3TLGB

Microcin c7 self immunity protein mccf in the inactive mutant apo state
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 109
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
B PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlgB01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlgB02
4IIYA 4EYSA 1ZRSA 1ZL0A 5K99A 4E94A 5FD8A 3TLAA 4H1HA 3TLGB 3TLBA 3TLZA 3SR3A 3GJZA 4IIXA 5JYBA 5F9MA 3TLGA 2AUMA 2AUNA 3TLCA 3TLYA 5F5XA 3TLEA 3U1BA 4INJA 3T5MA 3TYXA 4JVOA 4MI1A 5F1YA 3G23A 4E5SA 4MJXA
chains in the Genus database with same CATH superfamily
1ZD1A 2GZ3A 2G5CA 3KDAA 5CPBA 5LL6P 2HIMA 1PZEA 3AXSA 1KEKA 5DBHX 4CGYA 2V96A 2YNMD 1NPYA 1U65A 4ON9A 2ZZMA 3TR0A 5AWFC 5FA5A 4W1QA 3C3KA 1UMKA 1TUBA 1PUIA 1A8IA 3LDHA 1B1AA 4B84A 1QK5A 4G1VA 2NV6A 2OECA 3OFSA 3QPVA 3R09A 4IJUA 4NS1A 5BQXA 2Q2NA 1P91A 4C20A 1RYFA 2GF9A 4D92A 3EXHA 2P9ZA 4L8WB 4ZZ2A 5D6NA 1NIJA 1FB5A 4BV3A 1YZHA 5IAEA 1DJMA 4EFLA 2BEUB 2DTEA 3A6JA 2EV9A 2EL7A 5AJUA 2HIAA 3P9XA 1VCOA 2R11A 4IDOA 3U81A 3A3KA 2EFYA 5AKJA 4R4JA 2XTNA 4R0MA 3A4MA 3H17A 3BH6A 2PYZA 3AUXA 3OF5A 2IOYA 3O95A 2BDUA 1AGRA 1KKMA 2ZITA 1TVKA 3USCS 3ZHQA 1TAUA 2MDTA 1CBUA 3ROFA 1SIOA 1JIVA 1SG0A 2E37A 2NV2B 4CFYA 5CITA 4TJVA 3IQEA 4LOKA 1CZOA 2FPWA 3O8DA 3BCRA 2R65A 1Q0HA 2PH7A 1Q1EA 2ANCA 2WM2A 3B8EA 3INRA 3SYNA 2LCFA 4KQMA 3IURA 1D1PA 2WMOB 1KAQA 5FA8A 4YV1A 3W1EA 1LI4A 5C2JB 4AUKA 2X0KA 4L3VA 3U4AA 1MGPA 3WSTA 4LG1A 4TZ0A 1IQRA 1XQVA 2QRJA 3HFGA 1JJ7A 5LLDA 4G24A 3OE5A 3EEIA 2FHSA 3NAQA 4EPTA 3UCXA 3EA4A 2WU4A 2XXAB 1T1RA 4MIEA 4R8LA 1QIIA 5ALQA 1G5RA 4CCYA 3PLAE 4I7EA 4WESA 3RYIA 4DB2A 1G21B 2GEFA 1RJGA 1U0HC 1BKYA 2V7BA 4JC5A 1GL9B 4NOJA 1W36D 3NVAA 3MQ4A 5LQMA 3BMXA 2UZ1B 4LSMA 4ZQEA 3NB0A 3MTJA 5KX5B 5DTJA 2WUEA 4N7JA 1WMBA 2BN4A 1C7EA 3MCZA 2ZJ5A 4BVAA 1RVV1 2W37A 1U0JA 4Q48A 4ZGBA 4FDMA 5TQ2A 4P7KA 1PL7A 3DWGA 2TMKA 3DAGA 2PZJA 4TTQA 1SHTX 4Q1BA 2HJVA 2PMBA 2DPMA 1OX4A 3TZEA 1Q19A 3GLIA 1GLNA 4LBWA 2CT8A 1X7YB 3TDMA 2C5BA 2C9DA 1XAGA 4MGZR 1Z4LA 2FZ4A 3AFMA 3KZNA 4L50A 5E9WA 1DFGA 5K3AA 1TM7E 2EOAA 2OG2A 3CEAA 4MX8A 4EZBA 3C48A 5BOVA 5FOXA 4B7XA 4LZJA 5JH7F 1U2SA 2X7XA 1QHNA 2B4RO 3FJYA 3LT4A 5EE5B 3WXMA 1JLSA 4NSNA 3D5QA 1PTJC 4AN4A 1RJEA 3IS3A 4NBKA 2WIBA 1JAZA 2ZTLA 4QDUA 2VOJA 2NTYC 4FS8A 3SLRA 4UAUA 4QOJA 4WUVA 2C78A 