3TLEA

Microcin c7 self immunity protein mccf in complex with glutamyl sulfamoyl adenylate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords MccF
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tleA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tleA02
3TLZA 4IIXA 4INJA 1ZRSA 3TLEA 3SR3A 4JVOA 3TLYA 5F9MA 4IIYA 5F5XA 2AUNA 4MI1A 3T5MA 5FD8A 5K99A 3TLGA 3TLCA 4EYSA 4E94A 3U1BA 2AUMA 3GJZA 3G23A 4MJXA 3TLBA 3TLAA 4E5SA 3TLGB 5F1YA 1ZL0A 5JYBA 3TYXA 4H1HA
chains in the Genus database with same CATH superfamily
4KXWA 2K2WA 1BE0A 1ADGA 1T0BA 2F4NA 3AHHA 1L4FA 4H7PA 3ST7A 4TLDA 3HCCA 1QLWA 4BRUA 5MHTA 4FB5A 5CPBA 3C3WA 3LBIA 4JLJA 1FRNA 5HMMA 4FVTA 5JOQA 4DC1A 2Z8YA 3BE4A 3A8TA 2ZI6A 2ZITA 5JQGB 4JOBA 1BVYF 3NTRA 4E88A 5I7EA 4KC0A 1EGHA 4F5EA 3HZOA 4DV0B 4G8DA 4AZ3B 3OO0A 1L0BA 1TIKA 2YJZA 3Q7EA 3RC7A 4IM7A 2ZOSA 1DOHA 3RFVA 3SC6A 2NU7B 2ZJZA 1JXQA 3CSDA 2W8ZA 1L7VC 1U9JA 1D2AA 1FOEB 5TVKA 3WP1B 3U4CA 5LL6P 4KJZA 5DMXA 4EEZA 2IHUA 2WJZB 3N5KA 4PRKA 1C0IA 4IIUA 1ONSA 1QIJA 3PR2B 2IL1A 5JROA 4IOJA 2WMYA 4PYOA 4X00A 2CFTA 4OTZA 1K7CA 3A6FA 1ZAYA 3AY6A 4UHFA 3SK0A 4X63A 2OCAA 5BN5B 4M21A 3T7DA 2CKMA 1XZLA 4Q1DA 1SCBA 2FRVA 3KYCB 2X9GA 4IKOA 3UWKA 5JQGA 1L1QA 1PW7A 3F5FA 3IOYA 2ZRCA 3ZBPA 2Q0XA 1KR2A 4MVJD 7ABPA 3EY4A 3NJRA 3AJ9A 1CHDA 3DZIA 4FYWA 1GGMA 1KU6A 3I9V6 4HEA1 4LJLA 2B94A 4EB6B 5JY1A 1AHPA 2JG3A 3F6YA 1AN9A 2HIHA 2VA9A 3QLVC 4GLOA 4MWZA 2O2HA 5DLYA 4YCCA 5NLLA 3H1FA 4YXWA 2C4KA 2GYYA 1DELA 2HTFA 4GX5A 4YP0A 4URXR 2PUGA 4AG5A 2YWGA 4LSMA 2BE7A 3W9UA 3D6MA 1OZAA 4MUBA 1B0ZA 4BQOA 4CUJA 1WU8A 1PJAA 3T5BA 4UU8A 2QPOA 4MPRA 5FDFA 3DAGA 1TKBA 3SC2B 4E1VA 4YYEA 3QKUA 4DAOA 4BKQA 1QRDA 4H4CA 4Y2HA 3SZRA 1JGTA 2VHEA 2AFVA 3VAYA 1TEHA 3WMFA 2RC6A 4BS9A 4TMKA 5AVOA 4IFEA 3C3KA 2ZQZA 4CIWA 1WB9A 3BI1A 5ITZA 4JQZA 2Q6KA 2XUHA 2OE2A 1V6AA 2J31A 4J0FA 4TLCA 3H9EO 3H1AA 4E31A 1E63A 5KWEA 4F2DA 5KNDD 5A5EA 1X13A 5J2UF 1QHEA 1PE0A 2I1QA 1Z0ZA 1VG8A 2RKBA 2ZWAA 2D2VA 2I55A 3AF0A 4G5FA 5BRJA 1K8ZB 5AKJA 4JXZA 4ZTUB 1Q5XA 2UZ1B 3AY3A 1DADA 1W93A 4OVKA 3DT8A 4ND6A 5FRDA 2XQGA 3LIPA 3RHZA 2IZ7A 4MWDA 3U6KA 3A04A 4LXIA 4BZZA 3ROQA 4O4IF 4BRSA 3CX8A 1U31A 1XD2B 3SC2A 5F76A 2NO4A 3BXPA 4C87A 1K5PA 3FDZA 3K9HA 1K6IA 2Q1WA 1GXSB 1NW6A 1UP4A 1QFYA 3REOA 3WIDA 4M8NE 3BCHA 4HY3A 5D8DA 4U63A 4FFNA 2J5KA 1TJ5A 1Y5MA 4UAGA 3V3KA 2ZM6B 4AKTA 4FGLA 3VSBA 1J49A 1UBEA 4HRXA 3ZE6A 4F6LA 3T7JA 3DNMA 1SIOA 2F17A 2I3AA 1VA5A 1SUCA 3ANMA 4BVBA 1V43A 1Y80A 1PFGA 3ZZ0A 5D87A 3T7IA 2XHZA 4I1RA 4F1JA 3ZZMA 2FUKA 3C1AA 4H1UA 5DXAA 3NDIA 1P0IA 1IEWA 1LB1B 1R4NB 1T0JB 3IPLA 2P67A 4CMIA 4ENTA 4DV1B 1ONNA 2W6MA 3JZIA 3SFTA 5ALEA 4Y1RB 1Y9ZA 1NVWQ 2OV1A 2Q5CA 1NXSA 3G1WA 1NP7A 1NY6A 1VGVA 4FDLA 4IFTA 4MUJA 2L82A 4QPCA 3MJHA 1EVQA 1PBNA 2YS6A 3ZE0B 4YMHA 3NUZA 1CZHA 1ZK1A 3K9LA 3GP5A 3QA3E 3LUCA 1DX9A 1FTWA 2Y1KA 2Z57A 3DW1X 4U2GA 4XLLA 5FAKA 4M0UA 5BVGA 5I7SA 3SZMA 2Q46A 3GV0A 2HR1A 3FFTA 2QTGA 2XVAA 3EOBI 1VKRA 4IIEA 3VMMA 4NXNB 4NFLA 3ZDCA 2E4ZA 4RIFA 3PITA 5L4SA 1SXJE 2ZQ5A 4MS4B 4DUYB 4WFJA 2HRCA 1P7PA 5FV7A 2B4KA 4BLUA 4DA6A 4TL7A 5DTQA 5A06A 2WJIA 1J8DA 3DEAA 2QUAA 2IIQA 3DUWA 2QNIA 5JXWA 1YXMA 4AMBA 4Q02A 4JEUA 3S2YA 1BGXT 2LNDA 1G5RA 3CR8A 1I7QB 1NYRA 4KGDA 4H17A 1CJMA 1Q1NA 2CL6X 3DHEA 3NNSA 4GVLA 4NARA 3W1VA 4ZEMA 4PYKA 1XLUA 3GZNA 4HDNA 6CHYA 5JR3A 3EEYA 1DIGA 1QG2A 1Y7LA 2ZTUA 4X94A 3TN7A 3NONA 3ICUA 5REQB 4O02B 3CWQA 5C8XA 2XRZA 1F20A 1WUJS 1ZONA 3AHDA 3NP7A 4Z9AA 5SY9A 5ERYA 4CIDA 3DH0A 1JX6A 4V3CA 2YWJA 5ELLA 4EYOA 2DKFA 5U1PA 3S27A 4DCVA 3COSA 2C4TA 1P3DA 2OMKA 1T29A 2AR9A 2VNKA 3RFFA 4DM7A 2OCBA 3SNKA 3DOEA 3IAM6 3R4VA 2HIGA 5EYPB 5KSPA 5BQXA 1DG3A 5MN5A 1S9DA 2O14A 4YV1A 1CSEE 1GTRA 5LU9A 3EXEA 1IXRC 2GTHA 4ISBA 2WKSA 3GNTA 4WDRA 3E2MA 1PS9A 4F56A 4ME6A 4KPEC 5DYGA 2A5GA 3KCNA 2VHYA 4QXPA 1K97A 2D3WA 2OLJA 4DRZA 2OV2A 2Y0BA 4X85A 5JPIA 1TADA 2FV8A 2QQEA 4KE9A 4EO7A 5A2GA 3CNOA 1FU7A 4BJ3A 3RSQA 1JG2A 3MLAA 3QBTA 4YI5A 1LQUA 4RJLA 1LBTA 1MD9A 2AOVA 4BFSA 4BNIA 1NDUA 2NZYA 2XB9A 1E5XA 1UWKA 3V2UA 4PBTA 3A7DA 1DQRA 3L7IA 4WBXC 2WMOB 3ZWPA 3DE0X 4AY2A 5LXTA 3QXGA 4D41A 2WWXA 3T4EA 1G3RA 2BFBA 1Y5NA 4HZUA 1Q16A 2IOYA 2DAPA 1RYYA 3E82A 4PPNA 2XUFA 4HMQA 1LDBA 2HMYB 4O4HB 4D6YA 4Z2AA 5SV2A 4RTJA 2NT3A 3L8YA 2FMKA 1YK1A 3HFRA 4KQXA 2WT9A 1KDRA 4UBMA 2QV0A 2WUFA 4WINA 5C31A 3GT0A 1Y3IA 1M0SA 2WK1A 4L4SA 2HC9A 4BP8A 4ZAFA 2IWRA 4EFMA 1ISPA 1LF5A 3ZDZB 2QLJA 4M1OA 4JB3A 4KVFA 1LK0A 2CXXA 2BMDA 4L6IA 4A0QA 1SCUA 4GC9A 4HDOB 4KPGA 3WAGA 4KQKA 4WJLA 1EUZA 4QTZA 5J63A 1RC8A 4U5XA 5IJXA 4XW2A 3ZR4B 2G06A 3K8OE 1GR1A 1UAGA 2R00C 1RRKA 2HEGA 2N47A 3FNFA 2V1UA 5P21A 3WYBA 1KSJA 2O19A 2PKRA 4OBBA 3SVTA 3DOUA 1BMFA 4XDGA 5I9NA 1XNJA 4OI1A 3ZHVA 1SG0A 3ETCA 1RXYA 4HVLA 2BKAA 2YFQA 4EAAA 4JQCA 2EJUA 1EAYA 4ZEWA 2PGLA 4EI2A 5CXUA 5CP8A 4ZAXA 3MMNA 3IVAA 3K15A 3VR6H 1IXSB 4Q9LA 3L7MA 1S2GA 3CRVA 2PCNA 1CXZA 3BK1A 4U8GA 1SCKA 1OI4A 4BV8A 1BYIA 1MEOA 4HOYA 4CMKA 2ZVDA 4WOKA 1U5BB 2FWRA 3VTZA 1P61B 3E9YA 1F2TA 1HT3A 3LJKA 3TPCA 1Z82A 