3TLCA

Microcin c7 self immunity protein mccf in complex with microcin c7 antibiotic
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYADTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
total genus 116
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlcA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlcA02
3TYXA 4E5SA 1ZRSA 3SR3A 5F9MA 5F1YA 3GJZA 3TLBA 3G23A 4MI1A 5JYBA 4IIYA 2AUMA 3T5MA 4E94A 4EYSA 3TLGB 4H1HA 3TLEA 4MJXA 3U1BA 5FD8A 3TLAA 3TLYA 5K99A 4IIXA 3TLGA 1ZL0A 4JVOA 3TLCA 3TLZA 2AUNA 4INJA 5F5XA
chains in the Genus database with same CATH superfamily
4XCXA 3BG5A 3FZEA 1ULBA 1V2HE 1SG9A 3L0DA 4JB8A 4AJJA 4AMVA 4PO9A 5CM8B 2WYWA 4RX1A 2A33A 2JCBA 2XQJA 4F5ZA 5LL6P 2O5VA 3FAKA 5JYBA 3EDOA 4UM9D 3MBKA 1VSQA 3C5EA 4LXUA 1AOXA 2X4LA 4P7FA 4CI0B 3THXB 4I8DA 4QOEA 1G3UA 1LSUA 2CE2X 4MVJE 5C3MA 1FMTA 1K63A 1XD2A 4UUNA 4FD3A 1ZK3A 2GZSA 4LZZA 5U4XA 5GV7A 5GJCA 4IH4A 1OX5A 2QMHA 4GZMA 2ZIWB 1PFUA 3IILA 1FW8A 4J0FA 4Q03A 3X1DA 2WTXA 2Q27A 3HMKA 1U6IA 1GOTA 3FFWA 4CE6A 2Q5EA 4HN2A 5HR5A 4X64B 1EA7A 3AHEA 3S3TA 3TBHA 4CMGA 1G5HA 1BCRB 1NQUA 4LK3A 5KTPA 4MW0A 3IUBA 5LQAA 4E5DA 1XZCA 4RTKA 3TLJA 1QIGA 4MR9B 1GITA 2ZJAA 3U61B 1CF4A 3QKWA 1O7JA 3PHCA 1IUKA 2Y0BA 3BBPA 3FD8A 3BHIA 3JD4A 2RKBA 4O29A 1JALA 2EX1A 5CB0A 1TLLA 2F43A 3WGVA 1K8YB 2GZHA 1G7SA 4EEKA 1Q20A 2ID4A 4BNFA 4PFQA 5BSGA 4CQLA 2W2LD 2PMEA 4BNZA 3FW1A 2BTQB 3OCJA 1W59A 3EUFA 4BNGA 1HLFA 3OM1A 3WK9A 2GCIA 1HDYA 2JAPA 1DAIA 3Q3GE 1Q5XA 1T8YA 2VO1A 3EZNA 4OFBA 2HFKA 4J2OA 4RF4A 1L7MA 4S1NA 5KJCA 1TKCA 3HLYA 2G1JA 2FSHA 2Q2NA 5CR9A 3U3ZA 4TWZA 1DE4C 1QOQB 3LF1A 3U3KA 1UP7A 2W22A 2XDQB 1B8PA 3OQMA 3FMPB 1ZEMA 1S2DA 4HZUA 3KLMX 1QV6A 5D3MB 3V9AA 4CLOA 2W2VA 3ZQ4A 1Z36A 1KAGA 3FG9A 2AQHA 3OLQA 4DIKA 2GCEA 2CL5A 2NO7A 2Q1TA 4C6TB 5LQKA 4XB1A 4KDEA 4R1MA 4AP5A 4C8CA 2W2XA 2H5EA 4RJIA 3U3RA 1KI6A 1OHHD 5FHRA 3DF9A 3UC5A 1NPDA 3IPCA 4DOMA 4G0MA 5M7EA 1WD7A 4Z2AA 4DSAA 5FOTA 1Q1QA 4N7MA 3C14C 4GLBA 4RK7A 1I5EA 3ZJ4A 2DAPA 4K9DA 3OP1A 4RK1A 4EPWA 3I39X 3BCRA 4Q6WA 4PZLA 1GUFA 1G17A 2AVDA 2TS1A 1RAAA 4BVHA 4MDFA 3PXXA 3ONVA 1GSAA 2QROA 1EA5A 3FTCA 3IE2A 2ZAIA 2ZBQA 2X1HA 1CR6A 3DLBA 2JPDA 3M3PA 2VFAA 3NDPA 5JNVA 1LLCA 2ORED 2CLCX 1KP2A 3NRJA 1G8KA 2PT6A 1V4VA 2W8BB 4OFXA 3H7AA 4QPDA 3UMJA 1T6YA 2GS9A 1KHHA 1IPFA 3QFHA 4J7UA 4YGXB 3W8EA 5C37A 3FWHA 3U1BA 4HH4A 2QSZA 4LCEA 1R18A 3CZRA 2DWPA 2D8AA 2K2WA 3HXKA 4DKXA 1SC9A 5EMKA 1KKMA 2JKYA 1QYDA 4C9RA 1NBME 2P9BA 4BO3A 2XXJA 2FETA 3QOWA 5AI5A 4EO4A 4HQKA 2ZVQX 4G24A 2H1LA 4BMDA 3GELA 1OCEA 1NBWA 3L77A 1CUHA 3E35A 3PQCA 4LI3X 2QMQA 2G8NA 5JG7A 3FXAA 1E92A 2A84A 3H4IA 4FZ5A 5LMCA 1UWCA 4NYMR 3W5DA 3GCGA 1N2EA 5BN4B 2XIJA 4BKRA 4LF8B 3FVWA 3OBBA 2NO4A 4N3CA 4C4TA 4FM9A 1SCAA 2VNAA 1R6BX 4QOJA 4A26A 4Z3OA 2UUAB 3JWEA 4HL6A 4JZ0A 3ENQA 4W9YA 3ZCSA 3L02A 1PJTA 4XASA 1N7HA 5FL7A 4LDJA 2FWAA 3AB3A 1A5ZA 1FUUA 1J70A 2ZRLA 4PSAA 4HVLA 2F1HA 1SIOA 2CNBA 2ZTMA 3DEFA 1LGYA 4J29A 3RC7A 3EXHC 1RZRD 1P2DA 3K71B 4GOKA 4BWFB 3DCYA 1XQWA 5E38A 4JODA 4E2YA 4RZQA 1P6UA 4PSCA 1MB3A 4CM6A 1V47A 2GKSA 1X7WB 5IKPA 5DX0A 4Q9KA 3SGLA 2DR0A 2C6GA 5J58A 1SVWA 2GDZA 4UEOA 4ZARA 4EFMA 3RS4A 4B3DA 3HVRA 3KSRA 4UM7A 3PDUA 3BVPA 3RFVA 4ZI7F 4JLBA 4HLQB 4NH4A 4L5JA 3KEMA 3BJMA 2PV7A 3EXFB 4HEQA 1VPTA 4RF5A 5KX5A 2MHCA 1HH4A 1CFJA 3I04A 4G0ZA 4URWR 4NABA 1K6IA 1Q2XA 2O2CA 5JDIA 3JU3A 4MUNA 4BGEA 5INTA 4Z3KA 5CB4B 5DGTA 2BIFA 4AFNA 5EE9A 1QGOA 2R60A 1QDLB 3A11A 1QYCA 2AZMA 4MPJA 1NRJB 1ZCAA 4C14A 4U9HS 5TPWA 1BFDA 4GR4A 3L0YA 1A7JA 2IP4A 2D5IA 2J3KA 4UHJA 5JSHA 2O4UX 3PQEA 1DFIA 1WY7A 2WTMA 3A3YA 3ZWVA 1WR8A 2CJPA 1OI7A 1PDOA 4HLUC 3N58A 4IJQA 4FUTA 1KERA 3T6KA 1GNVA 4Q02A 2PYIA 1R9JA 1EE2A 1N8SA 1JDBB 4DFDA 4G1BA 1WTCA 2H1VA 3OFVA 4X65B 4TRNA 2IX9A 3KYJB 1U6JA 2O0JA 3NUGA 3PUVA 3CX3A 3HFSA 1SQGA 3M0EA 4L5BA 4OL9A 4D0NA 4ESVA 4JI8B 3E0XA 3TNJA 3C8ZA 1HNXB 4M8SA 4OPMA 4RJLA 1PUIA 4QTZA 1MRSA 3HB0A 3BICA 2FUNB 2J41A 2OTCA 3KHUA 1DV1A 3MHTA 1CZHA 4HS9A 1N7IA 3F8TA 4H3HB 1P77A 4FW9A 4K2AA 1CKEA 1XTRA 1S8FA 2IIBA 3P71T 4MQEB 8OHMA 1BU5A 1FFXA 4RGYA 5GONA 1X9IA 3CWZA 2QM7A 1O2DA 4BBZA 4D26A 4O4LF 1YJ5A 4QU9A 3USZA 4N8DA 2Q5JA 4OMFG 3UFBA 3N76A 2VPYA 4HNUA 3EVCA 5LZ9A 2GYWA 2KLBA 4H9GA 2A58A 1MOPA 3BILA 3ZXSA 4KVGA 2XTMA 2FDXA 1GL6A 1I1OA 2PIAA 3C4QA 4G2NA 3BTVA 1O58A 1KMQA 4B3RB 2J07A 4BNWA 4Z54A 4I3HA 3HN2A 3OU7A 1H23A 3RSLA 1Z5GA 5ULLA 3WRVA 5LDGA 5EIEA 1XQYA 1XZPA 1Y8RB 2KQUA 1REQA 1RYHA 2ZCUA 2DHDA 3HEMA 3HVKA 4N7JA 4P54A 2YIJA 1Y98A 2CVPA 3AWIA 1F48A 1BROA 4TTAA 4WOPA 4OX9Y 2O2GA 4RE5A 1T2FA 1DBIA 2HSWA 3U7EB 1NJ5A 4BEJA 3CH7A 3SOPA 3LQ2A 1X1CA 2RKOA 4KZKA 2HSEA 2JL1A 1G8SA 3FPGA 5G4KA 4S04A 4Y6GB 2DFKB 5DFAA 1DFGA 1GZHB 1DTEA 3L0IB 4PN3A 4B47A 3TRDA 1BDBA 3MB5A 1TL7C 5DCLA 1PYGA 1UJ5A 3QUCA 4PBTA 4I5EA 3OE7D 4XIIA 3EXEB 3DEKA 1IBRA 1Y80A 4WJKB 5EHQA 3TD2A 4AU1A 3NEAA 1UPBA 4EARA 4P5PA 4CV3A 5HKAA 2F1KA 1KETA 1NXQA 1RAFA 3F97A 5JMTA 2OOTA 1DX4A 3FZGA 1L1FA 2JH8A 5K6RA 3EIQA 4GZ6A 3ROEA 3WHIA 1TU0A 2CUTA 4C7KA 4JYCA 2Q6IA 5A9RA 