5E0KB 4JL5A 4JI5B 1GA6A 4FGUA 3FSGA 2O8BA 1XYGA 1IY9A 1R9JA 1ZGAA 1KI4A 1T8WA 3PPIA 2YBEA 1KFCB 3H3FA 4OKIA 4YJGB 3RYCA 2RHJA 4HDMA 1HTWA 2BFFB 2MHCA 4EF6A 2Y9MB 3R5JA 2H2GA 4X60A 1M5RA 1VB3A 2KW5A 4K9RA 3G5AA 2QQGA 4MNTA 4IYJA 5U1PA 1M8PA 4JEUA 4RORA 4Q3AA 3DTTA 4S2UA 2BL4A 1H2EA 2QM3A 3IERA 3IPXA 4CQMD 1BCSB 1PR2A 1AO0A 5FI5A 4OU4A 4V3BA 4EF5A 3KXLA 1XTUA 3IVCA 3T07A 2J31A 3ULKA 3WTBA 1QBKC 4FFRA 1A4XA 1F60A 3H5TA 2HSEA 3LLUA 1Y8RA 4X6LA 2HF8A 4D3DA 5IN4A 4LJLA 4IDEA 5H16A 3EGDA 3CINA 3H5NA 4PR0A 1F38A 1UK7A 1OPRA 4B40A 3K2QA 2XCRB 3GJYA 3ZCUA 1XZQA 2QVLA 2HPHA 3A2MA 3DZJA 4GPIB 3SJCA 4B34A 1YL6A 2VHCA 3MJSA 1PNTA 3JATA 5BWMA 3TGLA 3UWOA 1N5MA 2CFTA 4PTYA 5CEEA 5AHXA 5BN3B 4ZD6A 1II8A 1VLZA 2E2WA 2H1LA 5K0BA 1D6NA 2YINC 3I39X 3HKEA 1XQ1A 3HUTA 4IDQA 3V9AA 2Q3FA 1M66A 1S7GA 2EFJA 1E20A 5CLLA 2ANBA 1P5HA 1QGDA 1T29A 2Q49A 3FMOB 3N0WA 2O7SA 1UJNA 3WL6A 4BRZA 4EUSA 2CLEB 4F1WA 5C52B 2VL7A 2CZQA 2NXEA 1K2VN 2IHBA 3NC0C 4B4WA 3OZXA 4BNWA 4YA6A 5DM1A 3H8SA 3H97A 2R9VA 4DDUA 1KSFX 3AESB 3PYMA 2OHOA 3WQQA 4HYYA 4QU0A 5EMKA 3U1BA 3PK0A 4IL5A 3GRUA 4P58A 1WDLA 2Z9CA 4PNHA 4QOHA 3FFAA 3R3WA 2VNHA 1MC4A 2V7WA 5DWVA 1S8OA 2YV2A 4KMMA 5CA0B 3OPYB 2JIQA 2DIKA 4JLAA 1JQKA 1T1GA 4FFWA 3WIDA 5J1TB 5LDHA 5SYAA 2A58A 4QUIA 4W5OA 2F8SA 2VTBB 1Y1LA 4R1QA 3QVWA 3AY0A 1C0EA 4P08A 5A03A 3OT4A 4M8DA 4KR2A 4JODA 1T10A 1S96A 2OO7A 3FLAA 4GECA 1XZDA 1LQ2A 3OPYI 4UDNA 2JATA 2FKNA 4DJEC 1YK0A 2HMUA 5FEUA 1PFKA 3LPDA 4X41A 5AI8A 2BBWA 1JU3A 3ETLA 1T9KA 3ASVA 2VJQA 3BH0A 4BPBA 4IZ6A 3OZSA 4DUZB 4OX9Y 1FS5A 1I32A 1K27A 3IJEB 4FEYA 1HSOA 2CLCX 1TU4A 2Y2VA 1DBRA 3FNFA 5EL0A 2FW8A 4EEZA 2RGCA 4RKQA 2ETVA 2GN6A 4B44A 1V47A 3KHSA 4CG1A 5JBQA 4M8IA 3RO7A 3FB4A 2NV0A 2X3FA 3F6EX 3I12A 3C45A 2IE8A 1H2WA 5JBNA 1Y4ZA 2IIBA 1PGQA 1KETA 3T12A 2G36A 4BWVA 3GAAA 3VA7A 2J4CA 3T1OA 3CR7A 5LU8A 2GAIA 4RMJA 3KB2A 2XT0A 4J2OA 4UE3S 1Z12A 2DBVO 3X0DA 4BFWA 3DEYX 1VHLA 4MW9A 1JIQA 5EXEA 4S1OA 1IBKB 2Z2ZA 2H2WA 5KNCH 2QQ5A 2GCGA 3UZUA 1DBVO 1E98A 3QBTA 5D85A 2VRBA 3FJ1A 4J0FA 2PVWA 3LHKA 3VNBA 1AHPA 1OI7A 1NLYA 4LYFA 1NNEA 5CW2A 2IYNA 2ZBQA 4A4DA 4NU0A 5AW4A 2JEYA 1NMQA 1NBEA 3JTMA 1FP1D 3KBOA 4MHOA 3VNQA 1JLLB 1KDRA 1QHGA 1AS3A 2OUKA 3HU3A 3V2GA 1JQBA 5IKXA 4C0BA 2HO5A 2PWYA 2PANA 1MOPA 3HUFA 4PC2A 2AFHB 1L8XA 1SXGA 2JVJA 