3ZWDA 4C3UA 4A8PA 2YKGA 1V0JA 4I50A 1RWVA 4JB0A 1XRMA 2F67A 3TDNA 1RP7A 2QMOA 1ILEA 2BBOA 1D2HA 1NVVR 4G0ZA 3PQ3A 1GPUA 2ODPA 4B17A 4ZRDA 4WESB 4IMRA 2FFJA 3A4VA 3ICWA 3L8ZA 1EA7A 5FOUA 1J2EA 2G40A 3TGWA 4CHGA 1KJIA 4BV2A 4L75A 4X41A 1B93A 1M1YB 4QXRA 2AEEA 4ZZ0A 3ZWCA 2ZWIA 2OVBA 4M46A 4A8JC 2QP9X 5M5BA 1KBLA 2C8LA 3GG2A 3H83A 3K09A 3FPFA 1K66A 4BWYA 4HNRA 1JMVA 3CN7A 4FYIA 2CYBA 1C1YA 2PRKA 3DBHA 1ODIA 3RFTA 4R9VA 3EIHA 4J07A 3B38A 5DYWA 3VDXA 3C39A 2IOFA 3GYGA 4BB9A 2CDBA 2A9FA 1ES9A 1J07A 1DAGA 4GEKA 5E9JA 1CERA 3I28A 3IMCA 3KPWA 3KQOA 4LTMA 4N12A 4HAOA 4BKRA 4HCJA 4K9NA 1RT9A 4JGGA 1B2LA 4UVDA 4KFCA 3MQ4A 4WGGA 4E09A 4LY0A 1RLOA 2VWPA 3FAKA 1ODCA 3L1KA 2FFAA 5AHKA 1YJ5A 2VS1A 4UBOA 4Q18A 5JSZA 1JDBB 1UDCA 4GL4A 6REQB 2MHCA 3NM4A 2JLQA 2CB9A 2F9LA 1AKQA 2WSLA 3ZWBA 1URPA 4TSFD 2JBAB 5BV2P 3OY2A 1C7EA 3CX3A 4AO6A 4LRSB 4AXBA 1JFFA 1RJDA 1VSQA 2Q07A 3I0NA 4WK0B 3K2BA 5AI8A 3UVEA 4MUYA 1Z4OA 3KEOA 4RH0A 4YAIA 2A1UA 3OI7A 5IUKC 3LUBA 1N2IA 4MR7B 1HDOA 5EXTA 5DU2A 3TGPA 1N2GA 1U7ZA 3KTOA 2MSCB 4KHZA 5F4BA 3DP7A 2XGSA 4H31A 5AM3A 2B3DA 4PXSA 5IDQA 1HGXA 3GQBB 5DNEA 3MLEA 3R9KA 1J8VA 4BNFA 2Z08A 3DZHA 2XOXA 2X8LA 3CLVA 3IVXA 2J9ZB 3K0HA 4QNRA 4BN5A 4YJHA 4GWLA 4LYHA 2LUOA 4B3MB 4XRRA 1K4MA 1NE7A 3WOHA 4A9AA 1H8ED 4NMMA 4BQRA 1G64A 1ZRSA 1FB5A 3AKDA 3I2HA 3VVBA 2FSSA 1UBNA 1LNQA 2FY8A 3HU3A 2O1WA 2FZKA 3U4QB 1T5SA 1AHHA 4PF1A 5JDIC 4P93A 1HURA 1Z5WA 3R77A 4RMNA 3N75A 3RJTA 3DTTA 3SYLA 3Q7PA 3U49A 2ATXA 3JAWA 3A3KA 1EFTA 2H4FA 3HH8A 1E2KA 1KPGA 2HPHA 2A0WA 1KQPA 3IMFA 3N3BC 4IVNA 3OPXA 4R3WA 3TXYA 6ABPA 4R81A 2HI0A 3WKCA 2WB4A 2IHVA 4BVEA 5CLFA 1BU8A 2XGGA 3B2EA 1IK4A 3FZEA 3TD2A 3VZQA 4BQFA 3BFPA 3KV1A 5IT0A 5BV1A 1JA1A 1XKQA 1WXDA 3O0TA 3ODGA 5K6TA 2PKYX 4CM5A 4LBYA 4H4EA 2FN9A 3JQ6A 4XX0B 2CV2A 4BZQA 5CFRA 3GJRA 5KDOA 4TV9B 3VU8A 5KPDA 3DMGA 4GKAA 1ESDA 1E7RA 4UUBA 4HRYA 1EQ2A 2D74A 5DT2A 1I4OA 5KJEA 4NS1A 3TZHA 1ZGJA 4HB3A 4UEJA 1DBQA 4RPKA 3TG2A 1DKPA 3ZTWA 3BULA 2TRSB 3WA6A 1XZ8A 2O4CA 1W36B 3RIGA 3AGPA 2ZJ4A 4EVRA 3TLXA 2FW9A 3KR9A 2OCKA 3SBXA 4YMSA 4CKBB 1LQ2A 2QJWA 2X1MA 3K9NA 1SB8A 4YJ2A 4HUQA 5A7FA 1L5VA 2PS3A 3KVVA 1GGJA 5EJFA 1ABFA 1FDRA 4JP5A 4ABYA 1WS6A 4NS4A 4A0SA 1PNOA 5F4ZA 4GPD1 1D6SA 1CETA 5GAJA 1P2UA 4LX0A 4QELA 3FDIA 2OKCA 4BAUA 4RTKA 5AFSA 4LUCA 1J9GA 2POCA 3UTCA 1QO7A 5HRAA 4G5GA 2J9GA 4CU2A 3DWGA 4K9RA 4I08A 2Q9CA 4NBSA 5G1OA 2OFFA 2QSYA 1EX6A 3WGIA 5EUMA 1OD6A 4KU4A 3C15C 4LZPA 2OKGA 1D1TA 3W3AD 1W6UA 2RH5A 2P2CA 3UT5A 3RAFC 1NIJA 1V2HE 3F3MA 4O0MA 4MV3A 2P6OA 4ND3A 3EDOA 4ZPJA 3CURA 4CEIA 1KRWA 1CUZA 2EP8A 1PFWA 3UH1A 1WDLA 4XWWA 4LXUA 4PTYA 1J25A 2QT9A 1CY7A 1S7CA 3VNVA 1SZJG 2LXNA 1ZC3A 3LT4A 1OLOA 4IHQA 3AWIA 1O54A 2WT8A 3FYDA 2I34A 3UQZA 1JKMA 1VI4A 1WPXA 2ZB3A 3VJRA 4D4MA 2IF2A 1E2PA 1EJ0A 1WHTA 3A9WA 1NBMD 5ALUA 4FHGA 1HV8A 1EP2B 4D9GA 3OJOA 2BKUA 3FMPB 3ONEA 3UWMA 4A0FA 1U8FO 1XA0A 2PNFA 4OQLA 1RS0A 4P22A 4B0OA 4OMDA 1JHZA 1G5HA 4RSGA 3HSKA 5HIIA 3VH4A 5LD2B 2BFMA 4ND8B 2JIZD 2G1PA 3JU3A 3T38A 1DEOA 1FYXA 1G3IA 1MPXA 3HYSA 2L69A 3S2FA 4I4TA 1A9SA 1B0UA 2CWDA 3OJEA 2NV6A 4B43A 4YLEA 3AR9A 3MGGA 5EZSA 4C4ZA 1AF4A 4IL5A 4DCSA 5CK5A 5LLDA 5J2TB 1DL5A 3M6IA 1GN9A 1FC0A 3KKNA 2ILVA 2YCLA 2COUA 1FFEA 5EKXA 2OZEA 3C6QA 1CX9B 1K1EA 2P4QA 4MMYB 3VZRA 4Q19A 1XHLA 3OT1B 2X0SA 3IXMA 4KQGA 4HZIA 3SXUA 4WZAA 4IG4A 3KQHA 1US8A 3PPIA 1CC1S 3ZCTA 3NLLA 1NNUA 5HJ2A 3IEPA 9ABPA 5C51B 3MYYA 3OZWA 1BEZA 2B7LA 1GZVA 2E5WA 4Q3CA 5LQJA 2H00A 2IH2A 1M2OA 4GOJA 4QJ4A 3GVXA 1ECLA 3R9IA 3OBBA 4RO0A 1HT1E 4IH4A 3AHCA 5DH9A 2GPNA 2XWBF 2ZUSA 3S8YA 3IAS1 1V3VA 4LHXA 1NG9A 2UXBB 5HILA 4WT7A 1GRNA 3WS7A 4LE0A 1ULZA 1N57A 1NUHA 1SBQA 3FWYA 3NEAA 3P2KA 3UW3A 4OP2A 4AJJA 1ZWKA 3GLSA 4YJFA 3S1AA 2O7RA 1TU0A 1EG7A 1DCTA 3I5YA 3ETHA 2WWIA 1CNFA 1UFVA 1DT3A 1UBUS 2GN1A 4TUYA 2RG1A 3LPAA 4G9BA 1FDIA 1TM1E 1K2VN 3G8AA 5HEKA 2G6TA 3D4PA 3JAWB 1U8EA 3KPVA 4RLHA 2GBLC 4BUZA 3QVGB 1P33A 4W9RA 5F1KA 5AW9A 3T4XA 3VSEA 3KWMA 1J0DA 2DYKA 2W98A 2BM9A 4R2KA 5FI1B 4MINA 4OLFA 1ZM4A 4RCYA 4U9UA 5K4GA 4DKJA 4W4TA 4WKGA 3FYHA 1NKSA 3V33A 3O4IA 1PUXA 1KNXA 2ZYWX 4E1AA 1VC2A 1JEQA 5EIXA 3FCSB 2I4NA 4YJHB 5GZ3A 3GUVA 2I78A 1BOOA 1Q7GA 3PT5A 1SVOA 4FE7A 4B2YA 4BCDA 1R4MB 4FGWA 2CLDX 1Z6QA 3GQBA 4NU0A 1FSZA 1JIIA 1W76A 3ZWMA 1HC7A 3KHSA 3B9RA 5IEJA 5E38A 1LF0A 2HRZA 2TECE 1VLJA 1WA5A 2XGMA 3JY6A 5COBA 1TNDA 2QX7A 3O4JA 4NL4H 3A4NA 1ECFA 1E66A 2GS9A 1QWSA 3D8TA 1MGPA 5J47A 3FPBA 4ARZB 4BRWA 5JEDA 2MP0A 4EJSB 3TZKA 4JITA 3ZW7A 5EJ9A 2GPJA 4R0NA 3QFSA 4QOSA 4PG8A 1K8YB 1Y81A 4FFBA 3GCDA 3KTAB 2JBAA 2QLNA 4WBSA 4PX9A 1ISFA 1T6XA 2ENUA 1QG6A 3OEED 3ORRA 4POAA 4DCCA 1DFHA 1GIAA 1CUFA 2PYDA 1ZUIA 1WQ1R 2QE6A 4M76B 4ZQGA 3I73A 2CD7A 2YHAA 1Z7YA 3BXFA 4C9AA 2ZBDA 1SVWA 3UHFA 2R8EA 2JFNA 1OE0A 4JCCA 4EPYA 4U0KA 5U9CA 1U65A 2V54A 2FOXA 5J4YA 2ZI3A 4KNGE 1XRNA 4Y2RA 4FFLA 4DEXA 2GKGA 2GLTA 4D57A 2ZWMA 4IJVA 4AURA 1KXJA 4AJ1A 1H23A 3BGOS 1ZZEA 3WHKA 1OFGA 2ATVA 5FO1A 3DDWA 3VNRA 4F2WA 1JQEA 3GEEA 1I8TA 2WNHA 3QELA 4GZLA 5EIHA 3KJEA 