2Q28A 3ILVA 1WMDA 1R6UA 4M0DA 4Q4AA 4KC0A 3TECE 1P8AA 1JDPA 1F51E 1QGUA 1R00A 1X0XA 2FSSA 3I4CA 4KP7A 1BXRB 3K73O 5EWMA 3TW0A 4NYIQ 4EG8A 1WUTA 3A25A 2VHXA 4OQPA 2V6MA 3WDSA 5HEKA 1JQEA 5E6UB 3OOSA 4FN4A 3JYLA 1G64A 4IUCS 2JJ1D 2FFQA 1P1RA 2XWJI 5MDHA 5IJ0B 3W5VA 5E9QA 3WGKA 1GYRA 5HCUA 4BWVA 3IDAA 1ZD5A 2WQZA 1GRNA 1CNFA 1Z7GA 3F9IA 1NWCA 2I4MA 4MO2A 4X0EA 1GPDG 1N6LA 4EF5A 3DFUA 3ZNPA 1NQWA 1VCNA 3F46A 2JA2A 3KFXA 1PAUA 1WVGA 1SOAA 2WWHA 5ICSA 1N7GA 1W5SA 1P2TA 2R48A 3X0DA 1LLQA 3ZCUA 1NASA 1RU3A 1IY0A 1ZPDA 4Z9YA 3VR1A 3OZBA 1AGYA 2XVZA 2WJAA 1Z0ZA 2O3QA 4M9CA 1VB5A 2BEKA 1QZUA 2A9FA 1EWTA 1FTYA 4IIYA 3WLTA 4AWBA 4M60A 2R6HA 4K6MA 3UXYA 2XRFA 4ZDWA 4D4JA 2PGJA 3J7AC 3BE6A 4V0RA 3L7NA 3EEQA 4NENA 3D02A 2RGNC 5DYTA 1N2JA 3TW8B 5DHAA 2J3HA 2RGRA 3NRBA 3RDPA 3S68A 3AERB 4JH0A 4D8VA 2P2YA 3U31A 3VTZA 1LY1A 1MIHA 1N57A 1W19A 2BBWA 3DFZA 3H2KA 2WYHA 4A8PA 4CUJA 4F9GA 4GHWA 2X3YA 4YFVA 4G8DA 4HDOB 3SQOA 4PYJA 3KHTA 5FR2A 2YV4A 2AJLI 4WLOA 1I01A 3X1JA 3KAKA 4MVJI 1H0HA 1PZHA 1XTZA 3B1ZA 3GMSA 1DRUA 4Q16A 1Z34A 3VM6A 4WNYA 3BHJA 1Y4ZA 1H65A 4Y8VA 3C6ZA 4MWOA 1NONA 3S9NA 1WP9A 2Q4TA 1ADCA 1TA0A 5JATA 1G2PA 1M8JA 1VFPA 3D1LA 5IK2A 4I4TA 1GO2A 4Z9AA 5DM0A 2WM3A 1YASA 2CL6X 1YS6A 3O4JA 4JC4A 2CMKA 3DTVD 3U4CA 1BE8A 2GCOA 2V55B 4YJFA 3L6CA 5ALYA 4CMCA 3ITNA 3EGWA 4Y2RA 1O95C 3PXAA 4II7A 4FDAA 4D96A 2EP5A 2NPFA 2X9VA 4XLTA 5ARDA 3K1TA 4EDHA 3G2PA 1G9SA 5FUXA 4ZZ1A 2GB4A 1JLLB 4GECA 5EIXA 1OT3A 1RKUA 3DZ8A 4R41A 4JCOA 5CCDA 2E9SA 1I80A 1F38A 1Q0UA 1GAXA 2JVKA 1AZWA 2YJNA 1N0IA 2PYDA 4NK4A 1HORA 5LQDA 3G0GA 1X8KA 3FRJA 1DQSA 2OHJA 3KSUA 3KKMA 3WOHA 5CFPA 1SZCA 4KBGA 4HNAA 2VP4A 1EDBA 3QLVA 3SFZA 1J0DA 1N6HA 4BE4A 4K03A 2FN9A 1CIVA 3DBRA 4HEHA 1I1HA 2FPWA 4IXNA 4OF4A 2WZBA 5AK0A 1RBQA 4FJ0A 3NOOA 1P74A 4LBVA 4N8SA 5KJEA 1HYGA 3NVDA 5HILA 4H4CA 3RYFA 1ZRSA 1CT9A 1K27A 4PZPA 4ZVRA 3I5YA 1R5BA 1GTL1 4FFSA 3FGPA 1N2CA 3IQGX 4KWEA 4NIMA 1T1RA 2YJ3A 5SV2A 1TAHA 4TRJA 1F4LA 1LU9A 1JMYA 4PPFA 4EW2A 2GRJA 2AJTA 2C04A 2DOKA 2PUGA 3FLEA 1GGEA 1QFMA 1LJUA 1TD9A 3GD7A 1PD1A 2OGTA 4RJ2A 2FMTA 1FXSA 3LLUA 5AR1A 4II3A 1PT9A 1SXJD 5CEJA 3EG5A 1C3EA 2ENWA 3A28A 3IP7A 3HI4A 3TLZA 2VRNA 2C5FA 5LXTF 5TR9A 1Y8QB 3E61A 1WUIS 1Y7TA 3DNMA 1T34A 1YI1A 1JAXA 2HGSA 2JBAA 3GAFA 1RPJA 2G4CA 3MINA 5CTJA 5H16A 1B0ZA 3R0JA 1YC2A 2R68A 3NFYA 3UTCA 2A86A 1FP1D 4ETNA 1XZHA 5FI3A 5FBVB 2Q1XA 3W04A 5JVDA 5FNVA 1XMPA 2BKEA 3KKNA 5ITWA 3R6LA 4FZJA 2J67A 4RTSA 8MHTA 8LDHA 3CLUD 1QJ4A 4QWWA 4D9MA 5KWJA 2X6TA 2W6ID 4WVFA 1MO4A 1ODCA 4GI3A 2VDPB 1EFTA 3QPWA 4ZPXA 3BIOA 1OYVA 3QMMA 1RC0A 1HDOA 4FNGA 4L7QA 5TC4A 4DLRA 3C43A 2GZ2A 2GYYA 2PZBA 4WUVA 3UPDA 3PQ8A 4HF7A 3UENA 5BW8A 3U3MA 5KHLB 4WK0B 2VG8A 1XCMA 1XMOB 2VNKA 1YQEA 1RYDA 3DULA 2EBWA 4XWTA 1TDJA 421PA 4ND1A 4ZQEA 2P3QA 3K70C 3E3OA 2X3UA 1KEVA 3A6DA 2CNKA 2FWBA 1RHKA 2SCUA 4KAJA 4B6RA 4DUGD 2EZCA 4QDXA 3RLIA 5CIYA 4GOMD 5SY9A 1CG6A 1J2EA 4ZVOA 2WJ6A 5JU6A 3COVA 1E2JA 3GFPA 4EJ2A 2UXCB 1U7ZA 1W5FA 2VJOA 1B6GA 1NG1A 4CV0A 1QQBA 3LW8A 5JAZA 1OUMA 1QKJA 4BO8A 4Z2YA 2H8KA 3TCXB 4UHEA 1PO7A 1Y6JA 2FEOA 1KI8A 2VPTA 2B4RO 2BN4A 3B89A 4KRXA 3TVDA 4DQVA 2GETA 2IYPA 4PXAA 5KNCH 3AGQA 4JZKA 1XRMA 3WAGA 2PO7A 3NORA 4WOJA 1OXSC 2Z2YA 3GR6A 3IURA 4OKSA 3OZXA 2WK1A 5TIIA 1V1MA 1C7IA 2HMUA 3JARA 2GQ0A 3F6YA 5A5EA 1A7AA 2ZYHA 5CA1F 3I34X 2C5QA 4MQ4A 1U2ZA 4R1UA 1U0LA 3MF4A 1OU0A 1Y7HA 2XSZD 3FTNA 4K88A 4PTLA 4QGHA 4MIYA 5EMLA 3F5MA 2XMSA 3FIJA 3MJVA 5THXA 3QXCA 4MQ6A 3UKDA 4RKFA 2JFHA 4YHHB 1QYRA 1W0KA 2PM8A 3MJRA 2VYCA 5AKLA 3D9QX 3GIWA 1EM6A 4HQNA 4HYQA 3RJZA 1QAMA 4M8LA 2CFOA 4TN1A 3ZJ5A 2W2PA 2X23A 1Y1SA 2EP8A 4FIZA 2AXPA 3R2JA 1NTOA 5B2EA 5IN4A 1JHDA 3VZQA 2C7BA 4QDUA 3H4TA 4QXAA 3K0KA 3I9NA 5A05A 3R0QA 3PQDA 5A6VA 5I48A 2WTUA 1E8MA 1LH0A 1FU4A 4JL8A 4FS3A 2O54A 4AJHA 1KI3A 5A4KA 2GBIA 3MJDA 1Z62A 4YV2A 1TQDA 8AT1A 2AOVA 1AHPA 1DDGA 3FNRA 1KAMA 5FOXA 2I9KA 3TN7A 4YUYA 4P4UA 5IBCA 3DQPA 3HUUA 3UBMA 4JA2A 4S1TA 2B6HA 1VBHA 1WXXA 1P4JA 4NFLA 1YJCA 5IUJC 2OILA 1NXTA 1KDRA 3GWGA 4IR7A 2QBYB 1IOLA 2WPNA 5JBQA 1N6PA 4PYMA 4L5IA 3L8ZA 4M6WB 3SJCA 2V1UA 1KDYA 1OBVA 4UQPA 1PW7A 2Q2QA 1OC2A 1XZMA 5SICE 5LD2B 4KPYA 1DGQA 2SECE 3RRZA 4I2VA 3F5SA 3KUXA 4IX1A 4O6VA 2HYDA 4B32A 4UAJA 1EVQA 5LZ5A 3VHXB 16PKA 3IYLW 5IEBA 3S55A 2AF3C 4OX9B 2WJJA 1UMBA 1XTJA 2DIKA 1O94D 2BKXA 1SC6A 3T5GA 5M3BA 4LHXA 5KNBH 2F48A 3IEXA 4LAFA 4LHWA 2IUTA 3DMRA 4EY5A 4YV0A 2ZPUA 4NBSA 1HOXA 2J4FA 3G5MA 4H35A 2O7NA 1RJ9A 2JJ8A 5JALA 3ILXA 1E58A 2QGNA 4BBJA 1G7RA 2QM3A 4E5VA 4RTPA 3JD0A 2H8GA 2MSNA 3D81A 5E0KB 4ENUA 5C4MA 3ZU6A 4RJJA 1MPXA 4MQFA 3WB0A 1Q6ZA 2OP1A 3S40A 3EFEA 4KACA 2C2WA 4AB1A 2FWRA 5FYQA 5BPFA 2NZVG 4C8PA 1SUAA 5BNIA 1G0OA 2UDPA 1YQUA 1DQPA 1UJ4A 2QIOA 4TQ9A 5ALFA 5LOVA 2X9GA 3P9KA 1RI4A 1Y5MA 2VQ3A 3GG2A 2NWQA 3JCZA 3MMPA 3ETHA 4NULA 4BFWA 5K09A 1IQ0A 1DIOB 2AR9A 2EFGA 2F1OA 2I1WA 2GM9A 2PD6A 2V3WA 3FYTA 3PICA 4YP6A 1L6RA 2ZP1A 3RWOA 2WTBA 3A2MA 3JZIA 4JBWA 4YRZA 1TW3A 3M5CA 4H7KA 4C3VA 1OIWA 4G0UA 1SEPA 1TO6A 2W2KB 3FA2A 5LDDC 1XRSB 