3TLCA

Microcin c7 self immunity protein mccf in complex with microcin c7 antibiotic
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
molecule keywords MccF
total genus 116
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlcA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlcA02
5F1YA 3U1BA 4IIYA 3T5MA 4E5SA 3TLGA 4H1HA 3SR3A 3TLGB 1ZRSA 3TLBA 4MJXA 3GJZA 5K99A 4INJA 5JYBA 3TLAA 4JVOA 3TLEA 4E94A 4EYSA 4MI1A 1ZL0A 3TLYA 5FD8A 4IIXA 5F9MA 3TLCA 3TYXA 3TLZA 5F5XA 2AUMA 3G23A 2AUNA
chains in the Genus database with same CATH superfamily
2QMOA 1IEVA 2Y0BA 3QX7A 5FOUA 3RJ5A 5KTTA 4HQ0A 3MN1A 3E9RA 4WNAA 4UUAA 3FLAA 1C4WA 4WFKA 3BBPA 3GFOA 4OJTA 4WZAB 3SS9X 3EBLA 1PX0A 2TECE 5IZCC 1FTYA 4DSNA 5E4JA 3PA8A 2Z2XA 3C39A 5HS6A 3VTZA 1E2LA 3GT3A 1IPFA 1ZXLA 2ZR7A 4KQHA 5HS4A 1I5OA 4C4TA 1LF5A 1ULZA 5KQLA 1RXYA 3ZIAA 4BVJA 4BAGA 3JAKB 3GGPA 1JDTA 4Q3BA 4P92A 2PCLA 5FPPA 5A3VA 1PI3A 2ZYIA 4MV5A 1ULUA 4D92A 5JBQA 3QH4A 4FK8A 1D2CA 2XMRA 3BPSA 2HWKA 1DAIA 3URMA 3VZCA 121PA 1K2VN 2NNWB 3KDSE 4LHSA 1GSOA 1KI6A 2UZIR 3GV0A 1SD5A 3KIPA 2O8DB 4K1LA 3RYHA 2OCBA 5ESRA 3NHRA 5T6BA 3UGTA 4BAUA 5AKIA 4TTTS 1XJ0A 2YASA 2ZI3A 1LSSA 1TM3E 3E03A 3SFTA 3QFRA 5L3QB 1J3LA 1VCIA 1D4OA 2CMDA 1GSIA 2IYWA 5K0EA 2HSJA 4RSHA 4P5DA 3WRYC 3PXEA 3DLTA 3WGMA 1N8TA 1PV2A 3FMVA 5I5GA 3GMTA 4W7HA 1XTQA 1XX6A 4RKYA 3OFKA 2FDRA 1D6JA 1W34A 1HE5A 3LE8A 1BGVA 3ORRA 2VEDA 4I81A 4XD7A 3NG1A 3RNLA 4B84A 3F47A 1XI2A 3V42A 1P1CA 4P7GA 3ZH9B 2H4FA 3QM1A 3MS7A 2QV7A 1NMSA 4TV8B 4ARCA 2BEJA 3OQJA 4Q4HB 1UAGA 3WIEA 3AUJB 1Y81A 4AJPA 3FZNA 4UHHA 3TMAA 2FW6A 2RARA 3C7AA 3KV3O 3NIDB 4F06A 1C3XA 3F5SA 3GJ3A 2WTUA 3OC0A 3CU5A 4FCWA 1SQ0A 2ZDQA 2OXCA 1VMIA 4JLDA 3CNQS 4FGKA 2Z04A 1RKBA 4LOJA 3SG0A 5IT9A 1OC4A 5C1BA 1NVFA 5JSHA 3VNRA 3DDOA 4HMQA 1Q83A 2OR3A 1E3SA 4EEKA 1KC7A 2QXUA 2AQKA 3RF6A 1PGNA 2AKAB 2DFDA 5FPKA 4UE6A 1RJFA 4Q3DA 1CYDA 1NVEA 2XWBF 2ASEA 3E6AA 2VDNB 3GZNA 3LX8A 3N6VA 4H59A 1NNUA 4RVSA 4U0KA 1OFHA 2V97A 1P5HA 2VR1A 3MCTA 2YOHA 4ALMA 1TAUA 4LMAA 2WWHA 1C3OB 1DAMA 2QAGB 4IQGA 4LY6A 3WB1A 2Z1NA 3QITA 4WWHA 1TCVA 2OTCA 1G60A 4D82A 2LVBA 2OO5C 2X8JA 1XVAA 3M9WA 3T1NA 3ZV5A 4BFXA 1N1DA 4PWZA 3W2FA 4M1YA 4PN7A 2UZAA 1A5SB 4NPCA 5JW6A 2ZRQA 4TV9A 1I2ZA 2MSEB 3U5TA 4YJKA 3OQHA 1KJNA 1ODLA 4EHHA 4TX1A 5EZYB 4CL2A 2XW6A 4PINA 1JFVA 1U2GA 7REQB 2EFYA 5H3HA 1P7WA 5JAUA 4DL9A 2H9IA 2IZ7A 3G9XA 4I3FA 4YCBA 3WOHA 2A0KA 3T0FA 1LC0A 3M6UA 1WLSA 2J9RA 4KWEA 1UC8A 4C08A 4YT8A 4DN6A 1Y6JA 2A1TS 4DXAA 4XB1A 1Z63A 2VPIA 5FUXA 2XXJA 4ETMA 2D1RA 4IAOA 4NOMA 2F3UA 3ZE1B 4D41A 2GXAA 1ZC3A 1GPAA 1Z2OX 4PU0A 5JC1A 2ENWA 2VSXA 2C9CA 4JVSB 5AW1A 4TYPA 2XY4A 5LC1A 1NTRA 2LRHA 2ZDHA 2Y93A 5DBHX 5KSOA 4G8DA 4A6PA 4RM2A 3QBTA 2JH3A 2QA5A 3BWMA 3IXMA 3UXEA 4D42A 1IBLB 1Z2CA 3HCWA 2WQ7A 3RUIA 2WVJA 2FWBA 2BFPA 2QUJA 1E2GA 2ZVDA 1MEOA 4RLSA 2EJUA 3MJRA 4RK4A 1EQAA 5EIFA 4MB0A 4QJ4A 5EZ6B 3T12A 4CM9D 4EM6A 3C87A 4GM1A 2EZ9A 2CJXA 2GQ0A 3OKCA 2DBZA 1NOIA 4PXSA 1C81A 2VQFB 2GTHA 1GM5A 3CLSC 3NCTA 5KWEA 3TX2A 1W2GA 2XOKA 3GHYA 4PC7A 5H81A 4B3TB 4DPLA 4I8IA 3ER8A 1I5RA 1TJ3A 5EWMA 4YUXA 1YMVA 5CDFE 1YZHA 2DH6A 3FDZB 4R9NA 4D9NA 1C0LA 1YA4A 1Z7BA 2ODBA 2ONJA 2ZJ6A 2QTVB 3IALA 1R6TA 3G89A 2PA3A 4B2YA 2QJTA 1M1NA 2BTQA 1RAHA 2WKWA 1X7YA 4P45A 3ET4A 5B1EA 1QKJA 2AMLA 2ORED 1SU8A 1NLUA 3A4NA 2WYVA 3JWJA 4MYRA 3MRTA 1IDN1 3M9XA 1X7WA 3KOUA 1ZGAA 3M3HA 1KMHA 1PO7A 3G88A 4PN3A 1TD1A 3H2BA 3TBFA 8ATCA 1G4UR 1GG2A 2CL5A 2CLKB 1JP7A 3CLTC 4AQ7A 2BGRA 4C0SA 2BWJA 4E5SA 3EE6A 4Q4JB 4L74A 4G1CA 4WH0A 4HGOA 3IX7A 3I5AA 4MQMA 5CRIA 4Z54A 5JSQA 3O94A 1AUXA 3QA3E 2VHQA 4RACA 5L9AA 1JHPA 2FG6C 4FB5A 1T34A 4A36A 3AHEA 3WGZA 4X3OA 4MCQA 2QBYB 1ESCA 2JIRA 2QGZA 2W6PA 2OYRA 2IPOA 4KLRA 3RYIB 1RLTA 1PFQA 4MWDA 1FA9A 3MAJA 5CVDA 3P9SA 1ZR2A 1PR6A 3LQKA 3ISJA 3EPLA 3HB1A 1NVGA 4AN4A 1QOQB 1S01A 1V8FA 3FOBA 4C4PA 3RTBA 2BP7B 3F73A 2JF0A 3JVDA 4J1TA 3TRDA 1ODTC 3I6SA 5CHEA 5DTMA 2BBSA 2RFLA 1TM7E 3S70A 4RTMA 1EVLA 4DR2B 3V2HA 4NBUA 3V80A 1RWMA 2H7CA 4Q9AA 5LOVB 3KBBA 3E8SA 2V3WA 3L06A 1YBMA 2DMRA 2XUGA 4ZVMA 5BN3A 2XKAA 4LF9B 1QQTA 1NW7A 4TJVA 3PC2A 3CLHA 3VPFA 3QYAA 5M29A 1YV9A 3U0BA 3FFBA 3I3OA 3TZ6A 2VT3A 4Z4HA 2GF2A 1B3RA 2VXYA 3T3NA 3SMQA 5LOVA 4PIMA 4MIYA 5BR8B 1BW9B 2GARA 4G6ZA 3STTA 4MWGA 2XZPA 1IONA 2FZLA 3PE3A 2C2XA 2QTHA 3BRWD 2ZB4A 3WRXA 3LC1O 1P8JA 5DLPA 1XMXA 2DVMA 2ZI4A 4U4AA 3U4CA 4ZTZB 1RBYA 1XU9A 2FWJA 2WA2A 2Q62A 4MLCA 3BXZA 3T4EA 4HXFB 3O3MB 5B3AA 2EJTA 1A2OA 1E96A 4NV0A 1ULTA 1AQJA 1U6KA 1ML4A 3EZAA 2RGYA 2WFLB 1DPGA 1P1FA 2C4MA 2FX5A 4JBNA 5AXDA 1LZKA 1SB9A 2QM3A 4DLBA 5FEUA 3QUAA 3FPGA 2YHIA 2AC4A 3AEUA 1Y5RA 1I36A 1UAAA 5JIBA 2P4HX 4X62B 3HADA 2D6FA 2W2TA 2VDMB 3LZCA 2IBSA 1E1CB 2ZJ3A 2ZSBA 2R5WA 3TX6A 1IC6A 1NXTA 4PR3A 2FDCA 3KUKA 1LLUA 5C5IA 1HWYA 3BDIA 4F3YA 1V3VA 2RAVA 2YY7A 4DGSA 4H0CA 3RUDA 2PXAA 2Q4TA 3Q0EA 4LGYA 4DM4A 5EKUA 3AWDA 3CGWA 2VH5R 3WNVA 3RR2A 3PNQA 2B21A 2IHKA 3NKLA 2WWWA 3CNOA 2D5BA 1KH2A 4UTOA 3RU7A 4CHGA 1T6ZA 3DLCA 3U7EB 4D26A 3W34A 2QTGA 4AQYB 3UB2A 