRA 3W9SA 3WK8A 3AF5A 1IY8A 3Q7QA 2YJZA 1P75A 5KOJA 1U4NA 1ZM3A 5EWMB 3R23A 1Y9JA 3AW8A 3O84A 3LPDA 3AVYA 1L6RA 2GM3A 2ODAA 1WX1A 1ZUNB 5AJWA 2XCTB 3GQBA 4IY1A 2EVWX 4MUBA 5CG2A 3EXHB 5DTMA 1AA6A 4ZVNA 4F11A 1GITA 4GLJA 1E96A 5BUQA 3RVDA 1BDHA 3A1TA 9MHTA 2C2ZA 1G7TA 2P78A 2OOTA 4C99A 3TLMA 3FPAA 1JLSA 2BR3A 1P9LA 4AW9A 5IVPA 4KO4S 2ZTSA 3BDIA 4F7DA 4ZKEA 4F2HA 2IPLA 2XXJA 2GTHA 2GAFA 3AGPA 4OFZA 3V2IA 1RADA 3RSCA 1D1PA 1II9A 1DO0A 1IHXA 3IBFA 1EDOA 4ETIA 1W4BA 1N6PA 3DFFA 2OESA 3QHQA 4KPUB 4M1OA 4M1ZA 4E33A 2AK3A 1BVHA 2CUNA 1AMUA 3VPDA 2I4TA 2B7CA 2KM1A 4FWIB 4N6OA 4XTRA 4YV7A 3A0UA 3B6EA 5EJ7A 3FOEC 1Q2XA 2JJ2D 1VLZA 4WJZA 1RTTA 1W48A 3R7LA 3MT9A 2UXBB 1RYEA 1EAYA 2QL7A 5C4IA 5KTOA 4KXVA 1N6IA 4KQJA 5EIFA 4MICA 4BNGA 1YCDA 1ZIPA 3CBQA 3C7AA 4EG5A 3WGLA 4RGYA 4AF8A 3OIDA 4IIBA 4GMHA 1FFGA 3BMQA 2QOEA 2XUFA 1UP7A 3LE8A 3RC9A 1RWWA 2QVLA 3LPNA 4I1OA 3EN0A 1D2AA 2UKDA 1OLUA 1GIAA 4YPVA 4QYWA 1NW3A 1TK3A 5U1PA 4B2PA 1NVMB 3HNPA 1BMDA 3PC8C 4Z8YA 3RTEA 1Y3DE 1HE4A 3SU8A 2YHIA 3C3PA 4YRKA 1H3EA 3OPYI 3C8MA 4M8DA 1EZ4A 3ODPA 4Q01A 1E1RA 3WG9A 4L5BA 1SO8A 2AJDA 3M4XA 4UM7A 1ZH0A 4YLGA 1RS0A 1SPBS 3A6DA 3IJRA 3PUHA 4M0DA 4OAQA 3VH3A 3NT5A 4KK3A 2O1SA 3H9CA 3NTXA 3CLKA 3GDFA 4HMQA 2CT8A 2P0EA 4U4AA 5JAZA 1OXXK 3ROGA 2YH2A 3UAGA 4BX3A 2ORWA 1D7OA 2W37A 1R50A 1GZ6A 4KH1A 2BEUB 5T4FA 1QBGA 1MEJA 2GA8A 3WGQA 4AICA 2J3HA 3D6FA 4GOXA 1ZZGA 2WJ6A 1LJLA 3R3VA 1NVTA 4PXYA 1IQRA 4ZVLA 5ALVA 3Q5GA 3GZ4A 2ZI3A 4KXQA 1PP4A 5H3LA 2NVOA 3HDYA 4Q9JA 5DN6D 4V1CI 3U16A 1I7NA 3B9BA 1A9PA 2C2BA 4FR2A 4P2GA 5A3RA 4KNGE 3JARB 3AQIA 2PKWA 2VAPA 3T3IA 5F5LA 2HLPA 4H7HA 3NPAA 4B82A 2VYFA 4Y2VA 2FMUA 1E6LA 2PT9A 2VNSA 2WUGA 2XEXA 3QLVC 3FHJA 2JLZA 1UJNA 4DTIA 1I4WA 4JR1A 5HIJA 1HA3A 1N2ZA 2FCAA 2VAXA 1VQ1A 3DVAA 1E4VA 3EUEA 4JSRA 3NDRA 4LVUA 4WEQA 4EHKA 5LYJB 2XHZA 5AM1A 4GLFA 1ZU4A 4DARA 5JNTA 2P3SA 1XAIA 1T15A 1P0PA 3A1FA 3K0CC 1G41A 3I2JA 3U80A 3HKCA 4OC4A 1N0VC 5AJUA 4MEBA 1H3FA 4JENA 3K20A 3D7DA 4BKPA 3CKLA 1L7QA 4BFXA 5E0KB 4CXMA 5EUBA 3HMQA 5JNVA 5K8JB 1MU0A 1UOPA 3L49A 4IXMA 4OAPA 4MQEB 4C2BA 4M9QA 5B55A 3BC1A 1ENYA 2GT1A 1XEXB 2PX5A 2YKGA 3AEKA 4NCNA 5AKYA 1A8HA 2WKRA 2HCJB 4Q9LA 4JL6A 4JASB 1KAHA 1AA9A 2GSWA 3TIIA 3TYXA 3DD5A 1JKMA 3NTOA 1YQXA 3QVUA 2B1IA 3HUEA 4LBYA 4ND8A 4UEOA 2P2CA 1NU8A 3ELDA 2Y0PA 4XX0B 3HTXA 4REMA 2C8KA 5JXGA 3A2NA 3HR4A 3PK0A 4Y6PA 4K7JA 1I6KA 3FJYA 3JX9A 2GO1A 4ZVVA 4DT1A 3GIDA 4G01B 3OA2A 4CR6A 2OO5C 3T07A 5CDYA 3O8LA 2QLMA 1QZ3A 2PBRA 5ERYA 1YA8A 1EVLA 1PQYA 1Y48E 2QX7A 3C6BA 3H1TA 4JBXA 4CETA 1XRRA 1YD7A 3EWNA 4HP8A 1V48A 4W1SA 4FEGA 4R54A 4FYPA 1IM5A 3MTIA 1V3VA 1C0LA 1FVOA 1FNDA 2PRKA 3JW8A 4O4IF 4AWXA 3K6SB 4E2XA 1IB0A 2YICA 1OXUA 3DNMA 2PWZA 2LP4Y 1CJCA 3N59A 1O9BA 4PLWA 1GG9A 3G2IA 1HYBA 3W8NA 3H8SA 1PFVA 1B1CA 2QYTA 1DAFA 5DU2A 1R9MA 1CZHA 4DA9A 4WBNA 1RXSA 4P3KA 3P0JA 1JXQA 3AUTA 3FCOA 3CRW1 4IIEA 2PVSA 2C2KA 2SICE 5B1IA 3CVOA 1NP6A 3MXTA 4YA6A 2XODA 2PR2A 3N2KA 2NTEA 5ALWA 4BNTA 4ZOQI 5JD5A 2R5WA 3JSAA 1IDOA 4UVEA 4L8FA 3O91A 3MAAC 3K4IA 1MABA 1P0MA 1UJCA 4KLRA 2ROQA 4NH0A 5ALQA 4AVYA 2V7EA 2FCRA 4II2A 4TOIA 3EXG2 1E3IA 3NYQA 4UNPA 2MDTA 4X61A 2IXBA 3G2HA 2J48A 4TLMB 3HYTA 3BA6A 2MCFA 4UAUA 2RDMA 1LH0A 1ZCZA 3JR7A 4JR0A 4BJ1A 1CRZA 4OU5A 3CNBA 3D9QX 2YY6A 3MWGA 4MLPA 1YK0A 4J0NA 3EK2A 4UQPA 2IT1A 3BL5A 4Y3UA 1JHUA 5BNIA 2ZJ6A 5CCXA 1EUYA 1EFCA 1XJQA 3N28A 4CIVA 4HZUA 5LBTA 2HYDA 4IVRA 3Q1KA 4DLLA 5LQJA 1ND6A 3OTGA 1ESNA 1F9EA 2J5BA 2R2AA 4C4SA 4Q39A 1L5YA 1WDKA 1ZK0A 1VLHA 2NU9B 3IBGA 4KAAA 1U7WA 4Y2GA 4C3UA 3QJ5A 4D3SA 1QVWA 2ZIEA 1X7GA 4YJFB 1KIFA 2OHIA 3AHGA 1F0PA 3OOWA 3W9YA 3TZQA 4POAA 2C0PA 4KMRA 4UKDA 3L1KA 1Q0ZA 4QUEA 2FW1A 1ZM7A 1H2RS 3R77A 3KVVA 4NBSA 5FBLB 