5KYVA 1TJ5A 1YBHA 3LPMA 2HA4A 2AQ8A 1Z5OA 3EOBI 4H6XA 4L22A 2NG1A 2Y1OA 2I7CA 5AW8A 3C3CA 2JIMA 1TTHA 2NVWA 3N0VA 5I8ZA 5CA0B 4G1VA 3ZWNA 1XMSA 4KUGA 3CRZA 3WV5A 2ZWVA 4YV7A 4C9EA 4BEBA 2PUDA 3B36A 1WG8A 2IIPA 3ETCA 3FUWA 4ISBA 3GZNA 3S44A 4X95A 3A58B 5TQ2A 3AI3A 3SDSA 4COKA 3THYA 4X7BA 1FE8A 1G8GA 4R31A 2JKVA 2I2FA 1Y3CE 3RFXA 1RCTE 3OJCA 3UCEA 4A6XA 2DJIA 2FCRA 2IF0A 2OZEA 3NX4A 4OD0A 1XJCA 4PIMA 5ALTA 4B4UA 4C8AA 1ZK4A 3DA8A 2IEDA 2C0PA 2WW8A 1T6ZA 1XZLA 2O1EA 3LSYA 1OB5A 2QRQA 4ZHQA 2IXGA 3UA3A 3ZE6A 5A5FA 1NT4A 2ONJA 4QXPA 1YBVA 5BV7A 4X7RA 5LWQA 4V2UA 1H2RS 4AT1A 1U3FA 4UVGA 2W2QA 1KMIY 2NUAB 3UT5A 3MD0A 3CKMA 4A8JC 2I6SA 2X1MA 2GAAA 2P35A 2W2MA 4HV4A 4GPTA 3TI9A 1X14A 5IF3A 3OSZA 2HPHA 1JN0A 3GLVA 4OXNA 4AG5A 1D2HA 3H2BA 5HF9A 3ZQ6A 4RPKA 4TWRA 1W75A 2OZVA 3FE2A 2GJ8A 4O3FA 4BHTA 3CUYA 4F0JA 1ULUA 2WM2A 5K0JA 2ZYTX 4BVKA 3EX7C 3JXEA 3GFQA 3BAZA 3O8DA 4M99A 4P3NA 5FLEX 2HMYB 4A73A 2XRMA 2QVXX 2Z2ZA 3SYKA 1KBOA 1GFZA 3M9WA 1RP7A 4Q82A 3JVDA 2C5LA 3CJRA 4EPRA 3DT8A 3GJ8A 3HC7A 3FGZA 1RVDA 3IP6A 4WOCA 5JAPA 4UQLA 1HFKA 1O96A 5FOWA 3CYFA 3DNPA 4WBXC 4K9NA 1WZEA 2C8VA 2XWSA 2WIKA 4B6OA 2A0YA 5CUQA 1FDTA 2OZLB 4ECEA 1GGMA 1PGNA 1W8DA 1RRCA 2A57A 2PJUA 3LQYA 2DKNA 4F92B 3H6GA 1TKRA 3PUKA 4LWZA 2ZZKA 4R4JA 5K0CA 1ZWKA 3H8VA 2YW9A 3BUSA 4XYLA 5KYUA 1WB9A 3C3XA 2J9GA 2VSYA 2OM6A 2MSWA 3HP7A 1VMEA 5BYAA 4RAQA 4YCDA 1NUHA 4UVIA 2VTKA 2VCYA 3AUKA 3BMCA 2QL5A 3ZVLA 4Y2PA 5BR8B 2GTPA 1E9DA 4QECA 3IAS1 2CXUA 4RYDA 1DHTA 4DNPA 1JTEA 3DW1X 1UBNA 3T1TA 3QWAA 2YWJA 4UU1A 4XDHA 3WA7A 3PDIB 5KSYA 1M6VB 4EUFA 4BECA 1Z74A 3CLHA 3LGSA 3O3NB 4S0XA 1V1RB 5BQ5A 4JMPA 4BN4A 4EITA 1E2GA 1LVHA 1ACJA 2DH5A 2QIPA 3WK4A 4C6RA 3E3NA 3ON5A 2XUGA 1QCDA 2H1CA 2JI9A 4BLRA 1U0GA 1PT7A 5TPZA 1Q12A 4AUKA 1VYTA 4V0NA 3KUCA 2V4MA 4Z4CA 1UAGA 4PXSA 4KOAA 4WXYB 4AZWA 3ZVRA 4TXMA 3NTXA 4RK4A 2PBZA 5ALQA 5J9FA 1PFKA 3ANLA 5FLYA 1YRWA 3IOEA 5CBKA 4TS4A 3E81A 3QWFA 1C2TA 1W29A 2C88A 3ICPA 3RM3A 3FYDA 3TNDA 1JIVA 2VPWA 2C31A 3O3MB 4Q4LA 4G4GA 1PX0A 1SIUA 2RHBA 2BI7A 1SB9A 5G53C 4OB7A 1O6ZA 1YNSA 1Z3IX 3D6TB 4R7ZA 4W8HA 5J2UA 1CB7A 1YVPA 3NAGA 4YAUA 6NULA 2IVZA 1DWOA 1M1YA 1F1JA 2CMGA 4DCGA 4ZOQI 5DBHX 1WCIA 3UWOA 2Y77A 4HSEA 4ZCSA 1E2KA 2CLLB 4BC1A 3GJSA 1P91A 1GQFA 2W11A 1CJUC 2KBFA 3FHTA 4FGWA 1SM4A 2ZYRA 3KT3A 4MWDA 1GNPA 4NZZA 4R2JA 4BPRA 1Z0IA 2E1RA 3LIPA 3L7JA 4GKJB 1LQTA 3RPEA 2Q1YA 4G3XA 2BMFA 2IH5A 1T25A 2A94A 4AP6A 4B3FX 2WWTA 4I8XA 4TMVA 3ECAA 1EEHA 2H65A 4YJHA 1IB0A 4PX2A 1NQVA 4EVRA 1IEWA 4EZEA 4N5NA 3TW6A 5TQVA 1SXJE 1XCJA 1V41E 1GHTA 1NF2A 4QBIA 3ZCVA 2ZYIA 1ZIOA 1QH0A 2QUIA 5BNWA 5C1OA 1AQNA 5T67A 3VMMA 4AUNA 4ETIA 3FKJA 1EUCA 1KVRA 2YJ4A 3CH6A 3ZZ0A 3QYAA 2P6UA 5JXIA 3PL5A 3RSSA 3NM4A 2C7RA 2CNDA 1TJ4A 2F1RA 4L8LA 1EAYA 2BGMA 3DQZA 3N70A 4XX1A 3JQAA 2GD6A 4YN3A 1NM5C 2GP4A 5JNTA 4ND7A 1ESCA 1BXGA 2W6QA 3A8TA 3DR5A 4UTPA 4GE0A 4MLCA 3OY7A 3CLSD 1HLGA 1O97D 2QUJA 1N6OA 2P67A 2XVMA 2FVYA 5AOBA 2R7LA 3NHBA 4CR6A 3AU8A 5I9TA 1XTPA 3AC0A 2ZRAA 1L5SA 1CR1A 2I66A 3DV9A 3P0EA 3PGXA 4IQGA 4WRRA 1EFPA 2IWHA 5B7QA 1F7VA 2REQB 4Z0HO 3H2YA 5GOTA 4B85A 4AI6A 1QE0A 2P30A 4NBTA 1P5ZB 4XM1A 3V32A 5FX2A 2XZOA 4F46A 1LTQA 1XVTA 3RBXA 1WF6A 5IC6A 3TLYA 1NNEA 2NXWA 2PX2A 2AOUA 1L7AA 2D0PA 1VI6A 4LRXA 4FFDA 1ZSYA 2NU8B 2E2WA 3ANTA 4QPJC 2PXAA 4EHFA 2YC2C 2Z3ZA 1M34B 4KTVE 1J3LA 1O9HA 1EBBA 2PH5A 4A23A 3Q3VA 2VHVA 3WBKA 5DYNA 1VM6A 1UPCA 4K9LA 3FUVA 4FCVA 2G5CA 5ESDA 4QKQA 2HTFA 5F23A 1XD2B 3NWOA 4OP1A 4TVKA 1THGA 1AH2A 1FSPA 3KT0A 2JIDA 4M0FA 1H05A 2QX4A 3LX6A 1USGA 2CDCA 3ADPA 3PE6A 3H5NA 4BYGA 3OOYA 3Q6MA 2C4UA 1C8LA 1UAYA 3G8CA 1H69A 4BNLA 1N5JA 1AS2A 2W4IA 3JVIA 1EUYA 4MYCA 2I6QA 3OPYI 4ZVKA 3CRW1 3L0ZA 2P9TA 1YJXA 4I81A 4CO9A 3W2IA 4Q21A 2DFLA 5H9VA 1P0CA 4HYYA 1V11B 4N0DA 2F7SA 3MAAC 1D07A 2V8BA 4KYVA 4DLTA 2CMHA 3A14A 2G4VA 3PUYA 2DPHA 4OATA 1ULAA 4UHKA 3W1VA 5F2EA 3DC7A 5LA6A 4C0WA 1FY2A 3H5LA 4IEFB 2IZ1A 1WS6A 2PH3A 3GH1A 1OFVA 4NBRA 5CK5A 3LT4A 3JQFA 2JLAA 4X66B 1CY7A 4Y2UA 1XK7A 5K3CA 2QD2A 3T34A 3VMFA 3VU1A 3ILSA 1ZXBA 4FC7A 1E2DA 4CQLB 3AFMA 4TT3A 5IK2D 3CVYA 1E3TA 1DIHA 4QE3A 5FWYA 2E55A 4ZU6X 4W9NA 2DB3A 2FW6A 2ATVA 3JASA 3I6BA 4H7EA 2JK0A 5AVSA 3DMYA 1LA2A 1ZNXA 2B5WA 2D1TA 5C8VA 1W36B 2FM4A 3MTGA 1J4AA 2WABA 3FPEA 2FOIA 1ZIDA 4LJ5A 4Q4CA 1SEVA 4EMUA 3HGTA 1O89A 4B3BA 1NG9A 2QRGA 1IN8A 1W1WA 1YL7A 2Q07A 3SZLA 3H2SA 4P4BA 4CLOB 1F8UA 3GUVA 3WGMA 1T1EA 1FLNA 4JBIA 5BT8A 3UHPA 1I24A 3E5NA 4BU0A 4H16A 4Q9NA 4K9QA 3A4MA 5SZJA 3I9V6 3W7BA 1K5PA 2DQYA 2P5YA 2QD3A 1NW4A 2AG1A 1CQPA 1Q22A 1QFZA 1V4BA 2FV8A 4FNAA 4MV3A 2PSDA 4TTJA 1D2AA 2OBFA 4UBNA 5KVVA 1YT5A 1KI6B 3TGLA 3OCCA 2GZRA 2C78A 4F3TA 3UHAA 3GU3A 1E66A 2BDTA 1QO9A 2YVUA 3PQ7A 4GT1A 4QQ8A 4P4EA 5JMPA 3RS3A 3L9WA 3DF7A 1E7MA 3FFBA 3LUBA 4TKVB 1BH2A 1IFXA 1PFWA 3KZOA 4DNFA 4M0KA 1ZRHA 2YICA 1NW3A 1XQ9A 5G0TA 3BWXA 3V8EA 4AO7A 1ZNZA 2AHRA 3TSZA 6CHYA 1IXYA 4MKRA 1PVOA 3UATA 5FPPA 4C3ZA 1KRHA 1NN1A 1QK4A 2HWWA 1CVIA 1FYVA 5CK4A 2PTHA 1HNZB 3NYIA 2IS1A 2I33A 2Q0HA 4PX3A 5GMOA 5I4IA 3VPXA 