4ABTA 3COYA 1KZ7B 3BRCA 1UBGA 5TQ0B 1KJYA 3OO0A 2K6GA 4XH9B 1XCLA 4CQJA 5ERYA 3CNLA 1H2FA 3FMFA 4MW1A 1E59A 4KV9A 1EWTA 1IHPA 2X9QA 2FOIA 3CPJB 3SSNA 3X2FA 5IUNC 5L4LA 1PUJA 5JVDB 4U2GA 1IXZA 2YC4C 3EF3A 3R76A 3IXLA 3L4BA 1SXHA 3DAYA 3ORYA 4LXYA 3H8WA 5FCDA 4BMSA 3UZUA 1JWAB 3D9QX 3L9WA 3OPYA 3I6BA 1UMDA 4OXQA 3GEBA 3QI2A 4PLVA 5DCYA 1R0KA 5LPNA 1PG2A 1AHHA 1WKVA 3TN7A 5JFOA 1J9ZA 3HN2A 4IWNA 5H16A 2ZR8A 1Z34A 4DG8A 3T54A 1V2GA 2PKCA 4G5QA 1C1YA 2EKQA 4QNNA 1ACJA 1HQDA 1SXJC 2VLIA 4JNCA 4Y6OA 5CDFA 1ZK4A 1YXMA 4P5PA 1DC7A 3ZI4A 4IHQA 1C3JA 2CMFA 3FBWA 5E7JA 5BN5A 3V4RA 3AWIA 4DDVA 1SCIA 1B6TA 1VJTA 5AW4A 2M2IA 4NF2A 1LI4A 3RYCB 2XYVA 1GA1A 5BNWA 4YXWA 2JLWA 1ENPA 1JR3D 4KNGE 2JFGA 1AKMA 3CC8A 4JJEA 1DWOA 4PLPA 4UUPA 3RVNA 1ZYUA 3ZHQA 4EUEA 5LQRA 1NZFA 1USWA 4NYMQ 3K2BA 4JT8A 1L7EA 4RGVA 3IAM6 1F20A 3KWLA 3RRBA 3WHIA 3NNNA 2P0EA 3E9YA 2AMFA 3F6BX 5CNJA 2I2CA 4BNZA 5GPBA 2JFZA 1GTZA 2Q6OA 3GX1A 3AINA 1VHQA 1TK2A 4MQUA 2C6CA 1Z6GA 1UFQA 1C0KA 2BHNA 4NBNA 5HWSA 2EZTA 4HPJB 4Y2VA 3T4XA 1T2AA 1LF0A 4UOQA 4KQ1A 4H6PA 1EH5A 4W5JA 4DZZA 2F00A 3QQPA 3W78A 2WU3A 1PJAA 1U7OA 3HCCA 1Y8QA 1XAGA 2XDAA 4LYFA 1HT0A 3T7RA 4DDMA 4EHNA 2WWFA 1KBZA 2PGXA 2W6QA 3VMFA 4ZYWA 5C1IA 1Z0UA 2FUG6 5B3LA 3OAAD 1Q2XA 1JG2A 4TWZA 2NU8B 5K8TA 4DANA 5B2EA 4G89A 5EGNA 2ZKLA 5EMJA 1D1TA 3ZTTA 1S8NA 2BHRA 4D0RA 2CUTA 2FPRA 3KYBA 1YZYA 1IUPA 1X74A 2ZRIA 4M54A 3RKRA 4AY5A 5FRDA 5KJ6A 3GFFA 1H2ZA 2DSTA 3LYUA 2VA8A 4YP9A 3A26A 1F5NA 4Q05A 2BZSA 2BKEA 4AUMA 3ICEA 1K6IA 2JK1A 1JKJB 2O3UA 5HF8A 2UV8A 3PJGA 4ZALA 2VDOB 4RNCA 1H4TA 4NPAA 3QE2A 4CF5A 2GI4A 4ECAA 1PW5A 5D7NA 4RO0A 3UMSA 2BRUA 2DE0X 1FFSA 4GBGA 4I9GA 4JT9A 1CQJA 2C42A 4X93A 5EUMA 4PZLA 2JGAA 2P2CA 4CKCB 3LPMA 3IO5A 4TZKA 3K5HA 3I2YX 3CB2A 3V7WA 5JD4A 3HZRA 4C3OB 2F1OA 3FVTA 2PPVA 1TUEA 3U1VA 2GD6A 1N5MA 1VHLA 2OR4A 5IUKC 1B0ZA 1CQJB 2XZTA 3FWYA 4W9NA 4EHLA 1R10A 3SEQA 2AS0A 2OB1A 5DNWA 3ZWXA 5KTSA 4ID9A 3MFQA 3L0SA 1Q1EA 2BKXA 3LXRA 2JL1A 3UMCA 1OFUA 1RLOA 3DO8A 2QE7A 1J9GA 3FZGA 3MC1A 5LXTF 3ZZ0A 5KQGA 5D3MB 1H0RA 1E3IA 3N53A 2R2GA 5JTUA 2C4KA 2I6GA 4ZRNA 4ZGBA 2VVTA 3O3CA 1U1EA 4GMFA 1E77A 1X6VA 3FTDA 1CWUA 2EVWX 3TEFA 2L18A 2HHCA 3K35A 4PE5B 3TTUA 3ZPXA 3PKZA 4N12A 5GOTA 1W36B 2RIPA 2H51A 2NZ8A 2PMBA 5EZ5A 1TW2A 2HPZA 3KE9A 2B0JA 4K0KB 4GD3Q 2D5CA 2XA1A 4J9UE 1SC1A 2A1UB 4PYKA 1US8A 1PWXA 3ZHUA 3QUBA 3ELWA 5BSKA 3OZFA 3NWOA 4OGWA 1PEKE 5B7PA 1B4DA 4MH0R 1T5TA 3ZWVA 3VVBA 3UMYA 4C4XA 1SUIA 1R9JA 1L7XA 2D4AA 3JYPA 3OH8A 5ELLA 1J99A 2PUTA 4DMKA 2VNHA 3DGFC 4CMKA 2OSVA 4PZPA 3L0YA 3BSYA 1C9JA 4WHMA 2QE7D 2D0DA 1P3JA 4MUHA 3A1WA 3MSCA 2ECQA 3V7NA 1Y3AA 1NPTO 4MVYA 3BM5A 4GLBA 4NNOA 3W2EA 1GFSA 1I7SB 4IQFA 3PC8A 3TPFA 3ZBTA 1C7IA 4R98A 2VJMA 5DTJA 4OHWA 2ZIWB 2PUWA 3KALA 5AIAA 2QD4A 4GWKA 4GFDA 3ZY6A 1XCOA 4D4GA 4DIMA 3HU1A 3TUJC 4BC0A 2RE8A 3RS8A 1I2CA 1Z45A 1BEEA 3GFVA 2H59A 5B1DA 1FDRA 3J7TA 3CMMA 1KDYA 4C5BA 4ZYTA 3BB3A 3UANA 2I8AA 5LP6F 3UFXB 1OB5A 4B3GA 4LJRA 4L08A 1ADBA 3D5TA 3EVGA 1LRKA 3TSCA 4Q1BA 4S1PA 1YH3A 4XYMA 4HF7A 4DA8A 4ZDIA 5ITWA 2EG9A 1W4RA 1QFXA 4EKIA 1FZTA 4MEAA 2XNSA 2QZJA 3FJ1A 1GZ7A 5C7YA 1MIOB 5ETJA 5GONB 5M3BA 2Z5GA 1OQAA 1G8FA 1EGAA 2IU4A 1ZA1A 2QD2A 5L3RA 1M6WA 1Z0SA 3I9FA 1XLTA 5ALOA 4TLEA 9LDTA 3BI0A 5HUHA 4JT4A 3WRXC 2VJMB 2NZUG 1JDBB 2OOSA 1X1SA 3BFJA 4FNGA 3D6UA 3QYFA 3L07A 2FE1A 4YGYA 4XDYA 1Z15A 3EWIA 3V8RA 1HSZA 4F04A 1J33A 5IK2D 5JZOA 3V4PB 2EP7A 4R2WA 5K0TA 3N3AC 2ON6A 2D1TA 4IDPA 4RWEA 3AEYA 4RKEA 7GPBA 1NMYA 2C1XA 3FWZA 3GA7A 4P3OA 1Y1RA 1XRMA 1AX9A 1D07A 1L2TA 2VC2B 3D8HA 3B85A 3M6IA 3C5VA 3MWDA 4UTRA 4G1UC 5JSZA 1JQ3A 3A1NA 2OLEA 3A37A 3KO8A 2ZSIA 4LWZA 1XAHA 1Y6QA 2HEIA 2KWIA 3C74A 4D56A 1YJAA 3BL6A 3FRHA 1UC5B 3QBDA 3L84A 4QU9A 4LGCA 4C1NA 1AIPA 1WW8A 3QLUA 3T0IA 1JLSA 1SVUA 3AM5A 4FEGA 4Z7OB 4MAFA 4YBRA 1NL3A 3OEEA 4JQCA 2HJHA 2EFEB 3NWPA 2DLDA 3WTBA 3PUHA 4QASA 4EKEA 2LGJA 1ST2A 2IU0A 5DXAA 4Q37A 4MWZA 4S3MA 3GPLA 2NT4A 3AX6A 1XBTA 1KE1A 3KHSA 5C18A 1XF1A 1G59A 1DOAA 1KARA 2WQZA 1OLSB 2AEJA 2ZFUA 3I1YA 3K5PA 4QATA 1D6MA 2QR3A 1PGOA 1DKOA 2K2QB 1ZICA 2PVPA 3PNBA 3EQZA 3RJ9A 1TCAA 3DONA 1TOAA 5CT5A 3HN7A 5BQ3A 3UC5A 4NRDA 2IXDA 4BEVA 1MUUA 4FBLA 3VC7A 1G21A 5K3DA 4KO2S 3UMRA 4LEIA 5SZJA 3DM5A 4FKMA 4LDAA 4TS3A 2JGEA 2UXDB 2KHZA 2F64A 4XM0A 3Q9SA 3RHFA 1FU8A 3P9XA 4BP9A 3M70A 4FUTA 2C2YA 5TF4A 1P9RA 3R7WB 1U0GA 4MITA 4Y6SA 4QQRA 1IOWA 1R74A 3LBHA 3UG6A 1V5EA 4DTIA 5KOHB 3J7AC 2IYUA 4FYJA 4O1HA 3O92A 3W8RA 4BLRA 3ELBA 3DMPA 1J2RA 2ZIGA 4BATA 3LQ4A 1N9KA 1T1GA 3DKRA 3OIGA 4UEKA 3V1NA 4CF3A 1PZXA 2OCAA 2JGNA 3JASB 3UOWA 4FD3A 4C8PA 4UBOA 2AQIA 4MHSA 4RFVA 2CBZA 4AB1A 2ET6A 3MPUA 3ET5A 1ZJ6A 2F1IA 2LPMA 4US1R 3SCZA 1QRRA 5FL7D 5LNK1 2O2JA 2YV4A 1QPBA 1J7JA 2ZQYA 3IR5A 3OUTA 3G02A 4XYLA 3E84A 3A70A 1G8HA 3P9CA 2NU8A 4H7HA 3V6MA 4RCYA 5DW3A 5AVTA 1RQLA 3T7KA 4CUKA 2G83A 5K0BA 2VCHA 4RS4A 2YVAA 1BE6A 1CY6A 3UO8B 3UQYS 4K2AA 5I51A 4Q82A 1BH2A 3ND9A 1L5HA 1UM8A 1CP2A 1TEHA 4ZWNA 2QSZA 4Q24A 2PNFA 5IKOA 3R7WA 4C7XA 1G9TA 2P8JA 4TV9B 3USCS 3UV6A 