2I3GA 2W6ID 3ZK8A 5IEJA 1BGWA 1OYOA 4DF3A 2TMDA 4KMSA 1D2MA 5AO9A 3GFQA 4Q37A 1X8KA 3UAXA 3PQ6A 4H7IA 5T4BA 4CT5A 4QFMA 3OVMA 3LFUA 1YB2A 3RODA 3QHAA 4HNVA 1GU7A 4YCCA 2FXVA 2FUG6 4UW9A 2JJQA 2H1FA 4WDQA 1OI3A 4HVAA 4AKTA 4DREA 2NQTA 1PYGA 3C45A 1J2EA 3VR6H 2V74B 1GLGA 3RJ9A 5LYYA 1FSPA 1X7HA 5L7YA 1GGMA 2Y9MB 3ADCA 3A4TA 2P4EA 2Y76A 1G0OA 1PZXA 3CISA 3F4BA 1X1DA 3LVQE 2ZBQA 2I62A 4GZ5A 4NL4H 3WE7A 4BFYA 1Z08A 1XOIA 2GHQA 4MI6A 4V3CA 4F4JA 3V6MA 2VHCA 1WMAA 3ZDCA 3CF6R 4QRDA 4UTVA 1XGKA 2P6RA 1NFRA 1Y9ZA 3L5OA 4NCXA 3R7DA 3K15A 3S28A 1CNEA 1FDIA 3IAXA 4ZZ1A 4B3TB 2C9CA 3U5TA 4BC0A 3UY4A 1NR5A 3E7WA 2FFAA 1SCQA 2AC7A 2VIIA 3TVDA 2UYOA 3EVBA 4C85A 1OHHA 4HRAA 1EX7A 5G1NA 3MT8A 3UGKA 2VK2A 3CEHA 3SPXA 1KYQA 3C8UA 5D3ZA 4CTMA 1VXRA 2B0CA 1T5BA 2HA0A 4WERA 1D09A 1HNXB 2AMJA 4AU1A 1KQGA 2OZPA 1WHSA 5A9SA 1V1MB 5SYNA 4MRNA 4X84A 2OGWA 3FAKA 1S8AA 3G85A 4C9EA 3RNLA 1TEHA 1AT1A 1A1VA 3S7ZA 4OIFA 3PL5A 5CBPB 3GJ0A 2EX4A 5JHHB 1P4SA 5ALLA 3RJZA 3G0BA 5JI2E 4KPEC 4CIWA 1AMNA 2UAGA 2B3TA 1MRSA 4RDCA 2EP7A 4K2HA 4XGIA 4K9MA 1AK2A 3C41J 3FMIA 1WKVA 3L6EA 3TLGA 1E7WA 2LIPA 2V5UA 3EC2A 4YIHA 4FJ2A 1GG5A 4L8LA 4FFVA 1BXZA 3DFZA 5DFAA 3MINB 4M38A 3OIVA 2QN7A 2JZNA 4DCGA 1YVEI 4HTFB 1C7RA 4KKVA 3TIVA 1DTSA 1Q1QA 5EPOA 3BBLA 4JUAA 4G4JA 2QR5A 4R8MA 2CXSA 2ORYA 4GXRA 4LOKA 3ZDQA 3TSZA 5IZ4A 1YZYA 4JEMA 1I1HA 1ZGCA 3G2JA 1QYCA 3VU0A 1YZHA 4RD0A 3SS9X 2YJ4A 2D5IA 4WZAA 4B3XA 4RVDA 1GL3A 2CB0A 3G49A 3K2BA 4IMIB 4KXWA 3CB2A 1JR2A 4YASA 2DHCA 4RJIA 1QQTA 1Y5LA 2YXEA 3AIIA 4EARA 2HPZA 1M33A 2J9YB 2B4YA 3OLVA 4NJMA 4YDRA 2VDUE 4KI7A 5JE8A 3MJTA 5CAEB 3WL7A 3RIEA 3MTJA 1SXPA 2V7TA 1O97D 4HAYA 2VJDA 3RS8A 2AMLA 1G19A 3H3JA 3R6DA 4J6EA 1I0ZA 1TMGE 2ZDGA 4Z2AA 3QJGA 5FLXA 1FTQA 2ACVA 1IIRA 3L8CA 4PBSA 4INAA 4BRWA 5FA8A 2V58A 5HTKA 1E89A 1XJ0A 5K8LA 3J7AC 2A9VA 5JBQA 4JBIA 3SQWA 5LMZA 1CRWG 1QFMA 2H63A 3JQRA 2FR8A 1N33B 2FZ4A 1H0RA 3QMVA 1JLLA 5AHOA 3PFFA 1PFGA 1L8OA 2BI8A 3R5HA 4FZJA 4IXWA 4QOIA 5B1HA 4MA0A 5FTNA 3RYFA 5E4JA 4PRYA 1SQ6A 1CUVA 1S96A 1YRQA 3A1VA 4HVTA 4ZC8A 3UJDA 4TLAA 3UYLA 4I8IA 4C86A 2ZE5A 2VTDA 3TOVA 4ZK2A 1GY8A 2ENUA 5CA0F 2NYVA 4JVMA 3THYB 2BFNA 2FPRA 2P9QA 3GJ7A 4MVWA 1T13A 3LUPA 2VOJA 2X9LA 2FPMA 5EIBD 1GPWB 1OX5A 4B6QA 4C21A 4KGZA 2HHCA 1E18A 4L6AA 3OLYA 2DBZA 3CE9A 2B83A 2QTLA 1DZIA 5HJ5A 1KRXA 1NF2A 1XL1A 5A1JA 4Y2TA 4HWGA 1DAOA 3KETA 5E1MA 3SYRA 1GXSA 5HK8A 2JGIA 3VPHA 3AM3A 3TQOA 4DIEA 2XWJI 2R3SA 4FYVA 4ZFNA 1HTTA 4G41A 3R9WA 2OCYC 4L5IA 2GX6A 1H1TA 3EIUA 1IPHA 1Q5PA 2DC1A 3SZOA 1F5SA 4UULA 3HCCA 3H0EA 4A2QA 4Q9NA 2BTQA 1NC1A 4DLSA 1WP4A 1HNNA 3UATA 2WQ7A 3DOEA 1KIAA 3R1IA 3U48A 1MB9A 1MOSA 4CW7A 5KKNB 3UHAA 3CFYA 3O8QB 3EG5A 2EU8A 2EW8A 3K1ZA 1OROA 1NXWA 3RYHA 1QYIA 1KQFA 5C37A 1ZD9A 4KQFA 1XG5A 4N1AA 1GPH1 4DDMA 2XMRA 3NI2A 4F21A 4RFVA 4H77A 3NBFA 5BVHB 2EDAA 3REQB 5KIAA 3KJNA 2FFQA 1R5NA 2C3MA 4PLHA 3W5SA 5C1PA 4MCIA 1OHHD 2BFBA 1OXVA 2I33A 4WZZA 2OY0A 1R6DA 2X5KO 2YRWA 3L7NA 4OB7A 3SQNA 3TLEA 4QIHA 5C35A 1LF5A 3B8EA 4JA0A 1TEZA 1UDRA 1CNFA 2PWYA 2JD2A 3ZCQA 4JBLA 2C97A 2DWCA 2X8AA 1NI4A 4HDCA 1IZ9A 1M9NA 4GX2A 4JVSB 4NV1A 4YN3A 1V95A 2DECA 2O6LA 4K6MA 2VTKA 1FRNA 2EF0A 4XB2A 3WKBA 1KYWA 4EP1A 1SOMA 1LWOA 4ZZIA 1RU3A 1LTQA 3FCXA 5LP6B 3AZQA 3KLNA 3C39A 2GP4A 1FUEA 1XKLA 1J20A 1ZXLA 3MGGA 5AIAA 1RYMA 4BZWA 1U9JA 4OI0A 1BW9A 1DNPA 1RBMA 3SHOA 2J4DA 4I4IA 2GEVA 1L5HB 4CV2A 3W78A 3NDIA 3QUTA 3OM9A 2L17A 4G1UC 5TQJA 4L75A 5F5XA 1I1OA 2NGRA 1XRPA 1WXGA 3ESAA 3OZTA 4OCZA 4OQLA 4CT4B 5HOEA 2N46A 1JHAA 4TV9A 4OU4A 5H4GA 5JJCA 2XVYA 5H3CA 3RFTA 3K5HA 2RG7A 4LI0A 1G4UR 1REQB 2RHJA 4X92A 5BSRA 3V8PA 3WBJA 5ALFA 1IMJA 2P2ZA 4N54A 1KO7A 3OMLA 5A3VA 1K4YA 1Y5IA 3RFCA 3TN7A 3VU9A 2VCEA 3TTSA 5C8ZA 