3VPBA 4RDXA 4LQGA 1F6WA 1W8DA 2PZMA 1J20A 2ZAYA 1ZL0A 2M6KA 2JH3A 2BCGY 4TXLA 4BNXA 3DDZX 4OQXA 2F1OA 4R7GA 4GHWA 2V7VA 1K5GA 1RQ7A 2VNJA 4BQSA 3H5OA 2I4RA 4K9LA 3JQGA 5A5DA 5ARBA 5FA5A 3L6BA 1DP4A 4UM5A 3MCZA 1W85A 2DWUA 3DVSX 4N48A 3BE8A 2QUIA 3JQ7B 4A0RA 1ABBA 1U0BB 3BRSA 5DSTA 1DC7A 2JHPA 1A82A 3QHPA 4PC6A 3A58B 4DV2B 1FYDA 2Y6UA 4BO3A 1DDIA 1EHYA 2I65A 1MA0A 3NIBA 1D2NA 4IUYA 4HLUA 3K5IA 4M53A 2AUMA 4Q1BA 2PSSA 1J42A 2AX3A 2C5QA 1PEAA 4EQZA 1XHEA 1W25A 1Y4UA 3MGCA 4QATA 1IZ8A 1TUBA 4DDHA 5FCDA 3VR2D 2W4IA 5I9TA 4KR7A 4O2AB 4XLZA 4L27A 2F3QA 1LEHA 1NQXA 2IYAA 2NSYA 3PPXA 1M7BA 5AK0A 1UJMA 1GNTA 3QGMA 1UAYA 4TOIA 4I99A 1T9GS 2CFRA 1BXGB 3JQQA 3MJEA 4IVQA 4ZXPA 5C8YF 1N77A 1IM8A 1VE1A 2PYZA 2CDCA 1A8PA 4X0EA 1PNQA 1E9FA 4W5QA 1KDYA 2ESRA 2VF4X 1YS1X 1KYWA 4IIYA 2VF8A 3FUCA 3PQDA 1THTA 3EGDA 3CN9A 4IGFA 4E2XA 1R5OA 1C3OB 3JVDA 4FFSA 4E11A 3GUCA 4EPXA 2OILA 4EUKA 5IYZA 1SOWA 4LOJA 1NVFA 4MGYR 4G0XA 1O94C 4Y2TA 5EPOA 5K0NA 5GJWC 3MPOA 3RFUA 3N2LA 1TT7A 5E0OA 1H2HA 2IYPA 3RAJA 1DU4A 2V8OA 3JR3A 4M88A 1GVHA 1I2AA 5IN5A 1AUXA 1GAJA 2VSXA 4BLRA 2X77A 1K7EB 1ZW6A 2ZSDA 1E18A 1VI2A 4RNCA 1RE0A 2C99A 5DHUA 3TX6A 2HYIC 1QK4A 3W9SA 1ZQ1A 3CY6A 3LDUA 5JLAA 5MN6A 5DCUA 1UOPA 1T8PA 2ZUUA 5TV2A 4G0PA 2WF6A 3U4MA 4P4JA 1G41A 3GT4A 1KE1A 3PV0A 3UF0A 4EF5A 2PIAA 4C2BA 4ZGGA 5LCXA 1Z4NA 3ABSB 1G17A 2NO6A 4KLZA 3WKBA 4BX8A 3GGSA 2NT4A 4OXYA 3DO5A 5KOIA 5ALSA 4ITUA 4MNTA 3IESA 4QEKA 2MWMA 3ZWAA 2CUTA 4GOKA 2GPYA 3IHKA 1XCOA 3RRXA 5BWNA 1YDMA 1ZLXA 2QX9A 4FKMA 1KBZA 3HU1A 2FSUA 1BS9A 4N5DA 2X13A 4F3NA 3QE4A 3HCRA 1R18A 2X2OA 4PHGA 3EXEB 3GRUA 5MFZA 1QZTA 2B8NA 3VC3A 5CA1A 5EJ7A 2B4TO 3CCBA 1VRCA 5FBZA 2CNDA 2DKNA 4D0RA 1SIBE 3CYFA 2VJDA 3IB6A 2WPDA 3QVKA 3CLTC 3F3KA 3H9CA 5I7OA 1AT1A 3AUFA 3ZY6A 5KVVA 2CB0A 1LW7A 1VSVA 1SUIA 4HXGA 4RKYA 4B9EA 4ZDWA 5F9HA 2IS1A 5ELYA 4XB1A 1T9DA 2LDXA 2WABA 3QM1A 5FADA 4IRXA 4Y9RA 2YZ2A 1WXIA 3EXHC 2AFIB 2B2XA 2DLDA 2SKDA 1BD3A 3DLBA 3IQEA 4GG1A 3UJPA 3UW1A 1DJLA 5ANRB 4YT8A 2QD1A 5JH7A 1BNCA 2VT7A 3O26A 1ZGCA 4PS0A 5FFNA 3OF5A 4JJKA 4HWOA 3JYHA 2Z0MA 2SCUB 2H7YA 2JEYA 3F7NA 3G8DA 3GLRA 3DKKA 4X71A 3DMNA 3ZCVA 5J4KA 1U2TA 4UD6A 1U0TA 2PMCA 4OPMA 3UWSA 1CD5A 3W8RA 5DISB 4UHEA 3W8EA 3ZUGA 1FSPA 2FKNA 3C70A 2IV2X 4FP9A 1QVAA 1GPDG 4XUCA 2AXPA 5FOTA 4FDAA 4YDHB 1ZHHA 3I9OA 5JDIA 5LYJB 1AO0A 2UZIR 3M4NA 3C5HA 4BP9A 3I39X 5BSVA 3HKEA 4M8KA 1D8AA 3B3QA 2XB4A 5SZIA 2H29A 4FJ0A 2XTAA 4NZ9A 4Q47A 2ZR8A 5C7OO 2GVDC 2B8EA 1GG2A 4Z9YA 2F90A 4OI4A 4DUZB 4WLOA 1JG6A 3TRDA 1Y6FA 4OGFA 2FEPA 1GP2A 4XGQA 1SFRA 3L02A 4RVNA 4YJKA 1EFVB 1NBIA 4GZ6A 2CDNA 3IJPA 3IVCA 2BUBA 2QB5A 2D0PB 3H04A 5DTEA 4GE3A 4X44A 3ZV7A 2A0XA 3T9AA 1P4JA 4XWOA 1E32A 5FNZA 2BFFB 3OZ7A 1CF9A 2FLKA 3KU4A 3VOBA 4Y2JA 4G9EA 1X9HA 4D4LA 2XWQA 4B44A 2B2CA 4GGMX 4UMFA 3V1UA 4K6MA 2Y1FA 3DAFA 4GRAA 4BL5A 4BPBA 2DPLA 3U4GA 1UBRS 4A8TA 3W6UA 4B46A 4BLSA 4OD0A 4LHVA 4OQ4A 2YCBA 3I09A 2VLIA 1TFRA 3OD1A 3N2KB 4EHJA 1BW9A 1D5CA 2V74B 4YYZA 3UENA 1KAMA 2G25A 3N53A 5C5DA 3FF3A 4V0ME 3HZRA 3GOQA 3PVSA 4R40A 5CLHA 4PNEA 3LS2A 5I3ZA 5KEIA 3OESA 5FAXA 1Y6GA 4NVRA 4U7PB 3ZHUA 4DOMA 5C3UA 4JMLA 2FJPA 4WOJA 4YMIA 4WKOA 4QTXA 5HP4A 5CEEA 2PZJA 4KQ9A 1XDZA 4ZOLB 1TMGE 2AOUA 4OBWA 3L4JA 5FPYA 2AZDA 4BNKA 1Y9JA 3GLHA 3Q8WA 2FEWB 1CNMA 3R41A 1PZNA 1JDNA 2WYOA 4CEJA 3NT2A 4B79A 1JXMA 1DKRA 1UCFA 2W0MA 1UT5A 3LSTA 4PBRA 5ESXA 2NW6A 4R31A 4ZVRA 5E7IA 5IDYA 2EATA 2C2HA 4KFRA 1WQ4A 2ZAGA 2P7HA 3KLPX 3P2IA 4FN5A 1O95D 4AS2A 5AKEA 4GYKA 3CPSA 3K72B 2MR5A 4F11A 1OGIA 1CZOA 1QF6A 4OHYA 1H22A 1Z6ZA 1UM9B 2YH2A 2EZTA 1G7TA 4L8GA 3D64A 1GL7A 4YMTA 4G09A 1UDWA 4WN3A 1NI3A 1LI7A 1SUAA 3LUHA 3LXUX 4DCOA 4HPJB 3TBKA 1CDOA 1BW9B 1JAYA 1NG1A 2VAXA 4XYMA 5TSDA 3JX9A 4R1TA 2NXWA 2JGDB 2P79A 4CTKA 1D1SA 3NG1A 2VQEB 1IM2A 4IW3B 2JCYA 4DQVA 5BNFA 2J7PA 2PWBA 4YH1A 4WA8A 1VM6A 4H0FA 3UOAB 3ORHA 4DC9A 2EL7A 4QDJA 1HZJA 4RKFA 5H4HA 4MDFA 3C6YA 5CLJA 4XH9B 1KYVA 1EK5A 1MVNA 2ATEA 1RBMA 2NTEA 4JGIA 5CVJA 2V6BA 3G0CA 1Q92A 1VECA 1EH5A 5F5LA 3DE7X 3F5SA 5DBGA 2FR8C 5B53A 5ES3A 4E94A 4OXIA 1OSNA 5EFZA 2R25B 3HRHA 1NULA 1EZBA 3HEMA 1N33B 1N2OA 1HE5A 1T35A 2C6CA 3JQ9C 3KK0A 2J9RA 1VMEA 4X64B 4PVCA 3UWPA 5BYAA 1C4KA 4UE3S 3OFVA 2IYXA 1VMIA 4IIXA 4C01A 5AW0A 1MVOA 5FL7D 1MB2A 2VDUE 5IARA 2HYDA 3GZ4A 3SVZA 4D5EA 3EDRA 1HTBA 1L7AA 3BMCB 2B4RO 3TB6A 5ICFA 1M2HA 4TQGA 3KXKA 3EBOA 4OHCA 1TZCA 4WLFA 1D7AA 4A4DA 4MQUA 4YT4A 3ED5A 1NN3A 2VXOA 1KQ3A 2PD4A 4FU0A 3R7LA 1ZKMA 1UPTA 2YWCA 3CIFA 3KSAC 3LOUA 1W88A 5G0SA 1HY3A 1XQXA 4O0LA 4NV0A 5LQKA 4ZT2A 1WCIA 5JUWA 3FUVA 2VCHA 2G1JA 4L78A 3OIUA 3JQRA 3SX0A 4BLWA 4MQ6A 4BNDA 3HNOA 3ZNNA 5KQSA 3SHWA 1PT6A 1UPFA 4BX9A 1TZMA 5FTWA 4E5DA 1W30A 1PVVA 3T0TA 1C4WA 1SQFA 1Y1QA 2PGOA 2Q3BA 4YBZA 4Y98A 2FEOA 4LDRA 2ZUBA 1MIOA 5DYNA 2O23A 1KVSA 2QU8A 3FH0A 4OSEA 1PK9A 1V3UA 3UJAA 5JCZA 3IE1A 4N3AA 2QSUA 2W70A 4BB0A 4C6TB 1QE0A 1NN5A 2XE4A 1PJBA 2XNKA 1NW9B 2GKSA 3C4VA 3OCVA 4M0FA 1F8UA 2VXYA 3CGGA 5EESA 2O48X 1NMEA 1PX0A 4D4IA 1X9GA 3E81A 3FA2A 5GVRA 2F4VB 4B85A 