1PJ2A 3IFSA 1GN9A 2P5YA 5A2QA 2J8ZA 4CKEB 3SVTA 1AGXA 2D2VA 3RRFA 1ZYMA 2XTJA 2AMJA 3ZOKA 3RAFC 4TN1A 3TLYA 1TZCA 2F48A 1Z9BA 2XDYA 5ERXA 4PCVA 4F71A 2G1PA 4PG5A 5BPHA 1XLVA 4E46A 4UQOA 1JT9A 1SNYA 5KINB 5FAKA 5G2OA 4GHWA 4L28A 3WFIA 3OQMA 4AUNA 2P62A 3SQXA 2FJPA 3GWGA 2XDWA 3THYB 1BAPA 1TTHA 1GV1A 2XJ4A 1V1MA 4YX9A 1UPUA 1T3HA 5HMMA 1R0YA 3OHMA 1JHQA 5EJGA 2P1RA 1ST3A 2JI6A 1H23A 1BMFD 5EP3A 1O95D 5BN1A 5A3RA 4IEEA 1AKWA 1DQNA 4O0LA 4ZOLF 1VLMA 4NK4A 2DQSA 1IY2A 3ASVA 3K15A 1ADFA 3OLVA 1IG0A 4NEHB 3NM4A 1BZYA 3DQPA 3R09A 5JNVA 2B1JA 4J76A 3H19A 2G1JA 1S8OA 1CG6A 1ULBA 3L8EA 2B69A 1YGYA 4AJ9A 2G1KA 2QVLA 7ABPA 1OASA 1GAEO 3QHQA 3H9EO 3WMWA 1PHRA 4R5HA 5BSHA 2P6PA 3WNCA 1JG1A 1J8YF 3DWIA 1B16A 1XMSA 3H9QA 4YCCA 3B3GA 4TL7A 5F3DA 1XZDA 3TTVA 2PQ6A 4K46A 1E3MA 1WDTA 4UUBA 4QPNA 1ZJZA 3A3KA 5ARDA 1FYXA 2CXQA 3A06A 3B5EA 3H8JA 5BNFA 2JARA 4C9AA 6ADHA 4NS1A 4LK2A 3NDBB 1GYPA 4G56A 2J1LA 4WMLA 5HR5A 1RBZA 3KT0A 1D0SA 3OE1A 3VZPA 3B1ZA 4BNMA 3KVOA 3RUCA 1J07A 4AKGA 5KAMA 2CJYA 4QXQA 1S8FA 1E89A 1NR5A 3E18A 1Z75A 2QRQA 4YFVA 3NU1A 5FLEX 3AFOA 4MQ5A 4YI3A 5SICE 4KQ2A 1U3TA 1JHZA 4NGRA 1RKXA 3AF4A 3DYVA 4PCAA 5BWOA 1OF1A 4TMVA 5JAIA 3RAJA 2EK8A 1SOMA 4TUYF 3OJLA 1UQUA 3EFOA 2ZW9A 1C1XA 4HVCA 5B2ZA 5FQOA 3PQ8A 4L22A 1A72A 1MGOA 1HDXA 3LZ6A 2XTAA 1IXRC 1TIBA 3L7NA 3QRWA 4PLGA 3R5HA 3AK4A 3RDPA 1D2EA 4G0OA 4Z5XA 1TQ4A 1IJFA 4YT5A 2C0QA 2ZJYA 1XTKA 1DSSG 2F4NA 4GXTA 3SX2A 4PLCA 2GNAA 3VHXB 1ZXBA 2LIVA 4URFA 4MLDA 3SBOA 1GTL1 1OXTA 5DI9A 4LI0A 4DE5A 3NEYA 4FXOA 3OX1A 3QPWA 4HDNA 4NU0A 4C01A 3AHHA 3ZLJA 1RNLA 5DWQA 3SKYA 4D3XA 4S1VA 4BO5A 3F3KA 2GERA 4ER3A 1QU2A 2LZ0A 2PU7A 2QVZX 1QTQA 4B76A 2C95A 4G23A 3WLLA 5JHGB 2CFCA 4KXNA 4GICA 1UFRA 3WK5A 4M60A 1M8KA 1EB8A 2FLWA 4REQA 1YVRA 5IKXA 1ZW1A 2NUPA 1JJAA 2X14A 5PNTA 3ON5A 3SX0A 3V3TA 2AH5A 4AFNA 1I33A 1N0VC 3HUUA 2AN5A 5HQJA 1EVKA 2GZRA 2GPAA 3OMLA 3G68A 2FI1A 5DMXA 1DV2A 3HQ4O 3AB7A 3RGGA 5GGYA 3T5DA 2IZOA 4UCXA 4G81A 3I53A 4W82A 4DYDA 4B85A 4P2GA 3C6YA 1U63A 3NVKI 4I08A 1XD9A 2VUHB 3CZCA 4UHCA 4W6QA 4YRIA 1SBZA 3I8XA 1EK5A 2FOXA 1OLSA 4BLOA 1SXJE 1O9BA 4OXNA 4JOBA 4D8VA 4K87A 1L1RA 2PZEA 2Z1MA 1PD0A 4JYPA 2LCQA 4AL4A 4ZDKA 4P44A 5FUBA 3DE7X 4URZR 4UVIA 1FU4A 1R0SA 5FWAA 2NW6A 4JVNA 3IOBA 1TCCA 3WMXA 4KGXA 2FMUA 1T5OA 2WU1A 3LZDA 2ZCVA 1I4OA 3HSKA 4MZDA 2PKXA 1CUYA 3IVAA 4UD2A 5CNIA 4P4TA 1ZD4A 2IZ5A 1WVMA 3EPKA 4YV7A 2MSKA 1LPSA 4TMYA 2O2IA 3Q6MA 4Z4IA 1TLLA 3H4TA 1N3LA 3RFFA 1EVYA 1OAOC 2HA7A 1FVXA 2AGVA 2IQIA 2W2KA 1L5RA 3JAKA 1E6CA 4RV5A 3GUHA 1G20A 1I3CA 5I5EA 2Y1WA 4MUYA 1ZIXA 1A88A 3HCEA 3RAGA 3CG0A 4DAOA 1SVWA 2VF4X 2JIZA 4N54A 1JKXA 1OZFA 4EFNA 5JE8A 1OGYA 1FNDA 3IJEB 1RTTA 3LUKA 4JHXA 3BMQB 2B4KA 1JR3E 1JQEA 4EG3A 5JBIA 1GGEA 2XCRB 4BO1A 3H3XA 4HAOA 2WPNA 1EXVA 1TO6A 1F0YA 1GUDA 1G3RA 2R47A 2EERA 1RM3A 2XMBA 3A4YA 1O6ZA 4DCTA 1K3FA 1PLLA 2G5CA 4QHYA 3IULA 4IIXA 4F9TA 3GVIA 1NSFA 3THXA 2FDXA 3ZTWA 4MV0A 4P83A 1I7DA 4L5JA 2V6GA 4N3GA 4EMBA 2QRVA 4ZVOA 4IH9A 2GSWA 2NYAA 3LKBA 5JT1A 3CY6A 4HG2A 4QJ5A 5KNDA 1IN5A 4I2VA 3J81A 1E6KA 2BAGA 3ZXIA 3I72A 3KUCA 1WPQA 3NONA 5JD5A 5TEVA 5E6SA 4DRXA 4R1TA 1NBWB 3I2JA 1XZFA 5CBPB 1YOBA 3JZFA 4QT4A 4W9MC 1YDFA 2M6SA 2Z1DA 2P27A 4PC2A 2GAAA 7MDHA 2GAFA 1EUYA 4OFZA 2I7XA 3HCNA 4JC5A 1P2BA 1QIFA 2OD2A 3E8MA 4RKWA 5CYFA 2KI5A 3E05A 2BLNA 2DUMA 4EX6A 2X22A 4U2CA 1IOLA 3FSRA 3Q3HA 3D0KA 1QM5A 1DHTA 4GP6A 3WICA 5ICFA 5DNAA 5G41A 3WIVA 4DY4A 3ROPA 4EA6A 3ZDAA 1IM8A 1WXHA 3D3KA 4MP6A 1QOPB 1K3TA 3Q3IA 5C8DA 4M1EA 4HFNA 1I24A 2ACWA 1HE2A 2QX4A 4ZI5A 4ZZ1A 3D3QA 1PV4A 2GPJA 4MQ6A 5CB4B 1NUUA 1WX1A 4V24A 5AHKA 4BKRA 4NICA 1RZRA 2G63A 2BGIA 1UJMA 2ERYA 3O1IC 4AJNA 5BMOA 4EG1A 4NJMA 2H9YA 5IANA 2XF8A 1PZEA 1GDDA 1DFIA 4Y2TA 1AQ6A 5I7OA 1M7BA 1PJ4A 1VL5A 1ZH8A 4NH0A 4JU8A 5KOJA 4F3KA 3ZJUA 1NJ2A 4ND3A 2I6QA 2FN8A 5AK5A 4OXKA 4BOYA 2ZE5A 1VSVA 3Q1KA 2DUUA 3L6BA 2ZQZA 3ILXA 4GX0A 2YW2A 1HTBA 1XZPA 3B1VA 3GD5A 5AW3A 1IH8A 4EHIA 4EW6A 3A1SA 1UWCA 2B4AA 2CFRA 3EXEB 1CU1A 4KK4A 2E5LB 2JNWA 1WCIB 1OXBB 1C0IA 3J81k 1IRXA 1Q7EA 1QUEA 4JI3B 2ATVA 2YV2A 1U5BA 1GCUA 4IMPA 1QH0A 3D7MA 3H4VA 5H82A 2A7XA 3QNUA 4GNKA 1R4MB 4OEHA 3U16A 2OBMA 1SXQA 3KJFA 2RHBA 1KL7A 1ZEMA 3ANTA 2YN4A 1N34B 1RWVA 4JLBA 4WJKB 4BMOB 4U7PB 5IDWA 2RHJA 4K8RB 5DNCA 3U1TA 4LXQA 1RZRD 2OWEA 1NNEA 3KT8A 2HV9A 4BFZA 4QUEA 1N2CB 1YJBA 2O5RA 1TE2A 1YRLA 4J6FA 5HTKA 4JSRA 1TT5B 1QGOA 2ZBEA 1TF7A 3KLBA 4BGDA 5FUMA 1PJSA 1SPBS 4OYRA 4BQFA 4Q3KA 2HB6A 3ZHRA 4D4MA 5A1TA 2FFAA 1A82A 3BE5A 1NLZA 4G0YA 2XNKA 2VQDA 3O93A 3ZDXB 4C8CA 1AOXA 1BYIA 3FVWA 1E6EA 1OX5A 2W2MA 2O4CA 4WOKA 5AKLA 1EYZA 1WL8A 4S1NA 5AKGA 2Y1GA 2VNAA 3NAMA 1JFLA 3RFTA 1GQSA 4ZICA 3K92A 3L18A 4ZVNA 3W6OA 2A33A 3L7BA 3K6SA 2DUNA 1QVZA 3OOYA 1ZOIA 4DLNA 4E07A 2X4IA 1DO8A 2J9FB 2QTAA 3DL4A 1NURA 3QEMB 4JEIA 3TJMA 3TLZA 1CD5A 5B30A 1DE0A 1RCTE 3VU9B 1NR7A 1R6VA 5IB9A 3KVVA 5DM60 2HCRA 3JWIA 4PGHA 4JK3A 3SIXA 1JEYA 2J0SA 3FVQA 1BWSA 3ZQ4A 2B7LA 1M0TA 1U81A 1U3DA 2J0UA 3EXIB 4UE2A 4E3WA 4TSKA 4RE6A 3BWCA 4JS0A 1ZH2A 