3TLEA

Microcin c7 self immunity protein mccf in complex with glutamyl sulfamoyl adenylate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
335
structure length
335
Chain Sequence
b'PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 117
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tleA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tleA02
1ZL0A 4MJXA 5JYBA 3TYXA 4IIXA 4JVOA 3T5MA 3G23A 4MI1A 2AUMA 3TLEA 4EYSA 3GJZA 5FD8A 5K99A 3TLCA 4INJA 4H1HA 3TLBA 2AUNA 3SR3A 1ZRSA 5F1YA 4E5SA 4E94A 5F5XA 5F9MA 3U1BA 3TLAA 4IIYA 3TLGB 3TLZA 3TLYA 3TLGA
chains in the Genus database with same CATH superfamily
4KAXA 5L3RA 2O3QA 1EVLA 1I01A 4UNQA 3QQPA 1AQUA 1WXXA 4GXTA 1V5GA 3G13A 4IJ6A 4XR4A 3V1MA 3BGIA 5BR1A 1A9SA 4KODA 3BXGA 3K92A 3E1SA 3KZMA 3U3ZA 3W78A 4B3TB 5DHRA 3AL0C 1U2DC 1E69A 1GEEA 1XMIA 2BMEA 2V8OA 3M89A 5D1NA 2H1RA 4BO7A 5JXJA 3IS3A 3QG5A 2AOWA 3AUKA 3FPGA 3TW8A 1NUQA 3MRVA 3BL8A 2G0AA 1DQNA 4NNPA 5AXDA 4QZVA 3F98A 5IF9A 5GV7A 1BYIA 3UQYS 3MWKA 1ATZA 3IUYA 4HR7A 4HS4A 4DUGA 4C0BA 3GMDA 2JGKA 3OF2A 3U7HB 2I3BA 3PNKA 5CK4A 4NG4A 1P8AA 2UUCB 3WK9A 4JOSA 3LUHA 5IHPA 4K2HA 1BJTA 5KDOA 4FHEA 3OTGA 5LZ9A 3SZGA 3NKFA 3LT2A 3N5CA 1KOLA 2WFZA 1X92A 3F6PA 3NEYA 4MW0A 4ENUA 1KDOA 2W2VA 3EXEA 3PWKA 1O95C 1M6NA 2I9PA 2JLQA 3ZWVA 5KYWA 1SNYA 4E88A 1YHZA 3K0CC 5F9HA 2ZS9A 3HN6A 1O94C 2AUTA 2Q2OA 3UYKA 3KXPA 1EU1A 1HNWB 4DT1B 2A2ZA 2DVMA 2G7ZA 4RK0A 3IEKA 2IEZA 5HEKA 2JASA 4EUNA 1M2FA 4TWEA 1U3FA 1AG9A 1RYNA 4NI5A 1R6AA 5FUVA 5HVNA 2XGMA 1Y4UA 2IRWA 4HRVA 1W59A 1Z39A 3PUHA 3TQCA 3WR5A 1PFKA 4LZPA 2AJTA 1X19A 5TVKA 3R9IA 1S2LA 3PR1A 2O5RA 1JEOA 2XMZA 4KFRA 1GNRA 2JGNA 4JR1A 1V43A 1EP3B 2YS7A 3ZJYA 1XDUA 3VKFA 5KYXB 1YFJA 2AJBA 3GL9A 3CC8A 4O4JB 2HTEA 4Q7KA 3SHOA 3B1WA 1PR9A 4KLCA 4XYMA 4X00A 3SJFA 2ZSAA 3KWFA 2FV8A 2IS6A 1CUZA 5JOQA 1G8FA 1MIOA 2QUIA 2HJVA 3DOEA 3IAFA 4XFJA 2X9LA 4PG7A 4BNMA 4G1EB 1BDHA 3FRHA 1XKQA 3MPOA 3RUFA 4YJ2A 3DV0B 1KHTA 1Z37A 2RGWA 1U4SA 3C41J 3T41A 3ZG6A 4B0OA 1M8PA 3COWA 4MWCA 1T0BA 3WS7A 4BQSA 1E1RA 3T8YA 5I7AA 3MBKA 4P2GA 4KYVA 2V98A 3ZE2B 4W5NA 1ODJA 4DLRA 3NT4A 4F5ZA 3DVSX 4BP3A 3A9WA 3WGUA 1P7WA 1IEVA 3GLHA 4QQRA 1GN8A 3RKRA 4G25A 4Q4JA 1OBCA 4BV9A 5HKKD 4NOJA 1I6LA 3ZU3A 2BMAA 4ABYA 5K8CA 3GZ4A 4XH9B 5LP6B 2QXTA 3KVYA 1BYUA 1N4DA 4WBSA 3BCUA 5DCUA 2YJ4A 3PR2B 5FUQA 3QJYA 2IYZA 3DMRA 1I7SB 1JJAA 1HI9A 4JEHA 4LUCA 4G1FA 3CUVA 5DBGA 1T1SA 4HDAA 2HPAA 3LBHA 1CUBA 4KQCA 5FPYA 4HEA6 4P32A 3TOXA 4KQEA 2ZT6A 3ONEA 1H8HD 1VIAA 3WLFA 3AH8A 2FEWB 4R81A 3MAGA 1E8NA 1M2WA 4K05A 1YC2A 4MS3A 3NBZC 4AS2A 5CIYA 3ZWQA 4DV5B 1PGQA 4GUAA 5EHIA 3QX9A 3ZGOA 1TUEA 4P54A 1W4ZA 3CR8A 4NZOA 2GD2A 4B76A 5KNDD 2OL4A 4JEIA 1D6SA 2MSKA 3MF4A 4RY2A 2QNIA 5DCWA 3FZEA 5JATA 4KVAA 4RSHA 4PXYA 1KYIA 1SD2A 3SF0A 1XQ1A 5I7VA 2F8SA 1Q2XA 4BEWA 3CWQA 4KGXA 2YIVX 3D7MA 1S2NA 4E5YA 1KK1A 3BWBA 1XEWY 4HLUA 4I5IA 3HS3A 3UJAA 2QUHA 1SQSA 3DUWA 1DBRA 3VAZA 2DWUA 1TYDE 1IH8A 2GSDA 2YXPX 3FZGA 2B78A 2ZQ5A 1EA5A 3X2EA 1GSIA 4XCXA 1DGQA 2JJYA 3C3JA 3PDIB 3HJTA 2G70A 4R2HA 3UT0A 2CHUA 4P36A 5AKHA 1PL0A 2VIIA 2GSWA 2ZI3A 1TUGA 1LF0A 3ABSB 2JLWA 2JGLA 2OYSA 4N65A 3S27A 3KLOA 4LTMA 4PZEA 4BTEA 3P4YA 3R5SA 4N7MA 5SICE 1YR8A 2PX4A 3HY3A 4P5EA 1FS6A 4I1VA 4KC0A 4PC3A 5HJEA 2JBAA 2WKQA 1LDMA 2VJAA 3IDQA 1MOZA 2WT8A 5GADl 2VBGA 3FFAA 4J0EA 4UDYX 3BD7A 4IYJA 3TINA 4A4DA 3QK7A 1X7XA 2IW3A 3TI9A 1BKSB 2J0QA 4OJMX 3FNIA 3LYHA 1RHQA 4JLPA 2D00A 1TAHA 2JGRA 1U81A 5JALA 5EE1A 5TMBA 1GU7A 1ZR4A 3FR7A 1R4ZA 3C70A 3CKLA 1K0FA 3ZJ5A 3EWSA 5JRZA 3K70D 2C2ZA 1LCIA 2CNBA 3N8IA 1II8A 4J76A 2P75A 5AW8A 3DZBA 4RHUA 4J7AA 1SOAA 3BB1A 2VZEA 5DN6A 1BXGA 2GFQA 2ZI6A 2CLLB 4NMMA 1Y8AA 4H7EA 2GM9A 2LRHA 3PQ3A 3SS8A 2WHQA 2WVHA 3C16C 2ONZA 2P9HA 3W2EA 5A03A 1N2IA 2PYDA 1EP2B 3N8GA 1Z88A 2EXXA 3IDZA 2ZWOA 2VXYA 4KVZA 1EUDA 1EX9A 1T2NA 2J9FA 3AV0B 3H13A 4IINA 5ADVA 4FFVA 5JH7B 3PIRA 3PLRA 3CLRD 4ZYLA 5BV8A 2G77B 4FFPA 2DR0A 3JAMA 2CHVA 1YZKA 3HZRA 3CEHA 1XMXA 2HI0A 5ABPA 1FRQA 5J4VA 2P9JA 4BNJA 1F8GA 4GICA 1THTA 1JJBA 4H7PA 4BNDB 4E5VA 3KKKA 5JJIA 4COBA 1SWWA 1FRNA 2O57A 4O2AF 1R0KA 1OAAA 1XNHA 2QTBA 3G59A 5JCOC 3B3JA 4RMJA 2Z9DA 5H1YA 2PZAA 4RPGA 4HNVA 1U6IA 5JXGA 1Q1QA 3K9FC 4KR6A 1W2WB 4KDRA 4OOFA 3FWHA 1KFKB 2GT1A 5CTAA 4GC5A 4E5DA 5IEJA 2UYCA 4JBLA 5KNDH 2PGOA 3L06A 4PAQA 2HNAA 1OAOC 3R7WB 3KV3O 4HATA 2Y6VA 4XWTA 3SXUA 1JYSA 3FFTA 4MHOA 3DFUA 1Q7GA 1P4JA 2OLJA 3ETDA 1SXJA 2FPRA 4QDXA 3UFBA 5BT8A 1E2PA 3GLHB 1N36B 4TYWA 5DLYA 5HCIA 4LVOA 4QTXA 3WWYA 4OC1A 2E85A 4C4ZA 4OA5A 4JGGA 4RLQA 1WMBA 2FRXA 3IJ5A 5ILQA 5BSEA 3S2SA 2W4QA 3O4FA 1RKQA 4MI9A 2OYRA 4F6RA 2PRJA 3QPDA 2IPOA 2QLLA 3L7CA 4Y9UA 4ZU6X 3LXXA 3SBEA 3T7RA 1ZW6A 3HJHA 4BO4A 4E2ZA 4C30A 1M6HA 2O5CA 3S4YA 3EQ9A 3I04A 3ZGYA 2CE7A 3BIWA 2WR8A 2J5XA 1HUQA 4MS3B 5CURA 3L82B 1EMDA 1M1XB 2OXIA 1SA0B 1RAAA 2OHXA 3P8ZA 3QIAA 4MUKA 3IQXA 4QDKA 5IDYA 1PBTA 4Z9FA 2REQA 1JHDA 1KSHA 2YXLA 3DMTA 4JI1B 4WZBE 1Z15A 3R5HA 4US2R 1T5BA 1UC4B 2V9CA 4P5DA 1CY8A 3MJDA 3DEIA 3TW4A 5JZMA 1NP3A 2UVQA 2DLNA 4MB0A 4KGVA 