1EP3B 1M6EX 3WV5A 2GBFA 1PS9A 1W4LA 3KYIB 4JXKA 4Y1RB 1PKEA 3E3OA 2OBNA 2ZTVA 3DAFA 3JR3A 5F78A 1TIBA 4V02A 4I8XA 3BMOB 3ZUGA 4CHGA 3DFIA 5HF8A 4Q3NA 4CKWB 1NFQA 1QO7A 1Y3HA 2HMSA 3I2KA 4RTPA 1OXTA 3GF4A 1FVHA 3MJEA 4H3KB 1M34E 1CCWA 3BZUA 4XB6B 1KI9A 3OAAA 4IQFA 1JA1A 2QUHA 3DV2A 4DJ5X 1IG0A 3W06A 3KLBA 3GFVA 2C54A 4JNCA 4GKKB 4V38A 3SY8A 1U28A 4FHFA 3Q6IA 4GBJA 1E69A 3U7EB 2J0QA 5BUSA 3EULA 2GPJA 2GMWA 2A57A 4GOOD 4F84A 1KL7A 2F9LA 2O2CA 3M4JA 1HE8B 3Q4GA 3PQ3A 1YNSA 2MSNA 4N4AA 4BVEA 1Q6ZA 2RAPA 3X1JA 5TPZD 4I6JA 4KFSA 3QY9A 5A3JA 4FS8A 5KYXB 5H3HA 3I9JA 1UKEA 2EZ4A 4UPDA 1PFUA 3BAZA 4C0QC 4JL8A 3OLQA 4HRXA 4BO6A 3BN3A 1DBWA 4EZIA 1I30A 5JJLA 4NGMA 3AUFA 1YS9A 1QP8A 4AURA 4LK2A 1E9FA 4H31A 2IODA 1FMLA 3O74A 5KYUA 1ZOSA 4DRYA 1JV2B 3GVPA 4DUPA 4G2TA 2O8EA 2IUEA 3CWQA 4R6XA 2QTMA 2QUIA 3CNOA 3E58A 4MJLA 4OIMA 3WNQA 5JCPA 1CQWA 3RRZA 3WOHA 4AN4A 5LQRA 4COGA 1LDYA 1R0XA 3HDJA 3I9V1 4C1BA 1JEEA 3OPYA 3VX3A 3GCDA 2YW9A 1E5LA 1GQ2A 1H1DA 3LUKA 3AI1A 4PM4A 2UXCB 1NRXA 2CW5A 4DRXA 1TK2A 2YNMA 3IXLA 3GJYA 2Y05A 2XVZA 2VSFA 1G60A 2VF4X 1KZ4A 4Q1EA 3LA6A 4C7XA 4PYJA 1JN0A 5CB0A 4QZVA 4P4UA 3KR0A 5HWSA 4YMLA 4YAUA 3HB9A 3BMNA 2GKGA 2PZ8A 3OJEA 1KDZA 4PQGA 5F1KA 3Q3IA 4K6OA 4GZ6A 1OA0A 4B3MB 1NJFA 2X1LA 4RXUA 1WEKA 4G0ZA 2X22A 5GOTA 4E14A 2WKPA 2J32A 1K06A 2ORED 3HJBA 4V1CA 4KRXA 2MYTA 1FXWF 2X3YA 1OFUA 3BTVA 3FOZA 1NRJB 1YFKA 1N32B 1T9KA 3G79A 1OTXA 1WOYA 4BLPA 1X1BA 3HSSA 4YC7A 2COEA 1P1JA 1XVTA 3IB6A 3QTLA 3BXPA 3GEIA 4U39A 4Y1GA 4U7JA 9ATCA 3AVXA 1NJ1A 3IP6A 3PGLA 2ZJBA 1V5IA 1EIZA 2P9FA 4FONA 4LQLA 3LCCA 4QGSA 1E9RA 4POOA 2ZBUA 1C1XA 1Z4OA 3CSDA 1ZVQA 2ZYTX 4K1LA 3ZIUA 5HP4A 2ZTHA 1DRVA 3A6HA 3WO0A 1LK7A 3QWHA 4FW8A 4B45A 1IHOA 1RSZA 4I08A 4RO0A 1PQWA 1Q74A 2B92A 1QE3A 2OXIA 3VSCA 4EO7A 2FSHA 3FUXA 2W6ZA 2EV9A 5HQ3A 1GARA 1HRDA 4JVNA 3DM9B 1YR6A 1T9GS 3QEJA 1HDIA 4PZDA 1DC4A 1L7OA 1X7WB 3RANA 5KYWA 3IEIA 1V6SA 2C6CA 1G4AE 3O8BA 4L3OA 4DDWA 1N5RA 4OXKA 1NW5A 4RA6A 3MTGA 1R0WA 1BXRB 3ROMA 2G04A 5AHKA 1E8NA 2IYQA 2O3SA 2RCYA 3B1VA 4MW4A 4DJDC 1O6FA 1P2SA 1BKYA 4C76A 3RREA 2H7CA 3D7MA 1YQ9A 4BE7B 1FUYB 1R18A 2EFGA 3GX1A 4JCCA 3CJRA 5IC4A 2FPXA 2DBVO 1YIAA 2OCAA 2XR1A 3PHGA 5BW4A 4NE7A 5B3AA 1JLHA 4A8JB 4BVBA 3BIWA 1IBLB 1C0KA 1OFTA 3WYDA 1E79A 5L40A 3VR3A 1EJBA 2FMHA 2MOKA 3HG7A 2HK7A 4DE5A 2FMTA 2J3EA 5D1NA 5D7NA 2EG9A 1NJ6A 3BXHA 5E3JA 4KE6A 3D43A 1G2QA 3MQ4A 1CERA 3RBVA 2BEJA 4DC9A 1O54A 4NESA 4YIKA 4P9NA 2GD6A 2HIGA 1VRCA 1NLFA 2J31A 3P19A 4PZUA 3WK9A 4F9EA 4RTKA 3SIRA 3AGQA 2YW2A 3VKWA 2X2FA 4DSUA 2JAHA 4DNOA 3GXOA 3IBYA 1H94A 2J0UB 2JI9A 1E58A 1ENOA 5EXEA 3SE7A 3MNFA 1XQVA 5SYMA 4BFUA 3C8OA 3H16A 2G9RA 3CURA 2ZBRA 3GUUA 3OAAD 5ALHA 3W2IA 1F48A 5IJZA 4NZ9A 4DDHA 4OH1A 3MJDA 4PZZA 4QASA 5FNVB 1HETA 4NCIA 1FLAA 1SUWA 2Q3LA 2QLJA 2X0DA 3ZQJA 1XLVA 3L43A 1YR3A 4GWGA 4J3JA 2QTNA 2MMCA 4GW3A 4QBTA 1SBCA 4EKYA 2IYYA 2V7XA 5JY6A 3V4PB 3VMMA 2R6CA 4R51A 3IHTA 3WNCA 4Z49A 4QHYA 2RHCA 1SCJA 2VSYA 3EZ9A 3DLBA 4BMYA 4Q93A 2XCSB 3P32A 3QPBA 4HFJA 1SVNA 2QG6A 1T8UA 2EYQA 3EGEA 5C7OO 2APJA 2AXPA 3F9CA 3LBNA 4DMMA 2IWHA 3ST7A 1KTIA 4DLVA 5FFNA 4QM7A 2BI7A 3RLIA 4ESOA 3FTFA 2NSJA 2PRIA 4JI0B 4RJJA 3A10A 1J90A 2WHPA 3MB8A 4B75A 3GWZA 1HPLA 5TR9A 1W96A 4UD6A 1Y1SA 3NCTA 1UBCA 3QKUA 2H85A 2OKGA 4YR7A 5KSPA 3HO8A 2Q2QA 1IOZA 2CHEA 2QPLA 3B6MA 3SXUA 1KKUA 2FHSA 5ARBA 1Q7EA 4KLAA 5KTSA 1OVGA 1WNTA 5J9FA 5AW3A 4QNMA 1V4BA 5EZYF 1BU8A 1QE0A 1NXVA 2YNMD 2PD3A 4L9RA 5G0WA 3D64A 3A4MA 4UD2A 1EB8A 3BTUA 1GAWA 2DKFA 3NNNA 4C8PA 1T4GA 2ZCJA 3KL2A 2BMEA 1W4RA 1YTLA 1Z4IA 2BHSA 3ZWYA 5KPJA 1W88B 4B43A 1J70A 1VSTA 1SURA 1S2OA 3D1LA 3UEOA 1HKUA 4JP1A 2OORC 4N82A 3BJMA 5HS4A 2A9OA 5EZQA 4GLOA 1P1CA 2DPYA 1PU2A 3K9TA 3A6GA 