4BBPA 4CPDA 1EYZA 3EAFA 2XRYA 4LNUB 4G6ZA 3OOEA 2OA0A 2J5RA 3OFND 1Z0FA 4LV5B 4NPHA 1J6UA 2XWSA 3KWFA 5CCBA 4I8DA 3TQTA 4BPRA 2HWWA 1RLIA 2FRDA 2Q21A 4AIIA 1T2VA 1T2AA 4DBLE 2GNOA 1YS9A 3ES9A 3AXSA 1DX6A 3G13A 4XOUA 1T0HB 3CINA 4XGNA 1WIWA 3NYRA 4MEAA 5FBLB 4BO4A 3U60B 5ALJA 1RM0A 2IITA 3U3XA 1TL7C 1QFSA 3W34A 1HMYA 1YU6A 2ZE7A 5KAPA 3RS7A 2Q1YA 5FBHA 5K6AA 3IQDB 3OQIB 3FMVA 3OCYA 4RVHA 1PR6A 5E0KB 4CV0A 4FZ5A 3EGEA 1WLYA 4PYLA 2HSZA 2VBIA 3WHIA 1V2GA 1TK3A 1WBBA 2EQ5A 2CXHA 4G84A 5EGNA 1U1DA 1ZAKA 2QRQA 3I23A 3KOMA 4NYIR 3ZIAA 2CUZA 3I9V1 4UM8B 1AKWA 2ANBA 1MQSA 1JPNA 3OSZA 4BAGA 1KAOA 2LD4A 5KYYA 1G4HA 2D1QA 5DNCA 4X92A 5EXXA 2ZSIA 3AERB 1Y33E 4D25A 1H2FA 1R15A 2O7SA 2OORC 3EQ9A 4KACA 3WIEA 4N82A 3HV2A 5BT8A 1XWWA 1XZIA 4RVOA 3BYZA 4UNIA 5DK4A 5IP5A 4JA0A 1JIUA 3C98A 1OI2A 1H0SA 4BNVA 4BCBA 1GEGA 3GK3A 2UVPA 3SLGA 4Y2UA 1IVSA 4LOAA 4BX0A 5EZ5A 1SQGA 3WTCA 1WUTA 3BKXA 1KFCB 2KWIA 1LX6A 4N7RA 2R48A 2JZNA 4O2AA 1CUIA 3RSGA 3V4FA 1TF2A 1WWKA 3WKDA 1KETA 2UAGA 2R4UA 4Z7OB 2XUKA 2HGZA 1O6BA 2ON6A 3KXDA 1NKTA 4UCQA 1PZHA 1VHWA 1V9SA 2ZE8A 4MA4A 4X3OA 4F21A 3WNCA 1M74A 2KHZA 3O3MB 4OHXA 1PQYA 3D59A 4B0PA 3SX4A 1CV2A 4GX2A 4BVJA 5C1IA 5A4KA 1KOFA 1TX4B 1OXXK 1Y4AE 1IN4A 1J24A 1ZSYA 2VPTA 3DQQA 3GFSA 3M1AA 1ZMRA 4FQ7A 2I67A 4JU8A 4HZGA 5GTDA 2Z4RA 2B3TA 4ZOLA 2WAXA 2R62A 3HADA 5CVVA 4ROTA 1FVFA 2JNWA 4RV5A 4DUGA 1EM8A 3B7GA 2PX0A 1Y8RB 2SHKA 1E96A 1GV0A 1O87A 1GT6A 3AQ4A 3K1TA 3MGKA 5HPYB 2M1XA 5JS1A 4CL2A 4EPRA 4AQ7A 2CW5A 1MAVA 3O2NA 5JT1A 1H5QA 2PT7A 2Z5FA 3MXOA 1G60A 2WHEA 1YQUA 4YVFA 1MQ9A 3KQMA 4E4TA 2YHIA 3E22B 1P62B 4BQPA 5YASA 4DA0A 821PA 1T9BA 4M1EA 3MT0A 1RWWA 3QBDA 4HQ6A 2YW9A 1XMJA 1E3SA 2ID7A 1NNI1 1PL7A 4HJRA 4LWQA 2CDAA 5IKOA 4ENUA 4U2BA 3R3XA 4OF4A 1JSZA 5CR9A 2C5HA 3L07A 3T1OA 2QVBA 4KXVA 1RD4A 1SKUA 1ZJ4A 1RP1A 3OVMA 1KKMA 4MB6A 4WZAE 4V0QA 4YUAA 4V0OA 3FECA 1UWLA 3Q3VA 1IFXA 2BGMA 1GZ5A 3FWKA 1QIKA 4MS1A 1VPVA 1DC8A 1WB5A 3H18A 3UKOA 3NQ41 4INJA 1BZYA 3H2GA 1R12A 4G0YA 2AJTA 2I6QA 2WLSA 1G21A 2VZ9A 2YOHA 3JCZA 3N8HA 3MTAA 5A7HA 3QVSA 4MW7A 3OETA 3ZE8A 4EB0A 2VKQA 3IE0A 3U1VA 5BUSA 3WISA 1PR2A 1DE0A 3ZY3A 1PUIA 1VMDA 3FLMA 4EKDA 1QORA 4BMDA 1QOZA 5E6UB 1JV2B 3SG0A 2ZRGA 4R98A 1HQCA 5G0UA 2PQ0A 5AOVA 4BU1A 1X1RA 4C7BA 1FFAA 2PN1A 1KP9A 2DQKA 2PO5A 2VDQB 3OZVA 1R3UA 1ONBA 4TT3D 4ZHQA 4NJMA 5H9WA 5IB9A 1XX6A 221PA 1ZBDA 4HADA 4HL6A 5IXYA 1DEXA 2Q0SA 1AQIA 3TYXA 2CJYA 5EHZA 3WQRA 1AGXA 1Y8AA 4PG7A 5K0EA 2C7GA 2WWTA 4WH0A 3GGPA 5HUHA 3RYCA 4HVCA 5ISMA 3HKCB 1YA6A 1XQ1A 3U3KA 1GA4A 2HROA 4AJOA 3EVTA 4KAXA 5EZYF 5KQPA 3Q1LA 4RFSA 3L7YA 1Q17A 1ILWA 1L5RA 1QV7A 2SCUA 2ZSFA 3HS3A 2FZWA 5L45A 1CKEA 1LSJA 1QVVA 3T3OA 1AXGA 5FUMA 3CEJA 5JZSA 4B3RB 2A1TR 5DTIA 3FOCA 2PUCA 1O5OA 1UPAA 1IBMB 4YP7A 1KDOA 3M82A 1S6YA 1Z13A 1SWVA 3C3PA 1RXUA 5F21A 3IFSA 1XU9A 4RMGA 3S1AB 3VTFA 1T9CA 1JSCA 1EBBA 2R8PA 3FZQA 1N6RA 3GBSA 4O1IA 4BE7B 4TSFA 1Y1TA 3D0OA 3KSBC 2IZ6A 3CVXA 5CITA 1WAMA 4UU1A 4ER6A 1P1KA 1UDBA 3F8SA 2IYUA 3KCQA 1Z5UA 4W99A 2G6BA 4OM7A 4Y2SA 3U4HA 4RZXA 3AF6A 1AF7A 2DWCA 5FFFA 5AVQA 1X6VA 1XQ6A 3FPKA 4GP9A 3FETA 3L8GA 1MJ5A 3F9IA 1M2OB 2Z1MA 4LZAA 5IDVA 3EN0A 3IAHA 4DLXA 1KEEA 1AS2A 2PQ2A 2JC3A 3U4AA 4OI0A 4M55A 2ZTHA 4D6XA 3LF1A 4KBGA 1GR0A 1US8B 2OV8A 4PSVA 1LTQA 3LRTA 2QAGA 3C5CA 3JD2A 2BZSA 1ZMOA 2OC4A 4V3BA 2NVUA 1XZAA 3DMDA 5AW1A 1VB5A 2I5PO 3DDSA 1ZXLA 4CVNA 3DL4A 1PVOA 3WB1A 1SK9A 2Q3JA 4L5YA 5D84A 3CKLA 4Q9KA 2NVBA 1T8UA 2VIIA 4CCYB 4QTYA 2AZ4A 3FSGD 4TQUS 4MGHA 1VG1A 4JLOA 3D0QA 5BMVF 2C7RA 3T4UA 4TYQA 1BA3A 3FDFA 3EARA 4MIOA 5ITVA 3UFXB 3OLYA 3A1FA 1U2GC 3KJIA 4C1BA 1YA8A 1HFJA 2ZYHA 4ALIA 4MWTA 4RIHA 2VJMB 1K3FA 3HABA 2W42A 1W7AA 3IP3A 1SELA 3FHJA 5HS6A 1OREA 2QA5A 4TKMA 3RIXA 4XVQA 1KO8A 2GMWA 1LD3A 3CUEF 3NHFA 5K8TA 4M0CA 3HACA 3T9CA 4GRIA 1WHTB 3DWIA 2ZEJA 2ZVJA 2CLOB 3K4QA 1P75A 4JLVA 4NSNA 4R2WA 4R01A 4F71A 5AW6A 1XZDA 1IAQA 3KLNA 4KVGA 2VDJA 3KDAA 1S2IA 3KQSA 5GM1A 3SBDA 4DSNA 5BVHB 5BP7A 4P86A 1B8PA 3WLHA 4BNMA 4RVDA 3WWEA 4Y2GA 1QVWA 1MH9A 3WGHA 4HP8A 4KQMA 4QRDA 1VPWA 2VKTA 1V6CA 4WXYB 3GRAA 1OH6A 3ZQJA 1KOGA 1UJ6A 1U2GA 4L4YA 5CJPA 5JMWA 3OLXA 1BDJA 2GK7A 3AUAA 4X20A 1EWQA 2GH1A 2NZJA 2YIJA 1W34A 2OAP1 2EW8A 4BU0A 4FS3A 4DMFA 2HMUA 1FUIA 1H2ZA 3B5JA 3EB9A 4RENA 3CVWA 3TM4A 1HORA 4V24A 3DHYA 3OLZA 3VTKA 1SZCA 2EFJA 3N7TA 4R2MA 3EHDA 4GH5A 1G2PA 4US1R 4V02A 2Q0QA 3B1ZA 3HA5A 3Q2OA 1OA0A 2OTCA 2DFLA 2WTAA 4LXYA 4G67A 4X6UA 2GCGA 4D9KA 5IKMA 4II3A 2NU8A 2FK7A 3DZDA 4B6RA 2Z6QA 3DOFA 3O4GA 2ZZKA 1RM5A 5ICGA 1K7FB 1JVNA 1TPYA 3NWBA 2X0KA 4CKWA 3D54D 1CQXA 1LDEA 4G8CA 1ST3A 4BO2A 3I92A 3PNVA 5FF9A 4L8YA 4MVCA 4QT0A 5GONF 3UPTA 4LFBB 2HREA 3AZOA 7MDHA 3MT7A 4HDAA 3K30A 2PVSA 1W2HA 3KUCA 3CU5A 1K98A 4BNUA 2CL7X 1MNAA 3DZBA 3NAZA 4JLUA 5JD3A 3SJCA 3U3RA 4CM9A 1SZPA 1UQTA 1DIBA 2O2JA 3QELB 4KRYA 5E3JA 3C3EA 3RUPA 4W9NA 3T1QA 5EJ5A 5LJIA 2B8TA 2XJ4A 3LGXA 3REGA 5B12A 2ISQA 1EWKA 1YDHA 3IIJA 4MB2A 2CVPA 3NWEA 5IU6A 1AMUA 4MCIA 1DX4A 4UMEA 1WULS 1AC5A 1J0EA 4G5YA 1QRTA 2MSDB 5K0ZA 