3TLGB

Microcin c7 self immunity protein mccf in the inactive mutant apo state
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
335
structure length
335
Chain Sequence
b'PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 109
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
B PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlgB01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlgB02
4EYSA 4IIXA 4INJA 4MJXA 3G23A 3SR3A 3TLBA 3U1BA 5FD8A 3GJZA 2AUMA 5F1YA 3TLCA 3TLGB 4H1HA 3TLEA 3TYXA 5F5XA 3TLGA 4JVOA 2AUNA 3TLAA 4IIYA 1ZL0A 3T5MA 4E94A 1ZRSA 4E5SA 3TLZA 4MI1A 3TLYA 5K99A 5JYBA 5F9MA
chains in the Genus database with same CATH superfamily
3ZV4A 2J4DA 1SCIA 2D1TA 4ZVNA 3HY6A 3ZVRA 2O4UX 2GESA 4DUGD 1T10A 3E27A 4BWYA 2Q49A 4HEHA 4FM9A 3CX4A 4WZBB 2FG6C 1KJIA 3AKCA 3WLQA 4DMCA 4O8ZA 1LW7A 2PS3A 4G24A 1U02A 1VKNA 2OG2A 3Q7IA 4IOJA 1OD6A 4Q7MB 4TLMB 5IJAA 1MZPA 2JFPA 3NFRA 2O8NA 4RLFA 4FDVA 3QP9A 4M0KA 5A3QA 1VL2A 5BUCA 3PL1A 4A0FA 4QUIA 4UEWA 4W82A 5LU9A 2QD4A 4CUJA 4EG3A 3CKMA 2PS1A 2OGWA 1B0PA 3LA8A 3MMZA 3OTWA 2V1UA 1Z2CA 1N2XA 4BVLA 1ZCBA 1POWA 1MH9A 4M99A 1E4EB 1PTJA 1IAQA 2HRQA 2QDKA 5JXHA 1FNDA 2WF5A 3OEED 1IG3A 3CR8A 1T8PA 3W8RA 5I6DA 2AOTB 2JLRA 4M83A 5I9TA 4MWCA 3U2QA 3KT3A 3L06A 5LB2A 3H42B 3ZOZA 3OH8A 4INZA 4X3PA 3CT4A 3D2BA 1NR7A 3RIGA 1AQLA 3LXUX 1FP2A 1KBQA 5K3OA 4OF4A 2X0NA 2NXWA 2OZKA 2Z5LA 4UBKA 1KAHA 1KFCB 3A10A 2C5BA 3PXEA 1P9WA 5BV0A 1H5UA 3JQPA 3VR5A 1IQPA 2Q6TA 2R11A 2ZRKA 3C16C 3F7OA 4JUAA 3QYJA 1RPNA 5AKIA 3GPLA 1Y9ZA 3QEMB 4D4HA 4QUAA 1PO7A 1TYCA 5FWDA 1M34B 5CDYA 5CDSA 5JAZA 1U1GA 3O8CA 1ZVVA 4V0NA 2JBHA 1XRNA 1DXYA 1KJQA 2H8GA 4JJ6A 3KSUA 4KRXA 2ODTX 1QF9A 1S2LA 2WU1A 2XVMA 2YZKA 3HUFA 3KHTA 3MT7A 5DBGA 4CT4B 2A0KA 3BXFA 2CHQA 5IM4F 3FTNA 1KJNA 5KJ1A 4MGEA 1V4NA 1JLLB 1SZPA 2OM6A 5JVDF 1J7KA 3R7WB 4IWNA 2XMCA 4K9OA 2OV4A 2JCBA 4RGBA 2BP7A 3TVTA 1YVPA 1P18A 5C3MA 2C95A 5COAA 2Q3HA 3OCWA 2SNIE 1VJ0A 1O58A 2AD1A 3E7XA 4IJKA 4NOKA 4YECA 5T41A 1EM8B 3JQAB 2AR7A 4DG9A 1AY0A 2OD2A 3SXJA 1DX4A 3WKEA 2I9PA 2DFVA 1Y1RA 3FDZA 3B6MA 4RM3A 2DEUA 1XDWA 1A9XA 4DCGA 1OASA 3CKKA 4DR2B 3H2ZA 1ZSNA 3U60B 2P6PA 2IZ5A 2NXJA 2VRWA 4YS6A 2CXQA 1E0KA 1OBFO 1EEXB 2C5EA 4I4TA 1DJMA 1U7UA 3KXLA 4FSHA 1G3UA 4IHKA 4KRYA 3DL0A 1MIOB 1VBFA 2QS9A 2FZWA 4ZZ3A 1WTCA 3Q7RA 2P4UA 4KO4S 4UHEA 3R74A 4B7XA 1QIHA 5GJBA 4M98A 4XLLA 4Q3EA 3EY4A 2Q1XA 2P2DA 4OXQA 3QPDA 1D4FA 3PDJA 3QY0A 1SXGA 4I6GA 1K98A 2QT9A 4YLGA 4NGTA 4EYOA 3VNQA 2VQ3A 3TJRA 4DIUA 4ER0A 1G9XA 1UEXC 2XTZA 3R44A 5C3UA 3EFOA 2B92A 5BWNA 3QVJA 4IDNA 1CZHA 1I5EA 2QRQA 2VDOB 3BRSA 3CRQA 3EH2A 3E9MA 4FINA 5FBKA 4EW2A 3B70A 3HJFA 4DQKA 2UUBB 1IYZA 1JQAA 2VHEA 4IIXA 5EIEA 5JJKA 4QPNA 3W90A 4HEA1 1KU6A 4JDPA 1Q74A 1SVIA 1NY5A 2LR0A 3WB2A 4Z4EA 3LG2A 1VHLA 3LD9A 3PA6A 2GAAA 3VAAA 3FOWA 2Z6VA 3TAUA 3W5CA 4UBJA 3FUCA 2ZM6B 4XEUA 2FWAA 2OZVA 4JODA 1W88B 1QH0A 5LA6A 3A1WA 3ELDA 1TYZA 4D8TA 3K31A 3U0VA 4DIEA 3LBNA 1A9PA 2ZAOA 2UXCB 1O0SA 4BQRA 3KKKA 3SQLA 4Y9UA 2GPYA 4EDFA 4EPTA 5BSGA 1AA9A 4JXXA 2AWOA 4GOND 2P4HX 5DCLA 3I01A 4N6OA 4V0RA 1QS0A 2HU5A 3GYBA 3LBFA 5JZVA 1O9BA 4J0CA 4JB8A 2JI8A 3L82B 1L2TA 4FX2A 3NKVA 4K3UA 1B0UA 1P5ZB 2F1HA 2GR9A 2A14A 2XJ4A 2YUIA 2V98A 4PGFA 3VPXA 3QVKA 2GXQA 2XNSA 3OLQA 2G28A 1KKMA 3GGSA 3A6HA 1PR2A 5FOQA 1C3LA 4RANA 3A4YA 1S1CA 4URFA 1N1DA 1OVGA 3TBKA 2W6JD 1U7ZA 2ZSJA 5GJVC 3VX3A 1JG3A 1MABA 1XFDA 2ZYDA 4AP5A 3DBOB 3BH6A 4TS3A 4YROA 1JLKA 4UVEA 1FOEB 2OMKA 3GGJA 3A4LA 4OHYA 2PZAA 1OH5A 5DGTA 1DJLA 5JATA 3PUIA 2D5CA 1NVGA 2OO5C 5KZMB 2A59A 2NMVA 1TJ4A 3EGVA 3C3EA 1HETA 5FV4A 2REBA 3GRAA 3QVWA 3NKLA 2PZEA 1K7YA 4C4XA 5LR6A 2FLKA 4PHFA 4CG1A 3KQKA 1RBZA 5ED0A 3QLUA 4JR1A 4O4JB 1VLMA 4WY5A 4LGYA 4YDQA 4FCCA 2B69A 1Q0TA 2NUPB 4MWZA 5KWIA 4X1OA 1SWVA 5A2QA 4KK4A 3DPIA 5I8ZA 1NX6A 1YB1A 2WRZA 4J16A 2FFRA 3CVUA 2XE6A 3LJKA 4EVIA 3DFFA 2OXFA 4H3HB 1BS9A 3DBIA 1RKXA 1EK0A 2Z9DA 5AO9A 4C9EA 3BSSA 4JYWA 2CVOA 5FLKA 4RL6A 2OA0A 1JZQA 1SUWA 4IXMA 1AHIA 1ZVMA 2HB6A 5AKZA 4KQIA 3PXAA 3N1UA 1IDOA 1DV1A 4MUYA 2PQMA 2RAVA 3HEAA 2ZU0C 2BGJA 1SG6A 4FFDA 4OQMA 5BW4A 4GLBA 5EE9A 3NVAA 4OKSA 4V24A 5EG5A 3I61A 2PKXA 4M1ZA 2AFIA 2C42A 3B6IA 3E82A 4KQCA 1GGKA 2UAGA 4OJTA 3H3FA 2A1UB 1O6GA 1Z0UA 4PLFA 4JT9A 3ZGYA 6NULA 1RDFA 5CCEA 4QGSA 1JG4A 4G4SO 1R8JA 4DUZB 2EJTA 1K5GA 1S3GA 5EMJA 4INPA 4HDKA 3FEDA 5LYYA 1GGVA 1Q0LA 2P5TB 2H1VA 4RQBA 1PFGA 1R16A 2TMDA 4GW3A 2IUTA 4HHEA 1EFUA 4LZWA 3VR4A 2Z3ZA 1OBHA 1LRKA 3D6VA 4QYMA 2HUNA 1N5DA 2EGHA 2QENA 5LQCA 1S8AA 3PWZA 4Q82A 4RCZA 2F48A 1UH5A 1NU8A 1ABFA 4LYGA 4YWJA 3THXA 5ALGA 3FSGA 2DRIA 4NBTA 2R44A 3WIUA 3RRBA 4QLOA 4EECA 3GQVA 2ZR8A 3B53X 3IOEA 4NDNE 4X8LA 4CMJA 4IJUA 4DZZA 2OWEA 1XZCA 4PQFA 1DIOB 4MX8A 2Q4TA 3LUKA 5GOZA 4PO1A 1ISFA 1E8NA 4ZVVA 1P4RA 3ZK7A 2FWJA 3LLMA 2Q21A 3G5AA 3RAEC 1UM9B 2EWWA 2J41A 4MW6A 5TQVA 4RO0A 3GEIA 4CDGA 1EFHA 3ZJVA 2HSDA 4L6AA 3UOAB 1ZONA 2WJZB 3LQ2A 2ZIXB 1H0HA 2V7BA 3UHJA 1XTSA 4P5PA 5DGHA 3W5JA 5IN4A 3HDQA 2IBMA 1QHYA 4XZ3A 1KQPA 5T4FA 4ND6A 3WB1A 3TPCA 3COVA 1CFZA 