4D97A 2F55A 2BFNA 2W6CX 1U8TA 5IAGA 3NATA 4G5QA 4GGMX 4OP3A 2ZFUA 5CEEA 5DM60 5HZMA 1A9XA 3ZVLA 1OIXA 4RYDA 2XGSA 3U6KA 1Z56C 4FN4A 4CN8A 1Y7IA 1OT3A 1VB3A 3VU8A 1QG6A 2QVGA 2XMSA 5JYCA 1XA3A 2UZ3A 1GKKA 4QEKA 4JI8B 5AKGA 3SFZA 1G1AA 3ZHYA 1X80B 1GRVA 4IV0A 1QSGA 1V8ZA 3LU1A 3AOGA 4G37A 4MGEA 1ZGBA 2JVKA 2DFTA 1T4MA 2EW2A 2R7AA 4HDCA 4QARA 4Y18A 1YRQA 2XBMA 4Q9LA 3IYLW 3L1KA 4FVTA 4TMWA 1CNMA 1RE1A 1YWGO 2JIZD 2VP3A 2DC1A 3AR6A 3C5EA 2B1GA 2GRJA 4YA6A 1NI4B 1T9AA 4Q93A 5FH9A 1WOMA 4DLWA 4ZQFA 1FY2A 3R20A 4MR7A 3RSFA 1V35A 3S9MA 9LDBA 2ZIAA 3H9EO 1JJFA 2PUWA 2W37A 4JP3A 4LI0A 5FDFA 5E0OA 3MM4A 3BREA 3RC7A 2JLZA 3OFVA 5JT1A 4EK9A 3MJCA 5K0CA 2XXJA 1TIBA 3GD7A 1RXCA 3SYMA 2DKOA 4N3BA 5IS2A 1XTUA 1MA0A 3H87A 1TVMA 4CCYB 1D0SA 1T4CA 3AYZB 2Q4OA 2INGX 2QJTA 1QWOA 2WTEA 4J3FA 4Q3OA 1UJCA 3QX7A 3TB6A 3AP1A 1E58A 2J3KA 3DVAA 4OBBA 1ADJA 4C88A 1VBMA 1TQ4A 2BLLA 2I6XA 4CR8A 4NVRA 1WF3A 1UZLA 5FOVA 3ZH9B 4BUZA 4RE5A 1CY4A 2ODBA 3LUCA 4QYIA 3R3HA 1GOTA 4P44A 2NU8B 1MB4A 4EX6A 1M66A 1VIVA 4KBYA 4KRXA 5CVTA 2CV1A 1NKTA 2CLEB 3KKMA 3CN7A 2C4UA 3DBOB 1A97A 4MB6A 3QOFA 5C8YF 1XTKA 2DBRA 2XYHA 1PVDA 1FLNA 3RAEC 1PZFA 13PKA 3PI6A 2O50A 3FHOA 5C32A 1IB6A 1SM4A 1XHEA 1Z7BA 2GPNA 4FGSA 1QQ6A 2O0HA 1WZCA 2IHJA 1K75A 5I9IA 1HTTA 4WDQA 1QYRA 2XB2A 4GKVA 1CT9A 4RNDB 2VQSA 3AVXA 1QYVA 2PVWA 3LX6A 3PC7A 4RQBA 4ZOEA 5E3HA 3WLKX 4IUBS 1GZDA 1OTHA 3EASA 2JDID 2BW0A 3PFIA 3SWWA 5GINE 1TT7A 1X1TA 1GTMA 1PQYA 4TWIA 3EVCA 3LG2A 4MI3A 1W88A 1BGWA 2PSHA 3WZLA 4XDYA 3AEUB 4XM2A 2F8MA 1AHHA 4H1VA 3B2QA 5HDBB 2VA8A 4GZ6A 1FNDA 4L4UA 3GJQA 4ACAA 1W1IA 4UATA 1L4LA 1XWFA 4LBVA 3ANYB 4RK4A 3SXUB 4IVRA 3T12A 1KGDA 3GUCA 3QW4B 3W04A 4M8NE 1IWOA 2HK6A 1PTJC 1KBQA 1Z0AA 3UN1A 3A36A 4OUDB 4RW0A 5ADWA 1YUMA 1BWQA 4NMXB 4YMIA 4Y2VA 3STTA 4GKAA 1SZDA 2ZJOA 5EJIA 1GARA 4D43A 1TM1E 2XUGA 1J4AA 4KN9S 3ORQA 5K0SA 4B9AA 1Q3KA 3ODGA 3UMRA 2EWVA 3NIBA 1U7DA 1RIIA 5LPNA 3LIIA 2EZAA 2FGKA 2R5NA 1CE8B 1KEWA 1WVMA 1R4MA 2AJ8A 1W47A 2ZS7A 3EF1A 3BK7A 3FF4A 3KQMA 3O73A 4Y1FA 1ZVMA 3OZBA 1JMVA 1AJEA 2WNHA 5TGZA 2O8CA 5JW6A 2D8MA 3NALA 3HCOA 4G0VA 2AQIA 5EHNA 3DTVD 2P90A 3IQZA 5FO0A 2C8JA 5A4IS 4CLOA 4I9UA 1X7ZB 1HV8A 4WBNB 5K0FA 3T1TA 1TM7E 2VBCA 3O8RA 1CS4C 1GFIA 1P73A 3OI7A 1Z74A 3JQEA 3STVA 1RFGE 4KI0A 4UEJA 4IZIA 4CL8A 1J3LA 4IDCA 4H6PA 5HRAA 1EGQA 4EZIA 5JAOA 2YWXA 2XIJA 5ALNA 4JT2A 3MBOA 4BBPA 2GN4A 2E55A 3I4CA 3OUUA 4E1BA 2B7CA 1T2AA 3A3PA 3MB5A 4CV2A 3SBDA 4KNGE 1THZA 4GRDA 3T61A 2JZNA 3RUIA 5AKYA 3GT0A 4B75A 4FXOA 2PRIA 3IQEA 3IPRA 2UUBB 1KRHA 1LPOA 3D6JA 1BRTA 2O4CA 1DUVG 4NFLA 4OVKA 1K6IA 4ZVNA 4UBLA 4WEQA 1ZRHA 1JDBC 3VR2D 3ZUGA 1GA1A 2ZYVX 2C1EA 2FUEA 1J07A 1KARA 2IYOA 5EJAA 4J6EA 4ZOLF 3WWCA 4C22A 1P1HA 2DM6A 2VOJA 5K6RA 1OMOA 2FU5C 4IFIA 4X44A 3WOVA 1Z22A 3NNNA 3QBEA 2E2WA 2I71A 4RLFA 5B4VA 4ASUA 3H0CA 1RHRA 4U1RA 4B3IA 2TMKA 4E03A 4NBVA 3TQIA 1TTHA 3OPVA 4G26A 5BSRA 2AT1A 4MR7B 4RTKA 4AMBA 1P62B 4K1LA 3GEHA 3ANSA 1ESMA 3N6XA 1VC2A 1I1HA 4MVJP 4CG0A 5LOVF 1PNRA 2OHFA 2W9XA 3N0VA 3G9XA 1XDWA 2D7CA 3EGOA 3SXJA 1KAGA 4K9SA 3KJIA 1I2AA 1K8YB 1RCFA 1RMYA 3CNNA 4D4GA 4OXYA 1E5XA 5CYFA 1E4EA 4Q9AA 1E60A 3ZHOA 4F38A 5EUCA 5B64A 5C7OO 4JKYA 5LXTA 1XU9A 5C4GB 1UDWA 3ACCA 1EBFA 1JI3A 4QRHA 1HYEA 3I74A 3R3UA 3KUKA 2QSYA 1H3EA 4FIDA 2GCNA 4GOND 3P2OA 2HXGA 5KWIA 3W9SA 1IPEA 2D8AA 4RJKA 2WWFA 5EKUA 3TTWA 1B14A 3V1YA 4QYIB 2BONA 2I3ZA 3UMMA 2HFKA 2IW1A 3EIOA 3TNJA 3U17A 1NG1A 3RBAA 4UXJA 3TECE 3VPDA 4X85A 4HLQB 1W46A 3EVFA 3JQ8B 2SCUB 5IRCD 1N34B 4M7PA 4MCJA 4R2MA 2EX0A 3RBXA 1W4RA 3ZCSA 4BMVA 4C7OA 1R0BA 1ETUA 2HIGA 4JR0A 3JV7A 4BO9A 1KOGA 2QM7A 4U3JB 1HQDA 4ER0A 2IFTA 3T9AA 2CJYA 3CVVA 1KEUA 5ALFA 4TKUA 2DQSA 4JP5A 3IGFA 2HU7A 2XWQA 3UAYA 1QQTA 2IEBA 4B73A 5KTYA 3Q85A 1TJPB 3TUZC 2VK8A 4BQRA 1Y3FE 3D6AA 3A4LA 5TY0A 1AQYA 5IARA 2QRMA 3ZE8A 5BVHA 2XJ9A 4M1ZA 2VHUA 2Y1CA 3V7WA 2I3GA 5LFAA 3DE7X 2GKOA 3COYA 1T9HA 1WQ1R 4P4SB 4NE2A 5E7MA 3IV7A 3T7EA 3CH7A 5K4HA 2NU6B 4WGGA 4EW1A 5LUAA 4W8HA 3CJTA 1R0SA 1IXRC 3GLGA 3MGCA 3I83A 4XIGS 3K9NA 2CYAA 2FZGA 1Q92A 3PD7A 1KTIA 2WK1A 1T1JA 1YI0A 4LZAA 3RKUA 4A8JA 1KJNA 4OQDA 3FCOA 3FYSA 2Q9AA 5JYBA 1VDMA 3FH0A 5E3IA 4PLVA 3UH0A 5EESA 1NXXA 2OVBA 4IIJA 1GIAA 2PS3A 2XV1A 2W6OA 1FIUA 4I81A 1YKGA 3GROA 3L8GA 2WINI 4KUHA 4Q1VA 4KPGA 1QGED 3GD5A 3KLMX 4LXYA 1IVNA 1NVFA 3L8YA 4P84A 4XCQA 3S9NA 5IDVA 3F8SA 3BGSA 3O3OB 1N7JA 4NOLA 2QV7A 1MA3A 5SZIA 5JYEA 1GTZA 1OXMA 2C07A 1PKEA 1CJSA 2RGXA 3ET5A 3N0XA 1BOOA 4X3CA 3WAGA 2D7DA 2JEYA 4NC9A 2R7LA 2PANA 3F47A 3FVWA 3T54A 5BVGB 2HQ1A 3KT0A 1I3OA 4RQUA 3HWWA 3U09A 3WAJA 4AMGA 4FYIA 3VDMA 3KB6A 2GN1A 3FYTA 3ZK8A 4NFYA 2UDPA 3D3KA 2QN2A 2WUVA 5JD4A 2OR4A 5AVTA 1TZ2A 2O8CB 4KITB 4U7GA 3L2OB 1N2XA 3WZ2A 3P9CA 1NR7A 1OV6A 4FT2A 4LF5B 3C1AA 2I7CA 1ISSA 2V97A 1JHQA 1PF7E 4FI3F 2C57A 5CRIA 1IOVA 1G16A 1QHYA 1F8YA 2GO7A 5JS6A 3SQXA 2QTCA 4FCWA 4D82A 4H7KA 5LUBA 2FW0A 3GRUA 1S2MA 1NF8A 1COWA 2XAAA 4RMHA 3SC6A 3ZGVA 4RF5A 1N0VC 3VI4B 2JW5A 2XQIA 1DC5A 4RAOA 4EKDA 1T36A 5IZCA 2PL5A 1Y9ZA 3CF6R 3DT6A 3JZFA 