1W2HA 1IK6A 4KL8S 1YUNA 1ORDA 2FW0A 2X5XA 5K3AA 1AK9A 5AJHA 3SEFA 4QOJA 4NI5A 1FS4A 4I6EA 3EA0A 4GPBA 1N8NA 4C6TA 2HGZA 2VZ8A 1NYQA 1COZA 1KQFA 1EX7A 4I1PA 1ZGBA 2OBYA 3G5AA 1KO7A 4NE2A 4YCJA 2TSYB 3IPLA 1R6DA 1KERA 2OL4A 4HEA1 4GMXA 1N7IA 4P8RA 1ZCBA 2BOVA 1X77A 2N75A 4KUGA 2OFFA 3PJRA 3ECAA 2CE2X 3O75A 4PPYA 4RHCA 5HIMA 4DCSA 1BYUA 2D74A 3DHNA 4N03A 2P35A 3NS7A 2R1TA 4FR2A 4I55F 4PSCA 2XA9A 4ZJUA 2HDNB 4LDPA 1UOOA 3LRXA 2Q1XA 3NEAA 5I9TA 2ONYA 5K5EA 2BFEA 1OYOA 4RXUA 5GONF 4B82A 4CXMA 2H52A 3BDAA 3OLCX 4PGMA 4V3BA 1LBSA 4GI5A 3VPBA 4E88A 3KQKA 3B1WA 3ISVA 2DF8A 1N8SA 4X1IA 5CTJA 3W8FA 1Y3IA 3HFRA 4R8VA 5IAKA 2X1HA 4HH0A 3VDQA 3VPHA 3PTAA 4GKBA 3ROKA 2VTBA 4HNTA 5IYZF 4ZHSA 3GVPA 5EHNA 4C0AC 1K75A 3HXPA 4V02A 4B3SB 2P69A 4E3ZA 1H93A 1E6LA 3PQ3A 3QHAA 3MOIA 5ALYA 4FDVA 4F97A 1GILA 3VV2A 3ANNA 4RVFA 4QDKA 1SVLA 5FWDA 4B6EA 2HCBA 2RG1A 3H5RA 5A5VA 1RWKA 4QDUA 4BVHA 2O0JA 3W8EA 1ACMA 3U17A 2PX4A 2ZYDA 4X94A 5AO9A 1M72A 4WCFA 3EOBI 4B8WA 3IHTA 2BCEA 5JXIA 3LKDA 3HU2A 3AF2A 2IZZA 5HDBB 2I78A 1YZVA 2QS9A 3KKKA 1QKIA 2VF5X 3C16C 2PSHA 3NFRA 4FHCA 4HCJA 4QXAA 1DX6A 1FLAA 1J0DA 2JATA 2VPWA 2WK1A 5FYDA 4ZHQF 3NJRA 8ABPA 2BBWA 3HV0A 2RBEA 2XTMA 2VXOA 3CVVA 2X58A 2LTAA 1D2HA 4QEZA 3IGFA 4GM0A 2EFJA 1ZMTA 1IHUA 1WM1A 2Y9MB 4D9JA 2J7PD 3ZCTA 1RLUA 2PZGA 5A2GA 3FBGA 2QTCA 3DA8A 3TGLA 3HK2A 1E7RA 3ENNA 2O9JA 1RLIA 2AI1A 4BGVA 2O7QA 1Y7HA 1IZZA 4ZI7F 3SQWA 2CVFA 2AE1A 2GRJA 3A4VA 1B8NA 4PGAA 3ROQA 2PVWA 3K5IA 3RUHA 2M1XA 2DSNA 1O97C 3KXLA 2OHGA 4KC0A 3RYHB 4Z99A 3F4LA 1LBTA 2J7KA 4E08A 2AR7A 4ESHA 2JJ2D 5DHSA 1IG3A 1U04A 3D4BA 1REQB 3WO0A 3GEDA 4CT0A 3KSAC 2CC2A 4MQFB 1LK7A 2ZUFA 4M7RA 1Q91A 1T0PA 4BLPA 1KU0A 1L4FA 3O8RA 2IPLA 5IU6A 1L5HB 1AUPA 5FNVA 1G21B 1GLVA 1PK9A 1YHZA 2JFFA 1VKHA 5DHFA 1PGQA 2D8AA 2OFXA 3PHJA 1XDBA 3PHCA 4FFBA 4GBMA 1BVHA 2DFVA 1PTJA 2J48A 4AJ1A 4I50A 4GF5A 3KYDB 2Z2ZA 5KNBH 6Q21A 2EL9A 3MT9A 3R5FA 5TQ2A 1DKMA 4ZVUA 4ZAVA 2YUIA 3U7FB 1A9OA 2X7HA 1CHNA 4L76A 1ISPA 3LBFA 2I4TA 5JCPA 3UV3A 5JZ9A 2VNJA 3ZU4A 3FCCA 1ZR4A 2WJWA 4PGGA 1TEZA 3PVCA 1L5QA 1VLZA 1DG1G 1FFEA 1OLOA 2CJPA 4OOFA 3HRHA 3FYHA 1E0KA 3OM9A 1O6CA 4IRXA 1KYQA 2PL5A 3OTHA 2ZITA 3LLSA 4CIBA 4WNYA 3HCFA 2XH8A 2EZ8A 1AKVA 3UHAA 4I19A 3CURA 1Q95A 1OAKA 1UP7A 3AERA 3SP1A 1JFSA 1V41E 3EVBA 5DE3A 1RMYA 1V9CA 4RDHA 2W6ID 2VAVA 3ZHCA 2RHRA 1VE1A 2A88A 3FPFA 5AMXA 3V9AA 1FSPA 1ESNA 1LY1A 3HA5A 1Z8DA 4ES6A 1YZUA 2PZKA 1HORA 4DIOA 5CB4F 1XRQA 1U3UA 4B43A 3PXDA 4MICA 4L78A 3ADPA 2YN0A 5F4ZA 5JNWA 2ZS9A 4PZUA 4HYTA 3U3RA 1Y6GA 1D8AA 1VL8A 1IEWA 3ZGNA 2VP9A 3ONDA 3LHIA 3H1TA 3DHWC 2OXIA 1A1SA 3M8KA 3H9GA 3ZVKA 1RXWA 3MQFA 4B5KA 1UKVY 2GBPA 3AM3A 2VNIA 4MIEA 1SU6A 4HXEB 3TR5A 4TSFD 1FTNA 521PA 1QFSA 3BHNA 2FPOA 1HDRA 4FEAA 4YAKA 1GPMA 5DN6D 1U80A 3UPDA 4EMSA 2VBCA 2WMDA 2YVLA 4MAAA 4M8DA 4FOSA 2QHXA 3MAGA 4V0MA 3QBEA 4E5UA 3OZVA 2XNDD 2GNOA 3W77A 2X0SA 3AR4A 2G25A 4B0OA 1OAAA 1ULSA 2NV2B 3OZ7A 4GMGA 1KEUA 3S2SA 1TU3A 4G5OA 3WL7A 2ODNA 3NXSA 3C3DA 4DJDC 3JQFC 3W8NA 3V6LA 1I1NA 1V16B 3TOXA 3U7QA 1K0UA 2YVQA 4KE9A 3DCIA 4KGVA 1MIHA 1L0BA 4MYHA 1Z08A 2QVCA 1ZGJA 2YWDA 2IXBA 2HYIC 1KJWA 2OK8A 3CX8A 2M1ZA 3M81A 4PHGA 1E66A 1FFHA 2WNHA 3AVQA 1UXKA 3SYMA 3MWKA 1AC5A 1B8VA 2BH9A 2WU8A 4DNPA 3QHPA 3D5QA 3M6WA 4N82A 2QRJA 4CV0A 3JALA 1FJHA 1AGPA 1ODCA 2H08A 3DBHA 3JQ8A 1QMPA 3V1KA 5K0GA 2PGNA 3JD4A 3E8XA 1SVIA 2FPIB 2X42A 2BEWB 1UBFA 4HRYA 2DTXA 4O4IF 3O2SB 3FNQA 3R2JA 1SOAA 2DGDA 4XSVA 3V8VA 5DLYA 2E4ZA 2WSYB 2Y6UA 4HUTA 2DETA 3B38A 2W00A 1MT3A 3QW2A 3T1YB 4YAGA 4AJIA 2HZ7A 4LN1A 3DOEA 3WK9A 4JEUA 4DG5A 3PCXA 4N7BA 2FEOA 4G85A 5GP1A 3VXKA 3S28A 3KVYA 3IP8A 4Z2AA 3L6EA 6YASA 4PO1A 1ZBQA 3EZ6A 4X8OA 4DBLC 2HQRA 4KXVA 4M86A 4FSDA 5EHGA 4UPVA 3SOPA 1QRTA 4COGA 1O3YA 3AEQA 4L75A 4G2TA 3EC7A 4KVFA 1BVYF 4XA8A 2POCA 4HYQA 2Q21A 3HM9A 2CXOA 4HI0E 4LZWA 2XYGA 1EWYA 3B48A 1QQ5A 4F3CA 4UQPA 4RFSA 5EIXA 1XV5A 1JRLA 4GPIB 4F8YA 3FSEA 2GX6A 5EE5B 2CUNA 1JNXX 2E3JA 1D1SA 3N7UA 2QTVA 4JFAA 3WO1A 4WVFA 1GL6A 1UPTA 5DSTA 4G9BA 4M1OA 1J00A 2DHCA 3HCBA 4CGZA 2FSPA 1XMOB 3OA0A 3PUKA 3UATA 1RABA 4RA6A 4CQNA 2R87A 1PVOA 4AKIA 1GZ5A 1FBTA 5T8KA 2XWJI 2Y27A 3T34A 3W3AA 3FI0A 3L1JA 4COBA 3FUCA 1DX4A 1FE8A 1CBUA 4K6OA 4JEMA 1CIVA 2CYBA 4QLAA 3JWEA 3I1IA 3MCZA 3RM3A 2FR1A 1VHTA 4ACBA 5TS2A 1N77A 2IYAA 4BKOA 4PZ9A 3IBFA 1QP0A 5AJWA 1XRJA 1R4AA 1XT6A 3U31A 3ZCSA 3GJXC 1DLJA 4Z6KA 5BVHA 2WJAA 1SZJG 5DM0A 1EP1B 4L4XA 1PKEA 4C84A 1F4VA 3ANYB 3MS2A 4HGPA 4TL6A 4YV1A 2FW8A 3L43A 4IIGA 3GZTB 3KSRA 4BNTA 4HB0A 5HOQA 1RWWA 3TYXA 3PFIA 4GYKA 4XJSA 2P5UA 3CNEA 3OI7A 1KO5A 4R81A 3VHRA 3W9SA 3HCDA 3JW8A 4QU0A 3RK0A 1VPTA 1U4OA 3UMJA 5ALUA 4YMGA 1ENZA 1EK1A 1YSCA 4QQKA 4MNTA 2JAUA 2C7GA 4WSOA 1JSLA 1SWVA 3FHTA 1MEEA 3TFQA 3OZIA 4RQAA 5CLLA 4DVGA 2REQB 3MJVA 3ST7A 2PA0A 1E3LA 4V2UA 3BD7A 3T4PA 2FQ1A 4ARVA 3N0TA 4COOA 1NASA 4C21A 4M1SA 2CNNA 3T1QA 4OGKA 3EPHA 3WQRA 4WD3A 1P18A 3E9QA 4P08A 2YHIB 1O57A 4KXXA 3TQHA 5AUPB 1LVGA 4AKHA 4M36A 1DEXA 3CKYA 1AN0A 1NC3A 1QG0A 2X8BA 4HXYA 1NG9A 2XNHA 4XDGA 