1R0LA 1F8UA 3GFTA 3A11A 5D8DA 3TINA 4Z0PA 4BO8A 1OTXA 4EJMA 5DNVA 3RSHA 3IV7A 4LSZA 2H5IA 3OY7A 5GIOE 1KZ1A 2MTBA 3H18A 4UFPA 3BXGA 3PDHA 4QTTB 1P6QA 5CW2A 2HO4A 2ZROA 3HB4X 3NX4A 1R8XA 2HGSA 2VSXA 3QPCA 4GT1A 5TQ0A 5ULLA 3ZNPA 3P9YA 1WIWA 1AK2A 3IV6A 3OA0A 1R0RE 1PT8A 1SBHA 2A9PA 1FYVA 1VOTA 2GZSA 2IFTA 3LNTA 2X1VA 4V0ME 1NT2A 8ABPA 4IDDA 2IPNA 4WAUA 1RI2A 3WGIA 3AQIA 2UYHA 3V34A 1QH9A 4I66A 3OJOA 4DIBA 1VGVA 3ZW8A 4D80A 5CK4A 3GELA 1NDUA 1Q1NA 3CO5A 2EYQA 4UTPA 3QE2A 1GTZA 3C5HA 4JZYA 1W4AA 4B4VA 1Z4QA 4PYQA 4OC3A 3BRQA 4J1NA 1XTUA 4JK3A 4UE2A 3WYNA 1RE1A 2Q2WA 1ULZA 4MVJI 5K0CA 2CUNA 4FNGA 4XCVA 5G0SA 3AVXA 4RF3A 3AYZB 3GPCA 2HD4A 4OC2A 3H75A 4A03A 3PQ8A 1NBIA 2OCDA 5EHXA 4RTKA 3WRXA 1NA5A 4M76B 2ZR9A 1Y5IA 2PAAA 5K0NA 1CYDA 4ZVPA 4LSMA 4WADA 3WGMA 3CLUC 3ZDCA 2JIMA 4CE6A 1BE8A 1FJGB 4PANA 2NXNA 2IEDA 1W49A 1XRLA 1N75A 5BMOA 4LOKA 3U4DA 2J8ZA 1IONA 4EMSA 5DXAA 3IVCA 4MP8A 4YN3A 4EEKA 5IMSA 2AG6A 1GU1A 2XX3A 4MUIA 4OL9A 1FZTA 5ADHA 4IDCA 2AN4A 4LCJA 5G0UA 3T41A 3ROXA 4J7CA 2SKCA 4M9SA 1VCOA 1N0VC 1LNZA 1U0JA 3ZBUA 4COOA 3BSWA 4WBNB 2P9BA 2EZBA 1DNPA 5J2UB 4MIEA 3MWEB 2ZT5A 3K1YA 4GLFA 4EJ6A 2D5BA 1L7QA 3OY2A 3FCCA 1MENA 4DAOA 3EISA 3O8BA 2AMVA 2YJVA 4R2KA 5JNSA 3V9PA 4Z86A 5JRZA 1S8OA 3AF4A 4O2AF 1XD8A 4Y7CA 2QX8A 1Z2OX 4JBLA 4QBKA 2IWRA 4PGMA 4RK4A 2BGUA 3OT1A 4D8VA 2X0KA 4BKMA 1NMYA 1K6MA 1X9HA 1TU4A 1JLHA 2HUPA 3WNBA 1VCIA 1UZMA 2VPXA 2FVXA 4ND7A 2B9VA 2RHDA 3IQGX 1V48A 1U7HA 2CHUA 2GCIA 2LPMA 4MV8A 4UPDA 1XKLA 2Q1WA 4IICA 2FA9A 3R9WA 2D00A 2AEEA 1BH2A 4LDPA 3S9LA 1NBEA 3VC3A 3QWAA 3MQFA 1R4NB 2XRMA 3CEAA 5JAQA 3CEJA 3KEFA 3TW4A 3X1WA 4MEBA 4G0PA 4P2GA 5HS6A 1WVMA 1VI6A 4AKEA 1OXMA 2FPGB 3GO4A 2YOHA 2HYDA 5CJPA 1AUXA 4C29A 1KEEA 4JYAB 1AXGA 3L8EA 3EQ7A 4LF7B 1ODTC 4J03A 5KWSA 2OGTA 4BEBA 4LHVA 3BE4A 5I7RA 3H6HA 3I1JA 4B7ZA 2BHTA 2QMUA 4KQ1A 1CZOA 2QZPA 2BM8A 2JI9A 3E48A 1PT7A 2JF0A 3NIFB 1EINA 2QZJA 3U44A 2EQ5A 2XT0A 3EWNA 1B1AA 1SBZA 4LY6A 4OGFA 3P9QA 3TECE 1AN0A 4EITA 4J0NA 2J85A 1HTBA 4EATA 2ID9A 3ZWCA 3NH9A 1NXXA 1CUIA 1Y7TA 2FKNA 4AI6A 5JYEA 1YULA 1T5LA 3EVAA 1USVA 4O2BA 3FFBA 3ZTYA 4FFLA 3WMRA 4AY2A 1VFPA 1Y3IA 2JB9A 4CETA 1W96A 1O57A 2ZYGA 1AD2A 4RYDA 4EO4A 1M83A 1CT9A 2X9GA 3QSGA 4JGIA 4B6FA 2OBNA 5BT8A 3GLKA 3CNNA 1D2RA 2VRBA 4Y18A 1F8YA 3C6BA 3KXPA 2H16A 1JEAA 1VYHA 1XAHA 4GMKA 4L2IB 1TXGA 2BCGY 4M22A 4ZO6A 4BQFA 4QFMA 4EZIA 2B98A 1TZMA 2K6GA 5L4SA 1OT3A 5IAKA 4RD2A 4EVRA 2LNDA 5BW5A 2GPNA 3UKJA 1KDPA 4MMZB 4GMFA 4B32A 1OIWA 1LRLA 3T05A 3SHOA 4J9UE 4IINA 3FKJA 4AZ0B 1AGYA 4C4TA 2FR0A 1CHDA 1VHJA 3JQ9A 1FY2A 3ZH9B 1D8AA 4HWPA 3PE6A 3CXUA 3EGXA 3OC6A 3PG5A 4MULA 3SBOA 3BB3A 5FYDA 4EARA 1UZNA 3PGKA 2H7CA 3DKKA 3I6IA 3K1TA 1TLTA 4RTPA 3A28A 5J4VA 1GLVA 2ZI9A 2ZI4A 5F5NA 2AHRA 2FN7A 4Y2VA 3ZE0B 3MWDA 5FWXB 2O8EA 4YHBA 3PKIA 2YIJA 4PO8A 1JYSA 1K68A 1KKUA 3OPYB 3ABOB 5LUBA 3TLGB 3BK7A 3MCVA 4EL0A 3GLIA 1I2CA 1N57A 4H3VA 2HCRA 4L22A 4DQLA 4EPXA 5JAUA 2HW8A 4Z7JA 2C4TA 3U31A 4OP1A 2B3TA 1AKVA 5KQPA 3LIIA 5LN1A 2F8TA 3JD2A 2O6LA 4E94A 2O5EA 3SBXA 3VM6A 4IXDA 4AS3A 4E12A 5L3QB 1EE9A 2F4NA 1TJ3A 1SMKA 3QHAA 5ERYA 5KMGA 2E49A 1JB1A 1CULC 2V6FA 1T25A 4EB6A 3LWNA 3AL3A 3LF1A 5HJEA 1D8TA 1WU8A 1WKBA 3BG5A 3FFAA 4PS0A 1FJHA 1GXSB 2FCAA 4AMZA 2PUDA 4IXTA 4M6WA 3ZN2A 2FYTA 4LOJA 1NWCA 3D3WA 1KKLA 5ICEA 2IZZA 5CYFA 3D4LA 4JI3B 1CZNA 3IKLA 4J90A 3V4LA 4CLHA 2O0JA 2XHEA 3F9IA 4KKXB 4NLLA 3G88A 4ZDJA 2P27A 4R8SA 5KSYA 4W5QA 1OFHA 3GNLA 2Z3VA 4N47A 4C1BA 2CJPA 3SKXA 3K6RA 4KDEA 4BUCA 3PX3A 2OYSA 2OMEA 1JE1A 4ZAFA 4DR3B 4MV5A 1P7WA 1UOQA 4JL8A 4F6CA 5BWLA 4ZVSA 3RO7A 4U7JA 1C1DB 4A15A 3HU2A 4MV1A 3W04A 1IMOA 1PK7A 2LUOA 1UJ2A 2DAPA 4NNJA 1YZVA 3A4IA 1ELOA 4JP1A 5DYIA 5A3RA 3TG8A 2DF8A 2ZTHA 5AUNB 3TR6A 4YAOA 3FTEA 1F20A 3LCMA 4G1VA 4Z7QB 1WMBA 2ZVPX 4FE4A 3V4VB 2QN6A 1KNXA 2XODA 4UMDA 3T6KA 1JQDA 3M1IA 3NM6B 3TH5A 4CMBA 1YA6A 1DGQA 4XLTA 1FP4B 4G5YA 1HZZA 3L43A 3MFQA 3T5DA 2G6TA 3FLAA 3N75A 4F2DA 1Q2XA 5U1PA 3W1EA 5T4EA 4MYUA 2C2WA 1NE7A 1M73E 2NUTB 4G25A 4WZBA 4CKWB 5AOVA 2ROQA 3SI7A 3V8EA 1A04A 1QHHB 2C8KA 2H2FA 2GCGA 2HQRA 3QKSB 4M9RA 3O26A 4CCWA 5B1YA 3U7HB 3N05A 4C06A 4R1OA 1NVDA 1VRCA 1CY4A 4P54A 4NAUA 4RK1A 3JD3A 3ZQJA 3Q85A 5H70A 5JROA 1VI2A 1WX1A 1YDMA 1E9AA 3CZ5A 2LDBA 4L95C 1HT2E 4BP3A 1A7UA 2NZYA 3DHWC 3OMXA 3DMNA 3FECA 1O54A 4UEJA 1D2GA 4UTZA 5GP1A 1OB5A 1Q1BA 5BSTA 2VUTA 1LDGA 1PL7A 3N6RA 5CX4A 4GMHA 1ND6A 4HN9A 3N2YA 1R6AA 4Q37A 1XXHB 4A2QA 4IVRA 2CWWA 4LJ4A 4V0QA 3CE6A 3B3QA 4PLVA 1DWPA 1RZUA 3FWYA 2XBMA 3PF9A 3QYAA 1RBMA 4D45A 3O7WA 1UFKA 3GVIA 1Y3BE 3S2EA 3Q5GA 4NZNA 2CCGA 3PE4A 2ZUSA 3V2IA 1WMFA 2BE9A 3SIXA 2HQOA 1VE7A 1GD1O 1H2HA 2HTEA 1DTSA 2Q4RA 3BRWD 3HKEA 4RABA 4RZIA 5IBPA 1RVV1 5EHQA 3P32A 2QUHA 3K73O 5JCOC 3BSFA 1C5KA 4M89A 5DYYA 4BB6A 1JECA 1CY0A 3RNOA 2CMGA 1I24A 4UBIA 4DV5B 1PVOA 1FFEA 2B94A 2JASA 4OQFA 1M34A 1TUEA 2OCYC 5H5JA 1JEOA 2YRFA 2PUCA 2ZVJA 2G9RA 3O9MA 5KTSA 5CD1A 1TMOA 3A9UA 1MORA 3WG9A 5LUAA 1JQBA 3WGNA 1DBIA 4ZALA 2BEUA 1ZW6A 4JP5A 4OXXA 3WKCA 5HEKA 1NV8A 3ICOA 3FUXA 3R7WA 1AQUA 