1EVQA 3JSAA 4RPJA 1QBGA 3C97A 5LA6A 2G9NA 5BNTA 1PHRA 3V8RA 3R2JA 3TR6A 1N2CE 4NBKA 3KSBC 1E7RA 4MTLA 1JAHA 2RJOA 3OT1B 1B6GA 1J8MF 4TLMB 5J5CA 2LDXA 2AEJA 1P18A 2GKGA 4FZ5A 3BGWA 1MKYA 2BGUA 2DBQA 2K87A 2AEFA 3X1XA 3RSOA 3GRCA 4I4CA 3RTEA 4YMUA 3MTJA 2XQFA 5CDTA 1N2OA 4POAA 1ZISA 5ARBA 2Z8YM 2BH2A 2BEUA 1OLOA 1A50B 2QPTA 5AKEA 1X0VA 1L9XA 4S0XA 4ZVLA 3SJAA 5KX5F 1XJQA 3OG9A 4JB8A 1H3NA 4I8XA 4IS2A 3UJ3X 2B0AA 2WDPA 4K9DA 3WIDA 2AN9A 1NSYA 1Q1NA 1JWLA 4TWBA 3RVDA 2HHHB 4N3AA 5TF0A 2GP4A 3RFVA 4UASA 1LX7A 5ESDA 3CN9A 4AJ9A 2RGYA 1XA0A 5P21A 3EFHA 3RAGA 3GEDA 4A5SA 3N2YA 2JRLA 3SP1A 1OB2A 2NZUG 1YS7A 1C9JA 1XU4A 4KBFA 2Q3FA 2J45A 2YIMA 4WZBA 4AX8A 1QIGA 4UZFA 2OG1A 5K8UA 3H4IA 1FSFA 3TWOA 1NW9B 1B15A 1QYDA 3B1VA 3SQDA 3W5JA 4KVFA 3ZE7A 4BNIA 3ZCQA 4L08A 1K98A 5KTTA 3ICOA 3UG7A 2GEUA 5I4KA 2HCFA 1QR2A 3FRJA 2ORIA 3DLTA 3KNZA 3M1YA 3PGLA 4GBGA 4J0DA 1KAMA 4JSRA 2IODA 3UV7A 4HV4A 3BH7A 2D54A 2HQSA 4AG5A 4LPKA 4YQYA 1XDBA 3PSAA 2O7VA 1MB2A 1QC5A 4RZSA 1HBJA 4LC1A 4M6WA 1NJ1A 4EY7A 5F1PA 3W90A 5AOCA 1PZNA 3UKJA 4EARA 4MKRA 3M9XA 4OEHA 4MUJA 4CLXA 5JDIC 2XMBA 1MRSA 2YZKA 3ANXA 3OU6A 5A5GA 3CTPA 1B8VA 1JSXA 1WQ4A 4RTPA 1W85B 2PNFA 5HF9A 4UMFA 5GIOE 2RHTA 1IBSA 1JEJA 2FN8A 4RMNA 5DWDA 4GUDA 2CK3A 2X8JA 5D1HA 1TTQB 2HA5A 1PNOA 5LWQA 4QRDA 4K9LA 2R1UA 4GT1A 2BZ1A 2XE4A 3FMPB 3KFVA 5A0FA 1PZHA 2YVQA 3I45A 4KH1A 1SOWA 3T3OA 2WG0A 5ALPA 3G1UA 1YDGA 3A6EA 3U1BA 3AO0B 3G0IA 1U2GC 3AFIA 2ONKA 2DHRA 3Q8LA 3MJTA 4X8MA 1HDRA 3NV7A 2ORYA 5LN1A 1RACA 3RFFA 3X1KA 4QQNA 2PRYA 1PNVA 1SCUA 4BVFA 3NOVA 5FBRB 2UZAA 4P4NA 2QX9A 1F4PA 3F49S 1S0UA 3FG9A 3L8DA 3KOZA 2JL1A 4FDLA 2FW8A 1AUXA 4LQCA 4P81A 5GGXA 4V1CA 3WSWA 5DRYA 2R7KA 1DXOA 4A5OA 1JMKC 1XDSA 1FNCA 2FSSA 2QTZA 4LC0A 5KNLA 2W22A 2ERXA 1HNZB 3QEMB 4GLOA 4MICA 3W6NA 2G4VA 5HZHA 1ZGAA 4MIOA 1CZNA 2PL3A 3IAS6 3O92A 1MQSA 1K97A 4NCHA 4EF4A 2DR2A 1UQRA 2CV2A 5FLKA 1PT8A 3NZEA 4M1MA 2C8VA 4YP1A 1F7UA 1GL9B 4C9UA 4PRKA 4EABA 2HMWA 5B1HA 2BSXA 3DONA 2I5PO 2EFCB 4PR3A 2ANBA 4KQHA 1A8UA 3OEWA 3IHWA 2Q6TA 4C04A 1Q11A 1WG8A 2XB4A 1Z4JA 5CEFA 2BEWA 3A05A 1IXYA 4B4VA 2YNMD 5IUNC 4C6TA 5DSXA 4QUEA 4IEEA 2F43A 1H69A 4WESA 4B6EA 1TM5E 3G1TA 3ABRB 3ICEA 3WKCA 4B5LA 1DS6A 4G0NA 1OFGA 4R0NA 1Y8ZA 1OFUA 3GQBA 2ZJZA 4MUIA 1PUXA 3RVOA 4WRRA 1RYBA 2W48A 4UQLA 4RACA 2EGGA 4X91A 4JH0A 4U7DA 4UMVA 3TBKA 5LZ4A 3LK6A 1UXHA 3AVQA 2Z6UA 2HW8A 3HR8A 3W05A 3QWFA 5H83A 1T0PA 1GA4A 1A0OA 2Q1XA 2L18A 3ZXXA 1K8QA 1MOPA 4F8YA 1TLFA 3RVNA 4U2EA 3NBAA 2X3YA 3DBHB 2QM3A 2X2PA 1TLLA 1Y5IA 1G2QA 4WZAE 1VMKA 2V7UA 4RD0A 1GVNB 4P33A 2C7RA 1WTAA 4PNPA 4YCNA 3GJ5A 3N2KB 4FGJA 3ZTYA 2JANA 3SEQA 3NEPX 5BW5A 2SKCA 4P7KA 1YA8A 4KSCA 2NU9B 5HTKA 4QECA 2PU5A 1C81A 2Q3HA 4Y6LA 3VNQA 3WGMA 4C4SA 1TJ3A 2NVWA 4ZMSA 2A9JA 3EZ7A 4C89A 3ZIAA 4JLBA 1XPOA 1HWYA 4QBFA 1JVSA 2AFHE 1GPLA 3VR4D 3A4IA 2VP4A 4KU4A 1WMSA 3CZQA 4WZBB 1L5LA 2ATEA 1ODTC 3O7WA 1BC5A 5EERA 1CFJA 4O08A 3QXHA 3Q3CA 4GO1A 4CLDA 1IY1A 2R2GA 1AURA 2FQQA 2RCYA 1BE0A 4UAJA 5FL7D 3U9LA 2OK7A 4W7HA 4ESOA 1AUOA 1QWSA 5JJ5A 4NDZA 1PJ3A 1EJ6A 1K8ZB 4MMZB 3WHPA 2P8SA 2D62A 4Q1EA 2QQ5A 4YAFA 1S4MA 4X1KB 2O0JA 2VDNB 3T3GA 2Q3EA 1P0MA 1YI1A 3ZWXA 2FGJA 1OUMA 3DDZX 1QP4A 4IMPA 5M7EA 3A4YA 4PPGA 3T99A 3ZQJA 2EP5A 2Y6UA 1SBHA 1O4WA 221PA 4N18A 4LZLA 2CVZA 5ULLA 3OUZA 4XB1A 3AG5A 3RE1A 4MWZA 4TQ9A 4CFYA 2JHPA 3GNLA 5EWJB 3WRYC 2FZ4A 3NBKA 3U9TA 4F9GA 1J22A 4ID3A 1BGVA 4PCLA 3S2GA 1TL7C 1R0ZA 2XUAA 4WDRA 3ZS9A 3KBBA 5SZKB 3NVDA 1SVWA 3E7FA 4J16C 5AW4A 4DV1B 3SX4A 3KVVA 3P4UA 3B89A 3DWFA 4XTRA 4C87A 4TYNA 1Y48E 2BEVA 3LCCA 5HE9A 1ATIA 2AQHA 3EGVA 4MQ4A 3SD7A 4I2NA 4ZD6A 4JLDA 1X0XA 4NQRA 3WYEA 3JD2A 5K45A 1KBLA 1FDSA 3CNHA 2VA9A 3KM0A 3PHJA 4HK4A 4YJ3B 5J2UA 3EVTA 3U44A 3QVOA 1LS6A 3K0AB 3NTVA 4RULA 5FP0A 4DSNA 1TC1A 1YMQA 3C3CA 3PQ4A 3TAUA 4RZ3A 4U9IS 1U99A 1RRFA 2QK4A 2WE8A 2DLCX 2XQKA 3W34A 2HYIC 4JJAA 2ZSDA 1Z5GA 4W4TA 4YAJA 2A7XA 2HQBA 1VSUA 2POCA 5IXSA 4M38A 1A04A 3GLRA 3QU7A 1SB9A 1CF9A 5TVGA 1DLIA 3SVTA 4HNAB 5HS4A 3IODA 3QQ5A 2CXQA 1UBEA 4HL6A 4HEHA 5EKTA 7YASA 1Y9AA 2Y1DA 3TNFA 2NSDA 2BFAA 1Q20A 4L4RA 4CTOA 2LNDA 2W00A 4OHMA 3H1EA 4Q9JA 5EINA 1RRVA 1T1RA 1T6NA 4HVAA 4MZDA 1RWNA 3RIYA 5JQGF 4JLJA 1MQ9A 1NQVA 3E7XA 4WAUA 3RHSA 3WIVA 4FE7A 4BJ5A 4RVHA 4EJMA 1AGYA 1IAVA 2HMUA 2Q9BA 4FCTA 5LLTA 3JD3A 3G5UA 3VX4A 1E3EA 1G5QA 1NHGA 1TEXA 1RQNA 4MMYB 4N12A 3TLGB 4C0HA 1WU8A 4CQLB 4DLYA 3BMOA 4C84A 3JQAA 2BFCA 3N3BC 3QVJA 4WESB 4D9MA 1ECLA 1P39A 1MENA 1Z8DA 2XADA 3IC5A 2CMHA 3KWJA 1LPMA 2MYUA 4BIMA 4YT2A 1SXPA 4M36A 1AF4A 1TB4A 1E4VA 3ZV7A 5CU7A 1L4GA 3QYAA 1YJ5A 3VR4H 3FPEA 2ZU0C 3N59A 2FX2A 2OQIA 1Z35A 1M8FA 1PT6A 4XQCA 5T4BA 4LV5B 3QFFA 4X9XA 1BEEA 1TW3A 3KPVA 3Q3HA 5DNDA 3A9VA 3FLMA 1EHCA 1JIIA 2CNWD 1P5FA 3DL4A 3DQPA 4JDUA 4KN5A 4OHVA 4RQAA 1QHHB 2JIDA 5TB5A 4X90A 4CM1A 1RRPA 2NXEA 4CZ1A 3B6KA 5K3SA 3TR5A 2NWQA 3ZGXA 4EKNB 3CPHA 3QITA 1ZIPA 1GNLA 2XNSA 1TVKA 5JWRA 2VF2A 3I2FA 4JFAA 3TSZA 5AHXA 3WYFA 3WLSA 3EBPA 3ST7A 4ENSA 1QYCA 1W93A 3ER8A 1RCUA 3GN1A 2VCEA 1KSFX 1RAEA 2IVZA 