2AN9A 1Y42X 2R8RA 3E82A 1AGRA 2Y1CA 1D6NA 2NO1A 1Z12A 1JL3A 5ALKA 5KNCD 3W5UA 3V7YA 2WJ3A 2NNLD 3C97A 1JQBA 2OV8A 4F56A 1NQUA 1I2DA 4KQIA 1WTAA 2ZB7A 1SH7A 4INOA 1BO6A 2ZBRA 2AFHE 2GN2A 4PSDA 3CF6R 3DBLA 3LH5A 2XUKA 5AKYA 3SIWA 3JWGA 3MWYW 3OSUA 5JDIC 5K9ZA 3UUFA 4MJXA 5K99A 4LXUA 5KJCA 2VPPA 4D9FA 2VFAA 1FDTA 1PL7A 1F9EA 2ZAYA 5JRJA 1PK8A 3QUSA 4YRRA 4M8NE 2DT8A 5LSAA 3Q5EA 3JSXA 4OMEA 4P54A 4DA6A 5FPHA 3GJ5A 4M8KA 1GG9A 2A67A 1YZLA 3TQOA 4TM8A 1CE8B 1YVPA 1VIDA 5KI6A 2ACKA 1S0UA 2WILA 4EB3A 5L8VA 4KR0A 1T5BA 1AQNA 1KEPA 3R9WA 3A10A 3JQBA 3TS1A 3I2FA 1L7MA 4QREA 3DMTA 3R7SA 4U7JA 5JO0A 5K3SA 3QWIA 1W5AA 3DS8A 4QTTB 2BMFA 1N3YA 1Y48E 2XB4A 3FPHA 2G04A 5ITSA 2FRVA 2ZSUA 3QU5A 2I91A 2WD9A 1LUAA 4ZT3A 1VP9A 1J20A 1FFGA 4KKVA 5D84A 1CRLA 1LDMA 1W88A 2OQVA 5E95A 2OCIA 2BE9A 1TADA 4OK3A 3ZDFA 2EKBA 3DDNA 3EIOA 3FNRA 1L4UA 4KLCA 2FX3A 3SOZA 1F12A 1ZXXA 2Q41A 2NXEA 1Z0IA 3P71T 3VR6D 4XX0B 4MRAA 4ZK6A 1IZ0A 1O5OA 1YC5A 3L49A 2OY0A 3GEMA 1KE2A 5A9SB 4KDFA 1N2HA 4QIHA 4U7GA 3PX3A 3HO1A 1QX3A 1P2DA 3D8BA 5K4AA 5ALRA 4EJFA 3EQ9A 5CVTA 5KC8A 3WGJA 2IK8A 1A7JA 4YRZA 1ZITA 1L4KA 3FRIA 4V2IA 3EXEA 3H2IA 1SBIA 4X54A 5ECYA 2VF2A 3OZUA 4O4LB 2HU7A 3AR6A 4R31A 4ZYVA 2QTZA 2WIFA 3COSA 4LJ8A 3COPA 1DVRA 1OKKD 2DFNA 3USZA 1AB5A 4I3HA 1TQ8A 3STWA 5KSWB 2H57A 3A58B 3B20A 4DA0A 1AZLA 4C9VA 1Z06A 1J90A 3UC9A 1GGFA 3M4XA 1N4DA 3SY8A 1XWFA 3HJHA 3QK7A 4FT2A 1CJMA 5FUYA 5AW2A 1FP2A 1KK2A 1K89A 4AYTA 1SHZA 1P0MA 1DIRA 3A8TA 5CT8A 1I3NA 2GZAA 1MTZA 2IHZA 5LP6C 4J07A 1LDYA 3CIFA 3GMIA 5A4JA 2AZDA 1LLFA 1OBFO 2ZPAA 1EZZA 1XF9A 2BMDA 2W93A 3FN4A 3K8OE 3DEZA 2BDEA 2YBEA 3B7WA 1ZU4A 3LUJA 3P94A 4Q47A 4X7RA 1WWKA 3T7TA 5JR3A 5K6TA 4KFCA 1GKLA 1WZ2A 1O96A 4PY2A 3E9EA 2VH1A 3MGGA 2O8CB 2PMWB 4MQEB 1FRVA 5GM1A 4CTKA 3LUBA 2JJ8A 4G8JA 3IOYA 3H9BA 4LMRA 3U19A 1K4YA 4UTZA 4N8DA 1VCMA 4C4YA 4ZAYA 1JYEA 2B2NA 5KQSA 2DULA 3NWJA 1VBGA 1ZOOA 1Z4NA 3DVRX 2WMYA 1XQ6A 1ECLA 1JI0A 2CMKA 2GUGA 1LXCA 2HXSA 3OZXA 4JI6B 4CQLA 2A59A 2ANCA 3MTAA 3ZUPA 1DBQA 1W2WB 1UJCA 1XYVA 3I01M 3QVTA 4AYWA 1T15A 1NY5A 1TJPB 2OHHA 4HAXA 1UFOA 4WOCA 4X0EA 4EJ2A 3E7WA 1YGPA 4KHPB 3DEYX 3LBNA 1FLNA 1YS2X 2C3PA 3Q7RA 5EGSA 2GK7A 1H94A 4EI7A 4LRWA 1UKEA 5FL3A 3VKFA 4DQVA 1NRWA 2ECOA 5DM1A 3SQDA 4TZ6A 1BHSA 1XN4A 2NPFA 3B3QA 3TZQA 3FR8A 1MENA 1Q14A 1P0FA 1DFHA 2XIQA 1I1OA 1UP6A 4OSOA 3DAHA 3SVLA 1EB9A 1M8GA 1X2BA 1ZEJA 3NANA 4KITB 4MR8A 2OAP1 1ZSVA 2V5UA 2OXFA 4HHEA 4ZJZA 4I4TA 4U7TB 1ZRSA 3LECA 4MKZA 5HPYB 3VNAA 3OA2A 4F2PA 3WLIA 3WKCA 4C9RA 5DNDA 4RHUA 4DB4A 3WLAA 5INTA 1UWVA 3TAXA 4ZYUA 2A9OA 2FEPA 2BEVB 4XIIA 1CZKA 1WA5A 2PSEA 3PICA 1YCGA 3FM9A 3JVEA 1DO0A 1M2HA 2EWWA 3ZC3A 5C35A 5I9IA 4I55B 3FNEA 4DJTA 1TJ5A 4ESOA 4XXHA 1G3UA 1M67A 1L6IA 3LOPA 4OQMA 1SUPA 5BRJA 2FMTA 4P7KA 5HBGA 3S8YA 3HC7A 2A86A 3UXYA 2D0PA 4AJJA 2A1UA 4MDHA 4N7MA 4QWWA 1E1MA 1JSRA 4Y9RA 3CVXA 1DAGA 3B6JA 1WDLA 2OV2A 3FYUA 3K70D 1YC2A 2ZJ5A 3KL4A 4MUMA 4D97A 1JFRA 2X4DA 3FCOA 3E9CA 4H3SA 3ZWPA 1Z2NX 2PH1A 1IVSA 3R6TA 1NR1A 1WMEA 4WKPA 5BW6B 1UANA 1PJ8A 4XASA 1THTA 2F8LA 3RVBA 4E14A 4UZSA 1NHWA 4RZHA 1MU0A 2OUKA 2WAXA 4L2IB 3NR2A 3L7MA 3HDQA 1UK8A 1T1JA 2XE7A 3LRTA 4N0QA 1ZLXA 5LZ9A 4WOJA 2VNSA 1NI5A 5DHRA 4BZZA 2D3WA 5J40A 1EFRA 4FOPA 4CR8A 1JLKA 1RAIA 1XXHB 4MA4A 2XEJA 2FN3A 4RMHA 2Q1SA 5HCNA 1E9SA 1JXMA 3I9JA 3TKAA 4DC1A 4KR3A 3WRVA 4R3WA 1NAHA 1G18A 2PV7A 3QX9A 1SUEA 5AI9A 3TDNA 3GDGA 4KPUA 4KWCA 5LYJA 2FSGA 1UADA 1SCNE 1XXHA 3LP6A 1E9FA 4JLUA 4ND6A 4FYXA 421PA 4YYZA 1ZNYA 1FP1D 3Q7EA 3F7TA 1SWWA 1JYSA 1VBFA 3LUAA 3M34A 3QVMA 4OHFA 4PX3A 5I9MA 3TQCA 5KVSA 3OQIB 5HX7A 2EX1A 1POWA 4XOUA 3P9YA 1MPXA 2R6CA 3BHMA 3M3PA 5T3UA 2YJ4A 4ITRC 3RRZA 4KX5A 3M4NA 2BFDA 5DI3B 2YJZA 5AHWA 1GO2A 1YO6A 3RTEA 3JQ7A 4EATA 5AM3A 2VDVE 5FTNA 1N9ZA 1LQTA 2ORVA 3CNNA 2XQIA 4NMLA 2I5PO 4NBKA 4OLHA 2XUZA 3RK1A 4A8PA 1HDIA 1EFRD 1PN3A 1VSQA 2ZPUA 3BIWA 3EXFB 4GW3A 4N8EA 4XWGA 2EZBA 1BHJA 3O7WA 1PE0A 4XYEA 3BE4A 4U7HA 1JIUA 2Z09A 2Z43A 4IMRA 3M4ZA 4L8YA 3AVTA 1Y3BE 2GCIA 2JCBA 3DE5X 3HRKA 3L6OO 4DF3A 4P4EA 1JFTA 1O6BA 3HKCA 4Q03A 4GBED 4QUDA 4QBKA 5A4DA 1T3ZA 6AT1A 5H1YA 2JEOA 2CB0A 5K0NA 1G2PA 3KRVA 2JASA 4HLQB 4YUVA 4OK5A 2WIDA 4AZTA 2VHCA 1R4ZA 2Y99A 4TWBA 1RSZA 2Q1WA 2XCIA 1TVEA 2PLNA 4DSAA 4ZIRA 1GDTA 1J56A 1MDBA 1TC2A 1UEIA 2DCUA 2JCVA 3FMOB 2PZBA 2G9ZA 5CYOA 3TXXA 4UEOA 3CH5A 1EX1A 5DYYA 3ZY5A 1DJPA 1V6SA 3BH7A 1JE0A 3KKEA 3VU8A 3ND8A 3C1TA 2LKDA 4GSKA 5KDLA 4E32A 5EHXA 3OWXA 1L7VC 1Z8LA 2GVZC 1FYVA 3IXQA 4F9EA 3WNZA 4D6PA 2JH9A 3DE6X 4LAFA 4DGQA 1SHLA 5BN4A 3TRKA 5JS6A 4ER5A 1FVFA 2DFKB 4YQEA 2GZ2A 4R54A 3VM6A 1N36B 4HS9A 1QG6A 1ETUA 3BWVA 3PHLA 1N3IA 4HTFB 3RVRA 1VBMA 3IIJA 2XT9A 1ZJYA 1Z4KA 3PNLA 1SUDA 3EZNA 4JP2A 1GDHA 5C7IO 6LDHA 4NGPA 4M3NA 3ZV7A 2YV5A 4MHTA 1G3QA 3CX3A 2WLTA 4S04A 1XTTA 1MOQA 4HLCA 2J46A 3ZZNA 3P9KA 4J2HA 2J4FA 3PXBA 2IGBA 3ONFA 3R3SA 3TQRA 1ZG3A 3ZWOA 3EY4A 1QE3A 2QLJA 4J94A 5KNLA 4PSVA 3FPJA 1O0BA 4Q18A 4HDRA 4A2PA 3OT5A 4UTXA 2QZSA 3GRKA 4UAJA 2QPTA 5DGXA 3ZE0B 5T7BA 3JCZA 1JU9A 3E3LA 3PEUA 