1ZCAA 3M70A 4MQMA 1GA6A 1MB0A 2RHMA 1UADA 3R5XA 4LHZA 1EE2A 4LJSA 4MQLA 2Z6QA 2B94A 3QXGA 3DW1X 4L8VA 1FA9A 3KOXA 3ZYCA 2O0HA 2HRBA 3FH0A 4ZYTA 4CKXA 1OJLA 1RVV1 1T9CA 4MV8A 2CNNA 2IDMA 4U2DA 1JAIA 3WHLA 4AS3A 3C3CA 2QQEA 4BNNA 2EQAA 5KOHB 3THYA 2BE9A 1OXSC 3HHPA 1JWBB 3MGAA 3PIRA 3RS7A 3W5JA 2VRNA 4QATA 2JI8A 2W42A 1HLDA 2PGAA 2YMPA 3M6FA 3OZFA 4LZPA 3A9WA 1DEKA 3KQMA 2HMTA 4KSYA 1BJTA 2V6GA 1ISSA 2OLSA 2IYFA 2Y1EA 2XF2A 2ZIUB 3V1LA 1OBCA 2G1PA 3U1BA 1QTRA 4AJKA 5JJIA 4OEHA 1YAHA 3PF8A 3D8HA 3DMPA 2L69A 4D0SA 4J3NA 2YYAA 1JG7A 1QRRA 4I36A 2F55A 2HHLA 4EW2A 5C81A 1O0BA 1JHYA 2QW8A 3QF4B 3EFHA 3RSQA 5A4IS 3QYPA 5CDHA 2H16A 1NSYA 1KOGA 5KNLA 2EP5A 1RYZA 3NG1A 3ZV6A 5H80A 4HV4A 1DAIA 2V7BA 4R2IA 2VP4A 4FI3C 3QSGA 4YV2A 4RHXA 5FWYA 4AJLA 4AZ0A 2IA5A 3L0SA 1C8KA 1SBYA 2Q7XA 3BK2A 2CE2X 3ZBTA 1GKUB 5K4GA 4EPWA 3BIOA 1A9OA 1ZHFA 3CA8A 1QF7A 4CMHA 3KYDA 1BWQA 2UYYA 2ID7A 1II0A 5EHIA 1X42A 4IZOA 1YB5A 1EFRA 2Q3MA 1N0HA 4M55A 1E79D 1HI9A 1NGSA 2AN3A 3HGMA 3VR3D 4B46A 1RAAA 2FSGA 1RXUA 4RHFA 4OHBA 4MR8A 1X38A 3VDQA 3VNQA 3RRXA 2PPLA 3CF4A 4YFYA 4ZDIA 1YA6A 1EBFA 1YU9A 2C4NA 2QVGA 4RMHA 1CB7A 2OR3A 5H81A 2HJGA 3IV6A 1H23A 3U56A 1E2JA 1JDBC 2I67A 3PHIA 1THTA 4Y9TA 2XB2A 1WM1A 2N0SA 2WAMA 4CF4A 1JSRA 3DE3X 4U63A 1NUHA 1TQ4A 3T7KA 1QYDA 2NXEA 2N47A 3DOJA 3LX5A 2NM0A 3LP5A 3IR6A 4G37A 4L4ZA 4V0KA 4UVGA 2C6GA 3GGCA 3N6RA 3NEAA 3NHJA 2NXJA 4GVLA 4B7UA 5IKMA 1P33A 2GBPA 4EJSA 1O0SA 4EMSA 1R0ZA 1P4RA 2L2QA 2XGSA 5KPDA 3ME5A 4HXGA 2BEVA 2NV0A 3GG9A 1UC8A 5HIKA 5AVOA 3RUIA 2ADOA 1BE0A 4DR4B 1Q44A 3GELA 1JJFA 3K32A 3NFYA 4RD3A 2GERA 2IYEA 3GUCA 1W1UA 4G85A 4FI3F 1I3LA 3OOHA 2MSKA 4IDEA 1ESDA 2C6PA 1JIVA 2I55A 2IXFA 2VDPB 3DKPA 1F6DA 4CKEA 3KT3A 1D6MA 2FW8A 3L93A 2BM0A 2JG3A 3KEMA 2CXNA 1B8VA 1GZ3A 2WJWA 3QXCA 4M9ZA 1U31A 4C0WA 5A6SB 4PANA 5B1DA 3QBTA 1NXOA 4G5XA 3C5VA 3RU7A 1GRVA 4AZSA 2ZLBA 3EQ7A 3UK1A 4EHHA 1FTNA 3G82C 5T3UA 3EVAA 5IX8A 1XMPA 1WTCA 4NOKA 3E8SA 3DSRA 4XIGS 4F3TA 1K6XA 1HDCA 2AMFA 2C07A 2EF1A 3PPVA 5ADHA 1RAHA 1Z17A 2HV9A 3HA5A 1LS1A 1OWLA 4JH0A 2NNLD 4JUFA 1U3FA 3G13A 5EMJA 4YP7A 4CTKA 1A9XA 5DWQA 1DXHA 1UWLA 2RAVA 4OFWA 4QDXA 3GZNB 3PHHA 4X1YB 1D2HA 1OB2A 3SQXA 2A1UA 3FPFA 2QF7A 3Q7EA 5C4GB 4X91A 1A7KA 3EBPA 5J4HA 3Q72A 4JR2A 3QPCA 4KKXB 4YRFA 2RGEA 2XHEA 221PA 5DRTA 5HW0A 3QLUC 2QRHA 1ID8A 1JG1A 1MCZA 4WECA 1GNRA 2Y4OA 3F4KA 4INZA 5G0SA 3UXMA 3Q9SA 1F8YA 1SA0A 1GZVA 2MYNA 3NEJA 4HB0A 1Z12A 5D8DA 4A73A 2FN7A 3DCYA 3EGWA 4UDXX 4WGFA 3CH6A 5HOQA 1SG0A 4NNJA 3DULA 2I6QA 4FYWA 4BKUA 4NFYA 4BE4A 2YJNA 3RHSA 1OXBB 4H4CA 1QWSA 3ORSA 2N3ZA 4IF4A 4KV9A 3WLHA 3H8WA 3MTQA 4IDCA 3RT9A 2BM9A 2PK3A 4UFOA 3B8HA 3D3WB 1CS4C 4TLEA 1KAGA 4DKXA 5AW4A 1O08A 3I9V6 4FBLA 1F1JA 3A8TA 3AUSA 3HI4A 4EUFA 4F6CA 4ZOCA 1BRTA 5BN3A 4IXTA 3SM3A 2AFRA 1LPPA 2QPAA 2RFLA 3LIPA 5CG1A 1E2GA 2PKQP 3MK31 4QARA 2RGAA 3WLSA 4C6RA 2ZBFA 1RNLA 2PVVA 4Q3EA 2XGMA 1IONA 1TYDE 1U6JA 2OENG 2C82A 4FS3A 4XUGB 3SS8A 4QPDA 2WNSA 1PT8A 3UCXA 3ZY3A 2I3ZA 1QG6A 3L9XA 2WJIA 4QREA 1JW9B 2RGCA 3AB8A 5B1EA 1ZI9A 3U7QA 2IS4A 3I83A 1G8FA 1TCCA 1TMOA 2QRVB 1OXKB 2I7CA 2CZCA 4MI1A 4ZEVA 1AN0A 2VJLA 5FBHA 4XFKA 4AP6A 2F3SA 4GECA 1C7FA 1IE3A 1L7BA 1UPAA 2GETA 2VPXA 4WN9A 1JBEA 4BFLA 4A36A 1DGQA 1I32A 3TDMA 3BTOA 3EA4A 4YP9A 2R85A 1R27A 3A3NA 2NZYA 3EPPA 1P60A 1KH3A 2QRNA 5J2UA 3D4IA 3PLAE 5A0TA 3VSAA 3T7RA 2WLTA 1BCSA 5D7BA 5BR7A 2FSPA 3AEUB 4BUZA 4MV4A 3GDHA 2JLAA 3SQDA 4LFBB 1WUIS 4EBBA 4S2UA 4LSGA 3IE2A 1W36B 3D8TA 2IXAA 1BFUA 4DC0A 5IDWA 2IP4A 4Y9SA 2RK3A 1DG9A 3NAZA 3PNKA 4B48A 1YF3A 4AY6A 1O4VA 1E4YA 1Y8RA 2F3QA 2I78A 2XLCA 2G07A 4OL0A 1CQJB 2J59A 3OCVA 3V3TA 5HG0A 4BLTA 1R15A 2P6MA 1JDJA 4UOEA 1XTTA 2WT9A 4G65A 2DG2A 3CH5A 2XUJA 4LOAA 4ZANA 