3TLGB 1R0BA 2P6PA 3GJ5A 1BN6A 1YQEA 4KBGA 3RSGA 3UQZA 2PSFA 4A6EA 3FYUA 4OJKA 4EGAA 3WRXC 4AZ0A 1Z15A 3DDUA 4WK6A 1B3RA 2P3LA 1X94A 3PXDA 5IAKA 1WD7A 5BUZA 1DHRA 4PRKA 3RC2A 1OBHA 2HK7A 2JIZD 3WS7A 5EMJA 4D0LB 3U60B 3NLLA 3KPJA 2GH1A 5C4GB 2NU6B 2I3DA 3DBIA 3PRYA 1E0SA 4U9UA 4RM3A 1GTG1 3S40A 3TBKA 4C76A 3ZU5A 3ESZA 4MS4B 3DXZA 2Q3LA 3W5IA 5G1OA 1NW3A 3W06A 4DDKA 2BF4A 2VP5A 2G71A 2XW6A 5F7JA 1M2EA 5LBIA 2RI1A 4J0DA 1ORVA 4RNDB 5E6SA 3LU1A 1B23P 2O4UX 4BYGA 3BJEA 4ENQA 4DGQA 3QHAA 3ZV7A 4H9GA 2FPXA 4AJEA 2OHHA 3WR5A 3WLSA 1GPAA 1ZDMA 3KKEA 2XZTA 5JWRA 4LHEA 4G41A 1RZUA 1YUNA 3COVA 4PNPA 3SJAA 4RNCA 4B0PA 1H2FA 2XRYA 1BD4A 3V3TA 3LI2A 3JTEA 3K53A 2Q1TA 4D26A 1WP4A 3UMSA 2AZXA 1W48A 5LSAA 3SY8A 1VSTA 1ZBQA 4QQFA 4DABA 1QE0A 3MFQA 3QKTA 1DE0A 3A4NA 4H6PA 4RJTA 1UMCA 3KHTA 1NVEA 2CXOA 2PGAA 1FNNA 2GERA 2D5IA 3ORHA 4GOXA 4LF4B 4RA6A 3RUHA 5FI1B 2VSQA 3K1TA 1E3EA 3ZXXA 2AHOA 2AQKA 5DM0A 4OBBA 5BR8B 5F9HA 1YNOA 3D02A 4NJOA 4EELA 1ADFA 4B3FX 3GRZA 3QVXA 4J75A 3DLHA 4QYIB 3AB8A 3ZJUA 5DLEA 2AE1A 4B1FA 1P5ZB 2B25A 1YR7A 1CSEE 1UT5A 3DMDA 3KSDO 2HEIA 4H17A 4XIFA 1X9HA 2EWWA 1UAYA 4G5OA 3RBVA 4BFXA 5J5CA 3SBDA 1DARA 4MHTA 1Y7TA 3Q7SA 3T3DA 1W1IA 3HGMA 3QPDA 3GPLA 1RHUA 5BYKA 4WKGA 3I5UA 4NBSA 3RVKA 4DEYA 4CEHB 4Y9UA 2H54A 2R6FA 4KZPA 1J22A 1NQOA 4B6OA 2FE4A 3ZR4B 4ACAA 3NHJA 4BO2A 2VDQB 1WU8A 4D2IA 4XJSA 1A9SA 1NVXQ 4FCVA 2CK3D 1D1QA 2AOTB 1DFHA 1N8TA 3ED1A 4I2VA 4KB5A 5BYBA 3VNSA 1BG6A 4CETA 4B83A 1JIKA 2RK6A 2Q4OA 1PFQA 4MUAA 1V6SA 1W36C 1A9XB 2J6HA 1ZGJA 4FZJA 4J3FA 3CZ5A 4GR5A 1C3XA 1P60A 2ZTMA 4IZHA 4C4ZA 1CDOA 1U5CA 4R16A 2XKAA 1DDIA 1NNLA 4Q7LA 5K3FB 4J16C 3STVA 1J6UA 3DMFA 3TGPA 4FFBB 2IYWA 1CP3A 1JSRA 1NDHA 1WDTA 1ZN2A 3UICA 5IEJA 1CR0A 1YJBA 4K9LA 1TVMA 2DH5A 1RSZA 3FWZA 3AI3A 3BD9A 4E2YA 1FUIA 4FILA 4IV0A 2GLTA 1QE3A 2BCJQ 4H4EA 1JNXX 3A1NA 4MQMA 1NW8A 3KUDA 1JQ5A 4OQDA 5B2EA 3R3JA 2PKRA 1SGWA 4W1RA 1M2KA 2HSWA 1G8MA 1ND5A 2AN3A 2ZYVX 1DTWA 1JDVA 5DH9A 4IHJA 5AD1A 5BSUA 3R7SA 1I4DD 4UULA 4NBNA 2B0CA 3E18A 1ZRNA 5CU7A 4WXRA 3DVRX 1ILWA 4QBHA 2CXSA 2ARKA 2R00C 4UQPA 3WKEA 2X2PA 4CMEC 2HDWA 4GLJA 3PKIA 4F71A 2WABA 4AP5A 4G4IA 3HWWA 4PSAA 5DIZA 4L5CA 5EZSA 3G9UA 1PV1A 5B53A 4QUBA 1IN4A 3G9QA 1FL9A 1XHLA 2YXEA 4B4OA 3RJ5A 3N7TA 2ZBGA 1AB5A 1K4MA 3R3XA 3JZFA 2QS9A 2NYVA 1EMDA 2OGZA 