1EKXA 4RE6A 2CHQA 2H1FA 3QJGA 4P9NA 4GIBA 1GQSA 2HMTA 2Z5GA 2X5XA 4MUEA 3E1GA 1KAGA 2ZR0A 4U02A 3V8NA 2OD7A 3G2MA 2BLNA 3E2PA 2W5UA 3AKEA 3TUJC 1CDZA 3IOBA 1G63A 1E6EA 2Z5VA 1FTSA 4ZO4A 3SU8A 3FTDA 4X20B 3U4QA 3GC6A 5DLPA 2IHJA 2A35A 2JI6A 3RIEA 4L22A 4ZEXA 5CD1A 1A5SB 2VYFA 3CCFA 1FS4A 2ERXA 1GL9B 1Q12A 3PUWA 5DYIA 3BHNA 3LBYA 3JRNA 4B6FA 3R5SA 5CT9A 1JLLA 1ICEA 2XUGA 5DEOA 2R8XA 3I64A 4M36A 5G40A 1U0EA 1XZNA 2XMRA 2V6GA 5DM2A 4G37A 4Z4CA 2DCMA 621PA 2PL5A 3RKSA 2AZTA 2D3TA 2II6A 1DWPA 3T5CA 2EIXA 1XAIA 1KP3A 1PG2A 1YQXA 2HA0A 3DDOA 1OHHA 5BRNA 4EJ6A 4WCDA 3SYMA 5DOZA 2QVYX 3E23A 2R7NA 5BWMA 1JTFA 3OLVA 1JEQB 2XCSB 2E48A 3ZK7A 4ZK2A 1YKFA 2XYHA 4EPVA 3ILXA 4HBGA 4FGSA 1RI2A 2AH5A 2NTNA 4F72A 5KTMA 1ZA1A 4J91A 2WFZA 2BHTA 1M5UA 1U0SY 4OOFA 4D43A 2ORED 4FUTA 2NG1A 4P53A 4PLWA 4KBFA 4S35A 5KWJA 2X0EA 5IX8A 3FBGA 4YUVA 4EYQA 1XDGA 3I3OA 3UMBA 4FFMA 1ZYUA 2HU2A 4QM6A 2P35A 2C4NA 2CE7A 1RZ3A 1JB9A 3EASA 3ZTYA 2J45A 3D6TB 5E4FA 3PC4A 2DJ5A 3YASA 2G3YA 2ZVQX 5ALTA 2AOXA 3KBBA 4YRKA 1FQKA 4DJJA 2BZ1A 4RXMA 1VB3A 5E4JA 5JBIA 3PUJA 1DIRA 3MIIA 3TI9A 1IN8A 2PO7A 1NV8A 2RIPA 1JFSA 1VKNA 4J0CA 4BGIA 1M1YA 5KYUB 4OQDA 2EYUA 2H4ZA 3FJ1A 3D2LA 3LIIA 3MTGA 4MHOA 3IEMA 3OX3A 4FCWA 2CL5A 1LI5A 4RK1A 3KSDO 3L7CA 4MQFB 4NE7A 1IN5A 3ESXA 3SQMA 1IVYA 2ZJ3A 3WDKA 3LYUA 1YZVA 6GPBA 3N28A 3UG7A 3USES 1PJQA 2J59A 3DTNA 3KASA 1F2TB 1QGOA 4LKOA 4OKIA 3ZBUA 4YT5A 3DDUA 2WBLC 3KSZO 4RZ2A 3GPLA 1IN7A 1JDTA 4RCZA 2YN4A 3MCAA 4TKUB 4JN6B 2FSVA 2B61A 2ZE6A 3CVOA 4JBWA 3SHVA 5J2TA 4HR7A 5KTSA 1KYTA 1OWLA 4I4TB 3LI2A 3JQBC 4R2HA 4M1SA 1CQZA 3UMCA 4RD2A 4CM8B 2XNDD 1MH1A 5CFMA 1N9GA 3UHOA 3OMXA 2AEJA 3Q85A 3M9XA 1LI4A 3QXSA 2HIMA 4BASA 5I8ZA 2QSZA 3F3YA 3T7TA 3WBFA 4KDFA 3FMFA 2QL6A 4YCJA 1MX1A 2GFIA 1MEEA 2O2ZA 3K70C 1QBGA 2EW2A 2GT1A 4ILKA 3RU2A 1WB6A 4JJAA 5EE9A 1GPWB 3U80A 3VPFA 1UMBB 2IH4A 1ZYMA 2QD5A 2EBFX 1Q0LA 4K03A 1I6LA 1IU9A 2QAGC 3E18A 3ELWA 3OTHA 1JR3D 2R8YA 4KN5A 4Y0VA 5E6UA 3R7NA 1PJ3A 2V7TA 3OIYA 3P0JA 4EGQA 1JFTA 5AJYA 3AFMA 5K0TA 1L4YA 1PGQA 2L2QA 5ICSA 3M6FA 2RJOA 1DO0A 2Q62A 3U4IA 4U7GA 4DCGA 1E1RD 1IONA 1JE1A 1ISGA 1KIFA 1VLMA 3IIKA 3AETA 4KVAA 5KJCA 4FFOA 4MW4A 4YGXB 3OSUA 5LQMA 2LKCA 1ND6A 1N6NA 3DGFC 1PFKA 3QE3A 4QG7A 1PJ4A 5SZHB 5T5QA 4JJZA 3D8UA 4ESOA 2QSJA 2W8BA 3BWMA 4ZVNA 3T7AA 4XR4A 1EP9A 3NIWA 2R6ZA 4FPXA 1YUMA 3NCTA 3UMYA 4UDXX 5F23A 5LXTB 1UINA 1NI5A 3MW8A 1EFKA 2CXUA 3DZJA 2BPOA 4PONA 5KDLA 1PJLA 4ATNA 2HQSA 1GGVA 4LCBA 5DDIP 3LNCA 4MR9B 1L7NA 3INTA 3GJ8A 4D99A 1QONA 5F5NA 3I5XA 1POWA 2A0KA 1EGAA 4YROA 2CC2A 4CKBA 5A9SA 3D1LA 3TH5A 4FYVA 1ESCA 1LFAA 2QG4A 4EENA 1OBCA 2O06A 2PY6A 2DOKA 2JH9A 1UM8A 3I2KA 4PQRA 4R68A 1L9XA 1BGVA 3EZ7A 4NBRA 1C1XB 3E9NA 5CURA 1EDBA 2DWOA 3D6AA 4DZTA 2GAFA 2IEZA 1AKTA 1DBPA 1I4WA 2D1SA 2NTVA 3DAOA 4PGGA 3UJ6A 2GXAA 4G5RA 2GA9A 2OB1A 4MCHA 4TWZA 4YK7A 1VJGA 4PCVA 3Q1KA 1XCMA 1TYBE 1N5JA 3VYUB 4XWAA 1ECCA 3RF7A 4XX0A 4FJ1A 4GPAA 4M54A 3WL3A 2BCJQ 1S0UA 1Z88A 3ZJUA 3GCZA 4PG4A 2XDQA 4XYEA 2RB4A 3OMLA 2HU5A 3FLAA 4QLBA 2BF4A 2R1VB 1SCAA 4RXUA 4BATA 3FDJA 3FLEA 3Q9NA 4FONA 4R8MA 1CEEA 1MOPA 2IXBA 1T2FA 4B2PA 4N8EA 4ZDKA 4HDNB 4OJQA 1UOOA 2OYCA 5JISA 5ENZA 4AMYA 1VSTA 2K87A 2CEAA 3DA8A 4AKEA 1O77A 3I37X 3F71A 4Y2YA 2PFKA 2ZLBA 4UTXA 1ZM7A 2I6XA 5F3RA 4N5IX 4WD3A 5EIBD 1RHMA 1V5GA 4PLFA 4X1YA 5BNWA 2I2DA 3COVA 3COWA 1KWGA 4RGQA 4TS4A 1NOIA 2IYWA 1NMZA 3OA0A 1NT4A 4LE1A 2UUAB 3T61A 4X8HA 1FX1A 4Y30A 1Z39A 3NATA 3ITNA 2ZIZA 4E07A 4HTFB 2VDVE 3KYIB 4XQGA 3R8FA 4H3HB 3DOJA 1FNMA 3DPIA 5GONA 4P54A 3D0KA 2EZ8A 3EK2A 2WIDA 4FGUA 4UHCA 5AVKA 1YIDA 3N2GB 4R69A 4DCNA 4TWBA 3B9QA 1PLJA 1RHQA 3KSMA 4E5MA 1WVMA 4ETNA 2AOTB 4Y67A 4Z1OA 2LZ0A 3MEQA 4HFNA 3HEBA 3JARA 4EG0A 3T5AA 1D2EA 1Z6YA 1VDZA 1YACA 2A1TS 2VJLA 3L6UA 1RXEA 3GJ5A 2H9AA 4XDHA 1H42A 3HP1A 5LZ4A 3GFBA 4AB1A 2PXXA 3K2QA 2A1IA 3AF2A 3W2EA 5FUYA 3HVKA 2HX1A 3N3AC 3AKZA 4DLKA 4PR3A 4L5AA 1NJSA 4MS1B 4YA6A 3UGKA 1ZCZA 3I5MA 3BC1A 4JBGA 3NUQA 5IM4F 4YY3B 2ZXUA 2QTWB 1G6OA 2AI3A 3HMQA 4FHZA 4W8GA 5EIWA 4TYPA 2IZOA 1YQ9A 2EFYA 3HU2A 4P4SB 3DVLA 5AI6A 1N7HA 3HCDA 4B5KA 5HR5A 1YJAA 2V6FA 3CLSD 2OO5A 3LHSA 3OMWA 3TQSA 4TYNA 1CUHA 2VDWA 2UUPA 1L4UA 1OGYA 1D6NA 3LOQA 2JCBA 1E0SA 3PG5A 3L7JA 4NMLA 3T7EA 2BD0A 3ZU3A 2EEPA 5AW7A 3I76A 3O2QB 4I5DA 4KL8S 1ZD9A 3ENWA 4Y6GB 1W1UA 1Z2PX 4MX8A 5LJLA 1H1LA 1R9GA 1E5QA 5CH8A 3NDRA 2RARA 3C7DB 1E2IA 2G4LA 5T3YA 4WESA 3D81A 2JJ1A 3GO4A 4S24A 3WXMA 1XEWX 1T3TA 2ACWA 1UBMS 6YASA 5JI2E 2Z2KA 4YCMA 1HTWA 2Q45A 4RF2A 1NVUQ 1QM5A 3AOGA 5ESRA 4MYUA 3S1LA 3QYPA 3OOJA 2O2YA 4HGQA 4RIEA 4CDGA 5KUTA 2IKQA 1XNRB 4XSHA 3CZ9A 1PZFA 2BBWA 1Z5GA 1I13A 3RBVA 4HYTA 4QDXA 3V8RA 2XEJA 2HWKA 4PQGA 4LISA 3H8SA 1FF9A 5FUWA 3MJDA 4H7KA 3WLMA 2BFEA 2Q1TA 3PVZA 2DBQA 2HOQA 3WIVA 3VH2A 2O8FB 4L50A 2FPPB 2P41A 5K3SA 2WINI 3R24A 3C3DA 2XYQA 2GAOA 3MXTA 2V9PA 1KSHA 3H8JA 5E9AA 3SXPA 4EB6A 1W29A 1YE8A 2FMFA 4DB2A 1NVVQ 1HSOA 3I9LA 4KQ2A 3RK4A 3BBLA 3RASA 4L6AA 3H9JA 1JDEA 1AG9A 1BWQA 4HPWA 1L5NA 1MABB 8AT1A 2ZSEA 1L3IA 4NLLA 2DE0X 