2WIJA 3BXZA 3OSZA 5KSOA 1KI6B 3DOHA 4PVDA 4IGIA 1NQ5A 1G64A 2TS1A 1NBMD 4XB6B 5D51S 2W2LD 5ALTA 1N4AA 1UC5B 2NQTA 1A9QA 1R12A 3GPIA 3K73O 4N82A 3OM0A 4WY8A 4D9JA 4MWDA 5BURA 1V3VA 2RHJA 3QY9A 1TO1E 2GZ1A 3I92A 4HHEA 3V7NA 4FZJA 5LP6F 3KFXA 4JLOA 2JATA 4WN9B 1AKTA 5C0OE 4DA0A 3S8EA 5FOWA 3CVUA 3MIZA 4QLBA 3FLEA 1YJXA 2UZ4A 2Z9CA 1JDEA 1QK3A 5MHTA 4JVNA 4HAYA 1JA0A 2QGNA 5BXYA 4RTOA 1NASA 3G7NA 4IDAA 5GM1A 3BQMB 4BMXA 1DIBA 3BCHA 4YY3B 4OQ4A 1QGYA 1SQFA 3O03A 3AF4A 2QRPA 4ZT7A 5LYJB 4L9SA 1GZUA 721PA 3TCNA 1K9VF 1XRQA 1JU9A 1QYXA 2NNLD 3R5TA 1Z17A 5ERXA 3UTDA 2J4CA 2Y99A 4NPHA 2VLIA 4YIKA 3KUCA 5LDGA 3OU7A 2OAEA 3PE4A 5FKJA 2YZMA 3G2KA 2BHTA 2BEVB 4CIYA 1EEHA 4WK6A 1KJQA 2CHQA 3EXIA 1NVMB 1RQXA 1N25A 2CCJA 3WO1A 1ANKA 3KYCB 2YFKA 1T8YA 2GCPA 1EDZA 2R6HA 4I5EA 4PPNA 4QODA 4A0SA 1JR6A 1TRKA 5G2OA 3W06A 2H9AA 4NS4A 5CNJA 1KDVA 2C03A 3EMKA 1WCYA 3H4MA 4TWJA 1N0HA 1ZIYA 2PSJA 2X2FA 3HB4X 1M2EA 4YI5A 4NGQA 3PNPA 3F7MA 1POWA 1CULC 3LPCA 2ZBQA 1GCOA 4ZT5A 1KE1A 2BGIA 1J0EA 1IRIA 3CLTD 4LYAA 4I9HA 4OHCA 5HJ7A 2GPSA 2DHQA 3FB1A 1J8DA 1KORA 3FYUA 4W5OA 4KO3S 2ODQA 2XPCA 4P4EA 1F8UA 1XRPA 4LOLA 4LRQA 5G0UA 5B3JA 4F06A 4CM4A 3BC1A 4OFWA 2NW6A 5AKZA 3O2JA 3U56A 2Z57A 1V4VA 3ZKAA 3GX1A 4J4TA 2C2OA 2FWJA 2EF1A 3EZLA 1KO4A 2CNKA 3G8YA 2DTEA 1DSSG 1VL0A 1LLFA 3D4PA 3L6EA 5ALKA 3LPLA 3RS9A 1E94E 3BDVA 4MUNA 3KE9A 1NQWA 5IJ9A 1INLA 1DTWA 1DC3A 1MVLA 3O4RA 5KSYA 4J91A 1RRMA 2MCFA 4O4LF 1DKUA 1M3SA 3DCYA 2ECKA 1DAMA 1N0IA 3DTNA 1G4UR 3PC8A 4LBZA 3PGVA 5CVCA 2R48A 5EWMA 1J25A 1OFUX 3FUUA 1EGAA 3G6WA 3FPLA 3CT4A 3LWDA 4B74A 1NVGA 3OT5A 3GVXA 1JBEA 2W71A 3R3WA 1MW9X 4OXIA 1T43A 4JUCA 5C31A 3SVZA 5LSAA 1EM8B 2A1TR 1FNBA 4WADA 4XSVA 1XUOA 2B83A 3ZI4A 5HQTA 1SCAA 2HMVA 2O07A 1ACLA 2I65A 2J9RA 3B70A 3DAYA 3NFYA 3RRBA 3SLGA 5K8VA 3OJEA 1VMEA 3LT0A 3GELA 4GVPA 3CLKA 1KVUA 2QI9F 4LXIA 4OQZA 2XGJA 1Y7LA 1OV4A 3NYQA 1Z8NA 2L82A 2FKAA 4GH5A 5JH7F 5C46F 5ETJA 4ZCTA 5LVAA 2PH1A 4RVUA 4J0JA 1L1RA 4A6DA 4GP9A 3SKVA 4A26A 2Z5GA 1U9IC 1YONA 3BGVA 1QHXA 3WLLA 4DY6A 1BFDA 3WWPA 1PGJA 2A7QA 3DHWC 5CB8A 2YHSA 2QU8A 1FZQA 1PLKA 1XF9A 1T9DA 2YQ5A 1SBTA 1V1MA 4PBRA 4YJFA 4WCVA 3V1LA 4HFJA 1Y3IA 1C4OA 1U0FA 1YDMA 3V34A 5CFRA 4B4DA 1F5NA 1A8IA 1CJCA 2NUPB 2F3TA 4A91A 4DEYA 4TLDA 4X7MA 2ABWA 1MABB 4TUYB 4Q21A 1IWPB 3PHHA 1JFSA 3OX1A 1H0SA 4YI3A 4EQZA 3PC2A 4Y1EA 4PLFA 2EX1A 1R27A 3RASA 2BHRA 2XIQA 4B34A 1OB5A 3D2BA 3DNFA 4HAUA 4KNWA 2FUKA 1DE0A 1YFKA 2FCAA 2WV9A 4L6IA 3D31A 3LWBA 2HPHA 1L1FA 1JW9B 3DE5X 3Q7SA 5JVLA 1E2UA 4PE5B 5AM3A 1D2HA 2Y9PB 1M6WA 1GHTA 4Y2PA 5ER9A 5IULC 3FBWA 3OIGA 5CIQA 3C7TA 4A7PA 4CF4A 2O1EA 4DMKA 4ABTA 1AKRA 2XF2A 1DHTA 2IKSA 2IYNA 3CNBA 4XJXA 4YACA 2XTAA 2VKTA 4FNOA 2G25A 2OBFA 3A1CA 1C3OA 4JLAA 2A9KA 1FE8A 3Q2KA 5IVDA 3O4HA 2FW1A 3RO7A 5CG2A 5JUWA 4LXTA 4A8TA 4ESVA 2FMIA 2HMSA 4IV5A 1N2CB 4X3PA 3NP9A 1ZDMA 3D1VA 5IAAA 1X8KA 3QLUC 5F3RA 2O1XA 3WFIA 4MW6A 4OOEA 3AJ8A 5HMLA 3W2GA 4U2KA 1JYFA 5HNKA 2OCKA 3V4OA 5HOQA 2GH1A 2VEDA 3F6RA 4I8IA 2HX1A 3BCRA 1DO2A 3ILSA 4C8UA 2RHDA 1T1GA 1P0CA 1YASA 3ISJA 3K6JA 1GR0A 4OU5A 4TX1A 1NMSA 3U4CA 1E9FA 4Q05A 3BRWD 4WFJA 5IAKA 3EEIA 4ENVA 3FOFC 3D6NB 1ODFA 1F2UB 3H5AA 2FJUA 2XB6A 4KK3A 4XUEA 4NMHA 1YBMA 1FJ2A 2G28A 3LUGA 1Q14A 4I99A 1Q17A 4LCEA 4Q3DA 4QSMA 2YCLA 3AY7A 2PX2A 5DB4A 4DR4B 2X7HA 3PSHA 4TZ6A 3IPLA 3TTVA 3ZLVA 1TMYA 2PMFA 3FXAA 2VI5A 4YRLA 5IDXA 2OK8A 1TQHA 3DE1X 4PAGA 3X1MA 2XYGA 4K6FA 3UCEA 3RRMA 4PLYA 2J5KA 3FYUB 3N87A 2GVDC 2DQZA 3OECA 4IDPA 3L7IA 2VBIA 1V2GA 5G0SA 5BOSB 4C4TA 2J67A 5FTJA 3PUVA 4NG5A 1LNSA 4FLEA 1MIHA 2A88A 4IXTA 5AWFC 2C5AA 3HMQA 5EE3A 2QUJA 2JJQA 2ZJ0A 3DNMA 4GM0A 4IILA 3S5UA 4Z4QA 4COGA 4O3FA 4NPAA 1TZBA 4R9VA 1FRVA 5JYDA 2QXYA 4R6XA 4F3YA 3REOA 5F52A 1L5NA 1P3DA 4CM8A 3IERA 2HRBA 4BFSA 2FPGA 2EBHX 3UHPA 3SCZA 3HCPA 1K0UA 4GI1A 4EDHA 2I8AA 1GV0A 1UDAA 3BWVA 4BBAA 2G1PA 5BN3A 5L53A 3B5JA 4OD0A 3PICA 2SHKA 4R54A 4UDOA 1ID8A 3ZE1B 2H7CA 2Y1GA 4B1FA 4CMIB 1GDTA 3RCBA 3GA7A 4NLLA 1ISMA 4NENA 3OHMA 3QRWA 5B58C 5IT9A 3QE0A 4PTLA 2ALJA 5FNZA 2ZSFA 3ICQB 2J48A 2WTMA 1KMQA 3D81A 4KZPA 1S7GA 3FKSD 1HE1C 3WB1A 1QVWA 1CBUA 1M54A 2P1DA 3B53X 2V6MA 2QTFA 4GEGA 3R7LA 5FCDA 4CTMA 4QOGA 5A06A 4CFZA 2WF5A 2Z08A 3BVPA 3W4IA 2CC2A 1XAGA 2HRDA 3EPHA 3FPAA 3BJRA 2A4KA 2XJ4A 4HJXA 4QO7A 1CRZA 1ENZA 1I5RA 3CA8A 4F3RA 4M0PA 2XVYA 5KYNA 3WLQA 1DZIA 2OUKA 1W9MA 3W6OA 4FE4A 3IDFA 1KOJA 3H18A 2K4MA 1QRRA 4G97A 4YJFB 1VPEA 2A5JA 2QRJA 2W2OA 2QTTA 3GFFA 4HWRA 3WLPA 1E79D 1CK4A 5KNBD 3CG4A 1NRXA 3O3NB 4R31A 2H3HA 5FNVA 5E0KB 3A9SA 3DEKA 2ZXUA 4PSDA 3B8HA 4X5OA 1RWXA 4D4LA 2WD7A 3GJ0A 1UMKA 3KKNA 3U13A 2FEOA 1VE5A 4O59O 4GI7A 1VL6A 3NASA 1YC5A 2ZJ8A 1Y81A 1NE2A 5EZSA 4OM7A 1D1SA 2AW3A 4JOBA 2YMLA 1T9BA 1QO9A 3WWDA 5U9CA 3ZBQA 2BF4A 3BJMA 2B4RO 4AZSA 2E37A 3CTMA 3CLHA 4U7FA 4EI2A 4CIDA 4KKVA 3DE3X 3AY3A 4DXHA 4HGNA 1WXIA 3KOUA 1I4OA 2IHUA 2VYVD 3M2TA 2NO9A 1U28A 3IEXA 1T15A 4OLHA 1ZM4A 4N03A 1XQ9A 4IQGA 2UYGA 4XTCS 2DHEA 4D9NA 1A72A 3VHLB 2PXHA 3H17A 5JDCA 1VJ0A 1QBKC 4V39A 3TTUA 1GDDA 3W4KA 3M81A 