1OJLA 2PAAA 4DM4A 4NE9A 3CURA 1K5DA 2ZWAA 2XEGA 3H2IA 2AF4C 3KFLA 4A8JC 1SXHA 5KOIA 3KXDA 5B30A 3QUSA 2ZT5A 2YHIA 4G9GA 4JI2B 1G5FA 3AHJA 4MDFA 2NTJA 3GW8A 4UHEA 2V7UA 1E7RA 2LDXA 1W34A 2I6XA 3AHFA 1DOHA 3ISVA 1X3SA 1I7PA 4YEDA 4MJ7A 2WFLB 3JQBA 3WO0A 1A5BB 1KY2A 1RLJA 1KZ4A 4NABA 3IEMA 4MWCA 3O8RA 4CLXA 5BN4A 4G26A 2FMHA 3BF7A 3CXUA 2PSDA 2I8AA 3G2PA 4JBHA 2IHKA 2J9RA 4IIJA 4JELA 1H93A 1U7DA 1XVAA 3ZJ5A 3SEFA 4I19A 4P5EA 4UAJA 4UHHA 5DN9A 1I3KA 2IKSA 4ZGGA 2PYDA 4LRYA 2JJMA 1FJGB 1V8DA 2ZRFA 4DIDA 4LFBB 2XV1A 3M3HA 3PNVA 3QVUA 4E7OA 3N2YA 1HR0B 4ZOQI 2XKBA 3WHPA 3DLBA 3P0IA 1CZHA 2A9VA 2FPPA 2YMPA 3BF8A 2ZJBA 3K6KA 4IZOA 4J0NA 1MVOA 2P9EA 4BZPA 3UF0A 1Y3CE 1UJ6A 3C97A 1L4YA 1G0NA 1VJCA 4PIMA 4R0NA 2JGLA 3RJZA 3UMVA 3F7NA 2XMQA 1TCCA 3HFSA 5IHPA 4LBYA 3P9NA 4WX2B 4H60A 4PINA 1A8UA 2ODQA 3RNLA 4EMTA 4X71A 4WNAA 4X63A 3P0EA 4BVFA 5I4CA 1K2WA 3BXOA 1RQNA 3I05A 1YRYE 3UW1A 3VC2A 2I2DA 3D5EA 3QKRA 4PC1A 3HNOA 3GB9A 1X38A 1Z2PX 4FYPA 3Q8LA 3OEHD 5HS4A 4YAWA 1XZKA 3HWX1 1F3OA 4QVKA 2VQDA 3L0PA 1GOTA 1ZU5A 3R6LA 4YAKA 1ZRHA 4XUGB 2F00A 4CL0A 3IP5A 4YCSA 4DLNA 3ZWXA 3NBUA 2YV3A 3VO8A 1M8GA 2CFOA 4IOKA 1AVTA 2ICAA 1IK6A 5FHQA 3TPZA 1OC4A 2Z57A 3PHJA 3DKIA 3WMGA 2I4OA 5JAUA 3G0CA 3F0TA 1GO2A 2E5LB 5EUBA 1U6IA 2PQ2A 5HIKA 1SVOA 2HA3A 3JX9A 4MUMA 4D7AA 1YA4A 1OTHA 2Z2YA 4MP8A 4X54A 3RK1A 3DE2X 1X87A 2I9PA 4OIMA 4ENUA 4OB8A 1PL8A 3E3MA 4D0GA 2E18A 2P5YA 5FLXA 3DBVO 4DXHA 1UC4B 2OAGA 3B1WA 1X3LA 1FXWA 2PS9A 3H87A 3IPLA 3SQOA 8AT1A 3PXXA 2R8OA 3B52X 1O6BA 3NIBA 3RK4A 1IWPB 3PNLA 3AEKB 3Q41A 3EVEA 3I4CA 1MQ8B 4EG1A 1CP2A 1MT3A 1XTZA 1EWKA 1QB8A 1V8BA 2HNAA 2XY4A 3LIPA 3Q2OA 2DR0A 3V7YA 1GL7A 2VF8A 5BWOA 2BLLA 3AM5A 2OA0A 1DKMA 4CTOA 3L7AA 2WTUA 3D7NA 1SKMA 1Z75A 3ON5A 2JHFA 1P0MA 3AIMA 1YUMA 4F11A 1Y3FE 5C8YB 3HXOA 1E1CB 1FP4B 2HHLA 4QODA 4RTKA 3U9SA 2C57A 1CZNA 3H4IA 5HG0A 4A5SA 1II0A 4NX2A 4L8GA 1E3SA 5J58A 1Q20A 5ENVA 1K68A 3ZD9A 4OHFA 1EVYA 4UBJA 3P4YA 4I50A 4RPGA 5L3ZA 5L4LA 1KFKB 3GLHA 2BR5A 4GPZA 5IWAB 2KMLA 4FI3F 5JVLA 1OLUB 4D5GA 2WZBA 3R6GA 1L6RA 3V1NA 3T6KA 2FFHA 2IHUA 3GLSA 1X1BA 3SZRA 821PA 2OKGA 3QENA 2J7KA 4LOIA 3I9NA 1W19A 4P4NA 3RSLA 3DHVA 5C35A 1GKLA 1TO1E 4I46A 2YR0A 4X6YA 2DQYA 2XTJA 3GJ7A 3T0FA 3LQQA 2NM0A 3ZHVA 2EZBA 2UYQA 1SELA 4Y2XA 5DEIA 4MCSA 1GZ3A 1KZGB 2JK1A 1TAHA 