4V0RA 2PH5A 4IUYA 2XMPA 2IYLD 1CF9A 2BMAA 2C2ZA 2I2XB 3G9UA 4EMTA 3NMUF 2JBAA 1M2FA 1KF0A 3PI7A 1T25A 3A1CA 1G21E 2F8SA 1SBCA 2W0MA 4BGEA 1PAUA 3EA5A 3F9CA 1SXJB 4RPHA 2BCGY 4HS4A 3CBGA 2WHYA 4DLYA 4E51A 1HY3A 1Z7GA 3KOZA 2IYNA 1XDDA 5KJFA 1A1VA 1FXWF 3JYOA 3SU8A 3QWHA 2ZRFA 1U2TA 2ZTLA 4JXJA 2X8WA 4IHKA 3E53A 1BOOA 2I4MA 4NG4A 2CK3A 1L1FA 4W5HA 4IP0A 3AH8A 5JAPA 4GKKB 1XROA 2CFSA 3PSAA 4ZPJA 4YWHA 4AICA 4CM5A 4BKMA 4CDNA 4CWAA 2V3VA 1CQIB 2FSUA 2JLQA 1T5HX 1JDBC 1KI4A 1WXDA 2WM9B 4MRPA 2YHBA 3K9GA 4UVEA 4EBBA 4OHXA 4XQCA 4TQ9A 3OM0A 2CCGA 2WYWA 3DZDA 3KR1A 5FR1A 3RASA 3D7GA 3EIHA 1S7CA 4C04A 5HHTA 2XT6A 1GU0A 1C80A 1G3IA 1SR8A 3BXHA 4XWWA 2FUKA 3KQLA 1E63A 1J2UA 3R44A 2Y0CA 1BROA 3L01A 4OC1A 2XEDA 2D7JA 3BA6A 2RHCA 3GG9A 4EG7A 1E9CA 4LFAB 1RWOA 4JBGA 3ZHBA 3EIUA 1KYTA 3FUWA 5ED4A 5AVSA 2YWJA 4KJZA 3EXHA 1Q19A 3QLVC 3PHHA 1FZQA 4ZI7A 5KEIA 1ZI9A 3GDFA 1XZHA 1M2VB 4A27A 1OVGA 5FTLA 1XUOA 2UYHA 2X0EA 1SAYA 3AQIA 3IOMA 4RY0A 1Z88A 3DJYA 4U2KA 1XZEA 4F8JA 1KEWA 1K5GA 2FSSA 4NQZA 3S27A 3WBBA 2IFTA 2QX9A 4UVHA 3L82B 3KZMA 1X42A 2J5XA 1H66A 4FILA 3P97A 3Q3EA 1QCZA 1SB8A 1SCBA 1KR2A 1GPUA 2V1XA 3IR7A 5ELXA 2B98A 1O03A 3OESA 3OZGA 1DJMA 5L4NA 5CVCA 3NM5A 3JS5A 4D57A 4KODA 5EEGA 1L9XA 1B93A 3AV0B 3HM2A 4FYVA 4NOLA 4XKJA 3AKDA 3ZU2A 2XYRA 4KYIB 1FYWA 4XQEA 3BK2A 3HCAA 2NZWA 2YDXA 3ZGLA 3TFOA 4D8TA 3DDWA 3OLZA 2D7DA 1J0EA 1T8WA 2G06A 1VE3A 3CG4A 1SCQA 1M1UA 1J5XA 3M89A 4IPTA 4FGJA 2B4TO 4DC0A 4ZZIA 3RC8A 3HMQA 2Y9PB 3ZD9A 2JGMA 2X13A 4GQAA 4TVOA 4CKWA 3WWCA 4PNEA 1DAOA 4E5MA 2ZKIA 3C3EA 1E4EB 2CXPA 2XGMA 3LLCA 3E22B 2P4UA 2OBLA 3PFHA 3TB4A 4A03A 3MWDB 5EQFA 5J5CA 1WUYA 4ZFNA 5DSZA 1RHJA 4DLXA 4TMWA 5PGMA 4NCBA 1G8PA 1UKZA 1ODJA 4M21A 2I2WA 2AJ8A 3QXCA 3PNSA 2BDTA 4Q4AA 3PFBA 3QJYA 2RGRA 3VR2A 4RMJA 4BQIA 1E5VA 4Q7KA 1UZMA 2PUDA 1GL7A 3B6KA 2ZWAA 3QKSB 1WSDA 3LUHA 3RI3A 4INZA 2E87A 4BHTA 4LYYA 3SMVA 1F38A 3FKQA 4B87A 1GFWA 1L3IA 1ONNA 2SKDA 1YFZA 4U6QA 2DCMA 3GYBA 4WOBA 3RSQA 1PV1A 3UMVA 2AWOA 2OUIA 1KJQA 4WCFB 3GJ7A 1BX0A 1X1BA 1O8CA 1ZP6A 3ABOB 1A71A 3ENKA 4DV6B 3EZEA 4F92B 4YDRA 3L4EA 5KTPA 4MGKR 1YS4A 2Q50A 3EGWA 4UHFA 1Q0UA 4CT4B 2VJCA 5CD9A 4WVLA 2RGGA 4BLSA 4RH0A 2F1HA 3HUDA 1K8RA 1SBQA 2ZZMA 4M7WA 2FP4B 3IIKA 3KFXA 1DDGA 4R1SA 3TG8A 5K2OA 2GFHA 3I3SR 5JI3E 4N9WA 3OZTA 3KKMA 1XCGB 3TWOA 1I7QB 1KU6A 1AE1A 1P6QA 3C3AA 1GPKA 5GGXA 2DKNA 2C3UA 2QI9C 2C5AA 3BRWA 3VI4B 3MB5A 4IFTA 4DV2B 2P9GA 3WG9A 1RYNA 1SKUA 2RHOA 1COWD 3DKPA 2NX2A 3WMEA 4ZJPA 3ZJTA 3A27A 4EQ6A 3A36A 2G9UA 2I1VB 2R66A 1BQEA 4MYCA 4O3MA 2VJNA 2GN6A 5G02A 3U3OA 3X44A 1J06A 3FA2A 2MP0A 1P1RA 2QAGC 2JGDA 1G9XA 2DH5A 2G9VA 2JLCA 3OJCA 1L7QA 1BXRA 1A97A 2ZYVX 4JCOA 4UVGA 3DE1X 2QB5A 1M83A 1NBMD 1T0JB 1EI9A 4JLOA 2NU9A 1R9NA 4GXNA 4Y2RA 4AZ0B 4DR5B 2Q6VA 3O8LA 2NXWA 1F51E 5DNEA 5F35A 2WPDA 2EJBA 3F2VA 1JX6A 3LCUA 2RHDA 2WD8A 3RSSA 4Y98A 4MVWA 3A1FA 1E9DA 3I58A 3ZWCA 1TA0A 4U8GA 1SD1A 3L7LA 3BQMB 1WMDA 1OZHA 3C3BA 1XVIA 3C7KA 3G3EA 4D4IA 1VBHA 1VYUA 1OX4A 4PLFA 1W36C 4D0GA 2IL1A 4NE9A 3A6JA 2YR0A 3PPXA 4LVNA 3DXFA 5DU2A 4EA8A 4UNRA 2HROA 2OZPA 2IPXA 3T9DA 3K71B 4L57A 2A3NA 3RVQA 2PE5A 3FJOA 1KOJA 1TU0A 1TZMA 3CUKA 1JEDA 5AXBA 4CEJB 2XAAA 2VYCA 2B5VA 1BX3A 1MZVA 2CVQA 1UJ2A 2BM9A 4WY5A 1TZKA 2Q4DA 4FJ2A 3SKVA 4B75A 4DRYA 3KCNA 3OTQA 4X5OA 3CMCO 4A0QA 4BMVA 4NCAA 4YRPA 3QU2A 4R1NA 2HMSA 2ZIEA 3P0HA 2D0IA 2JGRA 3NHJA 4QUIA 5JCOA 3C7DB 3WIDA 4Q1FA 2IXGA 2D0OB 1GADO 5D85A 3FSGD 1RAFA 1K1EA 1ZD3A 3TG2A 3UAZA 4IO1A 5EPOA 3AEXA 4CRWB 1NMQA 3KZVA 3K09A 1B2LA 2QUHA 2VHEA 2W6JA 4XTRA 4TROA 5A1JA 1T5DX 2A35A 3EVDA 1Y34E 2EBHX 1MW8X 4IGFA 4BX9A 2QN3A 3IEKA 3HYLA 5FBLB 4E5KA 4E2WA 3DLIA 2EL7A 2H1HA 2RI0A 1AN9A 3O8OB 1JLMA 4J0JA 3W8DA 4G8CA 4PQGA 4OP2A 5TVKA 1JPUA 2GM3A 2MT9A 3P26A 4WXEA 5K0JA 3K6KA 3RYCA 4H9GA 3RC7A 4GE0A 4OQPA 3T5CA 3IUSA 3KB2A 3QVWA 1HQKA 4R7GA 4NCJA 1S2GA 4JP5A 3T0TA 4B3JA 5K0FA 1S96A 1YR9A 2FEAA 2Q1TA 5EP2A 3ZY4A 1SY7A 1EZAA 2Z98A 2F9LA 1NXOA 1YS1X 2WUWE 2DWQA 1KP9A 3GVHA 2ZJ2A 1URPA 4C99A 2WTMA 4MMZB 2CYAA 4WW0A 5B3JC 5I7SA 5EP4A 3E61A 1AJEA 4ETIA 3AERB 3HNRA 1GTMA 5JV5A 2Y4NA 4S05A 4GVXA 1A4UA 4M8LA 4UMFA 3W6PA 2ZWPA 2CCJA 3LWZA 3R0JA 2C4TA 4I4LA 4D7AA 5DFAA 2R2AA 5IHXA 4OD0A 3WLHA 2BGLA 5D5QA 2PJRA 3AP3A 4EVSA 1HOXA 3Q3VA 4GPD1 4NC9A 1NXPA 4OJMX 1OJ7A 2JAPA 1U0FA 3SNKA 1KETA 4PIPA 1CUCA 2A9RA 2FU5C 2WB4A 1OU4A 4G65A 4RNDB 1OZAA 3KJZA 2ST1A 4XGKA 1OYVA 2F8MA 2ARKA 4RELA 3QVJA 4TKVA 3EGIA 3INNA 5EMKA 3UB4A 1KHTA 1N2GA 1W8DA 4OI4A 3ZGVA 1KYIA 2E1RA 1A9XA 3OY7A 4IZ6A 5I4IA 1YBFA 4R0VA 1VHJA 3I6MA 1DRVA 1O0SA 5JUWA 3BI1A 3O21A 2HWWA 5CITA 2D59A 1WVIA 2H4HA 2SCUA 2XLBA 3G59A 4IZIA 1YI1A 4NGTA 2GKSA 5CLQA 3UY4A 1I10A 3CZQA 1PEDA 3GEGA 2GEBA 2YZ7A 3L6DA 4OXIA 2UVQA 4PGFA 1TGVA 3BF7A 1NVBA 2K2WA 4CIDA 4WRRA 3REQB 1P5FA 4IV5A 3BGIA 4CR7A 3R1IA 5BMVA 3G8BA 3WGKA 4JH0A 1HYBA 4QFCA 4BNGA 2VCEA 3GH1A 2P2NA 1G20E 1NULA 5C80A 2FK7A 2HRRA 3PXGA 3T1OA 2PFKA 3KVRA 3LBIA 3LW7A 1GA6A 3QVVA 4UE3S 4IDCA 2EIHA 2P9JA 1FX1A 3D5EA 3F8TA 3CLTD 1LPBB 2C2HA 3K0CA 