2J8ZA 2F62A 1LD3A 3AM5A 3R5KA 3TL3A 4JBNA 3AETB 4EA7A 4A91A 2BTOA 4I55B 3PD0A 4RVFA 1B8UA 1DLIA 1RI3A 3RHFA 2JBJA 4IHJA 2CHUA 3B6IA 3EAGA 2P7IA 1PF7E 5HMMA 4XWKA 1CX8A 3UAWA 3DMHA 4MZXA 3ZGVA 3SYTA 4D82A 2FEOA 4TTTS 5CNMA 3N8NA 4TKVB 1ZBQA 4KR9A 3AB3A 1JQLB 3O4GA 4HBGA 3AV0B 4LOHA 1P2BA 5IAEA 4Z0TA 5D6NA 1YZVA 5IVDA 1KC1A 4PX2A 3K0AB 1HKHA 1YQWA 4J0HA 1VPWA 4FSHA 1V3TA 2JRCA 2OV2A 3B48A 3H1FA 3HPQA 4JLUA 4PV7A 2X2OA 3ZDBA 4DXAA 2Q27A 3QNMA 1XD8A 1NBOA 5P8WA 1GRCA 2PT6A 4XQCA 4D4HA 4BNDA 4RL6A 3T61A 1E6CA 3GCGA 2QKYA 5DTJA 2W11A 1ZVVA 1AVTA 1DWPA 2IHBA 3ABRB 3DR5A 4DDTA 1X7DA 1XFAA 3AKEA 3SZ3A 1GQSA 2ZI4A 4ROSA 5LP6C 5LQCA 3GFSA 1FJHA 1HM5A 4LKOA 4XWAA 1E6UA 1JEOA 2EWMA 1TQ8A 3D3QA 4N01A 5HS6A 3WWDA 5JNRA 1Z62A 2BFEB 1RWVA 3FA2A 2HK9A 1SUAA 4I1UA 2G5CA 1DIBA 2RI1A 3LBIA 5KTKA 5C52B 2P5YA 2HDWA 3WB1A 5LMCA 2PBLA 4U7FA 3ZVKA 4MQBA 2YCBA 4B0PA 1JMVA 1XA0A 5BYKA 5JXHA 3FECA 2BGLA 4GKAA 1OAKA 3KP1A 2JD1A 3U49A 3IVCA 1S7CA 4C4PA 3MG9A 4GXNA 2WJAA 2QTHA 3WNDA 2YIMA 4U2KA 4CCYB 4CDRA 1NKVA 5J2TA 3MHPA 4I4TA 4JFAA 1Z2OX 4URWR 4G1BA 2EXXA 2XRFA 5KOYA 2WW8A 4GLLA 4QUHA 4XGNA 1ZMTA 2ZT5A 4Z4EA 4Q4JA 4N18A 5JMOA 4CL0A 3S1SA 4M8NE 3TIFA 4DAOA 2WI8A 3JYHA 5CM2Z 2Z43A 3IDFA 3I52A 8ABPA 1SVKA 2AOTB 1XLUA 2E6KA 2H1IA 2N1MA 2W2OA 2X6TA 1EGMB 2Z6VA 3EXIA 3JQGA 3N05A 3N76A 3OHSX 4ZRDA 2FMKA 4BX9A 1U3GA 1UUFA 5AW5A 2IXTA 3AUKA 4LSMA 3V1NA 3O83A 1I5EA 5JEDA 2ZM5A 3PV0A 6GPBA 2R1ZA 4DWOA 1Z6QA 1TO1E 2N42A 3TNDA 3T4PA 4OOFA 5KUTA 3RC3A 3DBLA 3PQEA 1M1NA 1RKXA 5BMVA 4M21A 4OXXA 2CVPA 4HYQA 1DBSA 1LW7A 1SC6A 3R7BA 5F77A 4CMIB 3Q98A 4BGIA 3AFGA 5JY1A 4G4IA 4J91A 3B2EA 4LJKA 4YDQA 1QIDA 1TCBA 2XZPA 4H35A 3ONFA 3TSCA 1IZ0A 7MHTA 1Q92A 4E32A 4X5OA 3FR8A 2PV0A 3GEPA 2OD2A 3DTNA 4KQGA 4BE9A 2BFDB 2Z0MA 1QOZA 2DQSA 4TV9F 1FMCA 4DTCA 1ODTC 2IEIA 3JD1A 1VJ0A 4JEUA 4B6SA 1H2BA 3ZLJA 2GCEA 4JHXA 2NACA 4L22A 4ZVKA 3VO9A 1J6UA 2IZ1A 2JFQA 3C4JA 1NX9A 3VHXA 1G63A 2HSWA 3ZBQA 2ZPUA 1LC0A 2CNLA 1UPUA 2HA3A 3ZHRA 3KG2A 5BR4A 1TEVA 1Q16A 2CJFA 3IMFA 3F9RA 4IWNA 5CVJA 1BROA 3W1WA 1E3MA 1P5HA 1TM4E 4UEKA 5G0VA 1XXHA 1LGYA 3EVCA 4DIOA 2ESRA 1GTSA 4QPCA 1R6AA 3HEMA 3P9NA 2W2KB 4O2AB 2IHTA 3IPYA 1J09A 2QQGA 4DXDA 5P21A 4FNAA 5LXTA 2O54A 4Y0VA 2ZRIA 3ZVRA 2YC4C 5KZMB 2CCGA 4JOCA 3U3KA 3CR8A 3DF7A 3ZTTA 2ZSAA 5AM5A 3EX7C 2A4MA 1P7VA 5HBGA 1KOLA 1TIKA 1V8FA 1SH7A 2Z5FA 2B0JA 1N9GA 3I3OA 4HYEA 3F3SA 4OLBA 4NULA 1U7HA 4HDSB 3HKBA 2WE8A 3GEEA 5IEBA 1MTZA 3QY0A 4X6LA 3IFSA 2ZR7A 5K03A 1DLJA 1D4FA 3URKA 4ZAVA 1VBFA 1RYDA 2H2AA 3B9PA 3HJRA 4AULA 3O38A 1IUKA 2FRXA 3DKRA 1R74A 2QJRA 4G4GA 4F4CA 1AMOA 3IUNA 2OL4A 3S99A 4EYGA 1JA9A 1JKIA 1M0WA 2JA1A 1QHNA 1Q17A 1SKYB 1TW2A 3CRNA 1JJAA 2PUHA 3FRIA 1LB1B 4LYGA 4PYNA 4CM8B 1QK3A 4ENSA 1VLMA 1KMHB 4S1WA 1GFWA 4WN3A 3IR5A 3LFTA 5KDOA 3FUWA 4C5CA 1XTIA 2HTFA 3CW2A 3A6EA 4ND2A 4R1QA 4U02A 3WKDA 5JAUA 3RADC 4XCVA 3EZFA 4TMYA 3WL6A 4JC0A 5ELLA 3W7BA 3L7CA 4Z0NA 4E5NA 2RGRA 2EZUA 3RU2A 3NIFB 3TW6A 2DTDA 1Y8AA 3DZDA 4ZHSA 2QLBA 5TF4A 1DBQA 4LDAA 1U5BA 3O9MA 2Z4TA 2ATIA 1DMRA 4J1QA 5DNWA 4I3GA 3VYRB 4KEAA 2W2XA 2FPIB 1E9BA 2YS7A 3G0GA 3ZZNA 4CKBB 4DHEA 4LDRA 1JFSA 2XAUA 3IUMA 4GR9A 2L0XA 3DBIA 1DCKA 3FYCA 3LUBA 1HORA 4YAIA 1JKXA 5LU9A 1FX0B 2KPOA 1Z26A 1N92A 3SJ7A 4A8JC 2PYIA 3BULA 4EFKA 4GDFA 4P81A 3BL6A 3ESZA 3TR6A 5E4FA 2G0AA 3CLVA 1Y80A 3JWPA 1W8IA 2I4RA 2OAP1 1QH0A 5CCBA 3OUTA 4P36A 3SLKA 3NP9A 1X9GA 2KX7A 2MSDB 3HR8A 4JJZA 4S1NA 3RD5A 2IIVA 4WZAE 3LOQA 5MDHA 1LNSA 3LK6A 1JKFA 2DFTA 1W8DA 4AB1A 2XWSA 5F51A 2FRVA 3FW1A 4J4BA 2DY0A 4U7WA 3RQIA 3WXMA 5TF0A 4EATA 4FB5A 5CA1B 4EKIA 3DVRX 3O2JA 4FMBB 1W34A 4D9EA 4OBBA 2HU8A 2VEOA 3E9CA 3O0TA 1IIBA 3AJEA 4K3VA 2FWMX 4RD4A 4I2NA 3DLTA 1DP4A 1TM2A 3DVSX 