4G9EA 3NFRA 3ZWWA 3MC1A 4URZR 1GDDA 1Z6XA 4U4AA 1E4EB 3DBLB 3QGMA 4CLRA 3G5LA 4Q18A 2W2NA 2FZEA 5J5VA 5CFRA 5ADHA 2GJ8A 3LBHA 4OYRA 5E0OA 1Q91A 2XT9A 1U2QA 5CT5A 1GYPA 4Z3DA 2HFJA 3WIEA 4BJ1A 5IWCA 1EDOA 2PXHA 3DZIA 1E7MA 4AFNA 1PO7A 1CVLA 1ZHOA 3MW8A 3NBZC 3A6ZA 2Q3BA 2BEKA 1WCIB 5BV8A 4UMEA 1UPAA 2WYUA 2FCRA 3CZ9A 2VT7A 3PFWO 4KQHA 2HWXA 2A57A 1BMFD 1LUAA 2BCGY 2EZ4A 2XJ9A 1HEYA 3B60A 3BRCA 3E9CA 3G02A 3JQGB 4FN5A 4Y2SA 1OYWA 4IHJF 1YDFA 5IT0A 3I01M 4MCPA 3UXHA 4PF1A 3NAZA 3CRVA 1ZC3A 2AEMA 2V5UA 5GMOA 3GC6A 4YXWA 1P9LA 1VGQA 3GCDA 3QXXA 4TGLA 3SVZA 2PVVA 1Q1AA 4P4IA 2HXGA 5JZOA 3LUCA 3QOXA 4HPWA 2PE5A 3AB3A 3GMTA 1JEOA 5BVGA 5IZ4A 2MIIA 4BJ3A 1XAIA 4TS4A 5FTJA 1C0IA 3N7AA 2BP7A 3OCJA 4YUYA 3L01A 3RC3A 1KPHA 4F1KA 2YZ7A 4HWTA 5EHGA 1QYDA 5I9NA 3MJTA 1C14A 4C9RA 4EZEA 2GO1A 2ZREA 4EG7A 4XIIA 4C07A 4OL9A 4V2UA 2BFEA 1JKJB 4NYJR 4G81A 4WCVA 3QXHA 4O6VA 4QWWA 3BIOA 4W1PA 3I34X 5DP2A 1DRUA 2J4DA 1G20A 2J8ZA 1R6VA 4OMFG 1TLLA 2I2CA 1NUTA 5DHFA 5ELXA 4YMGA 1X86B 1FZTA 2FW9A 1NMEA 3LJKA 4K5QA 2EZUA 1X9GA 3G2LA 4L0CA 3MAGA 1E5TA 5FHRA 2D62A 4LJ5A 4Z8YA 2H8GA 3DEKA 4K1XA 2EX4A 3AUKA 2Q5HA 5B1HA 1SKBA 2P9QA 4Z4HA 1OZGA 5E4FA 1AKRA 1KAHA 4RV5A 5JI2E 3Q12A 2LKDA 4IIJF 4EJFA 1UKVY 2E1RA 4B43A 3U19A 4DLPA 5TMEA 1RLOA 1KEPA 2PS0A 4TTSA 4ZAGA 4WACA 1UAAA 1PF7E 2O2HA 4F72A 3LBIA 1IN1A 2IT1A 1HYQA 2QTRA 3AK4A 2W6IA 3J81A 2JBKA 3ZVRA 5JZBA 3QF4B 4LHYA 4JR1A 4ZO7A 1U0BB 4TZTA 4HDSA 2WM8A 1MVNA 3QLUC 1USGA 4J0HA 1IZ8A 3BFJA 3VYRB 4PHTA 5DBOA 3WSVA 1ZINA 4DLYA 3BXFA 1E92A 4XOUA 4F7DA 3DKRA 5H81A 4BFZA 1KP3A 1NX9A 1RI4A 4PSDA 2HI0A 4OQMA 4OFXA 2XUPA 5B3LA 2GEBA 1ZD3A 1BQ4A 1Y8CA 3AXTA 4L5JA 5AVSA 1QH8A 1PBTA 3HCBA 2GJ4A 2I7XA 3QVMA 3B9RA 7ABPA 3EGIA 1J0BA 4KO3S 4MYUA 4X8OA 4YJDA 4TROA 2H1HA 5K20A 1LJUA 2R7MA 3TLCA 2BUAA 4I9HA 2PKEA 4PZDA 4JFAA 1L1RA 3T7CA 4LRQA 1XEXB 1VG8A 3DPSA 1WTCA 4RLHA 4TV9A 4TYWA 3LFHA 3DCJA 1UZMA 2VBIA 4ZHQA 2VDMB 3HJTA 4BGEA 1Z5GA 4F5WA 2V7GA 5CD1A 2XEJA 1AGPA 1V4NA 2OV3A 4K03A 5CUQA 2ZB8A 3UH1A 2NOAA 3H8JA 4BE9A 2IEZA 4H1HA 2GBGA 4GOOD 1TZ2A 1C3OB 1ADJA 2WJPA 4UU7A 1IEWA 4EHNA 3BILA 4F4UA 3AUSA 3I6ZA 5C0OE 2CNWD 1PFWA 2BZGA 2GEUA 2E4ZA 4IIXA 3I76A 3PUKA 3P9PA 1OI4A 2WSBA 3Q8XB 3F5MA 3TPFA 1ZITA 3EQ9A 4AZ3B 3ZZ0A 4BNKA 3AMVA 1IM5A 1E8MA 1FXWF 2ZPTX 3K9WA 3IEVA 1COZA 4TWEA 