4M8IA 1C9KA 1DAFA 2IJGX 4EA7A 2BDEA 2AV6A 3N6RA 2HU2A 4RXUA 1X39A 2XQJA 1PTKA 3M4XA 1YCHA 4N5HX 4PFKA 1CRLA 1M9NA 2QD1A 5M3BA 1Y4ZA 3W4JA 2IYWA 4WBNF 3DEFA 4HQNA 3B48A 1HO3A 3ZX5A 4HNTA 5IAOA 4WZAB 3GIDA 4TS9A 1WPQA 1YQGA 2D2EA 4ZWNA 5BPHA 5C2JB 2NM0A 2F3RA 2RGNA 3OQIB 3ZDRA 4ZCPA 5JVDB 1GZHB 1TM3E 3C1TA 3FMGA 3WX0A 4EWLA 2F00A 4DQXA 3S28A 1L4MA 4KPEC 4XJVA 2FZLA 1FVHA 4NTZA 2HCBA 3HYNA 3ZBPA 3K6SB 3ZVKA 3FROA 4M9RA 1O77A 3DE0X 1OC2A 4ZKEA 4BZWA 5KNCA 4OJYA 5BMVB 3HBLA 2F1HA 3VZBA 1AU9A 2AFHB 4X64B 2QVBA 1S6YA 1RQLA 3ITKA 2OM6A 3N53A 1K5DA 2QUKA 3IAM1 4ZQBA 5TQJA 3UFXB 3PV0A 3TRKA 3DUFB 1C41A 4U2FA 2NSJA 3TJZA 3SJUA 4OH1A 4KH0A 4DMGA 4DVJA 3W8DA 2X1LA 2YOFA 1J0DA 4LVCA 2IUTA 3Q98A 3OTHA 1ZN9A 1Q83A 2ZBUA 4TKZA 5AI9A 4BFWA 3RRZA 2PD6A 2QMQA 3O8BA 4QTYA 3B51X 1RWPA 3HXOA 2VTDA 4F96A 1F51E 2ZB4A 3B7WA 3MCUA 2Z8ZA 1L1QA 1KE2A 5HRCA 1SAYA 1TF5A 3EWAA 1E2NA 5CIWA 2C59A 3LF2A 3I9FA 2EBWA 1TMOA 2PZ8A 4ILEA 4RDHA 4UJ5A 4RD3A 2F4NA 5U4XA 2ZW9A 3WL4A 2TSYB 4YONB 1G9XA 3LVFO 4BP9A 2DXIA 1ZJZA 5SY6A 4CM8B 1HFWA 2F64A 5KWSA 2VS1A 2GZDA 2FPGB 4OATA 4Q4HA 3CWZA 3LE8A 2I22A 1R66A 4NE7A 1T9KA 2JI4A 2YUIA 4P4UA 5KNBH 5F09A 3BIFA 2AEEA 4JLSA 1PJ2A 2P6OA 2A86A 4PZPA 2DTDA 4JR2A 5BN3B 4BQQA 2YUTA 4DJJA 2IZOA 1BX1A 1BU5A 3WMRA 3DFFA 2B7BA 1KR5A 4I3HA 3HA7A 1O0BA 3IDSA 3KQYA 1JHMA 4HDSB 4QGHA 3ZKWB 1L2TA 4BB0A 3UH1A 5KQLA 3HACA 5L3SB 2BM9A 4W6ZA 1E3WA 4BN0A 1JGTA 4FTWA 5BWBA 4Q7EA 1YULA 4G81A 1AZLA 1DV2A 1MJNA 1VKZA 5THXA 1EFRD 1C29B 1P77A 4RFLA 3RJTA 5A9SA 5J4HA 2HBZA 1TZKA 1VPTA 1U3UA 3N2LA 3QF4B 2X4GA 3VVCA 5C1DA 3EPJA 3MWEA 3OZIA 3BDAA 2YRFA 4MVJD 4MPTA 1M0WA 3MQ4A 3K31A 5HKBA 1QFMA 1FP1D 2OKGA 1NPDA 1G3UA 4HQRA 4WI1A 1GG2A 3B9BA 1M2HA 2K7FA 2CLIB 2B8WA 3LMKA 1BIFA 4MPJA 1HFKA 1EFTA 1TW2A 4OHXA 4MLPA 3OIVA 1D4OA 4C5CA 3N76A 4XPIB 1OGIA 3I12A 4CDGA 3MNFA 4BNLA 4ROSA 2BCGY 4UD2A 1XZCA 5EYPA 1S5PA 1RXIA 4I08A 4DPMA 4IW3B 3VR2A 2ETXA 4Z54A 2VJPA 4IIBA 4A36A 3PDJA 1V8FA 4JS0A 3C3YA 4E13A 4EVRA 5AH0A 5F1KA 1XJCA 4DGSA 2JLSA 2YTZA 4UMDA 1TU4A 2BZGA 3DP7A 1PS8A 1P72A 1XVLA 3B3FA 3KKQA 3MWDA 4L9RA 4II3A 4OQMA 1XZNA 3PVSA 5ES4B 1DEXA 1SXGA 4BKQA 1KYQA 3DQZA 3IBTA 2D2XA 4UU0A 3IXMA 1NXQA 4DA7A 1XLTC 4R1UA 2GYYA 2XYQA 3LLVA 3O38A 4OHUA 4PQFA 2I2FA 2XUOA 3QELA 4MVCA 4AF7A 3DM5A 4ZRNA 4QJ4A 4Q7QA 3C5VA 2VHXA 1IN5A 2VP0A 1CX9B 1EK5A 3BORA 4WECA 4JI4B 1V8DA 3E5NA 3AM5A 4QATA 5GV8A 4C4XA 1R8QA 1YVDA 3ZHTA 2WJIA 2WJJA 1BMDA 3CV3A 4FI3C 3N05A 3JVEA 4JEUA 4MK4A 3CLSC 3TQOA 1ULSA 2RGEA 1YZQA 3RBZA 4DDMA 4DCMA 4MYCA 1DELA 4ND6A 3HADA 3ONFA 1GGJA 3KJGA 1X2BA 1FP4A 4LJ4A 5DI9A 1FFCA 2DWQA 1RJEA 4ZHQB 4Z53A 3NVMB 4Q7LA 5CW1A 3RJ9A 2X6QA 2C9CA 4TMKA 2WBLC 5IJ0B 1I4WA 1RXUA 3LY8A 4BMDA 4H3KB 5HKLA 4ZCQA 5ICFA 3AOEC 3HY4A 3DJYA 3EGXA 1UOOA 4NJOA 4PYKA 4HPWA 4F4IA 4Z1OA 3PNMA 2JBWA 5BQ3A 3A27A 1P6UA 5K05A 1WZ2A 1VIMA 2BY4A 3JQ7B 4ISCA 3MT8A 4QASA 3VYRB 3WSTA 2Q45A 3EC7A 3ZDXB 2J4FA 1VPVA 1N5DA 4DSZA 2V45A 3DA8A 1MX9A 2H4JA 2BZ0A 4BECA 7AT1A 2I78A 4ZIRB 4J2TA 3DLIA 4B3BA 1ZXLA 4OQXA 1T8TA 1KFCB 3WGIA 2K7ZA 4RORA 2BRUA 3Q11A 2AL7A 2Z6QA 1Y6QA 4G1UC 4MV8A 2NVUB 4EB0A 3N2GA 4C8PA 1GAWA 1NTOA 1ONBA 2YWBA 1WB9A 3R0QA 2FDRA 3BMCB 2FMKA 1O9GA 1U2RA 1N1MA 1ZD2P 1KFJB 2CW5A 2PXCA 2VJKA 5I7HA 2HDHA 3RABA 1WNFA 1XALA 1EDBA 3QSYA 1P0FA 4MGHA 4G5HA 1JG4A 3KBOA 4MVJH 1MJ5A 2FSHA 3OIWA 1SXHA 4Y98A 2ZRHA 1CUEA 2IKQA 3AEYA 3EZYA 3KJFA 1U0NA 3WLJA 1VHLA 1G20E 3K09A 2Y1FA 3NANA 2IZ1A 3MTGA 3KD3A 3HVKA 2AZTA 4UZSA 5F78A 2R62A 4W9YA 4LQ4A 1H0KA 3U61B 2VL7A 3MJFA 4HPXB 1OHHD 1YS1X 4MLZA 4HDOB 4NWIA 3WRWA 4AG3A 2YWDA 1Y8RA 1U3WA 5EZ5A 4AUMA 4GR5A 2Z1MA 3OZ7A 4N9WA 4GXQA 1W35A 4QDJA 1K6JA 5TF4A 2HF8A 2ZUUA 2JJ8A 2GOYA 1FDVA 2V4UA 4XJTA 2LUOA 4X7BA 2Q8PA 4RC9A 4RL6A 5BO5A 3SEFA 1E3WB 3AF1A 3T4PA 2F8TA 2EQBA 2YV5A 4ZPJA 3RTBA 3FWYA 1IPFA 3LYAA 3R0XA 1ZXBA 1KPGA 4URFA 1HLGA 1WPGA 2JJ1D 3H5IA 4HRYA 4IZ6A 4Z49A 1ORRA 3P94A 1KK3A 3RIXA 5A9SB 3F6SA 4PO1A 4W9MC 1UAAA 4QBIA 2RC6A 5K01A 2FPXA 4C7MA 2Q9CA 6GPBA 1E2GA 5IVIA 1JVNA 3CUWA 4IICA 1E92A 3BFXA 4EUHA 5JU6A 3EZ6A 3ZI7A 2G63A 2WTUA 3LKZA 1D6JA 1UF9A 2GAFA 5FLEX 4DDUA 4EH1A 1Y6JA 5CBKA 1RZRA 1UBJS 1Y37A 2UZ1A 3DBIA 2JLAA 3ND7A 4P86A 4XQGA 5DHTA 5BYBA 3E9QA 4N9QA 4JLKA 4ARAA 1C7IA 5GVRA 2QR3A 1ZK2A 4EECA 4X6UA 5DHPA 4KQ9A 3PE6A 3D0RA 4HN9A 4M1QA 1JKJA 3O1IC 3WQBA 1ODLA 2BC9A 1T0HB 2K6GA 4C8TA 3WLHA 5KOJB 4MS1B 1R16A 3HWX1 1AA9A 1OLSA 1PZXA 3S1AA 1J33A 2QPAA 5EZYB 4BO3A 2PSDA 3K8YA 1JAYA 3E5MA 2Z2ZA 2ZWPA 2RHMA 1RLMA 2HLHA 2VRWA 3HPRA 1U2DA 3L4JA 2PEYA 1A4RA 4D4IA 1K3UB 4JC4A 4C29A 2D4HA 2OGWA 1AQJA 3E3OA 1TOAA 3PRYA 5ICGA 1LPBB 1T3LA 2CE2X 2CXHA 3R41A 4GI3A 2EGUA 1NVKA 5IUKC 4X94A 4YAOA 3PXBA 1VI5A 2RHGB 2XNKA 2BUCA 3MQ2A 5FD8A 4B79A 2H48A 3QEOA 2J6CA 2GZHA 4E31A 1AN0A 2CL0X 4ZODA 3BS4A 4CV1A 1G21A 1OKKD 2PTHA 3F3YA 2DFPA 3KYDA 5JR3A 4LDPA 4Y0NA 4ENRA 1OZ0A 1Z26A 3M4ZA 4YP5A 1U80A 3MUNA 2YHAA 5KQSA 3IP5A 1O08A 2V55B 4MGYR 4Q3EA 1LK7A 2FPMA 1A4IA 2YMPA 2BJWA 3AC0A 4Z99A 1BTOA 3WYBA 3K0CA 1E3LA 2OXRA 2QM8A 6REQA 5K3BA 4ETIA 1E6KA 