1EI9A 1QUEA 1T8SA 1RRCA 4Q7EA 1SBYA 1F38A 1W35A 4RGVA 5H7XA 2VT6A 3HVHA 3NANA 1MDBA 1AHNA 4M9RA 2H4XA 4CQLA 4J1TC 5AVZA 3PWKA 4IR7A 3FWPA 5CB0A 3G7SA 2YHBA 3IOEA 4K0KB 8OHMA 2XQFA 4ZYLA 4XFDA 3HCNA 1XDBA 4F5WA 1QQ6A 1SULA 2EWVA 2XJ9A 4F97A 1E1QA 1YOVA 2ZIWB 2JAHA 3ZIUA 2CLCX 3IKJA 5JCPA 3AOEA 1KBOA 3CO0S 1ISRA 1SC9A 1T34A 2HUPA 5HJ7A 4PQFA 4MPJA 4JP8A 1SU8A 1WV0A 2GJ9A 4C4PA 8MHTA 2L18A 1U2EA 4ANFA 3E70C 1FE8A 1SBCA 2FHSA 4IZHA 1VBNA 3C8DA 2Q41A 1I1OA 4NH0A 4X6XA 4IXDA 4M98A 2BFOA 1P29A 3DNPA 4URFA 4XJTA 4AWXA 3CZQA 5SYNA 1NFFA 2WM9B 4QGBA 1P5JA 1T1SA 4UOQA 4JJ4A 5H3HA 3W4JA 4V1CA 1U2RA 2J67A 5LOVB 4NECA 4HN9A 4ND1A 2IH5A 4N76A 3VQTA 1N6OA 3GXOA 3TLJA 4FINA 1Q1BA 3IQXA 1EDZA 3EQ6A 5JNLA 1HE8B 2YY6A 1VPTA 2NO0A 5CDUA 2P62A 5H16A 3RVRA 1LVGA 3LKVA 2YWDA 1NONA 3ND5A 4E3WA 3A1DA 1G21E 2CLKB 4C7JA 4YXWD 3GLIE 3DBRA 4E5UA 3BE6A 5AKKA 1IUKA 3N8DA 4K1LA 3UK2A 2O8DA 4CMHA 2EERA 1XF9A 3RTEA 4URZR 2WWFA 3L0YA 1T4CB 1M8KA 1NWHA 3LXXA 2FW0A 3H86A 1D03A 4YRZA 4MQMA 4UCXA 1ZDMA 4OA5A 1OLSA 2WEKA 2XD4A 3JQFC 3KZOA 1KWKA 4JI2B 2I2WA 3R44A 2AYZA 2DFPA 2W4QA 4DVJA 1F0YA 5THKA 3FEEA 1EZZA 4EHIA 5L4NA 3B85A 1HR0B 1IHDA 2I1LA 3JSAA 3V1LA 3DM9B 1NF3A 4JVNA 4BNDB 2RJNA 3N59A 4R51A 4UNPA 3VRHA 1G8KA 3TL2A 4B3TB 1IM5A 2HSJA 1I3NA 2FQQA 1KZ9A 4MWCA 5FUXA 2ZIUB 3H9BA 2O0HA 5KHAA 2O2IA 3R8XA 4AJ2A 1T1IA 4MZDA 3UHJA 1WPQA 3W5AA 4V0RA 1VIDA 3HXKA 4I1OA 4PXYA 4XJVA 5CDFE 3OX1A 2WHRA 3GJQA 4M9ZA 5A4DA 3SS9X 3GJ6A 3KSUA 1QC5B 4XWYA 4OSOA 5MGBA 3V8MA 1I80A 1JF8A 3NV7A 4J0NA 3EXHB 2P9HA 1JJVA 3LYAA 3O91A 1TJPB 3K92A 4RSRA 1IVNA 2VZ0A 3IP6A 3MYRA 2K5UA 2AG1A 3AV0B 3QBVA 2QTCA 4I4LA 2IP4A 2Y71A 3RVLA 5BV7A 3FMGA 4V1CB 2VFAA 1E3LA 3TIGA 2I2BA 3C8HA 3OWHA 3C87A 1RAAA 4AJLA 3R5HA 4EUFA 4GMXA 4X5OA 1T3GA 2Q4BA 1I3LA 3I05A 1E79D 1HKHA 3K0CA 3K96A 3TKAA 5U4QA 5JECA 5JQWA 1SVKA 2OCDA 3HCEA 1WSBA 5D2CA 3WRYA 3O31A 4JDUA 1MHPA 2A0FA 4QQKA 4EI8A 2OWEA 2ZPAA 1E59A 2L17A 4A10A 4CYMA 3T05A 4F3CA 4QJ3A 2H1LA 2Q99A 4H1HA 3RG2A 4EKIA 1A8IA 2PMDA 4QFMA 1SHKA 4PPYA 1H5UA 1C4OA 5F51A 1PYOA 3M4JA 1I1QB 4N3NA 4PPQA 2R2GA 2ODBA 1HDIA 2BH2A 4KQHA 3IAS6 1PR4A 2QTMA 3SJZA 1KERA 3QVTA 2E85A 4KO4S 2FXVA 2I54A 3S8MA 1X1CA 1K9VF 1GYQA 4MVJI 1TLFA 4W6ZA 5JSUA 4TTPA 3DV9A 4F9EA 1U7PA 3F1KA 3M6UA 1A1VA 2K7FA 3TKYA 1SKYB 1KAQA 2NADA 3EDMA 1U1GA 3NASA 4XE5A 3EGVA 3MELA 3Q88A 5FORA 3T34A 4S1WA 2PZFA 4I9NA 3DDCA 4JVMA 3AEQA 3LHKA 3PUXA 3GNQA 4XEHA 4ZJUA 3RBUA 2Z2IA 4N3GA 2VP3A 3DXXA 3HJBA 3DG9A 1CVLA 1NVBA 4HX2A 2I4TA 5AM5A 2WJYA 4ETMA 4UXJA 4CRWB 5LU8A 3NBXX 1UJNA 3SIXA 2EP5A 1UJ5A 5H3CA 4REMA 3BHMA 2RONA 1NPDA 3WGQA 4UQLA 3K71B 2I3ZA 5IJ9A 2R85A 2BR4A 3J81A 1NMQA 4NOKA 4Q4HA 1PN3A 4J03A 1TU4A 3BMNA 1KO1A 2E87A 2KI5A 4TZTA 1U6JA 2WJ4A 1KP2A 2XI4A 1ZHFA 1PU2A 1C9NA 2IEIA 2NUAA 3AJRA 2ILTA 1YR1A 4O2BF 4TTIA 1MJHA 2WVAA 4OGGA 1P31A 4X3CA 3MOGA 2J6BA 1A9ZA 3FTPA 4PZCA 1CTQA 4DARA 1GFZA 2KBFA 3O3OB 4QD3A 4YAGA 5KS2A 3P45A 3W5BA 2D1FA 4IXNA 3TM5A 5BSGA 5KKNB 1KA9H 1QK5A 3MTDA 3V8PA 1HLPA 4GM0A 1WJGA 1NPYA 3N0WA 1AKYA 2DFDA 3OTGA 3N2KA 3WWCA 4G2NA 2HBQA 1SBTA 2H54A 3K05A 4XGKA 4C43A 3O1IC 1QTQA 4Z3DA 3LTNC 1YB6A 5FHQA 3W0LB 1LV8A 1UK7A 2RGCA 1FFYA 1P17A 2R79A 5T8KC 1E2GA 3N2EA 3HDVA 4FX2A 5JVDB 4WASA 2W22A 3KEFA 4UASA 4UZFA 4P4SA 3E8XA 3BI0A 1PV1A 4PHFA 1ZUNB 1C81A 3EVNA 2JFFA 3I42A 5KYKA 5JJLA 4I14A 1XNHA 5AKYA 4R8LA 1SKAA 1JHUA 2FZ4A 3G6KA 4YQYA 1IZ9A 5CYFA 3FUXA 1E5LA 2JFVA 5A6VA 1CP3A 1HT0A 2N3ZA 4KYVA 4TMXA 2W83A 1M3SA 2ERCA 2QAJA 5JBQA 4IKPA 2HK9A 2K7ZA 4HAVA 1L4KA 4MUNA 5DOVA 3SS7X 4MAAA 5D6OA 5KTNA 1OI7A 1P0QA 1BMFD 4LF7B 4CKWB 5F33A 3UXHA 1NBEA 4BKOA 1ZRNA 2PWAA 4FE4A 1V39A 5HHTA 2CUKA 4ZQIA 4B3DA 2F3PA 5L7YA 4ALLA 4EQ6B 4GI2A 1FDVA 2XWJI 2FM4A 1UBOS 2JBWA 3H0CA 2D0OA 3MG9A 1Q0HA 3MMXA 3IAXA 5H3LA 1LC3A 1Z4JA 4B7ZA 1B14A 3A6DA 2XNCA 1IRIA 3FGNA 3R6GA 2JRCA 5T67A 1KZ1A 3TW0A 3ZHBA 4C20A 2MU1A 1RJEA 2BTOA 5FWYB 1BO6A 4EHBA 3KYDA 1KFBB 1ZBQA 5D7NA 4JR0A 3MWYW 3A4TA 3D4LA 2BEVA 1XZGA 5A04A 3F49S 3PYXA 2AVDA 4WLVA 4WXRA 5LQRA 3TBFA 3VYTB 1BS2A 3L2OB 3F6PA 2GJ4A 2YXEA 1ORTA 3A10A 3WJAA 2AJLI 4ZP1A 2HWYA 3IIBA 4L0QA 2JFHA 3L05A 5JXIA 2GJSA 1RWPA 4ZCRA 5C7IO 3U61B 2AFIA 3AESA 4FOPA 1I6MA 2QXUA 5AUNB 5AVXA 2PU7A 4N3BA 5JH7F 4BXOA 1R6AA 4RS3A 2P2NA 3NRJA 5EJAA 4BEJA 4PO1A 5L8VA 1UXJA 2GDZA 4X6LA 1O95C 3PX7A 2LBPA 1RKXA 2F3TA 4ZOAA 2O8CA 3KM0A 5G4KA 1T1GA 4H77A 1R0WA 4G0VA 3ISJA 1PAUA 1OXVA 2JEZA 2QTFA 2FZEA 4BHTA 1V8ZA 2FB9A 1Z6GA 2WYUA 1I51A 2FZGA 4Q9AA 4LF8B 1ITZA 4IHJB 4OGWA 2AE1A 2FR8A 3R3WA 1GUBA 4CL0A 1QK3A 2QW8A 2O7NA 3HJNA 4IMPA 3L1IA 4RJJA 5LA6B 3L82B 4ZI7F 1EXVA 3C6MA 4IUDS 3HZHA 2ONZA 4X3RA 1WD5A 5A9RA 3FOAA 1GQQA 4GT1A 2BTQA 2FA9A 3QLUC 3K70D 1GUYA 3JQ9A 4FM9A 2QMHA 1PTKA 4Z9BA 5BSEA 4WNAA 1TQ4A 3SHOA 3LXRA 5ALIA 3AWDA 2VSFA 3G8CA 4XAQA 2P5UA 2YQ4A 4K6GA 4RDIA 3W7BA 4KX5A 3ZWKA 4GPIB 2EYQA 4KV9A 1PVDA 1K0UA 4ZYUA 3FM9A 1KYXA 1RPZA 4CKEA 3BREA 4L3OA 4EJSC 3W3AH 4KQJA 2REQB 1BYUA 3BE5A 3UBTA 3AR4A 4LAFA 1QP0A 2RGNC 1C7IA 1OLXB 1DCKA 1Z7WA 1L3CA 3KR2A 4Z4GA 