4KXMA 4BNYA 1T5LA 2TMDA 5HUJA 1CUUA 3ZHOA 3VGJA 1M8PA 3DLAA 2FHSA 3CRVA 4FNOA 3WQHA 1GTG1 4DA7A 5JAHA 3PSHA 3TCKA 4B32A 2FZVA 2JCSA 2B8NA 2GCNA 4N3NA 4JJKA 4DQLA 3GEPA 5BVHB 3LXMA 3PV0A 2J9FA 4JELA 3TDKA 4QRDA 4TWAA 4AWAA 4K40A 3AJAA 2ISSD 3MJEA 4UOZA 4MYTA 5HXAA 3DMHA 1T8TA 4M1TA 5AJZA 1CS0A 4RY8A 2ZS7A 5JMOA 2EATA 4BVGA 4ZVKA 4RA6B 5A05A 1DI0A 4UMVA 1T4MA 5KYWA 1N2JA 2PIAA 5BUQA 5AK4A 1XMVA 3B60A 3LRPA 2ZT7A 4OA8A 5IJ0A 4ML3A 1DIBA 1N2XA 2C3YA 2EKPA 4KDCA 3TTXA 1XCBA 3WYFA 3JQRA 4E94A 5LMUB 4X3RA 1SVSA 3MTJA 3IOCA 5JYEA 5HP4A 2QBYA 5JD6A 2H1WA 3P52A 3WTCA 3T9BA 3GUVA 3P9RA 1M74A 2G77B 5EMHA 4G4SP 3FAZA 3GLFA 5GTDA 3MLBA 2VPQA 2O8DA 1PR3A 2H07A 4X1YA 4DIBA 1MVLA 1L8AA 1J1UA 1Q0LA 1RQRA 1RXVA 2QRKA 4RENA 2O0MA 3PUWA 1KY4A 3MXOA 1JEJA 4OFXA 3IQEA 1QTNA 2HJVA 2W4MA 2W83A 4YK7A 4X1KA 2R7NA 2ZROA 1XMPA 3G2NA 1DMRA 3I2HA 1XFAA 1M2KA 2BFCB 5LCXA 3IS3A 4F8EA 2POQX 1H6DA 5F77A 3ZX5A 4CLOB 4CW7A 5DI3A 3E4CA 3R6DA 2COKA 1ZHFA 3Q0IA 4UUMA 4TXHA 5BORA 5IAAA 5IZ4A 3LGAA 3DO6A 5D6NA 2IEDA 5KNBD 2AR0A 1X1AA 1JF8A 1WNFA 1XHLA 1UKYA 2JD0A 1U8XX 2HREA 3K73O 4RLHA 3T5MA 1N0HA 1BDMA 3R9XA 3T3PB 2OLJA 2VP4A 2DHEA 2ZBVA 1U9IA 2FRDC 4KAAA 1W4BA 3W4KA 4RHYA 5KMGB 4U7DA 4WNIA 2COEA 3FSJX 3L0CA 4EY8A 2B83A 2X9VA 1GR0A 4MP8A 4N0DA 1H2BA 4K0RA 1MORA 4S35A 2J6IA 3NKVA 2GHIA 4LPKA 5GJVC 3UUWA 4DS3A 1ILEA 3R7AA 1BA3A 2D1QA 5AW8A 1Z0AA 4K81B 5ESXA 1KEEB 3BMOB 2Z2IA 2VRBA 2BH2A 3GIDA 4YJ3A 1T9DA 2UDPA 1L4NA 1ZCJA 3FFAA 3EFEA 3QEJA 3O8QB 4IMJB 1P44A 1CJKC 4J1SA 3IKLA 4P4NA 2FW7A 1D1QA 2PPLA 3QTTA 2JIOA 2AD5A 1P6UA 5HF5A 2EX0A 5KX5B 1G1AA 1XELA 5FO0A 3U7HB 4EVQA 3T3OA 4ASUD 1LH0A 1LLDA 3GGCA 4RPGA 4HC4A 4XPZA 4Y2YA 1IB0A 1WUHS 1A2KC 1WTCA 3MJDA 2FR8C 4PFSA 3EG5A 3NYIA 4EH1A 1YA6A 5JXHA 1N2OA 3KK0A 4ROSA 3LCJA 4Y1RB 5CH5A 1RC8A 1IRIA 1SGWA 3N2GB 5EFZA 1WOYA 4XEUA 2EKZA 2H65A 4WN9B 4W1SA 2QGFA 4QDTA 4M0CA 3LDFA 4YFYA 1XR3A 1GV0A 3OPYB 2DT5A 3ILYA 3FAKA 3RS5A 1P1HA 2VYVD 2OK7A 1A9QA 2WJYA 2AK2A 1ZNQO 4L3WA 5HEKA 4C2UA 4HVAA 3P0IA 2OAGA 3L0BA 4TRRA 1VYHA 4DCOA 5CDHA 3Q7QA 4HDOB 1CUVA 3QV2A 4W5TA 2JC3A 1V4BA 2FETA 4BB0A 1QVRA 1C7FA 1K7YA 2L69A 2F1KA 4Q0MA 3AHGA 1W9MA 1W47A 3A2KA 1DKQA 1JHVA 5FQNA 4WK6A 4DEYA 4KWHA 1LJ8A 5SYMA 3EHDA 2RJ3A 3W5VA 3L4KA 2GN0A 2ZWVA 3G9ZA 4Y2GA 2R85A 2WVAA 3GR6A 5FWYB 3FHLA 5TS3A 1NOKA 1B8PA 4A16A 2BSXA 1ISMA 3OIYA 3SQNA 2RGDA 1YR7A 3OP4A 1D4ZA 3RB8A 4I9NA 3QPVA 1P4JA 2R6R1 3O91A 5FYQA 8ADHA 3DV0B 1UPBA 4TTPA 5A0TA 2GKGA 1FC0A 5CVVA 1P1BA 1VIVA 4K6CA 2YRFA 1MTOA 2WJ6A 3LPNA 3PUJA 2XMQA 1EP3B 3A4MA 9ATCA 3JATA 3ZE9A 2P65A 2RGUA 4YECA 4ZA2A 3DDZX 1OILA 4GQBA 3DCYA 1ORIA 2C8KA 1O94A 4MRSA 1I6KA 4XWKA 2YICA 4U9HS 1W44A 1U5BB 4YPVA 1X8LA 3E2PA 4AF8A 1IZYA 1OFTA 1T8YA 3HNPA 3N28A 4EHAA 1TMYA 1UMBA 1ISFA 2FMIA 3DOCA 2VO1A 1MHTA 1HF3A 4UJ3A 1BDIA 2IV7A 4EHKA 3TQSA 1VZ3A 2N46A 3R3YA 3LKZA 1JJBA 4P4SB 4Q7LA 5KNDH 3VO2A 2K5UA 2XEGA 1V11B 3CUVA 5JRZA 3RRJA 1RQ2A 3R0ZA 4KIGA 4H31A 1Z74A 4HDMA 4TMXA 1SEPA 2QRUA 4MOWA 3CUUA 5CLIA 4FFWA 3GDHA 4C9BA 4KFRA 4OSPA 3BTVA 1MB4A 5DO9A 4L5BA 1V6AA 3O5AA 4Y2JA 1F2UB 2G09A 3IVXA 1RAEA 1RRKA 4F9GA 4G4SO 4Q66C 4Z7JA 2GR9A 1ADJA 3QG1A 5IBPA 1PZMA 1ZISA 1US8B 2G9RA 4RS3A 4ERXA 1K7CA 3L7DA 4KE7A 2Q5HA 3RABA 4YS6A 1L6RA 1MG5A 3AM4A 3FCUB 3GGSA 3I28A 3JQ8B 3A32A 4FCCA 4MPJA 1EA7A 4O0MA 3ZK9A 4EB8A 1MO2A 4RXTA 4OQQA 1DGQA 5ALSA 1PWYE 1XIVA 3BYZA 3ED5A 4BU1A 3I76A 4P7JA 5JBNA 3GRYA 3K8ZA 3R3XA 2YZMA 4Q3OA 1MXHA 3M2PA 4Q48A 3RFVA 3GCZA 4PYJA 2IH2A 2ECPA 3WOVA 4MKRA 4WY2A 1AUQA 3CH6A 2V7VA 4Z9XA 3RSLA 1RVDA 2JKYA 4NVRA 4F1KA 1D2RA 2I29A 4BN4A 5IVHA 4O4LF 3WKEA 2IOFK 2VWPA 1XDGA 4S1TA 5JVDF 1U9YA 3HDTA 5CB6A 4LRQA 4P4UA 3PGLA 3OIUA 4YAOA 3GF4A 2OHXA 5FBQB 3DZIA 1KGSA 2I2DA 5EQDA 1L7RA 3OM8A 4QXMA 1EFKA 3S2YA 1BD4A 1VJ5A 3UK1A 4CZ1A 4J43A 5EQTA 3DHVA 3EPPA 3PQDA 2JVIA 3BIOA 5CTAA 3W5SA 1DQPA 5B64A 3ZE2B 4OQEA 5GQSA 2AEMA 2IP4A 4DLVA 3U1BA 3WDLA 1OJLA 3SSAA 2B78A 3BGSA 3OTOB 2JZOA 3RS7A 2BC9A 3QKIA 4LI3X 1E4OA 4I55A 3GA5A 4YUYA 3FB1A 3VKGA 4HLUC 1Y1PA 4UBJA 2J3LA 4ZVSA 5IH3A 1SXGA 3VR4D 4MW2A 1E9RA 4N9QA 1E79D 3OZBA 3BSWA 2QRGA 3KAKA 1LTHR 3AUKA 1JPVA 4M0FA 3VYSB 2A1IA 2AXNA 3CCBA 4NPHA 3UHOA 5F2OA 3IIIA 5CU7A 1CY7A 1ZK1A 4MV3A 1FFDA 1CUIA 3DW3X 3FUTA 2QD1A 1SQGA 1TUBA 3VYWA 4S0XA 5H80A 1ZGHA 4M83A 4MS1B 1CB0A 3TKYA 1FTWA 4CG0A 2QVYX 2X9LA 3JWHA 4P58A 4EMUA 3FCYA 1JIKA 4HATA 1FRQA 2Z5LA 3W9YA 4MCPA 4G36A 4PICA 3LNTA 4UNNA 1V4NA 5FJIA 2BFBB 3IDOA 4QFBA 1VQ1A 5EN4A 3SZLA 2C5HA 1PK7A 5AUOB 3C8ZA 1P6XA 1WAMA 3MMPA 1XKQA 3ZXSA 4TM7A 1PWZA 2BMVA 1BD3A 2I71A 3GJ8A 3C6ZA 3I05A 4KXFB 3ZCUA 2AJDA 5JCZA 3CJQA 4OHBA 1WUIS 3M9LA 5E1BA 5AHOA 2CV1A 3RFUA 4KUHA 2DLNA 3L41A 1UKBA 2HK8A 3NW9A 3G0OA 2Q4RA 3IPYA 5FI5A 3NH6A 4M8SA 4XR9A 3UUGA 1QRUA 3K72B 3T1VA 4ENSA 3EDOA 5J2UA 1RRMA 3FPBA 5LQNA 2QSYA 1AHIA 1DELA 4UD6A 3U61B 1A9SA 3BG5A 1JWLA 1GNRA 2L82A 4OXRA 1C30A 3FLMA 2QL9A 1ZD1A 5DGHA 2I65A 4IZHA 2EW8A 5J5AA 3T6KA 1NVXQ 2X5JO 2KLHA 1DO2A 3K9TA 1T9AA 1NNSA 1VB3A 4H1TA 3TSOA 2V7QA 3HP1A 5J23A 1EHIA 1XVTA 3FMGA 