1Z22A 3SYLA 2QD4A 3QOWA 2VHUA 3DZ8A 4WZBB 2QZPA 5KYNA 2F64A 1M83A 2WZBA 4V39A 3H3FA 3I1IA 1P5FA 1JU4A 4JWTA 2PGLA 4L6IA 1H5UA 2AOWA 3BEOA 4NYJR 2GXQA 1G5IA 1E7MA 4IV8A 1KJ9A 4A6EA 1G6OA 3RAFC 3ROFA 1V7QA 5T64A 2Q0SA 3IELA 4X45A 1C8VB 1X1AA 1NQTA 3K8QA 3NHWA 3D4BA 1Y98A 4R3UC 2FV8A 4P0TA 4CT0A 5E6SA 5B53A 3EAQA 3KT0A 4UNQA 3FFAA 3X1YA 3IMCA 1A9ZA 4CEHA 3G23A 5EXPA 3PWTA 3DUFA 4LWPA 3AESB 4LY9A 5ENDA 3TLBA 2FR1A 1AU9A 1UMDB 2ZBDA 1X8JA 5KVAA 1VSBA 1DAEA 1EVZA 2R5NA 3OT1B 1I80A 1GKLA 2HLDA 1H1LB 5C1IA 1L5GB 1PI3A 1VKOA 3ISJA 4KO1S 4Q9AA 3GFGA 5AXCA 3U31A 3KEOA 2IEDA 2NLOA 4MJ3A 1QO9A 1RRGA 4GH5A 2JH9A 5B4TA 4LF9B 2XX3A 4Z53A 3HLYA 3OFND 4BO5A 3OIWA 4ZEMA 6LDHA 1CT9A 4URUR 3LS2A 1KFKB 5F23A 4M7OA 1U3DA 3KQQA 5A7FA 1HZJA 2GF9A 1N25A 1H5QA 2WSSA 2JARA 1R8SA 1GG8A 5FRDA 4RTMA 3CVXA 4KR3A 1QO0A 4TXMA 2JLWA 1XJWA 1RWQA 2EBHX 4GP9A 2F7SA 4ESHA 5GJVC 3IULA 4M53A 1AY0A 3U7FB 1S3FA 4GF5A 4LXIA 1R10A 5AW7A 1B8PA 1PE0A 5K8CA 1ZICA 3EZYA 1CU1A 4YS6A 4GEGA 3ZG6A 4F5EA 3I58A 2JZOA 5FIUA 1S89A 1OWMA 3O3MB 4FLFA 4G0YA 4KO2S 3ZWMA 4IGIA 5BSTA 1NR7A 3IEXA 1G6HA 1KJYA 3U7RA 1C8BA 3U4GA 2GJ4A 3FKJA 5IW8A 3WGVA 3HBNA 2H7VA 1JFFB 4ZOBA 3JU3A 4B9AA 1U65A 3JD3A 2G17A 2WVHA 1EESA 5AD1A 3FFWA 3MWYW 1E9DA 5FB3A 1G9TA 2QM0A 3RVBA 3NH6A 2JDIA 2EZAA 2F43B 2FZWA 4JLOA 4LSZA 4QYMA 1T8RA 4IO1A 1X13A 2HMWA 2JFXA 2ZWVA 3S2EA 3EEYA 2I76A 1NKTA 1UFOA 1USKA 4JXJA 4C05A 1AN9A 1KQOA 3M6UA 1IXZA 2Z2ZA 4BMXA 3HDHA 4UHJA 1X1RA 3TFOA 5D3MA 4XEHA 4UQOA 4XDYA 5EJ6A 3MWDA 1B7GO 4P08A 3A58B 1OR8A 1VKZA 3MOGA 1KY3A 4UTRA 1KI2A 2FLWA 3R3YA 2Q6IA 4D2IA 3BWEA 5K8IA 3H4TA 3P26A 1K8ZB 3NTLA 2VQEB 3FPGA 4PPGA 4BU0A 4BNFA 1OT3A 2CDBA 3I8SA 4NRDA 3B52X 5JNWA 3T05A 3NWEA 1EQ2A 3JSXA 3U2QA 3GI1A 1HK7A 1SXJA 2E4VA 4S0ZA 5J4YA 3HV0A 4O1IA 1SCUA 5KTNA 2TMGA 5BSMA 1V4VA 4M98A 3OX3A 4UHKA 2BOVA 1Q0UA 3IC5A 3P27A 2G9UA 4QTXA 3RT1A 4B35A 1AG9A 3CN9A 3THWB 3M6WA 3TMYA 3SNKA 2M6SA 5A5GA 5BORA 5IT0A 1P9OA 2O7NA 4OQXA 4YRZA 3BAFA 4LFCB 3S8YA 2PMDA 1FX1A 1RC1A 1GZHB 1YL5A 3IH5A 1T5IA 3U40A 1Z68A 2JFUA 1F51E 1ID1A 1KTVA 1R4AA 1TFUA 1TL7C 2EOAA 4LCEA 3DTTA 2GA9A 1U0TA 5EE0A 5CCDA 1C8LA 2PGIA 3FMVA 4YP5A 4EYKA 4E2YA 1NAHA 3ZHYA 4WCVA 1EG7A 4CMKA 1MAVA 3OQIA 4CNBA 3AF6A 4KP7A 2MU1A 1Z5NA 1Y4DE 1BGVA 1KEZA 2WWRA 3EGXA 1JPNA 1FYVA 3EVZA 3PCXA 2CIJA 1DJNA 2HF7A 2IDJA 2WC1A 3B89A 1GKKA 4MUNA 4XCXA 1L4UA 2OM6A 3U39A 5C8VA 5EN4A 4J2OA 4ER6A 1N1EA 4Q7QA 2C8VA 1ISGA 1Z74A 4RAQA 4KQMA 3AY7A 1B26A 3DMRA 1T3GA 3QBDA 1QU2A 3VYTB 4CFYA 3B85A 1XLTC 2C2GA 1E0SA 2E4UA 1M73E 1I2DA 3LX6A 3DZJA 4PS0A 4Q1AA 1DUIA 3N1UA 4GO1A 4DLNA 3OQNA 2XEJA 3QU2A 5CH8A 3WWPA 3BHXA 2AXNA 2A92A 2FEPA 4MGHA 2G0NA 4WWHA 4LHYA 1HYHA 4L3VA 2VLIA 3FFBA 4P33A 1E94E 3KZKA 4CUJA 2EWVA 1LDBA 3KR1A 5BT9A 3NM6B 3ORQA 1M2OA 2GTPA 3AR5A 4NE2A 3ZZUA 4EVRA 5EXXA 4DNFA 5L7WA 4S0XA 1K0UA 4F06A 4FFBA 3GU3A 2EQBA 2PANA 3SE0A 3A11A 4CF6A 1CNMA 3TUJC 1KI1A 5CXXA 4BJ5A 3WQSB 4PYMA 1PJSA 3IUBA 4DBLC 1USUA 1NYRA 2WA2A 1Y7LA 4MKIA 2TMYA 4HDKB 4M3NA 1V6CA 2X9VA 4YRBA 3UXEA 4MDFA 4HFNA 5F1PA 5AYVA 2YVQA 4IZHA 3V55A 4ZYWA 1TVKB 3EAFA 3LUAA 4CMBA 3C5HA 1ADYA 3FGOA 1TO2E 1T2VA 2Y0CA 4BFSA 4M9CA 2AEMA 1TPZA 1VM6A 1G1AA 4QODA 1MB3A 3O8NA 4QU9A 2P6PA 4UUPA 3VRHA 4BS9A 2Y68A 2GK4A 1CQPA 1CUZA 1E9EA 2IIPA 4BEJA 1TDJA 1Y1PA 1L4NA 4FFOA 4PIVA 4UBMA 1N2HA 3H1AA 4AMVA 2V03A 3IUEA 4F0JA 1DHRA 1I0LA 1PCXA 1NASA 2GDZA 4A26A 3HRKA 5CUQA 2BFAA 2QDKA 1NUPA 2D2EA 4BNWA 4GOMD 2YXLA 2WNIA 3KPVA 2YWEA 2AC2A 3DVQX 2XOEA 4UHHA 5ER6A 3KD3A 3V97A 5F1OA 5IKXA 2DUNA 1O5TA 5BW5A 3E23A 3W2TA 5DCWA 1OIXA 3E5HA 1CUBA 1VCNA 4NBWA 1ANKA 4FD3A 4IVNA 5HKKA 1Z2AA 3ECAA 4O0LA 2Q5JA 1WEHA 4R8VA 5DT2A 4BBPA 2EFJA 4AXXA 4QU0A 2OB2A 4QGAA 1OBHA 121PA 3K1YA 3ZVMA 