5C2JB 1IOZA 3GJSA 2BI7A 3UBMA 4EK9A 3ESAA 1X80B 2XYPA 1Y42X 4MCSA 2F62A 4WIAA 4ZVQA 4AZ0B 3CLRD 1MDFA 4GUDA 3VFDA 4OXNA 4AY6A 4IEEA 1DWUA 4UHJA 5DWQA 2Q1SA 3BFJA 2FPGA 1NRXA 1G8JA 2GWHA 3ROPA 4EDFA 5JANA 3G7UA 1YMUA 4FXOA 4W1PA 2HN9A 4ZDJA 3UAWA 2F1KA 3WLTA 2XECA 1IZ7A 2EJCA 3F5MA 4YGYA 4WOCA 4Q3NA 4PICA 3NALA 2DT5A 3V6LA 4ASUA 3KQKA 1H9AA 4C6SA 4DQDA 3AL0C 5EC8A 1A50B 3T9DA 2AFHE 3DO8A 5KNDA 4Q1VA 2DUUA 1N6HA 2WSBA 2CBZA 4C29A 3HJCA 5IULC 2XVZA 4F7WA 1N0VC 4F60A 3FPJA 2RGAA 1D07A 4BAZA 3D6JA 4JOCA 3FWHA 1ZFNA 1JR2A 3KTDA 1VG9B 3G0OA 5LPNA 2POQX 1CRPA 2HEIA 3FE2A 4L9AA 1T8TA 1Z5ZA 4YJFB 2VQ3A 3RS4A 1G98A 3VR6D 4P3KA 4AYTA 4F8EA 4CR8A 5B7PA 1MT3A 1B8OA 4GRDA 2JGMA 1GNSA 5C4MA 4XXHA 1GZ7A 2BP7B 2GN4A 1UZMA 2DETA 2YASA 3TL6A 4LG1A 3FFXA 3MJVA 3BD9A 2PT5A 2W6ZA 1YZHA 4ZODA 1OWNA 5DTJA 5ECYA 4GOND 1SCJA 4YLYA 2C6GA 1CJKC 4MUIA 1T9AA 3QKIA 4YB8A 3OJLA 1ZD3A 3D2BA 4MQFA 5TF0A 4EYSA 3VGPA 4LOKA 4MVJF 2H59A 2ODAA 4MJXA 5ALKA 4O4IB 2ZB7A 3MD0A 2AC7A 3TMAA 3ONDA 1YI8A 4W9NC 2CSXA 5TR9A 4NZNA 4NK5A 1WW2A 5EHGA 3FWNA 3DKRA 3AZPA 4RAOA 3N2IA 4NZOA 4BNWA 5IT4A 3N74A 5LBTA 2PZAA 5AHRA 2F59A 1XJCA 3B6EA 3I4LA 4JASB 1AZWA 3ROFA 2NXJA 4UNQA 4BP1A 3A26A 2H6EA 3FPHA 1P6XA 2PLWA 4NGRA 1XPOA 4JHXA 1CPYA 3WGVA 3O4FA 4HDRB 3T5TA 1KFEB 2DC1A 3USCS 5MN4A 4DR7B 3L0SA 4TRJA 4Y1FA 2C03A 4MKRA 5FL3A 3DMRA 3V97A 3OEHD 4TM7A 4JHLA 1FA9A 1C41A 1EXNA 2V0NA 3PEVA 3IURA 3RABA 4XRGA 3I04M 4TWIA 4DTIA 1YIAA 1DKUA 1VE6A 4B3CA 3Q7TA 1SUDA 1ZH2A 1ZEMA 3RUCA 1Q5PA 1XMVA 2WU1A 3NAQA 1JHPA 1U11A 3QLJA 3ACBA 4LJ8A 1U7TA 2X6QA 3QENA 4BEBA 4YUWA 5BVHA 1MMFB 1LKZA 4RH3A 1XWFA 3UT5B 3QNWA 2RH9B 5K3CA 2EJTA 2Q9UA 3TTWA 3ZUPA 3O9VA 4LEIA 3DP9A 3NHYA 3ZHZA 2IW1A 3CLSC 1XQWA 4BBJA 3ZWVA 3RBAA 5L6LB 3LM8A 1BMDA 4LBVA 1TTTA 1NF9A 2DERA 7GPBA 4BQQA 5A3QA 1KQGA 2R44A 1F14A 2BHNA 2WFAA 3DBIA 1DKQA 1VZ3A 1S1CA 4H16A 4H3VA 1UBTS 2AW5A 3CR7A 3LW8A 5CNMA 3WO1A 5HBRA 2W2XA 4DLLA 3TR0A 5A4AA 5A4JA 3QVGA 2J4CA 3ON5A 4KBYA 1BA2A 1JR6A 1WSWA 1ZP6A 2C3UA 1E4VA 2JBKA 3ESBA 4C21A 1J2TA 4LTDA 1PD1A 2AKAB 4I5IA 5EA2A 3Q0IA 2P68A 1YV9A 4A82A 4DHEA 4JP2A 4UPEA 3U44A 2WWGA 2ZJ0A 3NHBA 4UATA 3R5KA 4REQA 3MRTA 1U80A 1TEZA 2QAGB 3M89A 4RHYA 1MTOA 4PW0A 2YJ5A 4X24A 3HLKA 3FG9A 3DDNA 4DGSA 2IX3A 1DPGA 3SOZA 3K6RA 1JU4A 5T6BA 1YRWA 2HU7A 3WYAA 3SQWA 4I46A 2QG9A 1LVHA 1RQPA 1RWMA 3CX7A 2E9SA 3N76A 1Z62A 1KJQA 3I1IA 3QI2A 5DBOA 4A36A 1L8OA 4JB2A 4ZZIA 1AXRA 1FEZA 5IK2D 4K28A 5H83A 1TVMA 3OICA 2LIVA 1DJPA 2YW2A 4TS9A 4DPKA 4RZHA 2GBIA 5LP6F 4P36A 1TCVA 1TYEB 4HYEA 4HS4A 1H0HA 3AZQA 5ESWA 3WMXA 3QMVA 1XXLA 2IZ5A 4IS2A 2R5NA 5KOYA 3QHQA 5F77A 3ZW8A 2K6GA 3IBCA 1KQOA 1ATZA 4RQAA 2F8TA 1XRQA 3PBKA 4BJHB 1N8NA 3VSCA 4QREA 4JBLA 1N7IA 4R8SA 3DJYA 2GHIA 1B16A 1IY2A 5BUZA 3PEFA 4TLLB 4D9HA 3RSLA 4WRRA 1VSUA 4D97A 4JT8A 1U8TA 4P7FA 2ID9A 3PNQA 2VPYA 4FYXA 1DJMA 1OX6A 3NEYA 2HV8A 3FPSA 1YBHA 2AKYA 4LVCA 4XZ3A 5B1SA 3NDBB 2GK6A 1DE4C 2CKDA 4F38A 2IIVA 5JU6A 1COWA 3MAGA 1FNCA 2WTNA 4WBNB 5AH0A 3HJRA 3EODA 4J1NA 3IMEA 4J7AA 3DC7A 5K3BA 2A5FA 2EJWA 4EQ6A 2ZR7A 1U99A 3AG6A 3M2PA 5JALA 3LLUA 4J75A 2A1UB 1E3WA 1MX9A 1XHFA 2CDRA 2ZSHA 1R74A 4WZ6A 1OH5A 1RJ9A 3R3UA 3Q8XB 3RF6A 1N5RA 4PO8A 3L0DA 3AHFA 3ZJTA 1VE9A 2VJAA 5CXXA 4PGMA 2FQWA 3GGOA 2QLMA 3JD0A 4ZOEA 4RYDA 1RLTA 5A4MS 5L40A 1IWOA 1QP4A 2PUWA 2Q2VA 4AWAA 5DZSA 3KSRA 1UFQA 4F3TA 1MPTA 3KFXA 5AVWA 5D85A 1E1RA 2W2KB 1LUAA 2BOVA 3DE4X 4KQCA 1G6KA 1UKCA 5K0SA 1F17A 1UAAA 3AV3A 1LZLA 1ZJ5A 3VHLB 1GPMA 1L7EA 4HQKA 1EGMB 1XU7A 2EGHA 3MBIA 1GITA 3RJ5A 2I4LA 3F47A 4A2WA 5KTTA 3V2IA 3WKEA 1MOZA 4HQLA 4MLDA 5DLEA 3UV3A 4UTRA 1S5PA 1LBEA 2BTQB 4LF5B 2WUGA 3DMHA 1Q6YA 4EG7A 3MWGA 1IJKA 1F2UB 3QWAA 3AIMA 3IKVA 3CNEA 1KPIA 2X1LA 2YNMA 1Y8RA 2H2HA 2P30A 3NOXA 4MA5A 3JWEA 2QM0A 1Q3HA 2OL4A 1M67A 3G5LA 3ORYA 3DOIA 2H1RA 3K9GA 4C0WA 3PEWA 3K8QA 3F6BX 1U5BA 3RU9A 5HE9A 2ZANA 3C8ZA 4COKA 4F4FA 2IVFA 3SOPA 4D3DA 1FX0A 4D42A 4MPTA 4AF7A 2PS9A 1CZLA 3G49A 1PGJA 2EHJA 3HCWA 3NWPA 3TKLA 4D79A 1VI5A 3NBYC 4H27A 4M2LA 5FYDA 5HM8A 1BWPA 1KZ4A 2GEBA 1HWYA 1B6RA 1SVIA 2WVJA 2F2TA 3E0XA 3H3JA 4MVJG 1JHQA 4NFSA 3B7WA 3KVRA 4R1QA 4TS3A 4CT5A 4OX9B 2E21A 2WAMA 2DTXA 3PNYA 2GEJA 2FX3A 4FLMA 2V7GA 1ZNXA 4G2TA 1TM5E 3CNLA 4I1SA 2HD4A 1NW5A 4MQBA 4QPZA 4RQTA 3TFQA 2X86A 5P8WA 4F5ZA 1DFGA 2IPAB 4BGEA 4LMBA 2O59A 3PHBE 4L4ZA 2AB0A 3GBPA 2WSYB 1OBHA 3BRQA 3VI3B 2HQRA 4YRRA 4XWGA 3R0VA 1DG1G 3AEQB 1JMKC 1XTRA 4N49A 4TXHA 1VE3A 3SF0A 2AIRA 1A7AA 3GPBA 3V46A 1CS0B 4I19A 4YRGA 2RHLA 4D80A 4ZCMA 4IGKA 3LY7A 4MICA 2ZBQA 1KO5A 3GFTA 3ZZNA 1R4AA 2IF0A 1JA0A 3L77A 1E2UA 5CNKA 5D3KA 5HS4A 5C37A 5F2KA 1FP1D 5IT5A 1FMTA 3BWVA 1UZNA 3AFGA 4AS1A 1H8EA 2I4IA 2X6TA 4ZC1A 4AP5A 4IHJF 2GBCA 4ZHQB 5JBNA 1S3GA 1D2CA 3EYWA 3MA0A 4ZREA 3H11A 1LPAB 5B1EA 1IQPA 1DI0A 1YVDA 1SUBA 3BEDA 4ENQA 2I6FA 2DIKA 3V1YA 1QO9A 1MR3F 2I8AA 4ZCLA 4NHOA 4KOAA 3V4LA 3O1JC 4C0HA 4QPNA 1IHXA 2PGIA 3PGJA 1Q0QA 1QUFA 3EIEA 1DQPA 5I7HA 4G0MA 3V4RA 3DMTC 421PA 1NP6A 2YR0A 4M7WA 4II2A 1USUA 1ZM3A 3WK4A 3H1TA 2ZS9A 3RUIA 