3ZY6A 3T1YB 3V1TC 4FMBB 2JS7A 1F2UA 5F51A 5DBOA 3RS7A 5EMNA 4ZJPA 3EXIB 5DNYB 2CZGA 2B78A 3DBOB 1PNQA 3FSRA 1KI2A 3TLEA 5HRCA 2NXEA 1CX9B 2AC7A 2QVLA 2DVMA 3QY0A 2QGZA 5D5PA 1V7ZA 1OBCA 1V5EA 1UJBA 2Y93A 5DGDA 3GLQA 3HO8A 1HF3A 3G2OA 3LBHA 4NMXB 4QBGB 1H2XA 3OQJA 4NJMB 1UOOA 5DGHA 1CRZA 2D3TA 4QGAA 4CM4A 1U3VA 3O7MA 1QIKA 1QGDA 1D6JA 4D02A 2ZIXB 3AR2A 3K2IA 3MSCA 4TV8A 4UFOA 1I33A 4XW2A 3MQ4A 3TSOA 4KH0A 1BMTA 4EG6A 4E11A 2PKRA 3N2KA 1E79A 2ETVA 2FXIA 5HQ3A 3HY3A 3QELA 4M8KA 2O2XA 3KSMA 1EJ2A 1MT0A 2P8SA 3H6KA 3VPFA 2PZ8A 3BMQA 4R1QA 3UMYA 4QBFA 2C4VA 3ZU4A 4RCZA 1TMYA 4FYIA 1ZR2A 2AMJA 1EMDA 4FB5A 1DBWA 2XIQA 1V39A 1A9RA 2O0KA 1UCFA 5CD1A 1I7DA 3SJXA 1VMDA 5DX1A 3AXTA 2ZE7A 2J32A 5J5CA 4CQMB 4F12A 2R87A 4HDMA 3IJRA 4QWMA 1GN9A 3V48A 1S89A 1XD8A 2XHZA 3EPKA 1OWLA 3QFRA 1VSTA 3MJTA 1GRQA 2NP6A 4EKDA 3RAFC 2YIVX 1QB7A 5KOIA 2WUWE 2VZLA 4ZOLA 1N2ZA 4DXDA 3WO1A 4EAAA 5LR6A 2G9RA 2VF2A 1VKNA 2YXDA 3L4KA 1GSOA 3ZWCA 2W37A 3B7GA 4NBNA 1HQCA 4NZ9A 4EYQA 1F2DA 1NR7A 1PNTA 4OXIA 3OKAA 1AUVA 1RI3A 3CLKA 3HI6A 5LBUA 2FKNA 1NY5A 1EP2B 1VKRA 2I4IA 2NU7B 3W2GA 1Y6QA 4IIVA 2GF2A 4R71A 2DR2A 2F8SA 4PVCA 1XZJA 1ZGBA 1WCXA 1N0UA 2IZ0A 2W71A 3E9ZA 3EZ7A 3NETA 2VSXA 5TVKA 4D4GA 4E46A 1ZVKA 1TVCA 4WXPA 5JJKA 5JS8A 4H3SA 2CHQA 5KPJA 2A0XA 2VPIA 5TPWB 4QUAA 1GG2A 1E8NA 2APJA 1CD5A 1RFLA 4J4TA 3MWDB 2P2ZA 3UMMA 4XLZA 3RADC 2ATEA 1ZVVA 4YRKA 4JYMA 4GC5A 4JKIA 1E1RA 1UPFA 2D5CA 3PE3A 4MW5A 3FNEA 1J5PA 2XAAA 4XD7D 2O8CA 1KY2A 2Y4NA 4B6PA 4MV9A 5D86A 1JDZA 4V03A 2VS1A 1NKTA 2VYNA 1JDTA 2NU6B 4HAXA 4P81A 2O6HA 4G5OA 4JS0A 3HUTA 2AEJA 4JX8A 3L6RA 4OC4A 4EG7A 3K0SA 4WERA 2NADA 3WB9A 8ATCA 1VPWA 1O54A 2QB5A 4ZZ3A 4B7UA 2P11A 3B9PA 3RRYA 3TB4A 3CPJB 1LDYA 2XEDA 4YLGA 2AN4A 2DFTA 3K1AA 1E1LA 4OHZA 1N4DA 2VBGA 4WFJA 3PVCA 2YWXA 3UHOA 2G1AA 1OTYA 4DUYB 1GCIA 3NHMA 2O3TA 2Z6VA 3OFSA 1NQAO 1PYDA 2YFQA 3AF5A 3E5HA 3R9XB 2Z5LA 2BONA 4RTRA 4HX5A 2QZZA 5ERYA 1CBUA 4TLCA 3AM1A 1GZDA 3FR7A 1N8KA 1WPQA 1AM4D 2WF7A 2X14A 3HZOA 2WV7A 4Q7LA 2HBQA 2HA3A 3KJQA 4BQFA 3B6KA 2Q4BA 3D8RA 5FAXA 1OIVA 2HUPA 2PT9A 2R25B 1HEUA 4INZA 4WZAB 3R7DA 2J45A 3HBLA 4Q1CA 4Y7DA 2ECQA 2P4EA 1NKSA 4U00A 1NNLA 5DBEX 1YB4A 2WT9A 1T9GS 1P7CA 1YH3A 2AYZA 5LN1A 4DMFA 3D6FA 5IC5A 1BXKA 1X94A 3QVUA 3K5PA 5IKXA 3WRYA 4US0R 3VR2A 4ZZ0A 2XMRA 4BNIA 1BW9A 3OIWA 4F9FA 5JR3A 3F47A 5BSTA 1RKVA 1TFUA 1QIHA 1SUIA 5DSZA 2D8MA 1Z5UA 1O0BA 2CLEB 3ZDRA 4RA9A 4D9KA 4UDOA 5FCDA 3ZGOA 1AMOA 2DY1A 2RKWA 1KTVA 1JHZA 4GL2A 5HIAA 4KREA 3LWZA 3QXSA 2BISA 1YQTA 621PA 3ZWQA 4CIYA 4DJEC 2CHVA 4MGKR 4PC3A 4Z7JA 3RARA 4NMHA 4LCBA 5FOQA 4W63A 4OXKA 2ZJ6A 2YN4A 3DVAA 4JUDX 1YV9A 3OE1A 1U8CB 1W8IA 4P82A 3S8YA 4KOEC 1SOMA 1DPGA 5AVKA 2IUYA 4M9QA 3TF5A 4Q4AB 1IUOA 4PTYA 4RK6A 1QGUB 2JFUA 1BKDR 2ZDQA 1KE1A 4JUAA 4O2RA 3CE9A 3PT5A 4NPHA 3K09A 1DQYA 1ZOPA 4O4HA 5F9MA 1PFGA 5L3QA 1YZHA 2XI4A 6Q21A 2HJWA 1PQWA 5JRDS 1HGXA 1ENOA 4R3WA 3K4PA 2IV7A 4XX0A 1BJRE 3U5TA 3KWLA 1FP4A 3CRQA 3PUIA 2AEMA 2B1IA 1CSEE 1EXMA 3DHVA 4L9RA 1KEUA 1QF7A 2OL4A 1D6NA 3GJ4A 1NE7A 1X1DA 5AI6A 1YQQA 4MARA 1R27A 3VHLB 5T8KA 1A95A 3AJAA 3CLVA 3DVSX 5B1EA 3KUUA 3TZLA 4DBLE 1FFWA 2PY6A 3VYRB 2IDZA 1R0XA 4YS6A 4RD4A 4OH1A 2VT7A 2HWUA 4MVJH 4EI9A 3COJA 1BO6A 4DF3A 1QU3A 1D2MA 1EX9A 3L93A 1QIIA 1T8WA 4PQYA 3S99A 1XEWX 2O4CA 4IJUA 1KEKA 4W5OA 4X6LA 1JBEA 2VAVA 5ECDA 2DPYA 1HL3A 1DX9A 2ZU6A 1I8TA 4C30A 3A32A 5C2JB 5BV2P 1QYVA 1UBRS 1F14A 4U0KA 2ZRIA 2YRFA 4OGFA 3DNFA 1VZ2A 3OE4A 4QEDA 4URUR 1GGHA 5BSFA 3JPWA 5CBPA 3R0IA 1SBTA 5KO2A 5JSZA 3TX2A 1QHIA 1UXOA 2YQZA 3V5NA 4URVR 2IXDA 1D4AA 4GP6A 3DL2A 4MUKA 3YASA 4EI2A 2H2AA 3NHKA 3B1XA 4MB6A 4J1TC 4GMFA 2GN4A 1MX3A 1L0BA 4KZPA 3FKSA 5FWDA 1UWLA 3TQTA 2NACA 4F1WA 5JNWA 2YWEA 1H22A 1Q0RA 3D3QA 3ZIAD 1I4DD 2V7TA 1S3FA 4BWGA 2GPYA 4HG2A 4OC1A 1U7WA 4NEGA 5HS4A 4J43A 1L7VC 2EFJA 3GLGA 3SPXA 3BMNA 3FLMA 1GTSA 5KKAA 5CT6A 1F5SA 3SXUA 4EKIA 4LFAB 3E3MA 5A3QA 3GJ6A 4J16C 4LQLA 1RAEA 4MWEA 4OEHA 5EIHA 1EB8A 2GCOB 3E3AA 3GNQA 2ADFA 3MPUA 4HMQA 1Y0BA 4IHAA 4DA8A 5KOYA 3LVQE 2OLSA 2OM2A 2ZSEA 5FR1A 1JDEA 2C4TA 3N8GA 2ZRJA 3SEFA 2V5AA 3MCZA 5HKKA 3K8ZA 4CT5A 1PL0A 1TYAE 2F3QA 4H1VA 2RGWA 1R3DA 2XX3A 3TZ6A 3WC4A 5IP5A 1ESNA 2JATA 4DWVA 2OHVA 5F5XA 3PGMA 1U28A 1P7YA 4F4JA 1CIPA 4QYIB 3QPCA 2IZ6A 1NA5A 4A8JB 2FSGA 3B5JA 1P7PA 1JLHA 4BE7B 4HLUA 5K3EA 4XFJA 1BN6A 4HNAB 4DR3B 1Y3FE 2BH2A 2RH8A 2IV2X 4B7CA 1Z4LA 3FVVA 3HKEB 1F6DA 2X6RA 3JYNA 3PUHA 2WWRA 5E3JA 3R23A 3DBRB 1NYLA 2DHRA 4GF5A 3RK4A 1G9TA 1LV7A 4KH1A 1CQXA 1VTKA 2JI6A 3ZQKA 3H8JA 4R7GA 2D0OA 4YUWA 4A9AA 1L7BA 4KB5A 1A2QA 1L4FA 1NAHA 5MHTA 1ODLA 2P3SA 2WR8A 3F9CA 1NJ2A 3QBVA 2XGMA 3RYFB 1L5MA 1LBIA 1Z0AA 3GC6A 4JWTA 2C7VA 2Y0PA 2PZFA 3BE5A 3D3EA 4IAOA 1K8ZB 1RKQA 5E1BA 4FCCA 1N2CB 3RHZA 5HFNA 3WRXC 2YHBA 5HF6A 3AF6A 3QKSA 2OO7A 4CZ2A 2RHCA 2VHJA 1G20B 3I6ZA 3HJCA 1YBMA 2JEYA 2MYPA 2ZTSA 3GMDA 3TLBA 1LZLA 2XE6A 3KJFA 3RVBA 2DTDA 5G3ZA 4RJKA 4MEJA 4NS4A 4B73A 1MDFA 3TJMA 3GLIB 4IS2A 3RU9A 4UEQA 5LB2A 2MR6A 5CYPA 1Z45A 4S2EA 2ETXA 1W93A 1Q1GA 3E7XA 1V25A 