5TXGA 2EHDA 1E6EA 1HDXA 3VSAA 1KA9H 1TI7A 3FVTA 4NK5A 3K5PA 4NDNE 2AN4A 3BB4A 1HA3A 1DC8A 4J0HA 1CWUA 4KL8S 3B9PA 3FSGD 3C3KA 1XEAA 1OI7A 1RJ9A 5KYKA 5LQJA 4Y2UA 4MWEA 1CUDA 1PG0A 2W6NA 3HCFA 2GKSA 3GG9A 3OEED 1TMKA 3KPJA 1RXEA 1SRQA 1X7HA 5F73A 4E22A 3GRZA 5FWAA 1MC8A 2J9GA 1MAUA 3EGDB 2XOKA 3CVOA 3D4BA 3P0EA 2ID9A 3IB3A 1JLKA 1N2JA 1K68A 4IOMA 4BCCA 5KTSA 3OAAA 4FXPA 3S3TA 3BXFA 4GL2A 1L5YA 3RFUA 4QXPA 4RD6A 1BKDR 4ZOBA 2GRAA 1RTKA 3UB3A 3QG1A 2D74A 3E2IA 3GRVA 4UHKA 2P2YA 3OPMA 3UJ7A 4ZYZA 4WWHA 2IV2X 4CKYA 3A2KA 5IJWA 3GUUA 1Q1EA 3ABIA 4GG1A 1ZIOA 1VB5A 4H6XA 2F2TA 2PK3A 4QDOA 1RYHA 4EUSA 1I6WA 2P6RA 3EY9A 1CXZA 2X8AA 1YAJA 1OBOA 2KMLA 5C80A 4ZQGA 2FOIA 5AVUA 4Z2YA 5KYGA 2MINB 2NYVA 3BD8A 3LO5A 4AZVA 5LM3A 3GNQA 4L28A 5DULA 1T3SA 1SULA 2VJNA 4J0CA 2OB2A 2J0VA 3ORFA 4LY6A 4AZ3B 3L8FA 5JAZA 2HD4A 3OT4A 1Z4IA 4BJ6A 3AJ9A 1JFRA 2YWRA 2RAFA 3ZLJA 2IS4A 1IOLA 4HBZA 4NZZA 3K1AB 3FDJA 2DJ5A 4OQFA 2C4NA 2IUUA 3RIGA 1OXUA 1QH0A 1K6XA 1XKXA 1Z38A 4FR5A 2EX4A 4LJ5A 1Y6RA 1MQ8B 3HY6A 4X24A 2C92A 1Z9BA 3L3BA 3WLRA 2IITA 2XYPA 4R8SA 2BOVA 4WA8A 2X41A 5I4CA 3OCXA 3SJXA 3PR3A 2OUIA 3ZZ0A 1HDIA 1X1QA 3OLCX 5I9NA 1UH5A 4DLVA 1R9GA 3NG1A 2A30A 4C0JA 5FBVB 4PONA 2FPIB 1SURA 4FEYA 4MR8B 2I4LA 3UAZA 3VR6A 1XZEA 4IMJB 4LYYA 4ER5A 1W48A 1OGJA 1SCKA 2R8OA 3BXXA 2DPLA 2OQVA 1RYZA 4LW8A 4RLHA 4ZARA 2ZYUX 2F90A 3R40A 1AF7A 2PWZA 5LQMA 2UZ1B 2O2HA 2PS9A 5LB4A 3ZH2A 3SM3A 2H0QA 3BJZA 3G17A 2HCTA 4WE3A 1I1QB 2G80A 5DK4A 1M1NA 3GJRA 3ZJUA 1W5FA 1BJKA 4A2QA 2UYYA 4G0YA 5DNWA 2O19A 2QU7A 3EFOA 3Q0TA 4YJ3F 1BHQ1 1CVIA 2Z2JA 1X38A 1C7EA 3ABQB 4TT3A 4TJXA 1OLSB 1JQ3A 1C80A 3FCUB 4O4HA 3RUPA 5JPDA 1XZIA 5CG1A 4AD8A 5CVDA 4WFKA 1HEUA 2ARKA 3EVDA 3OWXA 4QXOA 2V1UA 2JI8A 4G07A 1BMFA 1U9JA 1CC1S 1YB2A 2AEMA 3E8SA 3IALA 4L7VA 3ZHBA 3UT5B 2W43A 5H9VA 4W1QA 1W8DA 4HQ0A 1WDLA 3M6LA 4KX3A 3RTGA 4EG5A 2CVHA 2W6ZA 1VL1A 2Z5FA 3G8DA 1Z28A 4A2PA 4N5LA 1Z75A 4AZ0A 2XHEA 4DJTA 1NC1A 5BY2A 3IQIX 3RYIA 2RGGA 5EFZA 4MRAA 4Z5XA 3PG5A 3U62A 2OCBA 1PS0A 3EGIA 4OI2A 1NR5A 1KKMA 1L6RA 4OXQA 2AKYA 4HRXA 5ERGB 4TWAA 2O2GA 3RRXA 3TUJC 4DWOA 1U98A 1I6KA 2XLBA 3PXGA 1GYRA 1TCUA 4FUQA 4UEQA 4I50A 3UBMA 3IQWA 3KVNA 5AO9A 4YQEA 4C4AA 4CKXA 4G0ZA 3NHYA 3CLTC 1CZOA 2G17A 4Z3DA 3IB6A 2HOQA 1EP9A 1E3IA 1AZTA 1SIOA 4OG2A 1NNEA 3ECSA 3T06B 1VBFA 4EQ6B 3GG2A 1LI5A 2FWMX 2ZRAA 3KOXA 1L7MA 4PLTA 3AIMA 3CX6A 4ALKA 4CUKA 4DWJA 4Z3KA 5FOTA 4BBJA 3OPQA 3OZFA 2ZBFA 3SYLA 4Z4GA 1N3LA 2ZPAA 3FGOA 1XT6A 1ZHFA 3G7UA 1V48A 1Y6ZA 4I0WB 5DYWA 3WV4A 1FQWA 4BNWA 3QWAA 4Z4HA 4UHHA 3NM6B 4MO2A 1KEKA 3FJ1A 4Q3AA 3SHTA 1RLTA 3HXQA 1L7RA 3RYFA 1L4BA 4IKEA 1YK1A 4I9NA 3WB2A 4XCVA 1FXUA 4TV8B 4NCNA 4O2LA 3NQ41 1TCVA 1GILA 3QBVA 5CDFE 5H4GA 5TPWB 2QE7A 1G5PA 3L7NA 4YMHA 2RARA 4MYSA 4G4SO 2Y0DA 3DLAA 2Z09A 3QV2A 3H4TA 4U6NA 3KQNA 4W5HA 4R8MA 3WNBA 4P45A 3S5JA 3ZEIA 3K5HA 3GEIA 3OE7D 4AF6A 3F4KA 2V0NA 1QRAA 3D6HA 2HGSA 1LPPA 2DBZA 4B09A 1FFBA 1PIWA 2X76A 3DCNA 3K6RA 1ID1A 1Z45A 3BRCA 5L3ZA 3O3MB 3A10A 2YQZA 2NYRA 4DCUA 5I4BA 1EXDA 5LP6C 2DPGA 3MGGA 1P91A 2LZ0A 3F4BA 1QX4A 4WD3A 3EXFB 2H1OA 1CR1A 2DERA 3WC4A 3BWEA 1OYYA 2GHTA 2RH5A 2DUNA 2GCOA 4TQUS 4D8WA 4RJIA 5BNWA 2XI4A 4DM3A 4WKCA 2FZCA 2YV3A 2V0GA 2V74B 3FKQA 4EMBA 2VSYA 1J00A 1G5IA 4HVTA 1DRJA 1CUCA 5GWXA 3LDHA 2C2WA 2XITA 5CCBA 2IZZA 1N0UA 4DCGA 3U16A 5ALGA 5LLSA 4GPAA 5LQKA 4LG1A 1H2RS 5FUMA 1XAIA 2BGRA 4ZHSA 1GQYA 4FILA 3KKZA 3G85A 2X5JO 5K2MA 2WA2A 5AHWA 2E4XA 4MS4A 3UMBA 1GL3A 2X42A 4B6SA 4M21A 4RGYA 3QE9Y 2C29D 2P4QA 1Z29A 2QROA 5SV2A 5FA8A 4JP2A 4TRMA 5LP1A 5LYJF 4B7AA 4BTVA 2C3PA 1U1DA 2EKPA 1I1NA 2ZE8A 3P96A 2GN9A 3L7AA 5T8KA 4RJJA 2Q8NA 3FUWA 1Q6ZA 5DTRA 4E5KA 5FV4A 2WAXA 3D2CA 4BGEA 4EZBA 2YX1A 2B0JA 5E1BA 1KU0A 1Z2NX 4HC4A 3SHWA 4Y7CA 4JI5B 5C53B 1J21A 5IBPA 4H31A 3TVYA 3NWBA 4RDCA 1ST2A 4J0GA 4EI9A 4DR6B 1ECGA 1KXZA 2H5IA 5FEUA 5I8PA 1NVXQ 4G23A 4D79A 4MWGA 3ZCVA 1QV7A 4H1HA 5GTDA 2GX6A 4YVFA 1JIUA 1RHUA 4F6CA 4HI0E 2FG5A 4H3SA 2V9PA 2QAIA 1JU3A 1FFXA 2C4HA 1W44A 3DXFA 5CNIA 4MW1A 1SCNE 3R8FA 1DLJA 1OBFO 2W70A 1H42A 1U0RA 1Y7PA 1ZI6A 5LYYA 3RREA 1QPGA 3ZCPA 3DH0A 2OMEA 2VJMA 4UDXX 3R76A 3PFBA 4LZJA 5IZ4A 4WW0A 5JE8A 3HCRA 4KO2S 3VGPA 3QXJA 3RBVA 4LF4B 4JXXA 4ZAWA 4BMYA 1CZUA 1O96B 1HTWA 3LBIA 3VTZA 2ZB8A 2VDWB 5TE9A 1JEQA 3E1KA 4WCFC 4BIIA 4RWEA 3ZU4A 5LMZA 3ESYA 2BM0A 1M5UA 3IRVA 2WM8A 3QLTA 2V7BA 4MSUA 1YQUA 1ZKDA 1NJGA 4OC5A 2I87A 2D0OB 1G8KA 3I6MA 4ZO4A 1E1NA 4ND8B 4PHCA 2W8BB 3GUYA 4S1NA 4BLVA 1N9KA 1Y1SA 3Q4GA 3ROGA 2HDNB 2BLNA 1FXWA 3IIEA 2IP2A 3MTBA 3QYJA 3OJ0A 4GMDA 1APBA 4EENA 1C1YA 1E1CA 3IOMA 2RHLA 2VJQA 3MINA 3IVGA 1HRDA 1SHZA 1I3NA 3UHAA 4RA6B 3E9MA 4OLFA 4XQ0A 3IOYA 3QJ5A 2OZKA 5BT9A 1RIFA 1QS0B 4GOJA 4K6CA 3PVZA 4F2HA 5JV5A 2CXPA 1JR4A 2GLXA 2IHBA 1G63A 3EXAA 3E4DA 3FJYA 3O93A 4QA9A 4V1CI 1NQTA 1TCAA 5C37A 1KP2A 1D8AA 2MWMA 2XZPA 3VSDA 1LPSA 4QXMA 5DYGA 3B20A 1WZUA 4Q1CA 5JSZB 3BWYA 4QOHA 1JHOA 1LBEA 1WMEA 5G41A 2VTBB 4GMXA 3EXHA 1OIWA 1R15A 3KT3A 3EW9A 4OBWA 1CDDA 1J2YA 1CR6A 1G8AA 3JS5A 3BCSA 4TTRA 3Q5EA 4OL0A 