5LN1A 3TF5A 5F3WB 1QPBA 2DX7A 3P9KA 1WXGA 3STVA 3NKFA 1U28C 4HB0A 5JSFA 2C82A 1TQ6A 5HDBB 3SKYA 3KG2A 2AI1A 4LXTA 5KYXA 1M8JA 4DA4A 1KK2A 1YS7A 4GXQA 3P0HA 3NDPA 3VKHA 3R0XA 1ADCA 4LYYA 2B0AA 2CLHB 2W6NA 1LLFA 3P9ZA 4EB3A 3BTUA 2EX4A 5AW5A 4HT3B 4JK3A 1MIHA 1UK6A 3O1HB 1NW8A 1ZMXA 1RVV1 3NO4A 4LN1A 4TYWA 1YS4A 2MIIA 3HA2A 5TF4A 3ZWYA 1B23P 4DLVA 4L02A 4NE9A 1W6RA 1V3TA 4LHZA 4RK7A 3UCXA 4AS3A 3SBEA 1XSEA 2I9PA 3IS3A 4UULA 2IE0A 2MSKA 3WYFA 3ZV5A 3KT3A 2FSPA 3GB9A 4B7AA 5CEJA 2WQ6A 2P9JA 1VLLA 2QR3A 3JVEA 3R23A 1XMOB 2YZNA 3PIIA 1JH9A 1CF4A 1SHUX 3HZZA 1V7PC 1EPUA 3AP2A 4M0KA 3A1CA 4P32A 2F3SA 3L4BA 3BORA 1E7QA 1I6WA 3C16C 4Y6LA 4DV6B 2B1GA 4CIBA 4LNHA 4MPDA 5JAUA 4EHFA 1JHDA 2VAMA 4O1MA 3TTYA 1U81A 4ZEVA 3RTGA 2JVJA 5C32A 1TK9A 3JWIA 2RHJA 4E51A 1ZVMA 2VJKA 1OLSB 1LSSA 3BMNB 3L3BA 4Q4HB 1KRXA 3O4HA 3UUGA 1UKBA 1FUKA 4LXGA 1T4CA 3PHHA 3R7SA 3HL4A 2OQRA 2WKQA 5DGIA 3QYAA 5I9SA 1N8SA 1OILA 3NH6A 3QEAZ 1A8SA 3TB4A 4E4YA 3EGCA 1GRCA 4CDRA 4E03A 4OC1A 4GDFA 1GPNA 1OIWA 4NDAA 3K20A 3ZC3A 2G9QA 1PDVA 2QROA 3A6GA 5HIJA 3U3ZA 4D02A 4UNRA 1C8KA 1WY5A 4RETA 3H0EA 4MW5A 4Z99A 4NKRA 2QRJA 3L6DA 2UVPB 3RAGA 3QY0A 2WAAA 3WGOA 1JLMA 1C3EA 1NUUA 5EKUA 4A1OA 2VRNA 3HLYA 3M49A 5GPBA 3UEOA 3HDHA 2NPFA 2XGOA 3KLMX 3O8LA 1P0FA 5B64A 4MVJE 3G2IA 3WNVA 1P9NA 2JLRA 2R60A 1E4EB 1RAFA 3B6MA 2JLWA 2MOKA 3KWJA 1QBKC 3I12A 5EP2A 3KOYA 4Q3OA 1GSAA 4J16A 1YZFA 4LPKA 3HXTA 4E3ZA 3SPXA 1H2EA 3F3SA 3GA0A 1P2BA 3PUZA 4K6OA 3UGQA 4E5VA 3HXMA 1HZZC 3OZXA 2A30A 4B31A 2WYVA 4LGYA 4ARAA 3VYWA 3MUOA 1EDEA 5CDHA 3NW9A 4W1QA 2VVTA 5ECDA 4EW3A 1X92A 4JI3B 1V5WA 4MCJA 4ZTBA 1BDIA 3RC2A 3WGKA 1BH6A 1E2FA 1YOVB 2GFQA 4CLOB 1H3FA 1Z15A 4KYTA 3OE4A 3E9ZA 3QTTA 4UFNA 3PX3A 2X2FA 2NZ2A 2RGXA 4F4CA 4FSXA 1QQAA 4H1WA 2B25A 3ZGYA 2XNDA 5IH3A 1UDXA 1YR9A 2JHGA 3ORQA 4EGAA 1TCBA 3G2QA 3WRWA 5KNBD 3EPPA 4K8OA 4PYNA 4BFYA 4KXLA 1YKGA 1ZUHA 2WDPA 2XTZA 4QUGA 3RVNA 3TW8A 4DMMA 3E3LA 2XXAA 2YYSA 3N0RA 3GLUA 1MABA 4RK4A 4X93A 1DZIA 1GCAA 4RHUA 1PTJC 2PXHA 5DFAA 5CBPA 1RQNA 2R7KA 2XZOA 1ZS9A 4OYHA 4DFDA 2JPDA 5HK8A 2BI4A 3QPCA 4B45A 1S2NA 3K6SB 1SXQA 1J9ZA 2GBPA 4LIPD 4NBTA 4WFIA 4JKIA 1D4AA 2D8MA 1A4UA 2F8MA 2NVWA 3FCYA 2FPPA 3ASZA 2EZAA 1LPPA 1Z0AA 2Z4SA 2WHYA 2HLDA 2XBUA 4XWKA 3BSYA 3LUPA 4C5CA 4CIYA 2WYHA 1M34E 4DQUA 4LXXA 1FMCA 2PS0A 5EHNA 3EULA 4D9MA 5I3CA 3BXMA 3QX8A 4O33A 5GIPE 1AKEA 4J16C 2AOUB 3E8MA 2OV6A 3M6XA 3L79A 3UFBA 5LNK6 3CM0A 3FKSA 1PQWA 1N2XA 1EFAA 1W52X 1R6UA 3DFZA 1V5EA 2YJTD 3SDZA 1VE5A 2RKWA 4DQXA 2AW3A 2V4MA 4NCAA 4EFKA 2NMVA 4LE2A 4BKUA 3RVOA 3TNFA 2DUJA 2GD6A 1WCIB 1BMQA 4KFTA 4P8RA 1ZGAA 5BW8A 3MT9A 1FFSA 2KMLA 4JC5A 2QTNA 1YCGA 2GZ2A 3CNNA 4U7TB 2HTEA 1E4OA 3QMPA 4IIJF 2I7DA 1XRPA 5ALDA 4MS4A 2OQVA 5EE5B 2GN9A 2XA2A 4MYTA 5HJ5A 1ZNQO 2XUQA 4LDQA 3RU7A 5DPMA 3LDFA 5M04A 1GQFA 5DI9A 3BMCA 2PXCA 3WFJA 3KLOA 3ZKAA 4CM1A 3QNUA 2C61A 1VHQA 4C0AC 1N78A 3RD5A 2JHAA 3SQLA 2GETA 2OFXA 1A2BA 4BYMA 2GZMA 3SR0A 1KVTA 1SEVA 1MZVA 3LC0A 1XDDA 1PJSA 2CVZA 4AFNA 4G1UC 5C1BA 2ZXFA 2FCAA 2CCKA 3WV5A 1VSBA 2JJ2D 2PL1A 3MVEA 3QVLA 4CEHB 2CE2X 1Q0UA 3M5PA 4HDSA 3JD4A 3S8EA 2EKQA 1G5TA 3OOHA 5EIFA 4BO6A 1Z47A 3QVXA 4LFAB 2QT1A 2JL1A 2Z09A 3LCVB 2BJWA 3JVIA 3LX8A 3PNPA 3SD7A 3G9ZA 3IX7A 3TXAA 4DYHA 3TOSA 4P44A 3U48A 4HB2A 1CUGA 2GCIA 5DN6D 2B5OA 4JVOA 3JVUA 2QN2A 3ZV4A 3EIOA 3EVDA 1W1WA 1TW3A 4PZ9A 3SM9A 4OA8A 3QUCA 2VQ6A 4YJDA 4MUGA 2QI9F 2QEQA 2G4VA 3A9SA 4ZHQF 1E8NA 1I24A 2NO9A 4KDCA 2JGDA 4EY7A 4HQFA 1YD7A 3BWXA 4ZV4A 2EL9A 3EEIA 4ZVLA 4FX5A 3D7SA 2FNAA 3ACDA 3SC4A 3NWOA 3OM0A 3TOZA 3GAAA 2YJGA 1RYNA 3O4RA 2VYVA 4BOYA 4C8FA 1A1SA 2WM3A 3QV1A 3WFZA 2RE8A 4Z4QA 3U7HB 5J23A 2COEA 2PM8A 4AG3A 3BGDA 1X86B 2IP2A 3I8OA 2EFHB 1FRVA 4PHTA 5DGDA 1QP7A 2O7VA 5AIBA 1BCSA 1E1YA 1NQWA 1OAOC 1SBNE 1T36A 2FGJA 4V38A 3L9WA 5DHFA 5KSWB 2ADOA 4LA4A 3ZH9B 3U16A 3IQGX 3TZBA 1N5MA 1RQ2A 2NPOA 4ZAWA 4ASUD 3DW3X 2HQ1A 4D8XA 2O54A 5CH5A 4Y9DA 1KJZA 1I14A 3ZBTA 5CCEA 1ELOA 1GU1A 1QG4A 3UC9A 3ZK8A 4YRPA 2E37A 2H2GA 2UUBB 4RW0A 1JU9A 1X7ZA 5FQNA 4YTEA 1YIOA 2QLTA 4DR3B 1UMDA 1WVGA 3STXA 4EYGA 4ZCPA 4HWGA 1UPXA 4JYPA 2QDKA 5THXA 3ZLBA 1U2ZA 3AO0B 4IHAA 4V0KA 4AP9A 2VUUA 1H93A 1QHNA 4GU5A 2HSWA 2VF2A 1VL2A 5ALHA 1KTIA 1JBKA 1CY2A 3MS7A 1Y7TA 3SDSA 5ES4B 1BAPA 1F3OA 3ZHYA 2Q6TA 4IX1A 1YVPA 1BN6A 3TW8B 2FG5A 4AJHA 4AZSA 1YZTA 4JQYA 5AJTA 3U26A 4P3PA 1SWWA 4DVGA 3HO1A 5T8KA 3ET4A 4YASA 1GGNA 1DO8A 3RSHA 2ZT5A 4IZOA 1U02A 4JJ6A 3S2SA 4AICA 4PZZA 4D4HA 4AJNA 5AUQA 1GTMA 5FKJA 2YQZA 4LOHA 2RGYA 2B99A 4LXHA 3FW1A 4ICIA 4CLOA 5AKXA 5C1PA 5DWDA 3OEYA 2C04A 3LA6A 2OC9A 3OWOA 1G3QA 1J00A 3KYCA 2RJ3A 1PJ2A 4RVGA 4Y0AA 1M7GA 4KDRA 2O0JA 2LR0A 1NC3A 2H5JA 3GYBA 2ECQA 4DLBA 1PT9A 2ZDQA 3P9RA 3PX2A 2C4HA 4TWRA 4QXOA 4WFQA 2D0PA 4M6WA 1KL7A 4FFPA 3TIVA 3JV7A 3ZN2A 5EHXA 1RFLA 5I7FA 4UAJA 3FOZA 2IYEA 2GNPA 2GX6A 2MSLA 3EH1A 4FD3A 4AUNA 4KQEA 3STTA 4DT1B 2J0UB 3TWOA 3ZDDA 4IS3A 5I47A 3RR2A 1RCUA 1XMXA 4AY5A 2A3RA 3QKRA 5FOVA 2RI6A 2JFXA 3LL7A 1PW5A 1S8FA 4WBNA 1RAIA 4Y8VA 3IQWA 1Q22A 4YREA 2H1OA