4JUBA 3A4VA 4DKJA 4ZVNA 2Q5HA 2V4UA 1BHSA 3QFSA 3RVJA 3KQKA 2I22A 1I7SB 3I1YA 1JYSA 2ZAYA 3L4BA 1R0CA 2YV1A 3EGDA 2HC9A 2GBGA 3ZDFA 4ROSA 3QKUA 3I74A 2JBAB 4D8YA 3MINB 3NTOA 2WVJA 3E27A 3G8YA 4QXMA 4JJ6A 5H68A 1MJHA 1T15A 2IYYA 1A4RA 5D1HA 4XWKA 4CL3A 3RD5A 2FG6C 2Y1KA 4BE9A 1E1MA 2OMEA 3GHHA 1CU1A 4LA4A 5B3LA 1E1CA 2DTEA 1UC4B 3WNBA 1WB6A 1U2QA 3BB3A 2DKFA 4FR5A 4XE5A 2QU8A 4XSGA 5AOVA 3GCXA 4ZAXA 3JQ9C 3AFIA 2B99A 1T5BA 3CZ5A 3DPSA 2PMDA 2UXBB 2QPAA 2RJOA 3KTAA 2I7VA 4H1HA 3HXQA 2QK4A 2WC1A 1G21B 4A2QA 4QLBA 4HH0A 3ZXYA 4BZQA 2XT6A 1RIIA 3HE3A 4NF2A 2OPBA 1X8JA 4Y2TA 1T3TA 4A0GA 1KYQA 1UMDA 4C6HA 5B6IA 3BE4A 3KX2A 1JEOA 1SCNE 2YIDA 4IWNA 4QO8A 4GVXA 2EEZA 3C6BA 2WAOA 4FFBA 1H85A 1KSHA 5E2BA 4D9JA 1K8XB 2SCUB 1IN5A 1S5PA 2FMKA 2JJQA 5EFOA 3PXDA 5FV7A 3WKAA 3VZSA 4F4CA 4MV1A 3UAWA 1TT5B 4G9BA 1XZQA 4E32A 1AUQA 5DYIA 3BWCA 3TBKA 4MS3A 3EYWA 3KQYA 3JQBC 2F00A 3W4KA 1JQBA 2PX5A 2Z2JA 2P2GA 4JEUA 4DL9A 1DOAA 3FMVA 4L0CA 1CJKC 1V48A 3DKRA 4QQNA 2C1XA 4WXEA 3P2KA 4H15A 4NYMQ 4Z9BA 3WLMA 2DBRA 3KSZO 4LOLA 2UYCA 2JCXA 1D8TA 2PVWA 1S4MA 1E6WA 1GKUB 1L3BA 5IN5A 3ZI0A 2QLNA 5EHIA 4YRGA 1XRLA 2NZUG 2RGGA 3H4MA 3KFLA 4L1KA 3RU3A 1IBMB 3THOA 4OC2A 1PG0A 3NH9A 3JARB 3C1UA 5DM2A 2W43A 1T5LA 1E2QA 1XKQA 4ZAZA 1GGJA 3LHKA 4PZAA 5D01A 5E6RA 4OU4A 4BEVA 1MAUA 2H17A 1E89A 1CUGA 2EFEB 1HQDA 4GAEA 3FJOA 3E9DA 2I7TA 5JROA 3EF3A 4WOKA 1B43A 3V1UA 5IMBA 3ZWDA 3VXKA 3W7VA 5FUYA 3KAPA 2VP6A 1JL3A 1Y5NA 1EUDB 3OD5A 2UUPA 4JJKA 5ELLA 1Y37A 3A1WA 2HI6A 1LV8A 6ADHA 3DDNA 2O06A 4DQDA 1T0PA 1VHTA 3B78A 3E22A 5EJ6A 3FTDA 4HS4A 3ASVA 5HRAA 2O1WA 3CW9A 4ZWNA 7AT1A 4LRYA 4TYQA 1PRYA 2DFVA 2ODPA 4PX5A 3VAZA 1ORWA 2CEKA 4QUKA 1Y6RA 5AKEA 2HF7A 4A16A 2V3VA 4EP1A 4ZCTA 2VPQA 5BWCA 3F7OA 1IH8A 3ANYB 1ISPA 2B8EA 2PH7A 3UJPA 1DC3A 2CCKA 3LWBA 4YH1A 4DCJA 4KI0A 3NHAA 4Y2XA 1KC1A 1RYNA 1VRWA 1PEDA 2O7QA 1XQVA 3H5IA 3IDOA 2F9MA 2PWAA 2OXTA 1DEAA 1CY0A 4M83A 4D4IA 4RLFA 1XBTA 4CDKA 3H1GA 3IP1A 2QE7D 3SSOA 2BSXA 2A5LA 4ZV7A 3TQSA 3ESCA 1OWNA 4YXWA 4G4SP 4H7FA 4MKIA 3B6JA 4ECAA 1LK7A 1EGAA 2XYVA 2BP7A 2AX4A 3P7MA 3GV0A 1BE1A 5AM1A 1G5RA 2FRDC 4BMYA 2YY6A 5KHAA 3I72A 4QREA 3KPVA 3PGVA 3WL3A 3HXMA 1YR6A 1UMBB 2MOKA 2VWHA 4MRMB 1YJ8A 2QRNA 2VSFA 4MDYA 3T7AA 1ZR4A 3GEHA 3AM5A 2JEZA 4AY2A 3BPSA 3QLTA 5JY1A 1MO5A 4E2ZA 2YRXA 3K6KA 1RXCA 3GOQA 4EUNA 3R8CA 3W5JA 1IZ0A 2RHJA 4RJTA 3QPBA 1MOSA 4I4NA 3W90A 1ADJA 1X42A 3Q11A 2EJCA 2L19A 1J42A 2FZLA 2P0YA 4R81A 4Q3LA 1V5GA 1YZUA 2W83A 3BWBA 3D8UA 3NXKA 3GEPA 4HMPA 1H5NA 4MQFB 4BX3A 4NGTA 1NVMB 3VH1A 2XYGA 1XVAA 2FMUA 3B48A 3HHPA 4ZEVA 1JFVA 2EVWX 3A4YA 4HX2A 5IH7A 1CF2O 1L8QA 1T0IA 5CDHA 4TLBA 2PKXA 4HGNA 1G1AA 5TSDA 2ID7A 3IAM1 1SPBS 3WTBA 4CUKA 3WL7A 3TNFA 4RVNA 1JFFA 1K5DA 2NO5A 3LCJA 3VSCA 1T6NA 3X1XA 4C88A 3N6RA 1OX4A 2AGVA 3AR4A 3WLFA 2X0EA 2EGUA 5LOVB 1GA4A 4WOBA 3AIKA 2QI9C 1QO0A 3F2VA 3M8KA 5J3JA 2C4HA 5A1TA 1Q95A 4AMZA 2IGBA 1U2GC 1YCFA 1OYYA 2HRBA 3AOEC 4E5YA 1Q3TA 4MW4A 3IUNA 1N5DA 2J4CA 5D00A 1B8NA 2XQVA 2HMSA 3WGHA 3G59A 1BIFA 3HJHA 1T2CA 1FF9A 4PPNA 2DUWA 3RROA 1FQKA 3ZDCA 2DPMA 1HZZA 4G09A 1H4TA 3WKDA 5MGBA 4NFYA 3L7BA 3CVXA 5ELXA 1UXJA 1JILA 1U0TA 1VA4A 4Q4DA 4UUAA 2EKLA 1LZKA 5JD3A 5KSPA 5KI6A 3VPAA 4O0LA 1SQ0A 3OCZA 3WR5A 1R8YA 3NCHA 1LDGA 3UQYS 1QYWA 4AYXA 4H3KB 4V0MA 4LF7B 4L0QA 3T38A 4YX9A 3GZNB 4JVSB 1LVGA 3MOIA 2D5AA 3L7KA 5TQ2B 1QP7A 4R1OA 5TARA 4FYXA 2PG3A 2WNIA 2JAQA 3GX1A 2GJ4A 5L4NA 1P72A 5KQMA 1OA1A 1ZCBA 3QH4A 3V4ZA 3CZAA 3P52A 4J7CA 4K86A 5FJIA 5IR2A 1JJAA 1ONPA 4OK3A 2MINA 5IKOA 3T99A 3T3GA 3V2HA 3F6RA 4HJRA 4OLHA 3R75A 3ZLTA 4DA9A 1L5FA 3ENNA 2IH2A 2EJBA 2NMVA 4HTFA 1CZOA 4IIBA 3VI4B 3OUTA 1DIKA 1G66A 1P4GA 3NHWA 4DUZB 1PEAA 4BNKA 4HGZA 2OBNA 4JP2A 1AGRA 3LF2A 5HSGA 5K03A 1GTRA 2O0LA 3AP2A 3W2TA 3PQ6A 4XIFA 1H2HA 1MHPA 4Q3EA 3QZUA 1B14A 1E79D 4Q24A 2YNMD 1IK4A 3UT5B 2X4DA 1XNRB 3FNBA 5A0FA 1RM3A 1UK6A 2GDJA 1KOGA 1I0IA 5NULA 4JYWA 3FEDA 2WSMA 4I9GA 3PF9A 2MSKA 4GNRA 1P6XA 3LGAA 4MKGA 3A9CA 4JR0A 3D6MA 4QPCA 3ROXA 5KSWB 2XNSA 3OTHA 4GPIB 4BX0A 4EMTA 3PUWA 1OR8A 3HJGA 1JTFA 5H5JA 1N2BA 3FCSB 3WDKA 3QI7A 3N2GA 5K8JB 3SDBA 4DLXA 1Y7PA 1EVIA 3GAZA 2DQSA 2J6IA 3HA2A 4TKMA 3R5TA 4RV4A 5SZKB 2BGIA 4YCNA 1W7AA 3DHWC 5JZ9A 5DH9A 4LXGA 1OC4A 5H3LA 4NLLA 4G5FA 4FT2A 2P9HA 2Q5QA 4WFQA 5ALIA 3ZVNA 1LI5A 1PV4A 1APBA 1CE8A 1LSSA 3OEHA 4J9VA 1ZGAA 4KQKA 5AXBA 4ESHA 3DE6X 1R61A 5ES3A 4ZXPA 3HBNA 4E09A 4IZOA 5A4AA 1TYZA 1M2JA 2NX2A 3FKQA 4JASB 5EZYB 1J9EA 3BMCB 3BS4A 1ZZGA 2IOHA 3W3AH 3BRWA 3OTIA 5JLJA 4QGFA 3D4LA 3NUQA 2V03A 4UASA 2X86A 1K7YA 3D7DA 4DV4B 3ZBUA 2RFLA 3ZDEA 1R12A 4KV9A 2QF7A 2FEXA 4KQMA 4MUEA 3KU4A 4BV8A 2QD4A 5EG5A 1UDRA 1WMFA 2Z9CA 4AKTA 3JZFA 1Z9BA 1S9DA 2GN0A 1V3VA 2VXCA 2G36A 4CEHB 1GT91 3WNDA 1RXUA 3M1YA 4MR7A 5FORA 1MEOA 2O57A 1Y9ZA 4RZ3A 4QQKA 3TTUA 2P40A 1JU3A 2X19A 4C01A 1U7PA 2AT1A 5ALOA 1G5TA 3B6IA 3EF1A 5G0VA 2HZ7A 1O6GA 1T3SA 3C87A 1CS0B 2O1XA 3T1HB 2ZJYA 4HQOA 3SR0A 4WQMA 3O8CA 3LX8A 1T1IA 2QRUA 4ZEWA 3V34A 2FPOA 4FQ7A 3VNVA 1E7WA 4P4GA 1TQ2A 2WF6A 1PU2A 1HDRA 3NT2A 