1P4HA 1NM5C 1C1DB 1KO7A 1PYGA 1U0TA 3CLUC 3NCTA 3NM5A 1Y6ZA 4IDFA 4MRMB 5CW1A 5AK5A 2QZ9A 5JATA 4EY3A 2EWMA 5DFAA 2JBAA 3QOYA 2F8LA 5KVSA 3N86A 3HJUA 3U3XA 1TU3A 3BVPA 5E38A 1XNRB 5K3BA 1RJFA 3E48A 4BATA 2BKXA 1J56A 1NR1A 3D81A 1LLCA 2YV1A 4JR2A 4R8MA 4HXYA 1ZZGA 4F8JA 3VC7A 1DNPA 3NONA 3NT2A 5FLEX 5EHXA 3CGGA 4DR5B 4R51A 3G8CA 3I1FA 4YYEA 1FSPA 3FRIA 4NTZA 2PZAA 1YH3A 3VDQA 4D42A 3M6VA 3DL0A 1IN6A 1Z73A 2ENUA 4ZYZA 2WVJA 4GMGA 4RV4A 3TZLA 5JNVA 4D96A 1QG0A 5LMCA 3VU0A 3WMRA 1LZLA 2V9CA 4ILKA 4I50F 4F6RB 3FZYA 2CXPA 1HMYA 4HXGA 4XPIB 3ZD7A 3OA2A 3RH0A 4B85A 5FRDA 5SV2A 5F7XA 4RJLA 3ONWA 1X1CA 2BGNA 4R1TA 1UC5B 2II6A 1KDZA 4OC4A 3VO9A 1MBZA 3L8CA 4J03A 5G0VA 4A0GA 1NP6A 4DG9A 5JEDA 4QVGA 1I2DA 3R9XA 3NHPA 4PS1A 4FOPA 4WGGA 5KDLA 1I33A 4UCQA 3IJ5A 1SC1A 4MIOA 1I7QB 3GHHA 1HFJA 4I55B 5BW4A 2FEOA 3WQHA 2R86A 4G07A 1CUSA 1NY6A 1QVWA 4WOCA 4ZCPA 2CHFA 4WKPA 4OG2A 4Y8VA 2C7GA 1YZFA 1KK1A 4GGPA 1DC8A 4RKYA 3IVAA 2VZEA 1QPBA 1JZQA 4KQCA 1M34E 2O7NA 1Y1RA 1ZSYA 2OB2A 4FJ1A 1ZI8A 4XYMA 3TTWA 4JB3A 4Q7QA 4ED9A 2H4XA 3PFKA 1I10A 1UP7A 3SC6A 3BHNA 4HEA1 3V4VB 5B2FA 1U8UA 2YZKA 1XZEA 5HF5A 5B3JC 1ORIA 2Q6VA 1FDUA 2W70A 1YRWA 3HKDA 5A4DA 4RH1A 1O4WA 3JWJA 5JSZB 1ZWKA 2WWXA 3IC5A 2C5AA 4BN0A 3C70A 1U8EA 3P32A 4GP6A 3CLVA 3AHHA 3QG1A 2YY7A 4B33A 2QU8A 5ALYA 2EG9A 3GI1A 1OV6A 4AS2A 3L9XA 3WK9A 1O9BA 2HR1A 1D2RA 1U8FO 4JA0A 1JA0A 1E66A 5HK8A 2R1UA 3DULA 1RCFA 5TQ0A 3QE9Y 3ADPA 1YB7A 4ZU1X 2CBZA 5ICCA 2VDUE 3TF5A 1RMQA 1PLLA 2WIFA 3EWAA 2XE7A 3IDQA 3LQFA 3FF3A 2VAPA 1K5HA 4ARZA 4MB0A 4B7CA 2OY0A 5BSMA 1AS0A 2ACVA 2KBEA 5T7BA 3JS5A 2X41A 2X42A 1UFKA 4N5IX 4OH7A 1DO8A 1NBWB 4Y67A 1Q5PA 3CUVA 5LA6A 1U0NA 2O0JA 2GHIA 5EHQA 1N77A 3FFTA 4J90A 2OHXA 3S9NA 2WYWA 4OFWA 3Q3GE 2Q9AA 4KH1A 4F1JA 1UPUA 1U0LA 2LCIA 3ANSA 3X43A 3DBRA 3FXAA 1UCFA 2SKEA 1PT8A 1TT7A 4E5VA 4PLGA 4C9VA 3TBHA 4WLFA 4NZ9A 3H6GA 2MINA 4V0MA 5TF4A 3W6OA 4EA7A 1F6WA 1R0WA 2QZZA 3LQ2A 4YRPA 2HRQA 1HYGA 1K7FB 2R1VA 1TJ3A 2BLNA 3L0YA 1Z56C 2DPYA 4Y2QA 4I1SA 4YT2A 1DOAA 2F8MA 3QEBZ 3T7DA 2NUPA 2ZUWA 3UHPA 3KAPA 5EJFA 2FWMX 4Q1AA 5AW9A 2W2KA 2I2FA 4U02A 2WU8A 5ICFA 3K16A 4MV7A 1XMPA 4OSEA 3ZG6A 3EC1A 4MSUA 1ECCA 5JD4A 5FNVB 2WA2A 4XUDA 3NANA 1E0DA 1UZLA 2NZXA 4AJJA 2NZ2A 4IKEA 4WXHA 1ZNWA 4GUAA 3W8EA 2UYHA 1Q6YA 1ND6A 3DE5X 1VLLA 3LLVA 