3UV6A 3EFOA 2IBMA 1MZVA 2WWWA 3JQ9C 4MUIA 3L0ZA 1B1AA 2REQA 4ZN6A 3KDPA 2Q5CA 4MYUA 1JH9A 2B8WA 2VXOA 3DEHA 4GYYA 1BCRB 2Y3IA 2JIDA 4B09A 3GUZA 1QSGA 1XYVA 3FYHA 3B5EA 3H9BA 1WUYA 2DMRA 5D01A 4DSAA 1JU9A 1BMFA 5EKXA 3NHKA 4C4RA 1QRDA 1OTYA 2GZSA 4RF2A 5TV2A 1SXJD 4MJXA 3U1VA 2G40A 3D0RA 3WGOA 4G9GA 1WZNA 4Q3AA 1KQNA 5GVRA 2IY9A 4O1MA 4YQZA 4ENWA 3L7AA 1QVRA 1MJGM 2GJAA 3TBKA 3L07A 4KJZA 4R9SA 5G0UA 3H5OA 3OX2A 5FUWA 3EIWA 3T7SA 3WDKA 1E59A 4DMCA 4FUQA 4DHWA 2CMDA 4CV3A 5KHAA 3ZWWA 1EXVA 5COBA 4RD1A 1Z16A 3U81A 4FLMA 4KX3A 1D4AA 4RZIA 4ENQA 4BNKA 2X2EA 3Q10A 2WF8A 4UCWA 1YJ8A 2IZ0A 3IQFA 1PD0A 3MZ0A 2WILA 2YFQA 4TMXA 1GL6A 3GPBA 4A8HA 1QZTA 2EAUA 1ILEA 3OM1A 2ZGVA 3WIVA 3H5AA 1M2JA 2EHDA 4YFVA 4DV7B 4BLRA 1YDEA 3KQSA 3WFZA 1QKJA 3RS9A 4KGDA 4L74A 4YCBA 3ZV5A 2XNDA 1DPFA 1Q11A 1UMBB 5JATA 2WF9A 2M1ZA 5DXJA 2YASA 2C4UA 1R5BA 3M4ZA 4ZU6X 3WGNA 4BFVA 3ANSA 1PK9A 4J7XA 3W6NA 2QJWA 3KKPA 3QF7A 4TRJA 2J87A 3VKFA 4ILEA 3ZUPA 4BC1A 2DU8A 1Y1QA 4RK7A 3C24A 3PUXA 2F1IA 1TYBE 2P8JA 1F4LA 5AJTA 2WM8A 4QJ5A 4JQZA 4LX0A 1MOQA 4EKNB 5AM2A 2JAOA 4WLVA 2J3IA 1NMQA 2D0OB 2GR9A 1Q20A 5J2UF 4OHXA 4UTZA 2JIZA 3CNHA 3K0BA 3CLHA 1SC3A 1U7OA 2V96A 5HM8A 2VP2A 5ELXA 3AVUA 3Q3EA 2QYSA 2JA2A 2NO6A 3UUEA 3ZDZB 4LE2A 4PYQA 3LUCA 4D3DA 1RLMA 3RG2A 1NMXA 3S68A 3SLGA 2O8CB 1FP1D 4WFQA 3FYTA 3PRHA 4F3NA 2ILVA 1JZSA 2I87A 2HNKA 4J0CA 3OFVA 3RK4A 3UH1A 1VBGA 4IOKA 2J85A 2ZVJA 1KU0A 2PH5A 3KVOA 3BGVA 1LSJA 1RZ3A 3MA0A 3U4CA 4Q4CA 3JRWA 4TTIA 5JMPA 3G5UA 1R6XA 2VP3A 3CRZA 4N5LA 1T2CA 4N65A 5DHFA 3PIDA 2PA3A 3BRWA 1CUSA 2M6KA 4BO4A 2AVNA 4B6GA 2BJHA 1DFHA 4OXRA 2QIPA 2WD7A 3PHBE 4A5SA 1N5OX 1T3SA 3AL2A 4LXXA 2R62A 5JZMA 3LECA 4Y2HA 3NDJA 3SX4A 2FJ0A 4O2BA 3EVGA 3UHOA 1UXJA 3OQPA 3JYOA 4US1R 5IDQA 2Q3CA 3H2IA 1R2QA 2WY2D 4OHCA 4F3RA 4EECA 3VBEA 2D6FA 3L7DA 3L7LA 2TS1A 1DE4C 1LBHA 2HGZA 2HPVA 3B1ZA 4WXYB 1K6JA 5G0TA 3VPGA 4RTQA 3R0XA 4DIBA 2X15A 3OFKA 1OJ7A 4HJXA 1TUIA 3E9EA 5TMDA 7REQA 2O2YA 1C3OB 1O6GA 4UAJA 4HC4A 5HKKD 1I01A 4ZGGA 4BP1A 1XVUA 2F90A 2VWPA 1VHQA 1Z2DA 1BZYA 2BMJA 1GNTA 1J2RA 1J8VA 2ZKIA 1DKOA 4YECA 1TD9A 1HQDA 1US8B 1SKQA 4CEIA 5LMUB 5ESRA 4JUDX 2ATCA 2QM8A 4YP1A 5ICSA 2XD9A 5FOTA 4DL9A 5GWXA 5DZSA 3N2ZB 3P5SA 2O0MA 3GY0A 4QLOA 2SKEA 4RC9A 1M6NA 5FO0A 4EB3A 1E3JA 4Y2RA 1EZ1A 3DAPA 3IP3A 1TLTA 4M0PA 4DCJA 1Q0QA 1DC3A 1Z4LA 2NO0A 5TX7A 2UZ3A 3QSYA 3LQFA 1J42A 3HQ4O 1ZUIA 4PLVA 3P0FA 4DMHA 4AMBA 3ETJA 4K87A 2QL6A 2IUTA 4I4TF 3SF8A 3UHJA 1H9BA 1PJBA 1QNLA 3CEPB 4PRKA 2ZXUA 3OE4A 4W5TA 2WKQA 5CMLA 4QUGA 3DZGA 1SK8A 4LSWA 3WLPA 1II8B 5CVEA 4OYLA 3AHHA 3VOAA 1L7DA 2VHYA 4CV0A 2P79A 5FJJA 3CZ4A 1JZTA 1SUDA 4BFTA 2GEJA 3QPVA 4Y9UA 2AD5A 3VKVA 4ZI7A 2O1EA 2OAQ1 1YR2A 3UCEA 3EVTA 1YTUA 4ETWA 1FJXA 1G18A 3ZWBA 1JDUA 4BMNA 4ILKA 4Q1VA 5KX5A 1LPMA 1WLYA 4RF3A 3EYAA 2YV5A 3G8AA 4H6VA 3H17A 4X1KB 1VIVA 3N8IA 1E20A 3TQFA 1C4WA 2GN9A 2Y1LA 4FKZA 4D9FA 3BG5A 1J2JA 1RIIA 5FBWB 2Q6LA 2Z1NA 4B4WA 1WKBA 3M2PA 1TFRA 3O3CA 3CN7A 1SAYA 1ORHA 2FMIA 3KPWA 3ZW9A 5KU7A 1JDPA 2EJBA 2E1RA 4OSOA 3BGDA 3TFQA 1WU7A 5A06A 3B20A 2O2XA 1QQ6A 1YSCA 1J8DA 4JX8A 1E2PA 4MIKA 4DNXA 1O95D 1ACMA 2UZAA 4WNCA 3WGIA 2E49A 2IC5A 4INOA 1FLVA 1FU4A 2R1TB 1VCOA 1JHXA 2C5FA 1BVYF 3RYIB 4DIUA 1P61B 1QS0B 2IGTA 1NUAA 1F6BA 4Q1DA 4UTPA 3Q85A 4FGZA 2AXEA 3PFHA 3TSWA 2B9EA 4GHWA 4EELA 2GN6A 2UYGA 2YBEA 5A5FA 5IZCC 5JDCA 2ZRFA 2GYVA 1XL0A 3NOJA 3UMRA 3QPUA 4GI3A 2GPNA 1C4OA 1F0YA 3N39C 2HJ9A 1SMKA 4HB3A 1E3WA 4GSLA 3PJFA 4U2GA 5DXAA 3VDXA 1K5HA 1EUDB 1O94A 4QX6A 4RFSB 5LXTF 2FPKA 1QIIA 2XPCA 5JQGA 2YY5A 3EVFA 3HVHA 3MUFA 3U1TA 2GYUA 2XADA 3NANA 5I7OA 3IGFA 4DLUA 1O96B 3R0IA 4KACA 1H42A 1I4OA 1A5AB 4ZDJA 3KZMA 1RPJA 1LCIA 3ECSA 4BNYA 1IOVA 3GNSA 1PSDA 4N8DA 4DBVO 