2Q5IA 3IXQA 1JXMA 1QGUB 3L0DA 2RKWA 4Z53A 2ADOA 4PHTA 3CNEA 4K9LA 2FRDC 3F4KA 4ZQEA 3GFSA 3FI0A 4Q00A 3JQFC 3DONA 1EM8A 1EFKA 4ZA2A 1ZUNB 3ED5A 4OO3A 4ZHQF 1SEPA 4WOBA 1EJ0A 3V6MA 2R97A 1TO6A 4HFJA 5TT0A 1G8GA 3NG1A 5EKDA 3WMXA 3ZNOA 1XHLA 3HYTA 3RJ5A 5FBVB 5IYZA 4AO8A 1RAGA 2VQ6A 3AI2A 5HUQA 1M2NA 5JVLA 2Y1XA 2GM9A 1JPVA 1HLDA 2PXAA 1UJNA 1U8TA 4GPEA 1YHNA 4IDPA 1KC7A 3I4LA 1JYFA 1TC2A 2VRCD 5BUZA 4MDFA 5E6RA 3T3NA 2BRUA 5ECWA 3ROZA 3WZLA 5A5EA 2PV7A 3Q3JB 1T0UA 1PJRA 1TKRA 4BYMA 1IY8A 3KSDO 2W37A 1R5NA 2A4MA 3DR3A 4OH1A 1TA0A 3WBJA 4W5RA 2FF7A 2ZJOA 4ARVA 1HDGO 1NONA 3QOFA 1WUJS 3CRZA 4KC0A 3FKSA 4XXHA 3IPRA 1TQ2A 2KHZA 4AYWA 3DP9A 1XRRA 2XNHA 2DT5A 2QX7A 4IR7A 2G63A 4PO9A 5DLYA 4AMGA 1FMCA 4KXWA 3RJMA 4BNFA 5KKCA 1T9BA 4EQZA 2MSEB 3LX8A 2MYTA 3N0TA 5FPYA 1P6XA 4X45A 5A71A 4MVXA 3R8CA 1QIFA 1SY7A 2GYVA 4RPLA 2HIMA 4PU0A 3WFJA 1XMXA 5KB3A 2GRUA 1D4OA 1SBIA 1ND5A 3QTBA 4NVRA 1BVHA 4DKJA 1T43A 2R5WA 4I8IA 5A5FA 5IDQA 3FUUA 1ZDMA 2AH5A 4TWZA 5DNWA 4IUBS 1SC9A 1NQ5A 5FBHA 3KHSA 5B2EA 4EGQA 4LJAA 2O2GA 3T7IA 1UOPA 2HROA 5C51B 1U3GA 4U9HS 2VL7A 2EKLA 5HGJA 3N8IA 2ZJYA 3PD7A 2A0WA 3ONFA 4DC1A 4JXJA 1CUHA 1LWOA 1I1HA 1E5LA 1GPWB 1UFOA 3IESA 4LWOA 4DKXA 1RP1A 1XF9A 3C98A 2JAUA 2DY1A 1Y4DE 2P4EA 4F4IA 3GFRA 1Q83A 3CZCA 2R85A 4Z2AA 2XEDA 3I72A 1NLZA 3UA3A 4YUVA 1H4SA 2P9GA 1R6DA 2XEGA 5JJLA 4TUYA 1G7RA 2A0XA 3WWPA 3ZXIA 3KQLA 1EEHA 5GMOA 3MCZA 3OCJA 4Q05A 4KSCA 4OLHA 2DJIA 1FFDA 2C20A 4E5MA 5G1NA 1W5AA 2AQKA 2X40A 3QVXA 4I8DA 1XWFA 4Q9NA 4XR4A 2VHTA 3UMSA 5DNCA 3ZWOA 3C8MA 1XTVA 1M7BA 2AEJA 3EAFA 3SSAA 4ER6A 1P2BA 4IFBA 3JRNA 1VHQA 3DOJA 3G8DA 1TVEA 2PYZA 2G8LA 2IODA 3B6JA 3IMGA 4JZKA 1LXCA 3EZ2A 4QGBA 5BN4B 5EERA 3IQEA 1EIWA 4TV8F 4R8RA 1DO2A 1O77A 2BDTA 2D5IA 4LVCA 1KZHA 4UVGA 3U16A 3QKWA 1Z2PX 3KZVA 3NPAA 4KUHA 1NF3A 4V38A 3S28A 4CV1A 4YIKA 5CK5A 4F1KA 1M7GA 2BGGA 1RQXA 1RLTA 3FCOA 1DQSA 2NUPA 5FL7D 5ILOA 3IFSA 4URWR 2JFQA 3L49A 3USZA 2R96A 2C7VA 1MP0A 2F3TA 1A4XA 2J0UB 4Q19A 4QODA 1DVRA 4UZEA 3FSRA 5IZCA 2ICAA 1S2MA 5KTMA 5DN6A 2X0EA 1ZCZA 4M1WA 3S99A 1QP7A 1T3HA 3C3MA 9MHTA 3D4PA 4MA4A 4ADSG 4N18A 5JUWA 1QRUA 1W52X 3PFHA 2FN9A 2GAJA 2BBTA 3P9RA 2NSJA 3BJIC 5G3ZA 3V8QA 2VJAA 1PSZA 5C1BA 2OILA 4XWKA 1YFKA 4KQ9A 1MR3F 5IVDA 3SBDA 4KDRA 4FX5A 2R7MA 1HTTA 5CCDA 1XMQB 1WVGA 3LPLA 4QC2A 1NVUQ 1PZMA 1T0PA 2C0QA 1SVLA 3K53A 4TTQA 4L27A 4GKVA 3UUWA 1K8XB 3ZLUA 5IVHA 2HDHA 3ZJTA 2X9VA 3JWGA 1U3UA 2DWUA 4RJJA 4XSVA 3EA0A 1WKCA 1J9EA 3K7EA 3PTLA 4L9WA 2I3AA 5DIFA 5HKKA 4ANFA 3NVDA 2OORA 2XUZA 1L7AA 1HNZB 2IYUA 2R751 5K7SA 2EFHB 4BHTA 1ESCA 2NNWB 4PRZA 1UC8A 4OV6B 2I8AA 2RIRA 1ZH8A 1SHKA 1V1MA 3GJXC 5UKDA 2RAPA 3EMVA 3W3AA 3ADBA 2R00C 3AONB 4U2GA 4XVUA 2KSQA 3W6PA 2AZDA 3EXFB 1OLOA 5DTIA 3WE7A 3Q9UA 3T4UA 4HAVA 4IV0A 5HF5A 4ENSA 1TAGA 4MI1A 4R1NA 2JHFA 3D31A 1WHTB 2HPZA 5IJ0B 5B64A 2VSQA 1UM9A 2QIPA 4Y2YA 1FVFA 4ML3A 2XEJA 2XZPA 4M46A 2CYAA 1MJGA 2ZIXA 5K0LA 2A5GA 2QTMA 4Q24A 1VIDA 3NTXA 2H08A 1SU8A 3C15C 3TD2A 4QQRA 4A0GA 2VUUA 2FPPB 3RUDA 3K2QA 1TF7A 2IZ7A 1I0ZA 5D1NA 3REFA 1NVWQ 4M37A 1VE1A 3DEKA 3NWJA 3QU2A 5H4HA 4XIYA 4AY6A 4UHCA 2Z6AA 1QMPA 3IMKA 3CZQA 1P5HA 1QYWA 1XEXB 2KS6A 3E3OA 2VK1A 3H9CA 2ZCVA 4TMTA 5F7JA 3ER6A 4C89A 1ITZA 4B4WA 2HF2A 4N0MA 1QZTA 1KFBB 2CL5A 4RVUA 1WZ2A 4GEGA 2F3PA 4GOKA 4NX2A 2ZU6A 4W7IA 4D9GA 2XKKA 4PM4A 3H2GA 1O6BA 1DXQA 2AEFA 1PW7A 2VTBA 4GPD1 4E08A 3SAJA 4AECA 2JCGA 2C82A 5FBZA 2DQZA 3SFZA 3VOSA 3IALA 1G8JA 3VR6H 3W2GA 2WA1A 4D6XA 2Y99A 2V45A 2GD1O 4JR2A 1OXUA 5BSHA 3H5WA 2H11A 3S2GA 1P2VA 2WIJA 4C0WA 1RQPA 4RTRA 1KQOA 4EGCB 2QZZA 2Y93A 3ND8A 4ZVKA 4ZI7B 1TQ8A 2DPGA 1L1EA 3PUKA 1DMSA 1A7AA 4C84A 4U6QA 1U3DA 3AERB 3KPVA 1NUHA 2WNSA 2FGKA 3EVDA 2W6PA 5AQEA 5CT4A 3CNBA 2BM0A 2DFPA 2R2AA 5FA6A 8ADHA 3S9MA 4RZUA 1GNSA 1Z06A 1C7RA 1QONA 1MDFA 1C3VA 5HCUA 2XVZA 4KE6A 2AR0A 2X58A 4CIXA 2R84A 3CO0S 4RK0A 4HQFA 4BNGA 1FYFA 2Y1EA 5DHQA 2LRHA 2INGX 1II8B 4K28A 2Z8YA 5C8VA 1A9QA 2WDPA 3BGWA 3F7MA 2XUIA 4IM7A 5AI6A 3NC4A 3JD0A 3SVTA 1Z45A 5JD3A 1DG1G 4WBNA 1Z39A 4UVHA 3AYXB 4ZVMA 4YV0A 3RKUA 5J2UA 2MR6A 4X92A 4QJ5A 3GLUA 2J3DA 2OXIA 1XUOA 3HHEA 3AUTA 1W6RA 4WJKB 3ZU6A 5JBIA 2P9HA 3IAEA 1IBRA 1JL3A 1FYDA 1XEWY 1Y3DE 5HPYB 1Z6PA 1FP7A 3B3FA 3RASA 2VA8A 4D9CA 3IBTA 4C6HA 2Z2ZA 5T6MA 1PVVA 4RKRA 1VG0B 1LJLA 1Z6QA 2DTEA 2J3QA 4HI0E 2PO5A 1ZXLA 2EHDA 1Z15A 1X6VA 3KYBA 5B3LA 2YFYA 4KZPA 5JSFA 2GD2A 4D3FA 4S35A 2DUJA 1QJ4A 4DBLE 3DYBA 4FFNA 2NZ2A 1SG0A 5TGTA 5JD4A 5GV7A 4ALNA 2O5RA 4RS3A 4N5LA 3EUFA 4C0BA 4KYVA 2FPGA 4G65A 4R8KA 3UMVA 4C07A 5TIIA 3GWGA 3K6SA 1SO8A 3CW8X 1FQJA 5DPMA 3W2HA 3GAZA 4KTTE 2QL5A 3D1VA 4V0KA 3UV3A 3V7YA 4FQ8A 1ENZA 2SCUB 3C5VA 4LJ9A 5AUPB 1RAAA 3QFCA 3DLCA 3PKJA 4RMGA 4DUYB 2RJOA 4RYLA 4MS4B 4I4IA 2GQ0A 3ZWQA 1DAMA 4NU6A 3VPFA 1RHMA 4JBIA 2BTQA 3IHTA 4CUZA 1LRJA 1XRPA 2YW2A 1GQ2A 1XE3A 3BMOB 4BZZA 1RAIA 2Q4OA 3EZBA 1TJPB 3HABA 1KPGA 1Y3FE 3B1YA 4DLNA 1FTWA 1XZHA 3VVBA 3ZE7A 4JJZA 5LXTA 3C6KA 3VJRA 3PUXA 5FKJA 1L7MA 3AR3A 4N41A 4XAQA 3Q8XB 4FXOA 3IDSA 3L8CA 2FGJA 4YRTA 3WISA 3ZYCA 2H00A 4D4GA 