1PVOA 1EUCB 5JAQA 1P5HA 4D98A 3EH1A 2HIHA 3NHFA 4FDUA 2QN1A 3D0OA 3NUQA 3KELA 3ONNA 3BI1A 1G60A 2YDXA 3BWCA 5EIWA 2PS1A 2B4YA 4H4EA 4DMLA 2BFBB 3LQRA 5AK5A 4YUYA 5B6IA 3STUA 3T07A 3TF5A 2MIIA 1NSTA 5JTTA 1A9OA 1T3ZA 1N6RA 5IWAB 2GTIA 5AQ1A 2E6KA 5JLJA 2FUNB 2GVZC 1NATA 3WQRA 5DF1A 2FLVA 2MTBA 2PD3A 1UDRA 3W3ZB 5AI5A 1K2WA 1NX6A 2JLVA 3WE7A 3MWLA 1O87A 4XWWA 2PCJA 4TV9A 4GP7A 4UVHA 3AEQA 3GEBA 3VXKA 2HV9A 4MQEA 1MD9A 1ZQ9A 5CT5A 1OTXA 1ZNYA 5EN4A 1U8EA 1NONA 3PZBA 3KT8A 4DSUA 3NMUF 4MS4B 3BUSA 2A0FA 4PPFA 1NJ6A 2X7JA 1SXIA 4O3MA 2BGGA 1DQSA 3RT9A 3C24A 3DZHA 4XJSA 2ID7A 2ZIXA 2IZ6A 4POOA 2YJNA 2FSFA 2ZUVA 2DZDA 3PEYA 3LP5A 2G06A 5HE8A 5EP1A 3G0DA 2OCGA 3UAXA 2EFEB 3D6UA 5CLLA 4IHJA 4TL8A 2AX3A 1XAHA 2C5BA 2WSLA 3IBFA 3KYJB 3IOBA 2OHHA 1PX2A 1Z47A 3LPMA 2P6PA 3S2YA 2VFAA 3VNBA 2P5YA 2W6IA 1DE4C 2YDYA 3YASA 1GPNA 3HKDA 2CF6A 2HA2A 2OV3A 1VLZA 2R6AA 2O8VA 3AV3A 4HZGA 3HBMA 2PJUA 4JA2A 4RLSA 1ZPDA 1PDVA 1G20B 2XUFA 4MULA 4P3XA 4LWOA 4KE7A 4LHWA 4FGKA 4CM9A 1VJ5A 3EB9A 3LVQE 4QUBA 2ZAIA 4PX2A 5K0TA 4CMHA 2QDKA 2RB4A 4XUCA 4DCNA 3GVCA 3FUXA 5GOZA 2PLNA 4B35A 4BC0A 3DZDA 3WLNA 3FNBA 3I0ZA 2FPLA 3L0OA 4OAOA 3QPWA 1UBLS 4YQFA 3VKGA 3UPDA 2V6JA 1Z4MA 1Y4DE 4OI0A 3WL8A 3UEOA 2DIKA 2QIPA 2WZBA 1KEEB 2CJFA 2JGDA 1SR8A 4IO1A 4RHFA 3X2SA 1YGPA 1EFUA 3G2NA 3JYHA 1U9ZA 3V3TA 1M2JA 3TBFA 1E77A 1AA6A 4L0QA 1PJAA 3E22A 2XMPA 4OSOA 4KR9A 4X65B 3QFRA 4YP0A 5T6MA 5CH8A 1Z4LA 3H5OA 5IH7A 3R3ZA 4UFNA 4UJ3A 5HIJA 1JB9A 3IOEA 1Y3BE 1UWLA 2PA3A 3H42B 1IY9A 3G0HA 4HWSA 1M83A 3QFSA 4H59A 5B2ZA 1ZMXA 1JDSA 3MFQA 1GAXA 1DWUA 2AG6A 5CLIA 2BDUA 2W6QA 4GYYA 2BT4A 1XPJA 3DZJA 3KUDA 4KWEA 4UCFA 5BSTA 4D9IA 2OXFA 2XZDA 4D3YA 3THYB 4ED9A 5EWLA 1NYLA 5AOAA 3L4BA 3FCXA 2G5TA 1XHFA 3EFEA 2PGDA 3K9GA 4B85A 5JD6A 1EUYA 3ASYA 4KCGA 4TMXA 3EPLA 2NZVG 3DWGA 4ARZA 4PU0A 4F12A 1XMQB 4TS1A 2VHWA 4B82A 2Q5FA 2EZTA 1WW3A 1EFKA 2RAVA 1UK6A 3D0QA 2PLAA 3L1UA 3CPEA 1MJHA 1RYDA 1V39A 1WY7A 2PWAA 3HDTA 1RMTA 3KL2A 4L1KA 1G3RA 1K7XB 3DBRB 1K7YA 5J4LA 2JGFA 4AI6A 3RC8A 4PYRA 2VCHA 3M6IA 3H11B 2Z04A 1TJ4A 3DYBA 3L0YA 3GY0A 3WK7A 5I7EA 4LHZA 1EQUA 3ICPA 5LQNA 5GM2A 3T5TA 3AESA 4YQZA 2BMFA 4GDMA 4QQFA 3WYDA 5LZ5A 4BPBA 1ZH2A 5DYTA 2ZI5A 1XBTA 2C9DA 5F4BA 1W7AA 3B12A 3QTTA 3K0FB 4Y6OA 3BTOA 3V8EA 1A5ZA 1S2OA 4ZI7A 4ZMBA 1JEYA 1RQ7A 4GPTA 4DFDA 5MF6A 1YB1A 2R2AA 2YVAA 3AYXB 3B1ZA 4IGFA 3DR3A 3T7JA 1D1PA 3UMFA 3ZD6A 2H63A 1FW6A 3EVBA 3DHYA 2DUWA 3PWSA 3RS7A 1OH6A 3C4JA 3ELYA 1AQ6A 3UXEA 4LGVA 2PGAA 1A7UA 4YX9A 3IIJA 2NP6A 3LBAA 2ZWVA 1O9BA 2QQEA 4M9SA 1ICIA 4P34A 4NEGA 4UAVA 3D4NA 2CB0A 5DDIP 1IG3A 4TN5A 5EXSA 2PVVA 3LM8A 4FKBA 4B4UA 1AO0A 1XP8A 4AY3A 2NU7A 3GP3A 4JBXA 1QO7A 1UFQA 3R3VA 1VLLA 3OX3A 1HRKA 5E6SA 4RM2A 4AKSA 1C0IA 1RPNA 3AHIA 3EN0A 4QKQA 3JR3A 5B12A 1VZ3A 4D9KA 5DWQA 1R4NB 4L2IA 1D5WA 1L5VA 3BILA 1N9GA 4KR3A 2BJVA 5U1PA 3VISA 2Q6LA 1ZM3A 4WJLA 4MQEB 2VHJA 4D9GA 3ISVA 2VDUE 2QYSA 2D59A 4YAWA 1DBVO 2OD2A 4WNIA 2FMHA 3QHPA 4HN4B 3F78A 2B9EA 4IP0A 4EGFA 2B36A 4E5MA 3QTLA 3C14C 4NRDA 1KJZA 1V3TA 4FD3A 3CNQS 4O5AA 4RKQA 1KY5A 3DEJA 3AVYA 1L4KA 1AB6A 1T8WA 1J70A 1IHPA 2JF0A 4ER7A 5JVDF 2X0EA 3GFGA 3FWPA 1E0KA 4LDQA 5DRTA 4XEUA 3FSJX 1Q74A 2WJ6A 1VDZA 3MS7A 3NM5A 5DFAA 7REQA 2NV6A 3HO1A 1JFLA 3M5CA 3P0FA 1TADA 2OV6A 3IUPA 3MHTA 1XL1A 1S1CA 1ORTA 1WPRA 2NPOA 1OAKA 3DZFA 5IYZF 2QBYB 2PXXA 1EVIA 4N8DA 3AEKA 4UM9B 2W42A 2P1ZA 4N6GA 1VYTA 2GASA 1E0AA 1NFFA 5ALSA 2H1LA 3WMGA 3IBCA 4O2RA 3FDZA 3MRXA 2PUFA 3ET4A 4FYWA 4LOHA 5AJWA 1UINA 1A96A 3LPAA 4QOEA 4QXQA 5JLAA 3AX6A 3U1VA 2IUYA 1KQGA 2EKLA 5HKOA 2RB5A 1MXHA 3ZCRA 1WOYA 1RI5A 2AHOA 2ZDQA 4K9MA 4HGYA 4RS4A 3RC3A 2J3HA 3VU9B 1G38A 2ZAGA 1P2GA 1ZHHA 1IQRA 1KL7A 3NDJA 2A0KA 3NNSA 4MV0A 4R83A 4JYWA 3LH5A 1LH0A 2D1QA 2VRBA 2JGDB 3LXUX 3SIRA 1LW7A 3WBFA 1GTG1 2IQIA 2PZKA 2PYIA 4F4HA 2WYUA 3E22B 1J7JA 4D74A 2I2DA 1FL9A 4AECA 4N7BA 3GH1A 2PQ6A 2NYAA 2WUGA 1E2JA 1JDNA 2LDBA 1WULS 2VBFA 3H2JA 1IZZA 2NXCA 5LQSA 3NDPA 2WHPA 2A5GA 4KQ1A 1ZO8A 3AF2A 3GEGA 1WU7A 2OG2A 1ABBA 4BGUA 3QU2A 3DLPX 1H4VB 1KY4A 4ZC8A 3T3DA 4AN4A 1FTNA 3L8CA 3H65A 3JQFC 4XGQA 1E0DA 3IUSA 5HCNA 2IOFA 3IILA 2J3MA 2A57A 3ZWAA 3IR7A 5FPHA 3BAZA 4TRJA 4KMSA 4I4TA 4KQ2A 3REFA 1MX5A 2A1TS 2J6HA 2IE8A 4FX5A 2IYLD 4BXOB 3JWGA 4KEAA 1J20A 3JTEA 4N0EA 1IHUA 4IWYA 1DJLA 5CFMA 4LQDA 3CUUA 4P3YA 1Z8HA 3B38A 2QJOA 3EBLA 1E7WA 3H16A 3H84A 3HV0A 3OQJA 3QYPA 9LDTA 2HWGA 2X0RA 1ECCA 3C7KA 5F35A 4CI9A 2W2XA 3CRZA 4KXMA 3RSZA 3CEJA 1ZCAA 4D3FA 4HQLA 2VEOA 4KRYA 2O2IA 2QY6A 3DYVA 4HAWA 5FTMA 6LDHA 5AVXA 3M6FA 1VKOA 1RAIA 2R8PA 4NV1A 3N5KA 3THWB 1XP5A 2AZMA 1U2GA 4WL0A 1QKJA 4F71A 4ZI7B 9MHTA 1YCDA 2OENG 4RZQA 1RT9A 5JSYA 4A82A 2LWIA 3IBSA 1NRJB 3UC9A 4BO1A 2FUG6 1OWMA 2C99A 1A95A 5DPMA 1UJ4A 2XUJA 3D6TB 1V6CA 3ME5A 1XAJA 3PDCA 4TYYA 1X13A 4MQUA 1XHLA 5FOQA 4KSYA 2Q5OA 2XA9A 2PBFA 3VHQA 4B6PA 1RLOA 2LE0A 3IPAA 3N75A 1SMKA 2GN6A 3ORSA 4JLVA 3GT3A 5DVZA 1B6RA 2I4MA 4DLTA 3I5MA 1GQFA 5E6UA 2DYKA 1DV1A 3DZGA 4AIRA 3PQ7A 4FSDA 1I2DA 3KTAB 4ENWA 1TAQA 4G86A 3GDHA 1WB6A 2VDOB 4TPKA 5E6SB 