1HTBA 1U3WA 4Y2XA 4ZC1A 1PRYA 3VOBA 2WG1A 5BY2A 1CY0A 1LRJA 5MFPA 3B12A 4PAWA 5A4JA 4D74A 4E07A 4I5EA 4YCAA 1NVFA 2IX9A 4B3IA 2GBIA 3KSRA 2IWRA 1YHNA 1J21A 4COKA 1SCKA 2BGIA 2ODTX 3HR7A 3OZSA 4M0UA 4Q24A 4CFSA 3NC4A 2LXNA 2XXAB 4K88A 1U0NA 2F8TA 4EW3A 4XD7A 1PZMA 5FPSA 2C5QA 3HP4A 1U3UA 1KSJA 1Q22A 3ZXIA 3IO3A 4EG0A 2W7TA 1KDRA 3DDWA 3K9QO 4YXFA 3W7VA 1H2FA 2WQZA 3VZBA 4DSTA 3C0KA 4FQ7A 3EISA 4UAGA 1I4LD 1MX5A 4WUTA 5LWQA 4R2JA 4WV3A 1S7GA 1Y8ZA 3PDWA 1VPVA 1PR2A 3ZE2B 3QXHA 4J7AA 2HNAA 4RIGA 2EBWA 2C88A 4PO9A 4UMFA 4EYOA 2I65A 2H4FA 3KPUA 2O8VA 3BXFA 2W2LA 3T3MB 3PR3A 5I7RA 1T0JB 3WLAA 3ORYA 3UB4A 3LCMA 4K0KB 4WOJA 1P1HA 1JDEA 2Q3EA 4BJ3A 4S05A 3EF0A 3ZE0B 3EZ7A 4KTVE 4MCSA 2IZZA 3IKVA 4NFHA 4CCSA 4EKEA 5KNCA 3UPTA 3KKKA 5J1SB 3K0HA 4BDTA 3V4LA 4GI5A 2LGJA 1EJ0A 2ECKA 3P9CA 2JANA 4I2VA 5C34B 2QAJA 2CLCX 1U0RA 3LYLA 1DWOA 3GDOA 3O2QB 3V7FA 1UAAA 3ICEA 2X8WA 4HH3C 5TMEA 1QX3A 1AF4A 3ACBA 3FCUB 4Q9HA 3SC4A 1KJ8A 2ZSHA 4PQRA 3VU8A 3T3OA 5DI3A 4WRRA 3UFXA 4F3CA 3ERCA 4HFMA 4BV8A 3GMTA 1GGJA 1NMEA 3NXKA 4YGXB 1J3LA 4UARA 1FEZA 2PTHA 1JQ3A 4RH0A 2HADA 2JGRA 3GLUA 5CA1F 4OSPA 3TEFA 3FWHA 4XRRA 5L3VA 3ZE1B 5JD3A 3O8QA 2PLWA 4IUDS 2CK3A 3J81A 4X9XA 1YRLA 3ESYA 3MPUA 3ZD8A 4B5KA 1BFKA 2O8FA 3PEVA 1KMIY 4B32A 4AY4A 2PX4A 3EARA 4Q48A 2PX8A 4EF6A 4D4MA 4JLAA 1FDVA 1N3YA 3KKEA 1K3FA 2Q8QA 4JZ0A 2A9FA 4L0CA 2WU1A 4FE4A 4AWAA 6Q21A 3VYVA 4R7GA 1DS6A 4LQGA 3MMXA 3VO1A 1YZTA 3G3EA 5ICMA 1BEUB 5DB4A 1BEEA 4E22A 3ND5A 4M1TA 1WD7A 1SULA 5E1OA 4C0JA 3COZA 4JB2A 2XA9A 5I3ZA 5KQMA 4WKOA 4TRNA 4PX5A 1EDZA 2ILTA 4PW0A 3TLAA 4DABA 4L73A 1XCMA 5BN4A 1ZD5A 2QE7A 4A1OA 1Z38A 2XMGA 2GEKA 4YQYA 2FWBA 3L6DA 1KO5A 1DG1G 1B16A 1MXFA 2J3MA 5CIWA 1WW2A 2FSIA 3FZGA 4RETA 2WFMA 3WTCA 3WVNA 4EPXA 1PJ8A 3NHAA 2UYHA 3RSOA 1WF6A 3DW3X 3AR4A 1ZO8A 3JATA 3N87A 3NIDB 1Z18A 4AJIA 3V00A 5BSWA 1UFRA 5KNBH 1MN6A 2BL4A 1HZZA 3H2YA 4LFAB 5GINE 2JW5A 4H7FA 1T1IA 2YV3A 1SBZA 3H4MA 1NSTA 3WYAA 2H7XA 3JVEA 4FGLA 1O6CA 2GEFA 3FPLA 2JIRA 3P1JA 3K9BA 4YJ3F 4N3CA 1V39A 2WHRA 1NQOA 1EYZA 1RWOA 1E0DA 2W22A 1FFSA 3ABOB 2G88A 4RVOA 1EGHA 4PAQA 2XQFA 4ATNA 2YFKA 1TADA 4KC0A 4CRWB 4FN4A 5JS2A 1USWA 1ZL2A 2BF7A 2XKBA 1AD2A 2OP0A 3QNWA 4DLAA 3GZJA 1FTSA 1KXJA 3CUWA 4KN6A 1UQTA 3GYGA 5DMXA 4ETNA 4CKWA 1TNDA 3M5DA 5EFOA 1VG1A 1W75A 1V7PC 1DBPA 1PGPA 1ZH6A 3ZWQA 4IIGA 2PEZA 2ADFA 3D7LA 5LQKA 5K3DA 3VKHA 1XKTA 3QKWA 1F1BA 3PXGA 4RW0A 1ZMXA 1NQXA 1Z2EA 3LNTA 3LOPA 3AKYA 4LJAA 4XD7D 5KWSA 4RY9A 5CB6A 4HADA 3REOA 1Q7BA 4TKUB 2D2XA 2A86A 1UDWA 4O8CA 1YUBA 5DNCA 5KWEA 5EJ2A 3L0DA 3IP9A 2QP9X 2HXYA 4HZGA 2JBAA 4G6ZA 3B2NA 2WT8A 4DR1B 3O8CA 4NBUA 4EHDA 3UAZA 3F7MA 5G53C 4CHTA 5DCUA 5KYXA 3FPSA 1XCGB 3H86A 2HIHA 4ND3A 4UJ3A 4YJKA 1SHTX 5SY4A 3WK7A 2FUCA 3LYUA 4QXAA 2OBXA 4YACA 1UBRS 1M0SA 2QD3A 3OCUA 5ENVA 1JDVA 2HH9A 3G17A 1PEYA 4CE6A 1XE3A 3LY5A 4BVKA 1XR3A 2JHCA 3VDMA 1MT0A 1WHTA 2H59A 1XZBA 3UGTA 2D00A 3AF1A 1O1YA 4OM7A 3E9QA 1HYQA 4I1IA 5E6RA 2Z1MA 5SICE 1U3CA 4DCCA 4CKCA 4E6PA 1EE1A 4OBEA 2G36A 3HP7A 3JRNA 3FKSD 5BOVA 2IBSA 1L1RA 1GQQA 2A5GA 5TT1A 3UTCA 1L7EA 2C5GA 4D92A 2A35A 3AJAA 1QHHB 3R76A 3TJZA 4RFLA 4OUDB 1Q7TA 4TYQA 5ECWA 1B73A 5KQPA 3AOEA 4PF1A 2HBRA 1KBQA 2TECE 5SZKB 4MR7A 1YRBA 2KI5A 2ONYA 4RD6A 1V9LA 4MYCA 2EKDA 3RARA 3WYBA 1ADJA 3RSGA 3W2FA 4MW5A 2X6RA 3TW8A 4TYPA 3WK5A 3RQSA 3VYSB 3Q8LA 2H1LA 2DUJA 3F46A 4KLZA 4O08A 3UOWA 3PX3A 1HT0A 2ANBA 2LPMA 1LLQA 1I6LA 1NN1A 1SZJG 2SCUA 1KR2A 1XXHE 1ZVMA 4RCVA 3FOWA 2CFRA 4BN5A 1NQUA 3GK3A 2QTGA 3WAJA 1NXJA 3H9GA 1DIKA 1QVAA 1NXXA 2I66A 2FFRA 1X3SA 1DQZA 1NVXQ 3WL8A 1X2BA 4OP3A 1PK8A 1Z0ZA 5KMGB 1XD9A 2WD8A 3RIYA 1KQ3A 3Q7TA 1T6BY 4BRUA 3BWDD 2H2GA 2WHEA 2AYXA 1RPAA 3EHEA 3OIFA 1GVHA 2X1VA 4Q4DA 4ZCMA