5J1SB 1FW6A 4PICA 5ICGA 1IPEA 3H65A 4GC5A 1LFAA 2LIVA 2R8OA 3AEZA 3ICQB 5EMLA 3LW8A 5CDFA 4DSZA 1Y4ZA 3TYXA 1XDZA 2V7GA 1NMQA 1OVMA 2OM2A 5FTLA 3O4FA 1PYDA 4L2IA 1QE0A 2EQAA 2EVWX 2H7VA 2UV8A 1I4LD 3OP4A 4UAVA 5DMXA 2A57A 3TMAA 3PRYA 2ZCJA 4O6VA 3W05A 2PUEA 3DDNA 1M10A 1HMYA 3QI2A 3R41A 1FPQA 3FROA 2G7MC 3OT4A 3V4PB 4ZI7F 3FYTA 3WK7A 3MTAA 3GRYA 4K0KB 3GRUA 1L4EA 2V0CA 4JOBA 4AZ0A 1XOIA 4C2UA 1RJFA 3P19A 4PX2A 5BYAA 1H69A 4BVGA 1R61A 1PWEA 1F51E 1PSWA 2I2XB 3FYUB 2ODAA 3MILA 3KVVA 4KTVE 4L0QA 4FK8A 3BIOA 3P96A 2IEGA 3VC2A 1U2RA 1W4ZA 3W5UA 3I9LA 4A2PA 3E53A 5KNDD 4FYHA 4PC6A 4XCQA 2D7DA 3VKHA 5B1IA 1N77A 3DO5A 1AV7A 1JNYA 4JC0A 4TS1A 3IO5A 3KAKA 3OPYA 5F1PA 2XV1A 4PRLA 3NP7A 1Y9AA 1RADA 1GQRA 1H9BA 3TW0A 3PP8A 3K5PA 4B6SA 1CF4A 2OBYA 1ADGA 1ONPA 2XVYA 2A1TR 3MUFA 1F17A 1QQ7A 3LY5A 4MOWA 2EHJA 4QECA 1BGXT 5E7JA 3FDFA 5FNZA 4AJLA 4RTSA 3LX6A 4DQUA 1HE4A 4PX3A 1U2ZA 2C2YA 3LK7A 3USCS 3WA6A 1G2QA 1OGIA 4Q3OA 2BFOA 5AVYA 4LZLA 5GONB 4CCYB 2NYRA 2J0VA 1VLLA 2ZJ8A 4HWTA 4F5YA 3F5SA 1YDGA 3CUVA 1M7HA 4ZC8A 4JXKA 2HLPA 1ZRNA 3V1YA 1XTQA 1GXSA 5FHQA 4K9KA 2PR7A 1M0EA 2FK8A 3ZNQA 1EWQA 2XXBA 4O3FA 4WSOA 5FWNA 3BX1A 4MVJD 3RU3A 3NKFA 3O2SB 3SS7X 3SYNA 2VJLA 1P33A 4YT4A 4YONB 1NDHA 4R2HA 4BO9A 2A8YA 3OTOB 1RWPA 3KE9A 2IE0A 4P5DA 3X44A 1Z2EA 2GYUA 3ZIDA 2C5FA 2C99A 2DLCX 4CM8A 2YV2A 3TNLA 1WCIA 1Y7IA 3I05A 4WECA 5D7BA 5NLLA 4D0LB 5AVRA 4MQBA 5JSYA 3QSYA 2BYTA 2VT6A 4CM1A 1KPIA 3Q3IA 2YUTA 4OU5A 4KR6A 2WZBA 2BTEA 3PBKA 1DB3A 2AA3A 1UWVA 3H8WA 1DC8A 1P4SA 1FB5A 2VJBA 4IJ6A 2JKYA 2B25A 3KAJA 4LHEA 5AYVA 3LBYA 2ZZNA 3X1KA 2ONYA 4ZCSA 1RRFA 1PFQA 3I09A 4XUGB 3PFBA 3RI3A 1E3TA 2W6MA 1H85A 4F4HA 1PFUA 4LTMA 1XHFA 1NQVA 3FNBA 3UIEA 4NQZA 1T4MA 1JHMA 1L7PA 3PPYA 2NUTA 5IJZA 3UK6A 3QKSA 1G1AA 1CY1A 1N0WA 1ZL0A 2P2ZA 2V7TA 2DCMA 3K4PA 3KWMA 1FXUA 4KH0A 1YZTA 3FPGA 4Q7QA 1WSBA 1ECLA 4Q1DA 1J0AA 3LOUA 4M9QA 4Q7JB 4L6CA 1FFCA 1KYVA 2MDTA 3JQ7B 4MHOA 1CRZA 1M1YB 3PEYA 2Z30A 3ZE1B 4CM7A 1GNTA 1PLLA 3ADPA 1U9IA 1YB4A 2XKJE 3JYNA 4PLTA 4Q3AA 5DI3A 3TGPA 2DUUA 1N2GA 3MUEA 3EWSA 1Z0AA 2BKUA 3DQZA 1VXOA 4DLRA 5ECGC 3ZIUA 4S1PA 4D92A 3GVCA 1XXHA 3A9CA 1XTTA 4EHKA 3IQXA 5HIIA 4DBLC 3BGDA 2W2TA 1O7JA 2EZTA 2HX1A 5AJXA 4AQ7A 1QFYA 2J3KA 4UDYX 3VU0A 3K20A 1ONBA 2XB4A 2PBZA 3ZZ1A 1K06A 1L5NA 4PCLA 3ELBA 1QBKC 4TS4A 1J8YF 4FEEA 1Z0ZA 1QMGA 4II2A 5AJTA 5EINA 2G04A 3A7EA 1VLHA 1Y8CA 1G98A 4FNAA 3WI7A 4PFSA 3CH5A 3R3UA 3AINA 4CM4A 1UK9A 3AUYA 5EXXA 2BZ0A 1E7QA 3C8HA 3M89A 3PD0A 1TVCA 2PFKA 3IO3A 4MKZA 4RIHA 1RYBA 4QFBA 3R7BA 4MRMA 1IAVA 3N2EA 5A5DA 1B6RA 2A5LA 3CN9A 1DDIA 3LFHA 3WJ1A 4BNUA 3HKCA 3ECAA 5IEJA 1SQFA 2K4MA 3QU9A 2J9ZB 2PRIA 3OZSA 3H2YA 1W46A 4WT7A 3TLXA 2GEKA 2JAPA 5I7HA 2J3IA 3W78A 2Q0XA 2AFHA 4GZMA 2FPIB 3M6AA 4II7A 3TAXA 7YASA 5HYVA 4K6GA 4EM6A 4Y2GA 4A82A 5AM3A 3UQYS 2E48A 4ZT6A 3R76A 2OV3A 2VK8A 2P69A 4FGUA 1X70A 1UBFA 2AW5A 5LDDC 3IKTA 5DX8A 4ECEA 1L4FA 3O93A 4XW2A 3MWGA 1K08A 4S12A 4BU1A 3QLVC 1M2VA 3ICCA 4B43A 3U9SA 4IVPA 1GFIA 3A7DA 4GI2A 4BEVA 2WPNA 3QEKA 2B4KA 4HWKA 4INJA 4JJ4A 2IYPA 3BQ9A 3KTDA 2RJNA 4G4IA 3O0DA 4Y6OA 3K9WA 4KMMA 4Y1RB 4JX8A 2QVZX 4R4JA 4KX5A 2VWGA 1BEZA 1ZH2A 3NPMA 4EELA 1ISJA 1I7PA 1B8VA 2VAPA 4N3GA 3LM8A 4YNBA 5C4IA 2IPLA 2F90A 3FZEA 4ZANA 1Y81A 4AX4A 4IS2A 3SIPA 4LCBA 1LBIA 4F11A 3T99A 2ZREA 3SD7A 3WAKA 2QR3A 4IF6A 1HOTA 2Q3DA 3UAVA 4HQKA 5H9VA 2AE1A 3KTAB 5B37A 1MZVA 5B58C 1BFDA 1KBZA 1KFEB 4MRRA 5CGQB 5GM1A 1PZHA 4GI5A 4BNTA 3MYRA 5HSGA 3S6JA 4RY9A 4DLXA 5I47A 5DHFA 1SUEA 1EHYA 2O3JA 1IPHA 1Z37A 2CN1A 1PEKE 1N2SA 2VJDA 3LY8A 4FN4A 4YCJA 3UJCA 3LQYA 2QTZA 1E2BA 1YTUA 2ZWIA 3D54D 1LI4A 2ECOA 2IT1A 2PTGA 4P3XA 2FP4A 3RVKA 4CR8A 4AWBA 3AIMA 1L5GB 2V9PA 4HATA 1I1QB 1NRJB 1SB9A 2WWRA 4CDNA 1U3VA 4QD3A 4ZRNA 3E8SA 2FF5A 5JTUA 1X19A 4TVOA 1H2YA 2YWCA 4YJ3F 3DC7A 2WJ4A 5JZSA 3FCXA 3X0DA 1R37A 4LS3A 2Q3CA 1OI3A 1TNDA 4J1TC 5EI5A 2AN5A 5HF8A 3TR5A 1XP5A 1WBJB 5ER6A 3NMUF 4MSUA 3SF0A 3T0FA 4M0CA 3M5PA 2YVAA 3QPBA 2ZE5A 2LZ0A 5FNVA 2PBLA 2VH2A 2HU8A 1P62B 2FX2A 1Z4JA 3SK0A 4WK0B 1UMCA 5IUKC 4F60A 4OVKA 3H6GA 2MHCA 2WYUA 3U4QB 4ARAA 2VEOA 2CXPA 3RIYA 3KBOA 4G2TA 3HKDB 3GMSA 2C3YA 1TQDA 1XK6A 1YKGA 3AHIA 4X9XA 2HMUA 3G8YA 3JALA 3R7FA 4BE7B 1BXZA 1UJ4A 5K0BA 1MT3A 5HKBA 1UPBA 1FXSA 3BEDA 3LGXA 3L6OO 3MD9A 4L9AA 3TEFA 4ZN6A 4UEKA 5IARA 3TB4A 4KIWA 3TIVA 3R0QA 3RYFB 1Y6JA 3A3YA 5KNBH 3DLPX 4PO3X 1OCEA 1P0MA 4LQCA 5C46F 1I6LA 1PR4A 2NU6B 3DE4X 3VI3B 3HYCA 4M60A 3W6NA 3C3YA 1UPCA 5BN4A 4HMQA 2PWBA 4AMUA 3NBQA 4BTEA 3SG0A 1MV8A 4L73A 1X2EA 2ATIA 3DZ8A 4QYTA 1PTKA 2WYHA 1XYVA 1MXHA 2A3RA 2VNJA 1HLFA 3E9CA 5ALOA 1G18A 5EKSA 4DRXB 3Q8LA 1PR5A 3A9WA 3NV9A 4RD6A 5D5QA 1PGNA 2QLLA 1TQ6A 3B82A 4OOFA 1J8QA 3A0RB 4JQOA 3KPUA 1DFIA 2RAUA 3R0ZA 2ETXA 5HQ3A 2QVYX 5JMWA 2J0UA 3FCEA 1GU7A 2DGDA 3RABA 4EYSA 1DPFA 3AHCA 4WI1A 1NJ2A 1YBHA 2R1VB 3R7SA 1Z33A 4KPGA 3DUWA 4XLZA 2R8EA 1O5OA 5JRDS 4MUBA 3I9NA 3ZBTA 4A6XA 4CFSA 4YCBA 3LHFA 2WFMA 2Z2XA 4HWOA 5JXWA 1ZJZA 4RF4A 3U3KA 3RJTA 3ODPA 5KDOA 1QH1A 3IAHA 2GERA 3SNHA 3H4MA 1NC1A 2XGOA 3GFFA 