1YKGA 1R9NA 2VK1A 3V2UA 2QTVB 2J3DA 4ENPA 4Q47A 1FFYA 4O4JA 2FPGB 2PZLA 3W2HA 1NVVQ 1MX5A 1NF8A 4MS1A 4I81A 5JANA 4DUGD 4NJMB 4JUFA 4P92A 3TDKA 4NCXA 1Q0SA 3DZDA 4XWOA 2UUOA 2PIDA 1ZHHA 2BDTA 2P4QA 5CGQB 4MB2A 2RHLA 5CP8A 3SMVA 1XTVA 2C00A 4JH0A 4C4XA 4RGYA 5DMHA 4YUXA 3LYUA 4BO4A 1Y7HA 2HX1A 1QC5A 2AOUA 1NRXA 3P7MA 3H1TA 4TV9F 1Y1PA 3WDMA 3PIRA 4B3XA 2GKOA 2X4LA 1KJIA 4YYZA 1EX6A 3FSJX 1VGRA 4ER5A 1RYYA 4X1KA 1TRKA 1FBTA 5AM2A 3BGDA 4UDYX 1LTKA 2OP0A 4D4GA 3WMXA 4AZVA 1M6VA 4LZPA 4MQUA 5FUMA 2GCOA 3A9CA 4MDHA 3KWMA 3O7WA 5BP7A 4FYYA 1IEQA 4C2UA 1U3CA 3LUPA 2HSGA 1W4RA 4JC4A 4QXAA 3X2EA 2GCNA 2XVYA 2DJIA 3R7FA 3LWNA 5L3QA 1ZA2A 1BDJA 4H59A 3OHSX 2HADA 4FYVA 1E7SA 1UBCA 4E2WA 2QJOA 4RXMA 4YUAA 1T3TA 1JHZA 1H85A 2EATA 3O8LA 3H0EA 4MR8B 3S44A 1NLUA 1UKEA 3LC7O 4NGSA 2WSIA 4PR3A 5AT1A 1WETA 4HAZA 3HY4A 1O6ZA 5EZQA 2O8NA 3TQOA 2MR6A 1XCJA 2X5OA 4P3KA 8LDHA 1K98A 1NXOA 4WK0B 2XVXA 3G0BA 2P40A 5FR1A 1TK3A 2SHKA 4TMFA 2J41A 3BMOB 1KYWA 4FT2A 5KNBA 2CHGA 3I2KA 1NZFA 3USZA 2WJHA 1IHPA 1V3QE 1RZVA 1Q17A 4MWZA 2Z2IA 3AL2A 1TF2A 3WLEA 5ITSA 1OXKB 4RZ3A 2B20A 3ZJTA 3A7DA 5JSKA 4I8IA 3URKA 4P53A 2HT6A 4LUCA 5IFKA 4QU9A 1NJ2A 4ENRA 2Z09A 1FFSA 3DZBA 1MO2A 1ZQ9A 3P1JA 5LQRA 3ZW9A 3OLQA 3OI7A 1ZPDA 1F5SA 3C6KA 1RLUA 3CEJA 4Y0NA 2I6UA 3FLEA 3L8FA 4O0MA 2ZJ3A 5KQMA 3OCYA 4IO1A 1EHIA 1V11A 5J4LA 2OCGA 1XL1A 2ZYDA 4M1YA 4U9IS 5IJXA 2VHZA 1KHTA 3CW2A 3ME5A 2IS6A 3K8ZA 1G9XA 4ISBA 4EATA 2X4GA 2TSYB 3VYTB 3QU2A 1GPJA 1PR6A 3AF5A 3ELUA 2HA4A 3SS7X 3WSWA 4EIWA 1AQUA 5BOSB 3HDVA 2Q4TA 3EVAA 1YFKA 4J7CA 2XQGA 1DKRA 1J2UA 3T61A 1X7ZB 1U0FA 2ZSEA 4A2QA 3OZTA 2IOQA 1LEHA 4U6SA 4MVJE 2UYCA 4D4KA 2JI8A 1KJYA 4XOIA 4OHPA 5H9VA 3TX2A 3DC2A 3D0OA 2H4WA 2HNKA 3DOHA 2CW5A 1Z2AA 4A8JB 1FUYB 3GELA 1G3RA 2CKMA 2IYVA 3INGA 3MJ4A 3O6VA 2WSSD 1JILA 4IM7A 4XQ9A 3IBGA 5F4BA 1XHEA 1SWVA 2C95A 5KYUA 3VPHA 5JTTA 3LUAA 1GPMA 1HKHA 2AYYA 2R8YA 2Z9DA 3K35A 4Y30A 4CV3A 5IJWA 2IW1A 4QUAA 4X8MA 2C0QA 4ZFNA 2G1UA 2Q3DA 1DI0A 2QQFA 2XDYA 3RB8A 3UH0A 4LXTA 3WLQA 4QXOA 1BXGA 1XTPA 2QYOA 2WTXA 3EZXA 3NTVA 3PNYA 3STXA 3STYA 3FDXA 2WIKA 3RC8A 2BY4A 3LCJA 4TN1A 5LLSA 4JDUA 1NN3A 3K31A 3G9ZA 4GUDA 3W5CA 3K72B 1TCUA 5B12A 1XKTA 1VOTA 3MGKA 3GJQA 1N1GA 1TJ4A 1RI2A 3LUDA 1LNSA 1V1RB 1H2BA 1ZN9A 4TXMA 3DT9A 1RXSA 3WLFA 1YBMA 3D8UA 1Y98A 2G5GX 