5DSXA 5AHWA 3TQRA 4MSUA 2ACWA 3CB4A 3HCCA 4QPNA 5I7SA 5IMSA 3OZTA 1Y42X 2BBTA 3MTBA 4HQ6A 1WQ3A 2A1TR 3EAFA 4DC9A 4DV7B 4BP9A 3TJRA 1FJHA 2X6QA 4C7MA 1UPTA 5J2UB 4C4ZA 1XE3A 3Q8WA 3MGAA 1FLAA 1O57A 2OSBA 1PWEA 3M3HA 4QRIA 5CXSA 4K9OA 2M9MA 3I6MA 5EE5B 3T5AA 4V02A 4BLVA 4BV9A 1DAEA 4JT8A 1GFWA 2DWCA 2RHLA 1MV8A 2XNKA 2ZB2A 4UDXX 5BQPA 1RWNA 1KDTA 2XXAB 4FCTA 1JHMA 1FTSA 4LFBB 2EIHA 4CL0A 1YDMA 2I7DA 5EAIA 2BE7A 3VNAA 4Z4QA 3RQSA 3NKFA 1C9EA 3NWBA 3KLNA 1JEQA 3TR0A 4D8UA 2J3DA 3LUDA 3TZCA 3QLEA 4JN6B 2R3SA 3SS7X 2WLTA 3RVKA 1ZUNA 3ZY2A 1VPDA 3RASA 2UKDA 3LT2A 3ZX4A 1EFRD 2QAGA 1DC4A 4PG7A 1Z6PA 2JBWA 3ISTA 1YA8A 3DQQA 3R3VA 4INOA 1QR2A 1R0ZA 3DD5A 3DTNA 4GP7A 2YUIA 3VC2A 4G0YA 1VSBA 2WUVA 4AY3A 1P0PA 3F6CA 7ABPA 2FI1A 1EUCB 3ZU2A 1GJRA 3PKJA 1TEZA 2DT8A 3U60B 2EEPA 2GFIA 1D2EA 1AHNA 1V7CA 3AH8A 3VNSA 5K01A 2AFIE 4J8PA 1QNFA 4NE9A 3ZHZA 1C7ZA 1NPYA 3URKA 1T5DX 5BR7A 2DZDA 3GH3A 2M32A 3JQAB 4BFZA 4DGQA 2Q45A 4HNVA 5JSFA 3GLFB 3KU1A 3UEOA 4CUZA 1BXGB 3JSXA 4A8TA 5LQJA 2C7OA 2HIHA 3OT1A 4PZ0A 4AKIA 2H52A 3GMIA 1SNYA 4OO3A 4AJLA 4IRXA 3R3XA 1U9ZA 2NGRA 5K2MA 4D1YA 4RTLA 2ZDGA 4ZOBA 4I55A 1I2MA 3HCAA 3JATB 4KW7A 1T3LA 2X76A 5ADUS 3V00A 1EFPB 1E5LA 3BSFA 1UXHA 5JISA 1M1YE 4KPEC 1W4LA 3NEPX 1AQLA 2HKIA 1Z15A 3I01M 1LDNA 2VSQA 3T9BA 4E88A 3F73A 2YJTA 2ZT8A 2OHIA 1YACA 2D0PB 1WPRA 4K9SA 3X44A 2AOUB 4NGMA 2QDXA 1OREA 1DBRA 1VG9B 1UKBA 2PLRA 4J0QA 3HKDB 5CFMA 1T8TA 5F2NA 5THQA 2QL6A 2H2FA 3FY4A 3OIGA 2OCPA 2IHYA 3R3SA 3UPUA 1RIFA 2V0NA 3L1VA 1IHDA 1LC0A 3IX7A 3ZKAA 3CVJA 4B33A 1GAQA 2QV0A 4OLBA 1IHXA 2XYPA 4ZO7A 1VJCA 2IOQA 2QN9A 4ZRMA 1AZLA 5HMMA 2C5AA 1DAKA 3N05A 3WYCA 1JSLA 1P9OA 3HU2A 4BFLA 3K9HA 4UD6A 1EB9A 3DL4A 2FNAA 2AKAB 4PLCA 3L9XA 5LYJB 1V6AA 2HMWA 1B76A 2CC2A 3G8DA 3TXXA 1IVSA 3HJBA 1W85B 1R0LA 3WWEA 1EGMB 1NVAA 1DU4A 2I3ZA 1U02A 1GL9B 2P9ZA 3L05A 2WU1A 3FKSD 5GP1A 3TTVA 2CF6A 1YHYA 1K66A 3BZBA 3DEYX 3RVSA 2OHOA 2VUUA 3PJEA 2GAIA 5LA6B 1IOVA 1EI9A 3HCNA 2WDPA 1I36A 1GGKA 3EIEA 2EZBA 2O07A 4JQZA 4MVJG 3ZIUA 1RLUA 3CH4B 4EH1A 4NGPA 3VJRA 4JIGA 4HKTA 2DMRA 2E4ZA 2Z43A 4WXHA 4BNTA 4CM8B 4LS3A 2C2HA 3VISA 4Z3DA 4UCXA 1WQ4A 4G25A 4PU0A 3ICVA 3WKCA 4K9MA 3SP1A 3OCVA 1ZOOA 1Q1AA 1VJ0A 1X8XA 5EJ9A 2DGDA 1CYDA 1FC0A 4Q37A 3SAJA 4YECA 4CTMA 4P7GA 2DJ5A 4PLGA 2FFHA 3OP4A 4DDKA 3DJFA 5K8VA 3BWMA 2P90A 2OHGA 4QYWA 5D8DA 4F93B 4KIWA 3CT6A 3EFBA 3IJ5A 4RVGA 3SX0A 5KQLA 3ITEA 5D85A 1OSNA 3ACBA 5B1SA 2BGUA 2BFDA 4KQ1A 4P3YA 1MH1A 1TCUA 1JUDA 3QXGA 5DTEA 5L7WA 1LFAA 5D7NA 4JI4B 1GUYA 4P0TA 1TIKA 3H11A 3WHPA 4M4SA 4MQLA 3UPTA 1GXSB 1QRAA 1L1RA 4V2IA 2M2IA 2XMBA 5CVUA 2XMCA 2JGIA 2WG0A 4UVHA 2QUZA 1RXIA 3II6X 2TMKA 3AI1A 1G3MA 1ZS9A 1II8A 5KQPA 2BR4A 4UE3S 3HSSA 4BMVA 3FZNA 4B5LA 1HE4A 5ENVA 1FEZA 1CJTC 4RH1A 5F9FA 4J4BA 2Z8XA 3GLHA 3MT0A 1ZD9A 3L07A 3PCRB 4WCFB 2CNWD 1UPAA 4MEAA 5C8YA 5IF9A 4XARA 1MC4A 2BGJA 1BKSB 1ONOA 2QTAA 3JQ8B 3NNDA 4W7HA 5AI0A 5HFJA 5BV1A 4A15A 4NVRA 3OX2A 4RIEA 2ACKA 1U63A 3L4SO 1LI7A 5EGNA 2ES4A 1XTTA 1LNZA 2N9UA 5IH3A 3SJAA 5DN6A 4EJMA 1C41A 3R7NA 1SB8A 1IRXA 1QO7A 3V1KA 4LE2A 3PRKE 2VWQA 4N54A 3WL8A 1GUZA 4GH5A 1U9CA 3B51X 5TF4A 2B3DA 1PR9A 3SZRA 3G88A 3B6MA 5ALHA 3MLBA 4N7RA 4L78A 3D2BA 4XGKA 1M10A 1WHTB 1UDWA 3KXDA 3W4JA 1C14A 3KKZA 4QLOA 4IMPA 1Z4MA 4CM4B 3LT5A 4EF4A 5HOQA 4DMMA 2QD1A 5LQNA 2FPXA 3ESRA 4YBZA 5A3VA 5CX4A 1P1FA 4G63A 4DWOA 4TV8B 4D81A 4F45A 2G0AA 3RQIA 1IMJA 2QW0X 3G0BA 4KE7A 1ELOA 2GCGA 3N2KB 1VE9A 3O2SB 1QKKA 3IOYA 2PQ2A 1XRQA 2WMYA 3REFA 3BMQB 4OI1A 1T36A 3A05A 2I80A 4MGYR 4C9BA 2JGRA 3UJ9A 2CJFA 1J8MF 1E4VA 2FW7A 5JNSA 3KLOA 3QV2A 4OK5A 5FXMA 4FWIB 4TZ0A 5LP6A 4KR3A 4X6XA 1ENPA 4OQEA 5IU6A 4D3XA 3OF5A 1EXNA 1L2TA 1FS4A 1Z28A 4HDMB 2F3UA 3T1NA 2OK7A 3VPSA 4FBGA 3NHLA 3WXBA 2IE8A 1EDZA 2WA2A 3OZIA 1ZK1A 4WKNA 1EH5A 1KFKB 1GFSA 2FE4A 5LLDA 1ZZEA 3GRZA 4P4SB 4ZOLB 1GKYA 5F7ZA 2CXSA 1H2EA 3LBAA 3QJYA 1FZTA 4YTEA 1XL0A 3QPDA 2BGNA 2PMKA 2H9AA 4UUQA 5KTTA 3S28A 1PD0A 3F3KA 1Z13A 4O2AB 2C6PA 1W4BA 3DR3A 1OE0A 2P9YA 5CDTA 1DSSG 3FOAA 2BKLA 1NU8A 1C80A 4KL8S 4FE7A 2HR1A 4JB0A 4NTZA 3D7SA 5JS2A 4YQZA 2VTDA 2AHOA 3VC1A 2A0FA 2G63A 2YOHA 4DYHA 3NPAA 1NZJA 3NP7A 4MVJM 4WLEA 4Q4HA 3V1NA 2V7EA 1KK0A 2FSPA 3NATA 5CLJA 1NX9A 1ZLXA 2PRJA 5H9WA 2BGKA 1HEYA 5F1OA 1XXHE 2VXYA 3WLPA 3GVPA 3ILYA 3U2QA 3BMOA 3CQ9A 1B8UA 4HLDA 3KVRA 3UK2A 3GLRA 4U5XA 1LBHA 1TM1E 4KQHA 4HB3A 3SLKA 4GI5A 1V45E 1OZ0A 2I3DA 2C61A 2HCTA 3C8HA 4PG5A 5GWXA 3CSSA 5ICMA 3W8DA 4FKMA 3V8PA 3G2LA 1W30A 4GI2A 3NDRA 3HYCA 3ZKWA 1P80A 4K05A 1ZJ6A 2GBCA 3INRA 2H1FA 3REGA 5A03A 1FVFA 1P17A 3ZW9A 5AW4A 1UBJS 1L5VA 2NYRA 3K1AB 3KV1A 4I19A 2OXIA 1BD3A 3F6BX 3TXYA 4M49A 1KAEA 3O8LA 4CV1A 3M2TA 4EPXA 5LP1A 3PX7A 3OPMA 1R4NB 4KWTA 4P2GA 1DTWA 1PR3A 3H9JA 3T61A 3AUAA 5JEEA 1VXOA 4TRMA 1P2UA 3RRNA 5GGYA 1AV7A 3TEFA 1NJ8A 1GCOA 2KI5A 3WLRA 1A27A 1HYQA 2QTBA 1QRDA 3M4ZA 1YKFA 4LXXA 4ASUA 1RDFA 2GN1A 3UANA 2E87A 3CINA 1YOBA 4NSNA 1ZI8A 1KPIA 2OESA 1KI4A 3HPQA 1NF9A 1FNMA 1GQRA 4J0HA 4OHVA 2ZSBA 1NVEA 3BEOA 4RK5A 4RYLA 4LJ8A 3LKZA 1XMVA 2H51A 