1N3IA 2AF3C 4ITRC 1B0AA 1Z4LA 2DPXA 3AWIA 5LKRA 2FDCA 4K9PA 5L4NA 1Q17A 2E5FA 2PRSA 4UPVA 2QP9X 4TN5A 3DUFB 1SCBA 1Q0RA 3L7AA 4CW7A 1F1BA 1G1MA 1Q6YA 3TFOA 1P2UA 3KR9A 3WYAA 4YV2A 4B7AA 5DISB 2FG7C 4IVNA 3OZFA 5BY2A 2GYWA 3CLRC 4PZPA 3IS3A 1UP6A 3L6CA 4NECA 4BMPB 1K7FB 2QI9F 1W36C 2BONA 2HF9A 1MJHA 1NBMA 2P2NA 4K26A 4ND4A 4A73A 4L8YA 1QRRA 2YZGA 3OKFA 3B3GA 1CG6A 3GFBA 3LYLA 4S1OA 5E9AA 4AJ9A 4YP5A 4EUHA 4FVTA 5K0EA 2QDXA 1GZVA 1E6WA 3QBVA 1SBQA 1XNHA 4WFJA 3LTNC 2C5QA 4TLCA 2DKNA 4Q9IA 3P2KA 3BVPA 4KDFA 4L9SA 4LNHA 3PQ7A 3C48A 3EQ8A 4L5AA 5H83A 1QVRA 9LDTA 1J90A 1F8FA 4I55A 4UM9D 5HG0A 3SYMA 1UFQA 1UKZA 2AFRA 3UXHA 3K2IA 3AOEC 3TZHA 5BNTA 1U5BB 2FU5C 2H1HA 4WFKA 1WHTA 3OBBA 1T2NA 1YCFA 4PX9A 2Q0SA 4N6NA 4REMA 2Q7OE 2IXFA 3H5VA 3OVMA 1D0IA 3MOGA 5TGZA 5ALEA 1MX3A 2DHQA 3O9ZA 3U7GA 3OP1A 3PEFA 5IULC 4BWGA 1FMTA 1EDEA 4DMFA 4J4BA 3CLSC 1Z0JA 2QRZA 3MC1A 3PIRA 4IW3B 2GF2A 4F8JA 1W5FA 2G83A 2I80A 4FMCB 1DAFA 1I36A 3DJYA 4NYIQ 3BOSA 1DO0A 2FFAA 2XRFA 3ENKA 4C04A 1JWAB 2UYQA 1UDBA 1CBUA 2J07A 3GHHA 3I4FA 3LFTA 2VNAA 4IGAA 5K2OA 3VHXA 2OY0A 1TI7A 4FZRA 3BIWA 2W2NA 2XGMA 4I50B 4Q9LA 3SZUA 4D6PA 4DA9A 3RRFA 1U1FA 4EVQA 2VPWA 2D2VA 1A71A 1BMDA 4L16A 2VCHA 3HLYA 5JG7A 1H9AA 4GU5A 4P4LA 4V39A 4C3VA 4YRZA 4ETWA 2XMBA 1XLTC 3M3DA 3OT5A 2VUIB 4WZAE 4X1KB 1KHHA 2Q9BA 3CPJB 1A69A 1U90A 2G9ZA 1WXFA 2J09A 4K2HA 3R9IA 1IZ9A 3VU8A 3X1MA 1ZW1A 1WG8A 1DZIA 1Z8DA 1HL3A 2PVSA 2X0RA 2XQKA 4L3OA 2WM8A 4REOA 1WD7A 2AQIA 2WTEA 3JAKB 5EJAA 1AZLA 1W19A 2G25A 1ISHA 1EGAA 3DLAA 3NRBA 2BV3A 1VZ2A 3ESAA 4NEQA 5P21A 1Q15A 4LJ8A 4D02A 4PN3A 3RYCB 1DIHA 2BMAA 1D0VA 2XYGA 4K2AA 4FR2A 3EOBI 5FA8A 4DEYA 3L4SO 4J7UA 1G2PA 4FYPA 1VYVA 2YVUA 1KETA 3NAZA 4QRDA 3M5DA 3QMVA 1BDJA 1VECA 1PS9A 3FMPB 2O05A 1OHHA 1EG2A 1Z6AA 1BH6A 2VK2A 3BTUA 4I1UA 4KFSA 1TZKA 2ERXA 2QV0A 2MU1A 2O23A 5A6SA 2H0QA 3FMOB 1C1YA 2ZPTX 1KDYA 4NFLA 3ZZNA 2IF0A 1ZXBA 2RI1A 5A05A 3RRNA 2Q3MA 5DE3A 4QATA 1RQ2A 1MT0A 3JTMA 2HXGA 5F9FA 2ZUVA 1MOQA 4OLJA 1GUFA 3FHCB 3GLRA 1ECBA 1RYDA 4KQ6A 3WZ2A 4PNEA 5TARA 2WHYA 2RI0A 2ZG6A 4I1VA 5DFAA 4NGSA 3PC7A 3TD9A 4CNQA 3OEWA 2I87A 4KLRA 3TD6A 1UKCA 3DZJA 3NYWA 2VJYA 3GXOA 2HWWA 2JBWA 1Z0IA 2XITA 3DVRX 1XC7A 4UMVA 3SKVA 2A5FA 2EF1A 3L07A 3OCCA 5KNLA 2Q07A 4I9HA 4E03A 1Z5OA 1U8ZA 3OUTA 2O7SA 4GG1A 4UEOA 1YIDA 4LMPA 4MDEA 3TFQA 4PYOA 2W6ID 1UZAA 4S0ZA 5I9IA 1N0IA 3B5IA 4E15A 3A37A 4CI9A 1CUCA 1RKVA 3DR5A 5EWMB 3Q7QA 3T7AA 3Q41A 1YQWA 3GK3A 3IVAA 3TIXB 1SVNA 3D4OA 2IZ1A 3R3XA 3S1AA 3D5TA 1G0NA 1P1RA 5EN4A 1ZGBA 1DC3A 1T9CA 1V7QA 1ZPDA 5JPDA 4FOLA 1KMCA 4K88A 4KIGA 1GV1A 3TRFA 3B1ZA 5KUTA 2QUIA 1P1JA 1P1KA 1YE5A 3HCPA 3IUQA 4FGSA 4HRYA 2QJTA 3GRKA 4KSBA 4ZZ2A 2JNWA 3WK9A 5T3YA 1I6KA 1P91A 1QNLA 4L0CA 3DXZA 2HWKA 4KJZA 3HM9A 4C6TA 4IIUA 3N7AA 3KWFA 1KI6B 3DT8A 3PPIA 3EE6A 4IGEA 4EDHA 4RAQA 1LQUA 4XARA 5KU1A 2JL1A 3R7DA 3JAMA 2SCUA 1Z8FA 3OETA 2C94A 5KO2A 4RK5A 1J0CA 1Z68A 3UHFA 4GR5A 2WDZA 3A31A 1LDBA 1SHTX 2LVBA 3TTYA 2PTHA 3UJ7A 5JJBA 5TLSA 3JQBC 1ODKA 2IOFA 7ABPA 2FZKA 3WNVA 1ZAYA 4KV7A 5JWOA 4MV4A 4LJRA 2QL9A 4NHEA 3EVEA 2F4VB 3HUTA 3HPRA 4MLPA 3SP1A 5MHTA 4R8LA 4MJXA 2B7CA 1K66A 4HUJA 1RIIA 3C3PA 3GJZA 2RHHA 2EKQA 2CYCA 3LAWA 1HFWA 3F5QA 1FE8A 2P35A 1P80A 2PMEA 4H9GA 3T0GA 1JQ5A 4HGOA 4XD7A 3NV7A 2CC2A 3E2IA 3LQQA 4ND8A 3EB9A 4C01A 2QXTA 1P44A 2QN2A 3OOJA 2VP3A 2XXJA 4TROA 4EB3A 2IEZA 3L4JA 3HO6A 4RWZA 2BFDB 2MSDB 1AKNA 1DTWA 2QW0X 3DOUA 1CYEA 2HN9A 3PU6A 3N86A 4UU1A 5LLSA 1RWXA 1Z0SA 2O20A 4ALLA 1AO0A 5ILGA 5A04A 1OKKD 2V6IA 3COPA 5LM3A 2BC9A 1CUSA 3DV0B 3BWEA 3I2HA 3K0FB 1A5AB 2FWBA 2PNFA 3C6ZA 5AHKA 1JEDA 1W94A 3R9KA 4BMZA 3MK31 3IMEA 3RHTA 3IBYA 4YV7A 2WUEA 4CEHB 2GBLC 3KJNA 3VV2A 3FYUA 1ZFNA 4D43A 2B0AA 3K71B 2D1RA 2WU3A 2NPFA 3DOOA 2V74B 1SHZA 3A32A 5EKXA 4B44A 1S3IA 2PGXA 3K09A 3PFFA 1Y98A 1FDOA 1KFKB 1MUUA 4JP8A 1E7MA 1E79D 1LJ8A 3OQJA 1CQJB 1QDLB 2A35A 5CDUA 3IR6A 4B74A 3F3MA 1UBNA 2PKRA 1Z26A 1FDRA 4ROTA 1YR9A 3ZW7A 5ADWA 4KMOA 3CNOA 1D04A 3TMKA 2OP1A 2I7DA 3R0IA 5HP4A 1VKRA 2WMOB 3ND9A 1PL6A 2BFFB 4JJ7A 5GONA 4ZCLA 1KARA 4CCYA 1E6EA 3AG5A 3P2OA 2DECA 3M5CA 4XUEA 3ZWXA 2ALJA 1I3LA 2BHSA 5EZYA 4E1VA 2WWYA 4RMIA 5BVHB 1W5EA 3NQ41 1NI3A 1YZLA 1WCV1 4ZJZA 1SKYB 2NQ2C 2YHIA 3F3KA 4A27A 2O1EA 4KQMA 5JSZB 2N9UA 4DGQA 1SIOA 4X1YA 5IBQA 3BYZA 1RI1A 5JPCA 3N76A 1KC3A 4OJQA 4FUQA 1O3YA 4GPTA 4MQLA 4PVCA 3TIIA 6REQA 1TCCA 3E22B 2WMDA 4I1IA 4GIBA 3AUKA 1NLUA 3EIWA 1NJGA 1C9NA 3KQYA 4LMRA 4ZEWA 1Z5ZA 3V1TC 1U1CA 4S0XA 2RIPA 4ZV4A 4OSOA 3BEOA 3TQFA 4D44A 5JDCC 2IQIA 2W6ZA 1DBQA 3JWHA 2CJWA 1HDIA 3DL4A 1Q44A 2GMWA 2NQ8A 2C58A 1WW8A 1IWPB 4OMEA 1QVWA 1HQDA 2PPLA 5BMVB 1Z35A 3AUFA 4GQBA 4KPUB 2C9ZA 2GZAA 2HCFA 2ZBQA 4F1JA 1JNXX 3AEKB 2IXGA 4TWEA 5LQJA 4PPYA 1JKFA 3NTRA 1FRNA 4MHTA 3PUJA 1N2ZA 2R62A 4DT1A 1JFLA 1W34A 3UZUA 4FS8A 4MYDA 5CBKA 3LW7A 3GT0A 2HBZA 3KELA 3KG2A 2P68A 4FSXA 3ZEAA 4NGNA 3FHJA 1C0IA 1UMBB 2O6HA 4MQFB 2X41A 3FA2A 3JQ7A 4Q4JA 4M55A 5DGCA 3WGQA 1BTOA 5EIXA 2YQZA 2B8EA 3VTAA 2NACA 4YALA 1H0SA 5ALTA 2PL3A 3X1YA 1FQOA 3O3NB 5JC8A 4QLAA 1SXJD 