4C0KA 1J39A 1L7EA 2XECA 1X1CA 3AI1A 2YMMA 2X2OA 4BMNA 4L2IB 2WB2A 4F3TA 1NNUA 4KPUA 3ILYA 3PGA1 2WKSA 1TU0A 3S7TA 1GG9A 3QHQA 3JQQA 3FDIA 1OU4A 3W2IA 4DJEC 4NJEB 1XEXA 2AE2A 2WF8A 3LXMA 1BA3A 3CMMA 4B3HA 4Z7OB 3FJOA 3ZV5A 5TGTA 4D26A 1DB3A 2I9KA 3WYNA 1PBNA 1IQUA 4YHBA 2YY6A 1S9HA 1RWVA 3K72B 1WUTA 4MLCA 4DBLC 4DHWA 3OO0A 4YRIA 4V0SA 1IU9A 3AILA 5GJVC 4HDKA 4ZHQF 2GZMA 1X1DA 2BMVA 2O05A 3EIWA 4L5AA 3BICA 1ESZA 3VV3A 3NHJA 3NVAA 4PQGA 2ID4A 5FLYA 4C14A 2OBLA 1N6NA 2O2CA 2PKRA 2RKWA 2X4DA 3KAJA 4LE0A 4YECA 3AUUA 2D3WA 3GLIE 2EZ4A 3Q72A 3Q1KA 1IXKA 4HYYA 4O29A 4BRWA 1H2XA 3GFTA 1IM5A 4WZZA 3OPYA 3L1IA 5D5QA 3LVBA 3PXAA 3OEHD 4IX9A 1KMHA 3B60A 3ZC3A 1VKNA 2I6UA 5ER6A 4FBMA 2R5FA 5KYYB 2AN3A 4MIKA 1Z16A 3U7FB 1J97A 2E21A 2FTKE 3BGDA 4JY7A 3FCCA 3JD0A 5EMJA 3RWBA 5U4QA 3GZNA 3OSUA 4WK0B 1QU3A 2XGOA 4YUWA 3LHSA 1FP2A 1WNTA 3O9MA 1FMLA 4Q4CA 3QKWA 1DRUA 5CFOA 3P52A 5G3YA 1P75A 2JFNA 1YL7A 3ND9A 5JMTA 4IG4A 1ADBA 2O8DB 1YJCA 5JSQA 1I9GA 4RUKA 3PPYA 1ZH4A 2WMDA 1I7LA 2C2XA 2PTGA 4JDPA 5BNFA 3RJ5A 4EB8A 2BFOA 3P45A 4LECA 4CW7A 2RHBA 4H0NA 1SVIA 1NRWA 2N42A 5K03A 3M3PA 4Q4AB 4BJHB 2C7QA 1NLZA 2XCRB 2EKBA 1CYDA 5A7GA 1TK2A 4Q6WA 4DOMA 1G55A 3DYIA 3P0RA 4JYMA 4J29A 1C1DA 2OO5C 5EQTA 4MGIR 1MVNA 4MA5A 4L7QA 2PD4A 3S2ZA 4DV3B 1CX8A 4GQAA 3V32A 2Q0XA 3Q8WA 2HBYA 2K2WA 4YAEA 1G7SA 2CUNA 3Q88A 2M6KA 1GUYA 2QB5A 1FDWA 3NBFA 3S55A 2AFIE 3UICA 3BMQB 3LGAA 1T0IA 3WRYA 3NDRA 4TS3A 5JNRA 2P0AA 3ANTA 3O8DA 2WT9A 2B5VA 2RDMA 5AD1A 1X70A 5G0WA 1ESDA 2EEPA 4BQEA 1NV8A 1QLHA 3GB9A 1HL7A 1ZGJA 1H8EA 1YU9A 3EQ7A 1ND6A 4M9CA 3WFZA 2BP7A 2IVFA 1EG2A 4P7FA 1XVUA 4M9ZA 4F5DA 1T8SA 3ZHSA 3DLBA 1ZJ6A 3A1UA 4BNHA 2P9TA 2ZB7A 1RJGA 3C98A 3FF1A 3W5DA 1AY0A 3ZZNA 2I80A 4XUGB 4I3FA 1IFXA 1I94B 2H54A 1WB5A 2C2HA 4BMCA 5EJ7A 3DD1A 4YCMA 2N1MA 4DMCA 3OX4A 3NAMA 3WP1B 2ANCA 2FF5A 4RWZA 2FCRA 3DKVA 1RWBA 5TQ0A 3GXOA 3JQGB 4MWTA 1NXPA 1WCIA 4R7GA 3IQHX 4L72A 1JFTA 2UU9B 5DTQA 2FH5B 5EZYF 5EGSA 9ATCA 3M3DA 1A8SA 2EW8A 3S9LA 1K4YA 1TECE 1HSOA 1QVZA 3HI6A 1FLVA 4WERA 1XZKA 4ZALA 1YOVA 4PQRA 4DQVA 1GTVA 4LXUA 2O1SA 1I80A 2G36A 2HWWA 3CNLA 3TGLA 2QD5A 4XFKA 1M34A 4J8PA 4IMRA 4U00A 4DZTA 3ZLUA 4HH3C 2YVLA 4FJ1A 4LK2A 1RC8A 1AV7A 2H06A 1DG3A 3B3QA 3EEFA 5CFZA 3GP5A 2ZIEA 3EC1A 1SVSA 3IA2A 3DVRX 4YJ2F 2ZDHA 1XXHA 2X4IA 1S1MA 3G68A 2ODAA 4P83A 4UPEA 1OWPA 3I6SA 4ZYXA 4L9WA 1WDTA 4DJ5X 1QV6A 1NU6A 3W8EA 1B8PA 4URUR 1KTVA 4WXRA 3T38A 2JHFA 2QZJA 5E7JA 2YJZA 4MUBA 3PFNA 4E94A 3BA6A 4XIIA 3T7IA 1XDZA 4OSPA 2GI4A 2QYOA 2HSEA 4MDYA 3EDQA 4GQIA 1W2HA 1E9BA 2BSQA 4EGAA 2H1HA 1OT5A 2H4ZA 2L2QA 3PFGA 1P45A 4P58A 2ASVA 3NW9A 1IZ7A 4U7WA 5DLQC 1JQLB 3O90A 1VA4A 2XUPA 5GJCA 2G83A 3FEDA 2QZPA 4HDNA 3HDGA 1AGNA 1DBSA 3NIFB 4A0HA 3ZDYB 2ZU6A 3UJ9A 3CF2A 1W52X 2A9OA 2JGIA 1A4UA 1ENYA 4HEQA 2E4YA 2ZWIA 4N49A 3UPUA 2YKGA 2ZUBA 1XPRA 1ZD3A 1BN7A 2ZR7A 4LDNA 4X6YA 3MC1A 3MN1A 2G1JA 3ZXYA 4A6EA 1DG1G 3RFXA 3ZDDA 4JCOA 2FUG1 2ZUEA 4I9FA 1EUQA 4EFMA 1EA7A 3RTCA 2BCJQ 3IJPA 2O2ZA 2QRNA 4HZUA 3NC4A 1HM5A 5IDQA 1NTRA 1HY3A 4RZUA 2FX3A 3ZW7A 2XUZA 4DUGD 4YR9A 1BMQA 1FNMA 1MCZA 2QRKA 3AERB 5AK6A 4ETWA 1GGHA 1LC3A 1DX9A 4WXEA 5DTIA 3U7EB 3RU3A 3H19A 5ALUA 5LU9A 2FR0A 3FMVA 3IKVA 4UC0A 3ZZTA 3QVVA 4PY2A 3TLEA 1JV2B 4GOKA 4CIWA 1CRQA 4YJGA 3QOYA 1R10A 4MRMB 1BXZA 1ADGA 3MELA 3QFCA 4G4GA 4N0MA 4B84A 4FFMA 3RVQA 1YB4A 2JCGA 3QSGA 4LMPA 3OHPA 1E7SA 5DW0A 2GHQA 3ZHCA 2QUAA 4IUYA 1PJBA 3WJ2A 1F6BA 3AU9A 4U6QA 3CKYA 4P3NA 3TJMA 1M0TA 1MRZA 3EIQA 2QN9A 3UAVA 3VPAA 4CDJA 2PL9A 2V4ZA 5K3AA 1MB0A 4YUZA 4JC8A 2BFFA 5D2CA 4HDRB 1ZGGA 4HUQA 4PG6A 4KNYA 4OP1A 4X84A 4RTMA 3OCCA 3CX7A 4ZREA 4XWOA 3GCXA 1BNCA 1MT0A 3ZE0B 3R6GA 5LNK6 4QDZA 1QFYA 3Q41A 1YZGA 2CEKA 4GU5A 1OPXA 4OFXA 2DMRA 3TR0A 3WRXC 1R0RE 3AINA 4INAA 1M2OA 4Q00A 1R0YA 4RDXA 2N47A 2D2IA 3N6VA 1G291 1KYXA 4NKRA 3ZWCA 1ZH6A 5ALQA 3FDFA 4J7CA 1KVSA 2AN5A 1BO6A 4N5IX 1K4MA 4KACA 1VCHA 3E7DA 3RWOA 5FIUA 2QVCA 3VOAA 2LIVA 3PHGA 1FYDA 1MV5A 2D0IA 3EUEA 3RU2A 4FHCA 1EJBA 5ELLA 3P5BA 2D1TA 3BSYA 3ZHQA 3OEEA 3KO8A 1GU1A 1EZ1A 1KVRA 1WW2A 2HCJB 3IFSA 1E5QA 5FWXA 5K4AA 4B6QA 4DRXA 5JBQA 2E4UA 5LZ7A 1NKSA 4L5BA 4RPHA 3MILA 4N47A 3RANA 2QNBA 3OOJA 1ONNA 2R1TB 3A4TA 4IKPA 4RPLA 5J1SB 3HM9A 4FOSA 1A9TA 4CG3A 3QVWA 3S44A 3HWRA 2O2EA 2NTYC 5D3KA 1HLFA 1VSBA 1M34B 5C8VA 3WA7A 2YJTA 1GITA 2H4HA 3NEAA 4C0AC 1X14A 2H7YA 4PS0A 5CPBA 1I4EB 4B47A 3T52A 2GD6A 5ECDA 3S40A 4QBGB 1KMCA 5JASA 1Y5NA 3I32A 4Z9YA 4OC3A 1N3BA 3OLWA 4K40A 3IAEA 3BFKA 1XF1A 2J0EA 3T3NA 2H9YA 2XYVA 2FK7A 2QR2A 5BWLA 2O3TA 3UJ6A 1A76A 1BXRA 5FR2A 5IG2A 7GPBA 1W4AA 3EJWA 3EULA 1CY2A 2GARA 3QUCA 4EG7A 2RAUA 2O3RA 4ZI3A 3NPAA 1C1XA 1O6FA 2AB0A 2PMBA 3CCCA 3ESCA 3H1GA 3ZV6A 3FGZA 3LPDA 1NQOA 3UENA 1DTSA 3OZSA 1WHSA 1YOBA 3A6KA 3B78A 3IUJA 4FNGA 1YVPA 4MA4A 4RFVA 1FLDA 2DJIA 4EPRA 1WV0A 2QQ0A 1VG1A 4O1MA 1WHTB 2BISA 1XJWA 1OROA 2R7NA 2EU8A 3DAHA 2Z30A 3IAAA 1DOAA 3QVTA 1UKBA 3SFVA 2VJBA 5BQ5A 1VJCA 3UXYA 1RP1A 4FYVA 4QJBA 1IUNA 2GJ4A 2V3CC 2G72A 4LRYA 5C1IA 4NX2A 1L5GB 2R00C 4B3SB 1D7OA 3HO8A 1I3LA