4QJBA 2B83A 4WHMA 3IALA 1RKXA 2D7CA 1O95D 4HB2A 3I4FA 2C3YA 1FU7A 1U2SA 2JKZA 4UPDA 4AJPA 4EATA 3WFZA 1UBTS 1WQ1R 2X13A 1WXIA 3GPLA 3C70A 1SWVA 5KIAA 2O2IA 1BW9B 4ZC8A 3GDWA 2HCJB 3DAGA 2WKSA 2ZI6A 1WKCA 2NT4A 4FDUA 3UWDA 5ITVA 1WUHS 4Y3UA 5FBZA 3UJBA 4RA9B 5LC1A 2ADOA 3A36A 3WX0A 2CV2A 2ZYGA 1Y5RA 4P58A 4PRKA 2GKGA 5H70A 2OOSA 2XUFA 1E2EA 2AMLA 2ZTHA 4DLUA 3VOSA 1PS0A 3EPRA 3V80A 3ZHSA 5FRDA 5A71A 1Z33A 4WKCA 1DCTA 4HUTA 5TGTA 4CODB 3FCEA 1L8LA 2HV8A 4MS4A 3UCFA 1RP1A 3L4JA 1WLSA 3D8TA 2YZKA 2HRZA 2ZUUA 5DU2A 3L1HA 5EA2A 4I1PA 1YL6A 3EEFA 4GRAA 3NRCA 4YY3B 1JP7A 1VPLA 2L0XA 4LSZA 4KXFB 1U9IC 4RD1A 3FMFA 4N7BA 2BR3A 4IDQA 4TXNA 3VOAA 2C7QA 2OBLA 2C1EA 4ENWA 4NOKA 5M5BA 1RE0A 4KO8A 4B4DA 2BBOA 5JNUA 1FMJA 4WBNB 4XX0B 3EZ6A 2OUIA 3MK31 1FP4B 3A4TA 3NTLA 3Q0EA 3BWVA 1Z07A 5ALPA 2JGDA 3CNOA 4PV7A 1AMUA 2NV0A 3PC7A 3NGLA 2JFGA 1OFUA 2ZSKA 2ZUSA 5JWHA 2V0GA 2X40A 2R5NA 2PL1A 4M21A 5AKXA 1U7OA 1CY2A 2F3PA 1AS0A 1NOJA 2NZWA 3ORRA 3QUAA 4W6ZA 2YX1A 2JH9A 4JQYA 3T54A 4QARA 4HDSB 2C5EA 3GVIA 4GKVA 4JYBA 3NI2A 3UUGA 3T3OA 2O8FA 3DOCA 1YIAA 1KARA 1ZMXA 1R0KA 1QU2A 3QPUA 2IRWA 4UBKA 4EQ6B 2FMXA 4IKOA 3RBVA 3RVOA 4G85A 5LFAA 2IA5A 1GYQA 1YZYA 2E7ZA 1XQ6A 2QVCA 4LDPA 1BH6A 3WIOA 1YCGA 521PA 1R4MA 2P6NA 3AUXA 3QI2A 3OI7A 4MPTA 4QFCA 2AN3A 5F78A 4CQMD 2QUBA 5CCEA 4QXRA 6YASA 2X7JA 4KQIA 3WL4A 3EXG1 3SKXA 1NUSA 1U4NA 1E9EA 2HU5A 3FYCA 4PO1A 5BQFA 1W581 3B3AA 4TT8A 2EZTA 3M6UA 3QY9A 5IBPA 1X1AA 4WNCA 5A4IS 3NOJA 4PYIA 1JWAB 1M74A 2CXHA 1UZLA 1ZQ1A 1EXWA 4OFZA 4ZPJA 3NC4A 4D3DA 3I6SA 2Q3JA 2FPKA 5ECYA 1UP4A 5DBGA 3TZHA 3FBTA 1QZ3A 4EYGA 5K8UA 2P0AA 3T3DA 1XLVA 2Q21A 5E1OA 1Z2NX 3W9UA 2PZGA 1PR6A 4K6HA 1H0KA 5GTDA 5LZ8A 5EP2A 1CR0A 4EKGA 3OT4A 4WJZA 1DJOA 4YDHB 1UBKS 1G2OA 2HQ1A 2Y1DA 1KJ9A 4JQCA 4YMUA 2BFBA 5KQGA 1SG0A 3SXUB 5TY0A 2WWWA 4TSFD 4NCHA 1I0ZA 3HN7A 1PHPA 1Q6YA 1HL7A 1ZD2P 8ABPA 1J90A 3I53A 1XDGA 1A4UA 1JXQA 1XDBA 3D5EA 3FTFA 3QBTA 1OASA 3EA5A 1L5GB 2J0UA 2JFOA 5KVAA 1RWMA 4LJ6A 2NYAA 3LLSA 1MB2A 3HDGA 4XQEA 2IYWA 1U31A 2BFOA 2LKDA 3TE6A 2K5UA 2WWVD 3VSBA 1KI1A 1FNNA 1L9KA 1JXOA 2AFHA 2HCFA 3A3PA 3HZRA 2OCDA 4IKPA 4R2MA 1GGVA 1NW9B 3UJ8A 2GHTA 3ABRB 1JQ3A 2VDVE 3P9ZA 4CG2A 4X3PA 4LJLA 4Z8XA 5ED4A 3HA5A 5GQSA 4WWHA 1JHPA 1UPXA 2X8LA 3LC7O 4IDNA 4HVCA 1WABA 1U2TA 3ZVMA 1HDIA 2HPVA 4FWBA 4ZODA 1SK8A 4GPBA 5H59A 4KPFC 3RT1A 5T7BA 2BMWA 3CW2A 3IJEB 3IPLA 4GQAA 3OJFA 5CVJA 3T41A 1R2QA 4D44A 1XQ1A 3K0EA 4JB3A 3PKZA 3W77A 2CDAA 3HDJA 4ABYA 1A7UA 3T0GA 3B2NA 1OKKA 3BK1A 3KZKA 4M9RA 4BNYA 4GSLA 4LV8B 4TL7A 5FLXA 4MI9A 1OH6A 1R8XA 3SYNA 5L95A 1U0SY 1W88B 4IXTA 2AK3A 4KIGA 5ALNA 3RYIA 3QKSB 1HE3A 2X0JA 3OZCA 3H0CA 2RMKA 2PKQO 5FBLB 2VJMA 3RHFA 2OA0A 4UEJA 5G40A 1NN3A 3UMGA 3R4CA 3TYXA 3A1FA 1GPUA 2G1UA 3LQQA 3L0OA 2XVXA 5EZYF 1QVVA 2JLCA 4EJSA 1QRTA 3ECCA 3VR6A 5LMNB 2EWVA 4F56A 1NN5A 2HMTA 3MMXA 4OUDA 1Z5NA 9LDBA 1PTJC 5HF8A 5CAEB 1STOA 3D3JA 4NATA 1V5IA 5IBRA 4OIMA 3GCZA 1YNOA 2W93A 4O1HA 4A5SA 1GSIA 4ITUA 1Q19A 4OC3A 1RQXA 2XITA 4JXJA 3VI3B 2XECA 3SZ3A 3VSAA 1S2MA 3EGDB 3B3GA 4C85A 3WSTA 3ZW8A 3I58A 4MJ3A 4QG7A 5I45A 5CRIA 2ZXFA 2GD2A 3U9LA 1INLA 4W9RA 5EQFA 5B3JA 1K3UB 4CGYA 1ATIA 4MUHA 4BEWA 2O52A 1Y48E 3HKCB 4IV5A 1CJBA 2VF5X 3FPBA 2QG4A 1Q7EA 2O59A 3QEMB 2RAFA 5B4UA 3EZ9A 3GGSA 1EX7A 1ZAYA 4L74A 1DXQA 4PGMA 1VDZA 4CLRA 2CNOA 1PLLA 2QUHA 4N8EA 3JAWA 2CCGA 4HQFA 1BGXT 5FTWA 4C03A 1C7RA 1U81A 3K9BA 1TZ2A 3GJYA 4Z51A 1Q7RA 4OHUA 1R88A 4Y9SA 1NIJA 2GN8A 4KXNA 3U7QB 1QCCA 4Q0MA 3ZH2A 4RMNA 2C59A 1OAKA 4R9UC 3CNHA 1L4UA 1Q92A 4D57A 3KQLA 4K81B 1GUBA 1UMDB 2P78A 4LK2A 4QNMA 1E69A 1LLDA 2JAXA 3GQBA 3VV2A 4FFBB 1QC5A 2XA9A 1NLZA 5JJCA 4KWCA 3A2KA 1BX3A 4FGSA 1KC7A 1P1CA 1FDRA 2SNIE 3CIOA 5AMXA 1RXSA 3ZV7A 1JT9A 1IULA 1L4HA 1PI3A 2OD2A 3IXMA 2XF8A 4P4NA 2EFHB 2OR4A 1W5TA 2FJ0A 1HC7A 3OIFA 4J94A 4BVAA 1NVVQ 1N6IA 4M86A 1U3UA 3N87A 1C1DB 2X1VA 1KZ1A 1AZTA 1MO3A 2J33A 3A6GA 4DS3A 4UTXA 2R8EA 1YJAA 2C98A 5FF9A 5L4SA 3L4EA 2ONZA 3AIMA 4CG0A 4EAQA 4I46A 3P5BA 3IPYA 4N0PA 1QHXA 2QRJA 4LEIA 5JQGF 1PJQA 2NM0A 2QTLA 3P2JA 4US1R 1Z26A 1BHJA 1IDN1 2V54A 3DZFA 3FPCA 4F11A 2D7JA 4WXMA 3LXRA 2Z6UA 2N1MA 3Q40A 4NBVA 5D3KA 4OIFA 1COZA 1MC8A 2K7ZA 4Z4GA 1Z4PX 1VBNA 4TV9F 4X3CA 1HE1C 2J9FA 3KKQA 4ZT2A 3KVYA 3JALB 4I50F 3ABSB 3PC3A 5C5EA 4FFVA 2TMGA 2FZGA 5IDVA 4J1TA 4ESEA 3KJZA 4PSDA 4FI3C 2QZ9A 5CPFA 1N6RA 1ORRA 1PFYA 1AF4A 1I6KA 4LI0A 1QCZA 1TI7A 4TPKA 2VT6A 2G40A 4MA4A 1GVNB 1IATA 3A9TA 1K68A 2EYQA 4RORA 3E22B 5E6SA 4D45A 3NV7A 2BEWA 1CQIA 4UTNA 2KPOA 1WUKS 1VKZA 1J07A 1XXLA 2ZIUB 2RG1A 3PFHA 4Q3CA 4RACA 1DPFA 4UD2A 3V9PA 3P26A 4J6FA 3W5UA 3R7WB 4FJ1A 4MV7A 1AC5A 5HOEA 4YDQA 1XA0A 4GKBA 4RHFA 4N5IX 1JWBB 3BSYA 4PNEA 1BDIA 2CXQA 3R3JA 4DWWA 3RLFA 2OHXA 2NO6A 3OICA 1WMSA 2IPAB 4EQZA 5D1NA 4FYMA 3V97A 2VN8A 4MVCA 4DLAA 1XTKA 4IHKA 5JFOA 1Q21A 4HPXB 4XTCS 5DOVA 4YCSA 1N25A 3JAMA 5FD8A 1P44A 4PCLA 4Q9AA 5TNXA 1YS1X 4X24A 2QTCA 1GZ3A 3KB6A 2BP7B 1KA9H 4FHDA 1FRZA 2YZGA 1M2VA 2PU5A 3NLLA 3AW9A 3GRFA 1H2WA 5HCNA 4OYRA 2OXRA 1HZJA 3M82A 1P33A 