5AW4A 2OXCA 2AOXA 4RVNA 2OAQ1 5BUSA 5JS6A 4U7GA 3G1TA 4HWSA 4NOJA 4QPZA 5B7PA 1QHXA 2ERCA 2YNMD 5CRIA 5AOBA 4F3YA 1ZZEA 1TLLA 3GCDA 4YMSA 3EW7A 1QB7A 2G1KA 4N76A 3KO8A 3D9QX 4QUKA 2GZRA 3SJFA 1PNQA 3DWIA 3NHUA 2BFCB 2I91A 1IWBB 1VKHA 2D5LA 1OC4A 4MNTA 1S2NA 4L9RA 4MO9A 5EIHA 3HEBA 2I2CA 3HY3A 2J5XA 4BMYA 5AVUA 2WB2A 1JHUA 3V3KA 2I6GA 2J5QA 2OFWA 5EE0A 2GTHA 4RVHA 5A1JA 1WB9A 2JLVA 3NLLA 5KIAA 1FTQA 4Y9RA 1U80A 4YJKA 3BA6A 2AX4A 1CR2A 1O9HA 3ZXUB 1Y42X 4R05A 3QVLA 1RRGA 2IBSA 2J46A 1UC5B 2EXXA 1P17A 4JLBA 2FPIA 1XDSA 1T0JB 4AJ4A 1UBMS 4GBMA 4KQGA 4A5OA 3AGQA 3P45A 2HEGA 2ZJBA 4NNOA 4RXTA 4EHJA 1A9SA 4H3KB 4KMSA 3PXGA 3EZEA 1A4RA 1NJ5A 3GAMA 1DQRA 3Q5DA 4UHBA 3V8PA 3VDXA 1EDOA 1NVEA 1E1QD 1L7DA 1COWD 2JH9A 2GHTA 3GDFA 2O1SA 3GA5A 3O8NA 4M1MA 2PGIA 1A5BB 4R9RA 3BD9A 5G40A 5A6SB 4Q47A 4Y2QA 4FDAA 5CDHA 3QV2A 3KCQA 4H0NA 3PICA 1XGKA 2F62A 2H0RA 3FPFA 4GYYA 2Y66A 1SKUA 4IFIA 4X93A 3M0EA 3W1VA 3CNLA 1H2WA 4RLHA 3AETA 3K9GA 3I04A 1WW3A 3IQDB 2PWZA 1WHSA 1CDZA 4GZLA 4HB0A 2ZRLA 4RTJA 2OL4A 2F1JA 1JU4A 2C9DA 1BXRA 1XZNA 3G1UA 3UB3A 1T1EA 4MGYR 1RJ9A 1EK6A 2VZ8A 3W7AA 2WIFA 3DOFA 4XQCA 1UKYA 1IU9A 1QG4A 5EZSA 2AWNA 4TLDA 4XVRA 4YFVA 3ESYA 4Z4CA 2XNCA 5JH7F 2GZ2A 3ZCVA 3VH4A 1YBAA 1H23A 5EMNA 1MB2A 3KSRA 1WEKA 4F84A 3GLGE 1T6XA 4O4IF 3KTAA 2MYNA 5EHIA 3WIEA 3FR7A 2NSYA 2ISCA 3ISVA 4LJLA 1YDEA 3HV0A 4OHVA 4WERA 1R5OA 2P7HA 4ZQCB 1DQNA 5FUXA 3UJPA 4EYQA 4KFCA 1Y89A 2GPBA 4RDIA 3ZUPA 3H13A 2G8NA 2P6OA 3CM0A 4JL5A 4EI7A 3KZKA 2DLNA 2P2YA 4I1OA 5DI9A 4B47A 3FZQA 1KO1A 4HX2A 3H97A 2QE7D 3F49S 1SOWA 3N0WA 1Q77A 3KYCB 4CFZA 1C2YA 3O2NA 1SU4A 4MIKA 4TS9A 3TOCA 5JJIA 4Z9YA 3C1UA 4QASA 1DP4A 5I7FA 2BGWA 1SXPA 1MPXA 2PL1A 3K0CA 1N2HA 1OFVA 2Q5CA 4WVFA 2OZPA 3KS9A 2IEAA 4N40A 4WOCA 3WWDA 1ISPA 5HFAA 2YYZA 5C1IA 3RGGA 2NVOA 2P65A 3DE5X 3MXTA 5L6MB 2FPXA 3VNVA 3CLVA 4S1NA 5CJJA 2EJUA 3EQ2A 3LOPA 4G1BA 3RU9A 1WUHS 3U7QB 2P3LA 3FR8A 4REQB 4BJ1A 1DCFA 2OO5A 1RXYA 3D6HA 4CO9A 4HZIA 1DOZA 2QMYA 2QPAA 1O95D 3NNSA 2V58A 2V7XA 3P9PA 2J0SA 4BV9A 1M2HA 3AVWA 1Z7WA 3AJ8A 4KQXA 1NW8A 3DKRA 5JISA 2IEBA 4M7OA 2P6RA 3I23A 3U4QA 1TPZA 2C8VA 3QGMA 4QICA 1E7RA 5T67A 3T7KA 2HNKA 3VKVA 4TVBA 1JXOA 3I39X 3NB0A 2EP8A 4J2TA 4OHRA 4DA7A 1YE8A 4F2WA 1LX7A 2QVGA 5IVIA 3VYSB 2JFVA 3AKEA 1OH6A 4PPQA 6YASA 4MV9A 4YAIA 2JIBA 2BKAA 4Q4DA 3SXUB 1SVSA 4YCLA 3HLTA 1YZHA 4FGJA 5FJIA 1EGVB 1HDEA 3GP3A 4M7WA 3A1FA 4R1LA 3RYFA 5LWHA 4QNNA 5TQ2B 4N5HX 4Y3UA 1BWPA 3TG2A 4BNIA 1XTBA 2PU7A 4RA9A 4RF5A 3P9ZA 1LWNA 1NVVR 3STVA 1D1TA 5CVUA 1THGA 3A6EA 5JYCA 1K3UB 1AU9A 3EA4A 2VDKB 4XI9A 4V2IA 2C92A 4NESA 2H1OA 4CL3A 4P82A 1PT9A 2R47A 3FF1A 2E7ZA 1B4DA 1M3SA 1IULA 3PNLA 4J0FA 2BVNA 1PQUA 4G1UC 4U9IS 5K51A 3VR5H 4D98A 4OK6A 2ZYTX 3ABSB 4LXIA 1N6OA 3ROGA 3CNQS 4QBHA 3HGMA 5B7GA 3I2FA 3KQWA 3I52A 1AQJA 3GCXA 4O0MA 4RNCA 4ZMRA 1SD2A 1VA4A 2G6BA 3H9GA 4YRDA 3K0AB 3TLBA 5HRCA 1J1ZA 4WEOA 2ZSBA 1LI5A 3GJTA 2OD9A 5CDGA 5T7BA 3WAGA 1A7JA 1OXSC 3ETEA 4J7XA 3N8KA 4WGGA 3S2SA 3STTA 4DLZA 4CODB 2EK9A 2GUGA 4UUQA 1GAWA 3NHPA 1A9OA 3JZDA 3ZR4B 1U0OC 2P5YA 2XUKA 3EXHB 2CNDA 2HCBA 3A36A 5TY0A 1L5OA 1KQ3A 3PXUA 4L4XA 1PQ4A 5GGYA 1JIQA 3RQIA 4C0XA 2JLUA 1KAEA 1XAJA 3PJDA 1E5TA 2QRGA 4FEYA 1TLFA 3KJFA 2Q0HA 4DQXA 1L4LA 1OBOA 3B6KA 1W5SA 4MKXA 1RTTA 4B3RB 3DUFA 4WCFC 1RP7A 3QI7A 4K05A 4B83A 4BNJA 5BXYA 4ARIA 2ZVDA 3L8ZA 3VO1A 1E89A 3E81A 2EZCA 2VZ9A 1QRTA 4O4HB 3L93A 2Z4RA 2NIPA 2XGSA 3JV7A 2AQ8A 4GWLA 4QWMA 1AE1A 1P2DA 2P91A 3GVXA 2IXEA 4R2JA 4XX1A 3KQHA 4AKHA 5LMZA 1EI9A 4Z4FA 3VNBA 3H0EA 2FOXA 4HD8A 2F9FA 2CVPA 1OA0A 1RAHA 5KNDA 1JDBC 1ZQ1A 1B2RA 2WEKA 2OHXA 2BISA 4JY7A 1GLGA 1PIWA 2COKA 3G82C 1XRJA 3EIHA 3OZWA 5AP9A 5F4BA 4BDTA 3UC9A 4QUDA 2FM4A 5E2AA 1KSHA 2X0SA 3ZNNA 3WL8A 1U0RA 4PIMA 4D0RA 3GV0A 3KTFA 1NLFA 2WMYA 4FW9A 3OM1A 3V8RA 4XYEA 3MG9A 3EXEB 1U5BA 4WVLA 3PFWO 4B6EA 4Y0AA 1ZVKA 1E3QA 1G7SA 1RBYA 1RKBA 2PT5A 1MVNA 2X3YA 3AR8A 2YKGA 3F5MA 3MT0A 1CJVC 3QVSA 1Z2DA 2WC1A 1ZA2A 3BMQB 1IEVA 4WWHA 2B7BA 4ARSA 4IGKA 5B53A 2HRRA 2XIJA 3H05A 3WK8A 3MINA 4D4KA 1ACMA 3TZEA 1OWPA 5FR1A 1GGOA 4AJ1A 3LKZA 1ZYMA 1YRBA 3QXGA 4Q4AA 3ZCXA 3GCGA 4I2VA 4R9SA 3NDIA 5CPFA 1A2OA 1JQJC 4KMRA 3QVOA 5HF9A 5DNEA 2I7XA 3P5SA 3MELA 4QSHA 2HWGA 2I0FA 4RJIA 1N7IA 2RI6A 3GOQA 1HYHA 4KI7A 4MVJA 3V4ZA 3PXDA 4BUJA 2JLXA 3MCAA 1V39A 4ZGBA 2CZCA 3H4VA 2JCVA 1PK9A 3ACBA 1C3EA 3SJ7A 3DTTA 3GMTA 4H7KA 5T64A 1H8ED 2C0PA 4HXGA 2P3OA 4HNUA 3U6KA 1NUQA 3X2FA 2H9YA 4DRYA 1FLVA 1TECE 5C8YB 1DC5A 5B3JC 1B43A 1U65A 3E9ZA 4JELA 2TS1A 4MEJA 4D2IA 1JIJA 4PRYA 4DLPA 3COJA 1IHDA 4KRFA 3IR7A 4AURA 3SEQA 3G2KA 4ZEMA 3IOCA 2PGDA 3M3HA 2CBXA 3V7UA 5FFNA 4HB4A 4O0LA 2VKTA 1FP6A 4C8CA 1GRNA 3H16A 3DMPA 5IXJA 1JH8A 4QYXA 1H2ZA 4MGKR 4YRJA 5AQ1A 1J1IA 2OBXA 4RDHA 2MJLA 1GN8A 1MO4A 3DSRA 2Z58A 3QUCA 4N3NA 2HOQA 4GUAA 3NHBA 1A98A 1XU4A 2B6NA 3A58B 1N33B 3RYCA 1Q7EA 2H2WA 2Z2KA 3IIJA 1T13A 2PZ8A 1RYFA 3NBAA 3D0KA 3UJ8A 5BV8A 4W99A 4UOQA 3ZI7A 4BKPA 4AKTA 5HM6A 1Z4NA 1YJAA 2C00A 3KB6A 4J2OA 5MN6A 1NL3A 3C8UA 4YI3A 4WNIA 2NVUB 4PFKA 1JMVA 1KWKA 3S7ZA 3PFGA 