3IQXA 1BFDA 1V8OA 3JYQA 1RXUA 2ZG6A 4KQ6A 4FWBA 4CQMA 3ESAA 4NFYA 4D4HA 3D8SA 3PFGA 4EYGA 3GDOA 2J3HA 3LL4A 1SCUB 2P2DA 3BQNB 1U0NA 1ELOA 3BGVA 2X0DA 2GMWA 3FKSD 2AOTA 3OG9A 1OE0A 1SQ5A 1T8RA 1XAJA 2JLBA 5EXPA 3CVWA 3SJXA 1G42A 3CGGA 3E3AA 4OU4A 3W6UA 2CDRA 3K8YA 4AJHA 4YGXB 4D98A 4JXXA 5D00A 1J0BA 1T2NA 2Y2UA 1XZKA 4ZOCA 5TQ2B 4JI8B 5LXTB 4OFBA 2J3MA 1QGUA 3ORSA 5HMLA 3VPXA 1NG1A 5MDHA 1ZAKA 5MGNA 3IE1A 2EU8A 2J5RA 3VOSA 4C4OA 3OE4A 2ODTX 2I03A 1GZSA 3VMMA 4QBTA 2OWDA 4LX0A 2NZXA 4IJKA 4PFKA 5ITZA 2PVVA 3OBBA 5KOJB 1BCRB 1RXCA 1YJ5A 1Z29A 1B6RA 2JGIA 4B6GA 4J7CA 4CLEA 2V6MA 3WNDA 3U26A 2QENA 1C7JA 3IVGA 1RCUA 5EUQB 2HXYA 2VATA 3DYBA 3ROGA 2ZSEA 3HPQA 2FOLA 2HQ1A 5ANRB 5AQ1A 2RAFA 3JQQA 4FFPA 8AT1A 3WLOA 4CMCA 2NXCA 4D4KA 2VRWA 1UJNA 3FKSA 3QXJA 2WVHA 3UH1A 4N41A 1R6AA 1E2DA 1LB1B 2YXPX 3TNFA 3HSSA 1B76A 2RGNA 2B6NA 4CYMA 1JE1A 3D6AA 4I99A 3O2JA 3RVMA 3HO8A 1UZNA 1XCMA 2IPNA 2D5AA 1F1JA 3JQ9A 1SKYE 2QN1A 3EGOA 3T9AA 3CWQA 3R40A 5FHRA 1AMNA 2JAQA 1GZ3A 4IW3B 2I76A 1EBBA 2WHXA 4IGAA 3TGPA 1ZZEA 4PZDA 1XVUA 3NBKA 4IJ6A 5EIAA 3WGVA 3OLXA 2AK3A 1ZI8A 4UNIA 4BNXA 3LWDA 5EAIA 1TT7A 1Z5PA 3P0EA 2QQ0A 4NFHA 2O8CA 2OMEA 2ES4A 2R5NA 1NXSA 4OA5A 3CUTA 5DEIA 2B0CA 3D2BA 5SY4A 2O8BA 5FB3A 2Q2OA 1SRQA 5T4HA 1Z4JA 2ATXA 3E2MA 4MJ7A 1UWLA 3ENWA 1T13A 4RJJA 2PKQP 3BUSA 4DDUA 3JQDA 4KH1A 4U2EA 1MO6A 2CVZA 4BMDA 4HPXB 3KU4A 1NDQA 1USUA 3R0VA 6REQB 2JFVA 4QC2A 1OI7A 2OHVA 1C8BA 5H3CA 1XQXA 4LE1A 4Q9DA 3SJEA 1WU7A 1W25A 2GBLC 3VZBA 1JEQA 3G9TA 4N39A 5F21A 3ZGZA 4CKBA 1DT3A 3P4UA 5KAPA 4TJXA 4MJLA 2DBRA 4QRIA 3UOGA 3UUEA 4B73A 1NNI1 2WUGA 3CZPA 4KZPA 3KEOA 3WP1B 1TX4B 1DAHA 3WE7A 4TT3D 2JGFA 5DSXA 1KYZA 1V5WA 1GQQA 1LBHA 1GGNA 1YQUA 4RK0A 1SOWA 1YD7A 2C8VA 2QVBA 3QXXA 4OTZA 1ISHA 4QBHA 5FO1A 3RIMA 4NCKA 1QP7A 3KKLA 5J2TB 2FWIA 4OF4A 1T10A 4RPLA 3RD5A 1IL0A 3KQVA 2E5WA 1VBKA 1TKAA 1DT5A 1U2PA 3HDHA 4FDTA 4PSAA 4QPJC 3DG9A 3GT4A 1P19A 4UASA 3HFSA 4I1UA 2ZE8A 4DDWA 1X0VA 1H0KA 3D2LA 4NMHA 4UFPA 5C37A 4G5SA 4HDKA 4HSEA 4BMYA 4D81A 4YRNA 5BSEA 3SJZA 1CEXA 4Y9UA 1U7DA 1NY6A 5YASA 4DIFA 1X7HA 1K8YB 2RGCA 4A91A 4GEKA 2ATEA 1DKNA 1L4EA 2ID4A 4G07A 4YMWA 3UAVA 3P1JA 3SGLA 1BXZA 4GVLA 2IV2X 4UAVA 4RVNA 3L7JA 4KQWA 1QK3A 4O4JF 1AV7A 2M6RA 5DF1A 4F11A 3M1IA 1QYDA 3RU9A 2I33A 4E4RA 4HAZA 1CX8A 1KVUA 5JMWA 3H6GA 2ZYGA 5JD3A 1NVWQ 1QR2A 2ZUVA 4P9NA 4HEA6 3KB6A 1UK7A 2Q49A 4MZXA 4ODIA 1KPIA 5BOSB 1QHEA 1KQ3A 3MQ4A 5DT9A 3ELUA 2MMGA 3M5WA 4BVFA 1RLMA 3JY6A 4KXYA 3QPDA 4MW4A 1I30A 1QGAA 2YBDA 1KMQA 2MSCB 5SV2A 2PSJA 4P4LA 2WD7B 4JJ6A 2BFFB 2R751 1N1GA 3PXCX 4AG3A 3FF1A 1WQ4A 3PRYA 1AKNA 2EHDA 3AONB 3EG9B 2PUAA 2GFQA 4FLFA 3ONVA 4UCWA 5FPQA 1O8BA 2H0QA 2VYNA 3MWEB 5L95A 5LZ5A 1W5BA 3IQWA 1KRHA 5A5EA 3THOA 1J2JA 2D5LA 2DPLA 1HDOA 1Z6TA 3CF0A 4S24A 1XC7A 2CN1A 2R00C 4IRUB 4YO8A 3U3DA 4PAGA 3HZHA 4CEIB 1T9ZA 4JR2A 1BKSB 4RDXA 2FA9A 1FRFS 4IVPA 1RDFA 1S4QA 1TA9A 4A6EA 3AVXA 4PYLA 4PO3X 3DHYA 4TZTA 4Z0HO 4HWKA 3IMEA 3O9ZA 1T1EA 3PIDA 4QEDA 4BX3A 1LVUA 2HJGA 4YDHB 4JBLA 1ZJ4A 3C1AA 3OF5A 1W4ZA 5DKFA 5JQGF 4EF6A 4POAA 1DEAA 2WIGA 2O19A 3V97A 4O25A 1HEYA 1IPHA 2E4WA 3BD8A 2EDAA 3L0PA 1UP4A 2X6QA 3NJ4A 3B51X 3EQ6A 1W73A 2QZ9A 3NUZA 2Q0HA 3QGMA 4ZQIA 3WV5A 5F3WB 5GJBA 2H1SA 3TZEA 3F7OA 2H1OA 2R68A 1N0IA 1NM5A 1Q2UA 1IBSA 2RIRA 3KEQA 3S3TA 4CGYA 2IDMA 2WBLC 4LXXA 2XNJA 4BEWA 3PDUA 2JZNA 2FE4A 4CUZA 3FNFA 3QPCA 2CXUA 3P2YA 3U9SA 5JJLA 1ATZA 2JJ2A 3LCCA 2ODEA 1U7HA 3MB8A 4LK3A 3ZLBA 4CVNA 2I8LA 4ER7A 3BFPA 3WMGA 4CIAA 2GM9A 1OH8A 3F6EX 5CT6A 5IP5A 1LSOA 1C5KA 1KH3A 2A0XA 3OQOA 4HPWA 3FBTA 3D31A 2HK9A 4U63A 2VG8A 4LV6A 4Z3OA 1P62B 3PD1A 1YS6A 2WQ6A 2WE7A 1XMIA 2WJZB 4NYJR 2BN4A 3PXXA 1R9GA 4MKFA 5DIFA 4QGHA 4KTVE 5FBHA 4HDCA 1ZD2P 4N0EA 4YT2A 5EKTA 4FMCB 1D2NA 4JYZA 1SCKA 2PRSA 4K3UA 2DOKA 2B9EA 3W7AA 3CPHA 2QZZA 4ZMBA 5A6SA 5A6VA 3R8FA 4C7VA 3OOSA 3K4HA 1TDJA 2WG1A 5CLHA 5DH9A 3R77A 3OX3A 4IOMA 3HDGA 5I48A 5E1OA 4MCRA 3LLUA 1IBKB 2YJNA 3H5AA 4Y7DA 2OGWA 4W9NC 3CEPB 2H6EA 4XAQA 2DQ4A 2X3UA 2FVXA 2II6A 4LOAA 4ZO7A 5E6UB 4CMGA 5KKCA 3KWJA 3IP6A 5I7HA 3CLKA 2YC2C 4GZ5A 1DS6A 1AY0A 5FIUA 3ZCPA 2EWMA 2YV1A 5AVWA 3RQIA 3TOZA 3ICCA 3V55A 3IPRA 3QQ5A 4FM9A 3NHWA 4C30A 1U5AA 2ZGVA 3VI3B 5ADHA 2DXIA 1KDOA 4FW9A 3AZQA 2FSHA 4NAVA 4GOKA 4N3BA 3DW1X 2H8GA 3TNLA 5FNVB 4QHTA 3LX6A 4LQDA 2GK3A 1TFUA 2XWSA 2AHOA 5KYYB 2VZ9A 1EFCA 2CXHA 5HKAA 3CEAA 1SUCA 4AJKA 2PL3A 2V7EA 3RHTA 4TKZA 2WFAA 1S7GA 4XGRA 3ZJ5A 2L2QA 3SZGA 5D3QA 3GHHA 3H4IA 4RGBA 3WKBA 4XFKA 1ESZA 1ICIA 3BERA 1EUQA 4MVJH 5JJKA 4RD6A 1KO4A 2YH2A 5T67A 1QCYA 3BRQA 3DT6A 4GZ3A 4J6EA 4TOIA 5JXJA 5LUAA 2ZU0C 3D6NB 4RD2A 1QB8A 2AN1A 5CYPA 3DOJA 3TXYA 4JJ8A 3T5AA 1QTRA 2AQ8A 2V9ZA 4B81A 2K4MA 3ESDA 4BBZA 1CUBA 3UCEA 1Q1ZA 3TZKA 1ODKA 5TMEA 3RUFA 1X1RA 2VDWA 2WKQA 3COZA 3GP5A 4BGIA 4PBTA 4OB7A 2GZMA 2I66A 1T36B 3LQRA 4I50B 5ICMA 1A8IA 1MA0A 4RTOA 1JDZA 3C4JA 3Q72A 4JKYA 1KK3A 4V1CA 4M87A 4E5VA 3TTTA 2YUTA 5JATA 3LY9A 4DUGA 2H2GA 3I39X 3W4IA 3F8WA 1JAYA 1G0NA 5A9TA 1RP1A 2C7VA 2XB8A 1U1FA 3ADDA 3WA6A 2BSAA 1QMGA