3QM1A 5F12A 3UB2A 3EYAA 1VIAA 2F2TA 4P34A 3JVVA 1JNXX 3L04A 1QQ7A 3DBLB 4LTDA 5A62A 4G65A 1VG1A 1U0EA 5REQA 2ZRHA 3PHBE 1G5PA 4RKRA 1PZGA 5KVQA 1TA9A 1KDVA 2GBLC 3DZCA 2Q8NA 1N36B 3I01A 2W6ZA 3CUVA 1OBHA 2CKDA 4FDVA 1Z18A 2GXSA 2GZ1A 4KMMA 2V8OA 2BMDA 4YP0A 5AO9A 2XZPA 3CWCA 3D59A 1XP5A 4B8ZA 2XE7A 3DV0A 4EYEA 3KPUA 4CZ1A 3OQIA 1QE5A 1NMEA 5BSEA 4I36A 4ZEXA 4C22A 3BJEA 1KO7A 4PZYA 1P1KA 4EI7A 3K0FA 4DB2A 5K0NA 3MRTA 3RS9A 3L6BA 3C8OA 1SVUA 3LYLA 5IJZA 4MW7A 3ZVKA 4S1VA 1DL5A 1H9AA 4IIUA 1JPVA 3H87A 3OE5A 5DI3A 2QJRA 4M0MA 5M04A 3D4BA 1SZDA 2NTYC 2RJ3A 3M49A 4NEHB 3WQHA 3ZLUA 4F1KA 4UVDA 5TQ0A 2BC9A 2YBEA 1ESEA 2Q49A 1BA2A 1E6LA 3TIIA 1SXPA 3F4BA 4DXAA 3I5AA 1B93A 2W6MA 2AS0A 2INGX 3V7WA 1GNLA 1KJWA 4BQNA 5A4DA 4RULA 3U62A 5F98A 3SJEA 2ERCA 4I5IA 3ER6A 2C2ZA 4FC6A 4G8CA 1QM5A 2HNKA 1PL7A 3AHJA 1NXJA 3BJIC 3DMFA 2KM1A 3UG7A 1U5CA 5T6MA 2G76A 3MBOA 4GGMX 3GPDG 1XAGA 3ODGA 4JXZA 1NX6A 4E12A 1ACMA 1T4MA 2IXEA 4ZCRA 1N4AA 3V4OA 5KNDA 1QYIA 1ULHA 3E9NA 3QQ5A 4ICIA 4LBWA 3SKYA 2QPLA 4TS1A 4GZ5A 2PHZA 4G1UC 3AESA 3M7IA 3K6SB 1Q3KA 5JCXA 1CDOA 3L7CA 3JQ9A 1PZXA 4O4IA 4BFXA 4DMGA 3GLIA 2CK3D 4LMAA 4UATA 4N49A 2GHIA 2OSVA 3DXZA 2K6GA 4R5MA 4JLMA 3G2NA 5TB5A 4WINA 4JVMA 5EMJA 5COAA 5JVLA 4LISA 4KXLA 4N47A 4OMDA 3MLEA 4KX5A 2IF2A 3UYLA 3VJKA 1A50B 1QOZA 3ZLBA 1UC5B 3ZG6A 1NGSA 4A2CA 4P33A 2MINB 4IIFA 2X0FA 2ZDHA 2C3OA 4BFTA 3F5QA 3ASZA 3PVSA 1MP0A 4HTFB 4RPLA 1DXHA 1E6CA 3WO0A 2ECFA 3E2MA 5JAIA 5AM5A 2VKTA 1F4PA 1KH2A 3DZDA 5CX1A 3ET5A 2C95A 4LNHA 5IJXA 5JBIA 3FTEA 1T4CB 4OGWA 1EVYA 2FSUA 3PNQA 4R2HA 4GM0A 4TLEA 1CZNA 3JQBA 1FVXA 3IH5A 4FD2A 4HWRA 3ABOB 2X8AA 3M4NA 3KUDA 2O05A 3GJ3A 5AW5A 4EHAA 4MRVA 1YAJA 1DJPA 2KE5A 3OCXA 4L9WA 3ST7A 4FVTA 2VDMB 4WMLA 3C16C 1CTQA 3LOQA 4LSGA 1K88A 3TQCA 3OEED 3L8FA 4QNRA 1TUBA 4HHEA 1O94C 3GP3A 3HS3A 2A7XA 2XJ4A 5H4HA 1PW5A 3A9UA 3LHFA 3MTDA 1CQZA 2PAAA 2P6OA 2PMCA 2TSYB 1P45A 3B12A 3BL6A 1YI0A 4FN5A 4FNOA 1V6CA 3KWJA 2XD4A 3WTCA 2GNAA 4OOFA 4D3ZA 1EGHA 4JV5B 5BXQC 1JDSA 2J1LA 1YFJA 3W6OA 1VCOA 1NBAA 3A6LA 2JJYA 2VDKB 3DWIA 4V0ME 3QOFA 2ZRDA 4YWJA 2YYSA 4W99A 3RV4A 3QHQA 1QBGA 3QK7A 3QMPA 4DPLA 2IU6A 4GXRA 4EW3A 4GM4A 4QAJA 2RB4A 4BNDB 4B80A 4UBJA 4IIJF 1O8CA 3OM8A 2IZ5A 4K3UA 4GOJA 3SVLA 2UZAA 2POCA 1NDHA 1VLVA 1WM1A 2HSZA 2XLCA 4NOLA 2E6UX 2W6CX 4C84A 1QGYA 3VFDA 1QQ6A 1XEXB 5AK4A 2Y92A 3QKRB 5B64A 3IGFA 3ZGNA 1Z4OA 4M1KA 1JR3D 2OCKA 1I3OA 3FSGA 4KYTA 2ZPAA 4ZJYA 1GDTA 1K4MA 3UG6A 2RGYA 3PP8A 5IVPA 3EHEA 2PKQP 5K0ZA 3EH1A 1KEZA 4CF4A 3PLNA 3UJDA 4K28A 3QP9A 4QSMA 3FF4A 3CG4A 3RAGA 2ATCA 2CYBA 3BGWA 4E03A 1C9NA 1I51A 3A6EA 3DDWA 3M1IA 3NWEA 4MR7B 3A1UA 2OCIA 4BB0A 1ZNYA 1WXQA 2QUAA 1LNQA 2W6JD 4Q1FA 3GLTA 3HPRA 5KZMB 2C94A 5ALVA 1BS2A 4HFJA 2YCBA 4NE7A 1M73E 1XHLA 1V3QE 1BDJA 4E3ZA 1B0PA 4EB6A 3SCZA 4C2TA 1A5SB 2M1XA 1GNSA 2NW6A 4PYRA 3C3KA 5CJ2A 1RJGA 3TOCA 3CBQA 3R5HA 3DE5X 2ZPTX 5HIJA 1JFSA 2V7BA 4PYLA 4K6GA 1CRWG 2AUNA 2E49A 3I73A 4EK9A 3P0HA 3VR4D 3EZEA 2PQMA 4XM2A 2EGGA 3SY8A 3CBGA 3WHLA 1A1VA 3EEYA 4K6FA 2FSVA 4C20A 2ZYDA 4XR4A 2AN9A 4L4XA 4EW1A 3HYRA 5K6AC 1U3GA 1US8B 1YWGO 3WOVA 1JG4A 3EGOA 2XBMA 1M0TA 3OJEA 1DIAA 4ZYZA 4PZZA 2BRUC 4MWSA 4H0CA 4G84A 1YGPA 3NZEA 1TVKA 4ZFNA 2Z3VA 2ZVJA 2WD7A 3F74A 1MW9X 1XZGA 1YUNA 4WZAE 5AXCA 4DCTA 5JSQA 2I3GA 4L5CA 4MVJA 2JBJA 1UZMA 2HJHA 3ZGVA 5D29A 1WPXA 1JEQB 2QLBA 4DG8A 1OI3A 4EJ0A 1ZCFA 4BASA 2EF1A 1KQNA 3DVQX 4DQLA 1YQXA 2H92A 2Q3LA 1E3QA 2POQX 5F2KA 4AJ4A 2XMQA 1IJEA 3C5WP 1F06A 4IRUB 3TTTA 3WG9A 4EHNA 5MN6A 3LKBA 4X63A 1YIDA 3IQFA 3IDFA 1DRJA 3EVBA 2HK8A 3QA9A 1CWUA 5KS2A 1VL6A 1ZOLA 2HREA 3SKVA 3B3FA 1H6BA 4W5TA 3N2EA 2FOLA 1GGFA 3AOEA 4JJZA 1O6BA 5D7BA 1G18A 1QRSA 3EGXA 4KE6A 5TVGA 3BHNA 5ERGB 1EIWA 3LSTA 3HJRA 3LLVA 1SVIA 1K5GA 4HWSA 3C6MA 1T10A 1CZUA 2QLMA 1NNSA 3FYUA 1W9MA 3N0WA 4QEZA 5AVJA 3W5BA 3DM9B 1IY9A 1JYEA 3C3PA 4GS5A 3VKUA 1GL7A 4I55B 2R86A 4MIEA 4MZXA 3ZGXA 4QUBA 3RE1A 3ZS9A 4CKCB 5J63A 2VH1A 5C80A 1YS9A 2B37A 3O3CA 3P19A 1OV6A 4K6CA 1EJ6A 4ONEA 5FPQA 4PG8A 2HH9A 4N3BA 4WBNF 4X1YA 5HBRA 3FPLA 3ZNNA 2UYGA 3BCHA 2OO5A 4BO0A 1EDEA 1FP7A 2WSLA 4GU5A 2B2CA 2H18A 5F7XA 3C3WA 1EZ1A 2ZYSA 2RJNA 3HMQA 4AQ7A 3HKBB 4HPJB 5TX7A 3ND8A 1QS0A 3NIDB 1WULS 3WFIA 2JIZA 5I9MA 2XNHA 1E9CA 4H0FA 1CJSA 2JAUA 2HF8A 5HIMA 3BKXA 2J09A 3NHYA 4PINA 3HH8A 3DWEX 3KLPX 5U9CA 1AU9A 2OV6A 4HTAA 4J7XA 3MAGA 1ZH6A 3MWJA 3B52X 4NV0A 4Y2HA 4ZT3A 1HT3A 4B45A 4ZIRA 1NXXA 2WJVA 1LRLA 4DILA 2QI9F 3FPJA 3NTVA 1OV4A 4R0MA 1H3EA 1VA5A 2G9QA 221PA 2I6TA 2E5WA 3LA6A 3S7TA 3JX9A 3X3HA 3LJKA 4IFTA 1SCBA 4BFUA 3BB4A 2WTAA 3QF4B 5TMPA 3UKOA 2AIRA 3BK7A 1AUPA 4PIVA 2FUKA 4EPVA 2CL7X 1RI5A 1OFGA 1RZ3A 1SQ5A 1XEWY 2NAPA 3AEUB 2Q8PA 3BIXA 2QN2A 3T9CA 1K7XB 1T35A 3TAUA 4DIUA 4KHPB 2DHCA 1IQUA 4YBRA 4ZAGA 3IKJA 2NVUB 2XYRA 5C8XA 5LNK6 4LX8A 3RK1A 3IAFA 3VSEA 2C82A 1GY8A 4ZVMA 3I92A 3KL2A 4C08A 1QQAA 4QYMA 3LPAA 3TRIA 3H1FA 3TX6A 4IHJB 3WB2A 2D06A 1NBMA 4LSMA 2OZKA 4ME6A 2G67A 1DVRA 3WWZA 1MH9A 4L08A 2NXJA 2AG6A 2OORA 4MMZB 3O8RA 3FFAA 3KEGA 3ZWMA 4BRZA 3W8NA 1ZL2A