2FRVA 2O3TA 2E4UA 1A4IA 4GBGA 4ZP1A 2O8CB 4OYYA 4MS3A 3U6BA 4HDSB 1TJNA 4OHKA 2X9QA 4LTNA 3R0VA 2X76A 1NUUA 3EC7A 4DL9A 1TCBA 1H2AS 2EFJA 3JD4A 4OQNA 3UAXA 5BPHA 5D51S 1QFSA 4ERNA 3KEMA 4MEAA 4PXAA 1KOLA 1WUIS 1YC2A 4HLCA 3TBFA 4YV1A 4L8LA 4W7HA 2PZJA 3PDUA 2ZUDA 4UU0A 4DSTA 1XAGA 3NNDA 1ZG3A 4IG4A 4AN1A 1N2EA 3G5TA 4NAVA 4Z4HA 3KZCA 3RKRA 5K09A 5HDBB 4URUR 1BFKA 1I7NA 3WNDA 1ZEMA 5FAKA 1GZSA 1KSFX 5KNBD 1PE0A 1ODLA 2D0IA 3FGZA 3FYSA 5EWMA 4U7FA 5L7WA 4RTMA 2ZSIA 1RHRA 1PRYA 5KVSA 1MG0A 1UAYA 3Q6NA 5TPZD 3VR4H 1XA4A 1UMDA 2UKDA 4G5SA 2CXUA 2WKPA 3GZJA 4KXXA 4BXOB 4MGIR 4XJVA 2ZUEA 1RPAA 3VR1A 7ADHA 1AGXA 1FXWF 2B4RO 2DFKB 3N2KA 3VSBA 5AK0A 3FRIA 3M4NA 3HMQA 4NULA 2OYRA 1N3BA 3SDBA 4H4CA 1H65A 2W83A 2WTNA 4RQAA 1HE1C 3E61A 3OKAA 4TQUS 4ZAWA 4ZFNA 1H3EA 1USWA 4RKYA 4EMTA 3DBVO 3CUKA 1T36A 3HJRA 3WMFA 4BNDA 4LDRA 3G17A 1HWYA 5ENZA 3S1LA 3W9YA 3X1ZA 4DDKA 2MINB 4KZKA 3VPAA 3AU9A 3LPDA 3K0HA 3QKTA 4B3BA 4G4SP 2DT8A 2H1RA 5K0FA 4LJ5A 1CRWG 4FDUA 5BR8B 1ULSA 1IATA 2G88A 4HXEB 1YS7A 4F2GA 3CRW1 1LBSA 2OCKA 2GPJA 4IJWA 3T7EA 4F2PA 4DB2A 5ADUS 1WXIA 3PR2B 2BGTA 4RHYA 2I6SA 3QU5A 3OEYA 5ALSA 4YRCA 2GLUA 1YONA 4MI6A 1WB5A 4ASUD 1YD7A 4C2BA 1THZA 1PR6A 2NPIA 1BU8A 1NN3A 5C8YF 3S81A 2CXSA 3EEYA 4LQGA 4MS1A 8MHTA 2PSSA 1WZNA 1SUIA 4HZUB 1H42A 1E3EA 4RU1A 5F1KA 2V6JA 4BIIA 4EKDA 5KYNA 1DKNA 4GMGA 4OREX 4LXQA 4FYYA 2M1ZA 2P90A 4WDRA 4HAXA 2VI5A 5AI4A 3F98A 4QVKA 3C39A 5KTRA 2WUFA 4TQGA 4GRIA 4M88A 5D7NA 1FQWA 1AHPA 3ZE9A 4DMUB 2BFDA 4NKRA 4QTZA 2FEMA 1U2DC 2MYUA 1UXJA 2XE7A 5ELLA 4GGPA 2HO5A 2XADA 3ADOA 3DBLB 5EIBC 4ZDKA 4R16A 4AKGA 2X8JA 1I4DD 1NN5A 2YYYA 5CW1A 1M8PA 3THYA 4OC4A 3I2GA 3EVGA 1NG1A 2CNWD 1NASA 1R8QA 4N6GA 3SC3A 3HR8A 3DV0A 5CA1A 2G3YA 3K0FA 4V0MA 4ZYVA 3T3GA 4B4DA 2ORYA 4UHJA 4DLKA 2PUTA 1NTRA 2VDQB 3MUNA 1Z63A 3OZCA 1GQSA 1KR2A 1Y80A 4PWYA 4RDXA 2NTEA 4BVAA 5AIBA 1GPDG 1OFGA 1L7EA 3KSAC 3VXKA 4N1AA 3D59A 2ZITA 4EG8A 1QJCA 4ZCMA 4YO7A 1VJGA 4G1MB 1TCAA 2HSWA 2YQ4A 2GP4A 3HP4A 2ADMA 4OEHA 1BMQA 1JQ3A 1RNLA 1Z16A 1JG6A 2FOIA 3P0JA 4DCVA 2BKVA 1H4QA 4JP3A 4RIFA 4XUDA 1U0LA 2WIGA 5J1TB 4DPKA 2F3RA 1DIRA 1TK3A 2PMCA 3P9XA 3UN1A 1GTRA 2FWNA 2GRAA 1KO4A 3L8DA 2RBEA 4N7RA 1SK9A 4GSKA 2IS4A 5BSKA 1JR3D 4C7OB 3NBMA 1T6BY 1SM4A 1X7YA 3DCNA 2FW8A 2DBZA 4ZT3A 4TWRA 1BX3A 3G2NA 5TQJA 1S0UA 4RD3A 3SFVA 4D5GA 3N53A 1OU4A 5CXXA 1Z22A 2QP3A 4QUBA 2BMDA 4ZC1A 4MR9A 4HVTA 5BVHA 2OQRA 3V5NA 2X13A 2YZ2A 3ANTA 2ZIWB 1TZCA 3UKDA 3VNUA 4DNPA 3A6KA 1JJFA 5IKPA 3M9XA 3B9BA 2AX3A 1XJ0A 3LPAA 4KNGE 7REQB 2YXBA 2XW6A 1UK8A 1N2JA 1RXIA 1RYMA 5G02A 3GBSA 3QH4A 3T61A 4MWSA 3TNJA 2H52A 3WK6A 5K03A 4U02A 1LGYA 1U3FA 4CM3A 2Y9PB 3KQVA 5FNVF 1SUPA 4NG4A 5G0WA 4B8WA 3BGVA 2GB4A 1AMOA 1L5HA 3TNFA 3E8XA 1F0PA 1DX6A 1EAMA 3L7YA 3L7IA 3MS2A 4ND2A 4DC0A 4U7WA 5HZKA 1E1CA 3STWA 3VA7A 1A2BA 4OUDB 2V03A 2JLWA 3OE1A 1LLFA 3OC0A 1B6SA 5A0FA 1DELA 2PWPA 5B7QA 1D9XA 2PYDA 3E9DA 2YXEA 4KPUA 3BULA 3I2KA 1Z5UA 2IL1A 3ZS9A 3CV3A 2IZOA 3AEKA 2JGLA 4P1ZA 3L3BA 4MLZA 3VH3A 1KVTA 3WFZA 5DCYA 4J6FA 2CB9A 4IX1A 4OAPA 1PD0A 1OBCA 2G5CA 2VDRB 3SMVA 1ID8A 5CU7A 3RTEA 2R8XA 4BMOB 2VAMA 5I7EA 1NMSA 3QV1A 2XTNA 3GUYA 3HZOA 3U48A 5JCOA 2MOKA 3I9OA 2FSGA 1Y5LA 3IC5A 1QRAA 3M1YA 1VG9B 1Q3TA 2P9YA 3M4JA 4LE0A 5LQDA 2HK9A 2R6HA 1J7JA 1X1QA 4BVJA 4CLDA 1IUNA 4QG3A 3D7GA 5FJJA 2AG5A 4DCUA 5A7GA 2IUEA 3PLNA 5CYGA 2ZSDA 3VUEA 1F60A 4FDMA 5KEIA 4OQEA 3E9YA 4EHHA 1F4PA 4M8IA 4O2RA 1KEWA 1R0XA 1TFRA 5EHZA 5L3SA 4QNRA 1I9GA 4BWVA 4N3AA 2BJHA 1HDZA 3F74A 1SKBA 2Q28A 4LBWA 3OG9A 2B83A 3OWOA 4QUEA 3EPHA 3PCRB 2D62A 3CVYA 2VF7A 1NBOA 1QAMA 2FRDA 3E23A 3P0EA 1QFXA 4YQZA 3SF8B 2D8MA 2AT1A 2ZTMA 4K6CA 4F85A 4OC1A 3HL0A 4RIEA 3JQFA 2DHEA 3JZMA 4RVOA 1LQ2A 2VBCA 1BE1A 1X87A 2OV2A 1QR6A 1SBTA 3LLUA 4HDCA 4JLVA 1Z36A 4LSGA 5KWVA 3ER8A 2X1MA 4LYAA 2XQIA 1T3LA 3SZRA 4M0EA 4EENA 2ZRMA 4ZT7A 1P4GA 2QAGC 2JA1A 3NI2A 4BC1A 4EWLA 4BNMA 2OCBA 4GPZA 3HCOA 4F04A 1FF9A 1LVGA 1OZ0A 1USUA 1XTRA 3KYIB 1G17A 4JT4A 3N8NA 4S3MA 1JRLA 4IJQA 3KU1A 4ZK6A 4N65A 3KWLA 3LDAA 3RFVA 4BOYA 2EFGA 3BXZA 2XUOA 2RGNC 2WG1A 3O0TA 1JQKA 3TX2A 1C4XA 1CF9A 4YP7A 3T7TA 3ZHVA 4BX0A 2R25B 2WG2A 3D5EA 3TB6A 4JOCA 4BXOA 1K4YA 3GIDA 2WIBA 4OM8A 4IVQA 3DAFA 3H2KA 4P5EA 1KIAA 3TOZA 1L4YA 1SURA 1GAEO 2XUDA 4CEIB 1AA6A 5HK9A 3IIBA 1EXNA 3I8SA 2Z9CA 2HMYB 3PR1A 3PGA1 2WINI 2VLBA 3C8ZA 5JZMA 1G63A 3MGKA 5LQNA 5CGZA 3UC5A 5DM60 5KYUB 4PZCA 2BSQA 1OPXA 1G3RA 3A1NA 3KV3O 4OHCA 4XOUA 5SY9A 4HG2A 1EFLA 1K7EB 2AF4C 1CJBA 2CDRA 3UK7A 3ZE6A 2IHYA 5EP1A 2F8MA 4JJIA 3VR2A 4CMAA 5KTOA 3S1SA 1A8HA 2PKEA 4IGIA 1A76A 3UJHA 3QBDA 4G81A 1R1DA 1QGAA 2WP0A 4B3SB 3IUNA 1PWYE 3DE0X 5I3CA 5IDXA 1CRLA 1RLMA 4LWPA 4BEJA 1XZAA 13PKA 1EDZA 1N9KA 1M72A 2IOHA 5LVAA 5IUJC 5TX7A 4JWKA 1P2GA 1XZGA 1GQOA 1OW3B 4XB2A 1ZGAA 2YZMA 4OP2A 4GFDA 2PFGA 3D6FA 3ZIAA 4WOJA 1DKUA 2I5PO 4RXUA 3ZXYA 4CMKA 4M87A 4ABTA 4N7BA 3C2QA 4Y9SA 1A1SA 2I4RA 5ALKA 2BBSA 1SQSA 4C5CA 4YI5A 5JQGA 1UAAA 1X9GA 3I34X 4NTZA 1MVLA 1Y6QA 3BI0A 1UEIA 3UJNA 3G5MA 4AJJA 1Q0ZA 5DLQC 3B1XA 3BRCA 4LC0A 3W4IA 1QYCA 3AO0B 1P3JA 2UZIR 4TT3A 4NFYA 2GEFA 3AVPA 5CX1B 5FXMA 5KJEA 5T8KC 3SE7A 3WGOA 5ITZA 3HJNA 5D3KA 3QOWA 2XNDD 1JFSA 4AKIA 2HC9A 1E1KA 4QBIA 4BYGA 1PGJA 1ESZA 4PY2A 1HDOA 4BAUA 3W9BA 4HT3B 1AMNA 1NDQA 3KKNA 4C8FA 2NU8B 5CNIA 5EGSA 3TSZA 2IYRA 3UYLA 5JR3A 3OPXA 1MXFA 1XLVA 4A8JC 3HB0A 3OPQA 2WNHA 1NJ6A 2DFDA 2C3OA 1FYWA 3GG2A 3O8LA 5KQLA 1WF6A 2CHFA 3KT6A 3LVFO 4AW9A 5BPFA 3ND5A 4R1SA 5HCIA 1Q14A 1F7VA 1F2DA 1JT9A 2W6IA 3IAAA 3DZGA 4Z4GA 2C54A 1B93A 1QB8A 3RLIA 3HRKA 2R82A 3VMFA 4FT2A 1ZY2A 2R6CA 3SBEA 5CTAA 1MDBA 5CLJA 3KZMA 4HQLA 4RUKA 1G4UR 3RS8A 1GILA 4YRMA 3I9FA 2J33A 5IC4A 6LDHA 2G08A 5GADl 2B1QA 3R6GA 9GPBA 4HNRA 2R7KA 2DQKA 5CFLA 4AJ2A 6Q21A 1PJSA 1KTIA 3RQSA 4GKJB 2P3SA 3O8OB 1M6HA 2VT7A 4ZO9A 1NM5C 1YA4A 3NJ8A 4EY4A 3P2EA 2QT1A 3LSTA 4QM7A 2ZZMA 1EQ2A 3AH8A 4JNKA 3ZCQA 2W8BB 3IVRA 4C08A 4F12A 2C5AA 1FSZA 2BI7A 2TYSB 4IL5A 1G5IA 4DVGA 4TXLA 4HX9A 5BRNA 3VRHA 2EBHX 1GITA 2DPLA 3HR7A 4BV3A 2H7XA 2E82A 3AI1A 1BA2A 3N9IA 2EAUA 1XNGA 3SZOA 3HACA 1WEHA 4JWTA 1BS2A 1F06A 1Y3CE 2XBLA 1SK8A 2EW1A 3K0AA 2BUAA 5JFTA 1GRRA 2OZLA 1J22A 3VPGA 2GHRA 1GZ4A 3P1JA 1RLOA 3W4JA 2QLBA 4F71A 5HR5A 1GQFA 4WNCA 5B3KA 1CQXA 1YRWA 4IEFB 1G8KA 1H22A 2FFHA 3CNHA 4OHOA 4X61A 5JHGB 5JAPA 2Q9CA 2FZGA 5LLTA 1UJ5A 4RNDB 1Y7HA 1EHIA 5EEGA 4XQEA 5L4LA 2R00A 4TKVB 1GR1A 3LI2A 4J3NA 4EI2A 4YFYA 1SQ5A 3DTVD 3ETJA 5JSKA 5EJEA 2FFBA 3PYLA 1M1NB 3EDYA 3A70A 1VSTA 1EVKA 4LXXA 4ENRA 4OB7A 5I7WA 4RM2A 1W5BA 2BUCA 2VQSA 3VNAA 1W9MA 3BZUA 3RRZA 3AUJB 1AQIA 1J4AA 3JQGB 3H1GA 4YQEA 1X80B 1AUPA 3C1TA 3HCBA 2PZKA 4XYMA 3KYJB 1GGMA 4DS3A 1VG8A 2BI4A 5B4TA 3EUAA 2Z9BA 4ILEA 3SJZA 3PQ5A 3TTSA 5JNUA 3QUTA 1P1IA 1QYIA 1VIMA 2PH7A 3N59A 4GNKA 1V3QE 4LRWA 4MIYA 2EIXA 4U4AA 3WIVA 4HN4B 1ZR2A 2J6CA 4JLMA 4NHOA 1FRVA 4PQGA 2IV2X 1WXGA 3KOZA 2EKPA 3OFKA 1MQ8B 2MMCA 4R69A 4GXRA 4IH1A 2H3HA 1BWRA 1V8PA 1C0EA 2Q45A 3TUIC 3G0HA 1TVMA 3UK1A 4KO1S 4R81A 1GARA 1I3KA 1YMVA 3BERA 4YP0A 2UZ4A 1ULBA 2O3SA 1QYVA 1PP4A 3DKVA 4P86A 5JWRA 1V5GA 3TUJC 1XLWA 2OQ2A 3BMCA 3EXEA 1V6SA 3INRA 3AR2A 1T35A 2VXYA 1P8AA 4HFRA 4PCUA 1K1EA 5ABPA 4WNYA 1TQHA 1L8AA 5IBCA 1R4MA 1V16A 1N3YA 3ZH2A 1T9GR 2VJQA 2GM5A 2W2LD 4GR9A 5TJ9A 1J1UA 5JNVA 1MFZA 1DIGA 1OGYA 3ZCSA 2UUCB 4QVIA 1U4NA 1J0XO 5BURA 1BW9A 2FMXA 1PWHA 3LDFA 4J94A 3L8FA 2J4CA 3OHPA 4Q02A 1NTOA 3HJBA 5I7SA 3RCBA 5E0KB 1RRPA 5THXA 4IKPA 1QAQA 3PC8C 2PGAA 1Z18A 4B6JA 3WIBA 1J5XA 3FVRA 4WXHA 1UJBA 1YRHA 2X4DA 3C5WP 1WLSA 4MROA 5AJHA 2FEPA 2PH3A 1V2GA 3QXJA 4IMJB 2P2SA 1B15A 3V3TA 1OR8A 2ZDGA 2G0NA 2HY7A 4UUPA 3M3PA 1KMMA 4WHMA 1UOOA 1S02A 3ZW9A 3V42A 2X2EA 2VH1A 3D4BA 4I5DA 2XXAA 4ZEXA 5F77A 3UEOA 3TGWA 4CQMA 4EHIA 4YAFA 2XF8A 5E95A 5IF9A 2FZ5A 4AZTA 4FR0A 1N2IA 3G2IA 3ZG6A 4NYJR 2QR2A 1SCKA 3GJ8A 4L50A 4MQUA 3QEAZ 3U40A 2XIQA 4D46A 4AVYA 2CFSA 1RFLA 3E35A 2FEWB 3PQFA 5KREA 4XH9B 3HBAA 1OAOC 3TK1A 3LVQE 1JAHA 2A3NA 2A84A 3PNPA 2YIDA 3BC1A 2H1CA 2IE8A 2QJRA 3EXG1 3BXMA 3VQTA 4RTNA 5AW5A 3OQIB 4C6RA 1ABBA 5EZYF 1YDHA 3RM3A 1YDWA 4YRIA 4B7UA 1M2JA 3BAZA 1YH3A 3B9QA 1LV7A 1P3DA 2CZQA 1ZLYA 3CURA 2H2DA 1RZVA 3R2JA 1QV7A 3ASVA 4L72A 3O31A 4CF5A 3L6EA 4UM8B 5AVQA 5FEUA 1ZD2P 2O2CA 3LT2A 3MWLA 4UASA 5KPDA 4GI3A 2NVUA 1FQKA 2A9VA 2FR8C 2JCSA 4MRNA 2Q99A 4NBNA 4OQLA 4PLWA 3VR0A 1PEAA 3H1AA 5F98A 3TI9A 1PJ2A 2QUJA 1L4NA 1R5BA 3DG9A 3I32A 2C9MA 3QXXA 1SXJA 1J2UA 1HYBA 1BN6A 5EIFA 1K89A 3UJAA 1NJ8A 1GUYA 1KYTA 3HGQA 4CU5A 1L4GA 2PAFA 3CGGA 5DSZA 3NHYA 2OXTA 3UO8B 3VC1A 2J08A 3KQNA 4AD8A 1G41A 4P8RA 1KMQA 4LJ7A 1NQOA 4RPHA 4OHPA 5IM5A 4Q48A 4XPIB 1XT6A 1GNRA 1TE2A 3OX4A 4CEJA 4CU2A 1BE0A 4C0LA 2BEWB 1R0BA 4L8WB 4DF3A 3VUFA 4IIGA 3M4XA 4U2CA 3RTDA 1CNEA 4Y6SA 3S5JA 1C30B 4OUKX 2ZT7A 2GTIA 1T2FA 1QGZA 3TQCA 1C1XA 2V8OA 3B85A 4ITUA 4PAMA 3UOGA 5C5IA 2C07A 2JEZA 3OQVA 2ZTLA 2J1LA 3CINA 1R0YA 3OE5A 4HPJB 2VXBA 4MUJA 2FPSA 3IQHX 1MTOA 2C7PA 2PX6A 5G1OA 5C52B 3FCYA 4I1RA 1C8LA 4D0SA 1IN7A 4CQNA 1YCGA 4TTPA 3WQSB 1IOWA 2GJSA 3BMNB 1KORA 4ZREA 2O2YA 3R7AA 3MJCA 3TCKA 3WBBA 2XCSB 3A6LA 4KYUA 4ARBA 2A9FA 4XSHA 4Z3KA 1WQ4A 2BFMA 3V46A 4U7DA 1AKEA 2QD2A 1NHWA 2HIHA 1LF0A 2J32A 2HHCA 4HQRA 1G9SA 1TK2A 3VR5D 4I9UA 2Q3JA 3VHRA 3W3AH 2ATCA 3KJXA 1Q11A 1L7BA 4G5OA 1Y6GA 3BS4A 1XA3A 3BFPA 4LISA 2XDQB 1C2TA 1CS0A 1K92A 4TM7A 3E5NA 4URZR 4EB8A 5IFLA 4B3IA 3DZCA 2ZWAA 5DHAA 5DSXA 3RLFA 2YHSA 1U7PA 4TMKA 1NF9A 3WB9A 4RJLA 2NOAA 1EBFA 1KS9A 2H2GA 4CKBB 1EESA 1Q5XA 1SCNE 1RC1A 2EFEB 3EIOA 2XECA 2P41A 2YIVX 1IRIA 2DM6A 5AW0A 1Z4KA 5CLHA 2Y9MB 1IY9A 2O8BB 3EDCA 3IKMB 2WIDA 5DVZA 4S24A 3TL2A 5JJCA 1DHTA 4IYRA 3J7AC 1NF2A 2BAGA 2DHRA 3OAAA 4JZ0A 1CIVA 1KE2A 1KI1A 2EATA 1XVAA 4ARZA 3ZZUA 2FE4A 4P35A 4LYYA 2DSNA 1M9NA 1Y5RA 2RH9B 2QTVB 1GNQA 4YPOA 3B78A 3EMKA 3DGEC 4CL2A 2YHUA 4YJDA 2HLNA 3GARA 1DARA 2BR4A 1QU2A 4YAEA 4JKIA 3T7CA 3AZPA 3H2IA 2Z09A 2AKAB 3T1VA 2B8NA 2X19A 2YWEA 2H9IA 2P3QA 3TM5A 1CZLA 3BF8A 3ULKA 3GP8A 1KI9A 1XYGA 3OOSA 2EKZA 3HXLA 2EV9A 4R40A 4JGGA 1R6TA 5E8RA 4LRSB 3IEPA 4HFMA 2B78A 3VR3D 3MWFA 3BWCA 4MA5A 4MMYB 3H9UA 4GE0A 1SCJA 3TTWA 1Q7RA 3H99A 2XDWA 4LDAA