5JVDA 5LA6F 1QGYA 2OQIA 2XDQA 2ZWMA 3D1JA 3A7EA 1CY1A 5EKXA 5AR1A 3RRZA 4F3TA 2QRLA 3KE8A 2G3YA 1Z6TA 1JW9B 4XSGA 3D9QX 3WGLA 1E2DA 4JUCA 1ULTA 3AEUB 3N07A 1YS2X 4NCIA 4YVFA 5JCZA 2VPTA 4RD2A 4EITA 3AR4A 4O5AA 3T7SA 1DVRA 2J30A 1T6NA 1CU1A 4J0EA 3W4KA 1Z0IA 1CIPA 1G5IA 3ANNA 2RAVA 3P96A 1QF7A 2HDOA 2OQ2A 2X5JO 3KTAB 1NXXA 2AS0A 4PHFA 1Z22A 4P4UA 4WZAA 1M0EA 1QQBA 3BI1A 3IDOA 4ARAA 3PF9A 1HV8A 4ZAWA 5CB4A 3AWIA 3V1MA 1GFIA 1IJEA 3CVJA 2BHSA 2XKJE 3RHZA 4GS5A 1W47A 5CVDA 1YKSA 5AJWA 5AIAA 4WTOA 2V9PA 4IVRA 3KRVA 1NKSA 2FFRA 2HJSA 4DPKA 3OQMA 3ZQJA 1O58A 3F8TA 1GSHA 2DT8A 2OLEA 1HBJA 2P4HX 2J3MA 3WL3A 4YT4A 2EJBA 1ZP6A 3IDAA 4OLBA 3DTNA 3TNYA 5JAIA 2EJVA 2ZM5A 2G9NA 1QZTA 4O4JF 4DBLC 5DNYB 1ADCA 1R3DA 5FYQA 3K8YA 5IVDA 4D4LA 4RS4A 5KTOA 1WQ3A 3C8ZA 2HREA 4J1TC 5J2TB 2ZIXB 4A91A 3FYDA 5B1IA 4G1UC 1MA3A 1BMQA 3QKIA 1KRWA 4CW7A 1GRQA 3TZHA 2B5WA 2CWDA 3MRSA 1QVAA 2F1OA 4U5XA 4UVEA 1HI9A 3KS9A 5JAOA 2JLBA 2H52A 4CMCA 5EE0A 4EW1A 5BSGA 1V0JA 1BN7A 4CE6A 3CM0A 1JFRA 1JR3D 3H9BA 2AC7A 3HYLA 3QEAZ 2DFLA 1Y37A 3NC1C 2HV9A 5B1EA 3T52A 3ODPA 4QUHA 1EUCB 3H04A 3S6JA 2HI6A 1ZH8A 1Z45A 3ITDA 4KXXA 2PJRA 3X44A 1CEYA 3OCUA 1TFUA 5JXJA 1AZWA 3Q7IA 2B2NA 3MLEA 1Y4AE 1LWOA 2V1XA 2EW8A 2JJ8A 3H5VA 4EB6B 1YONA 2H2AA 2ES4A 3G2JA 3I62A 3TZQA 4M7RA 2LWIA 3MJVA 4RHUA 3WRWA 4W5NA 5FWAA 4KXLA 3K30A 1P72A 3VJLA 1PR9A 2QXUA 2WPDA 4WLVA 4DJDC 1V5IA 3G8DA 3MMXA 3T1YB 5DBEX 2H2IA 4QOEA 3QV1A 3RBAA 1XU4A 4P34A 2O3QA 2V6IA 3T9BA 3TLJA 3ZHYA 1JHQA 3BD7A 1LTQA 4U1RA 1EUDA 1WA5A 1GPKA 4YJ3A 1WEHA 3WADA 2EQAA 1MORA 2QTHA 1QF6A 3RUAA 3ICOA 2OHGA 1BWPA 4G2NA 4KAAA 3VKFA 3VDMA 1OBOA 2R1TA 1MJGM 2IYAA 5H3LA 4EI2A 3J7AC 1RFLA 4BL5A 5IJ0B 3N2GA 1Z4OA 4KX3A 5FOQA 2FEKA 4N0QA 4Y6QA 2G04A 5K9ZA 2CFRA 1H4SA 1MPTA 1OFIA 1FMLA 2RARA 1CJCA 1D2AA 1T4MA 2YWBA 2Z9BA 3BGIA 3SC3A 1W8IA 1YSCA 1DEOA 1DV1A 2I7TA 4BQNA 5BSFA 5A7HA 1E8DA 1P9NA 4DYDA 5IG2A 1EBUA 2QPTA 2ZRBA 4ZCRA 3OQIB 1OBFO 4JXXA 4KDRA 5K6RA 3GMDA 3TBFA 3WIVA 1SQ5A 3QELB 2BI7A 2G82A 2O2EA 2YCLA 5IR2A 1GDHA 4CPDA 2WKWA 2XF2A 5BR7A 1G3MA 1IHUA 1S2IA 1GVHA 4AKEA 4CCAA 2ZI4A 1ZCZA 1YULA 2YFYA 4BZWA 1GGOA 5TEWA 1U2GC 2Q1WA 4UREA 1RNLA 2FZKA 3ZCQA 3NATA 1U5BB 2A1IA 2CGEA 1ZJ6A 2JI4A 1UMBB 4D8YA 1G8JA 4AICA 5JI3E 1XF9A 1CUIA 2AWNA 2Q9UA 4GAEA 4NZNA 1IY1A 4O4LA 1EUQA 3SICE 2RFLA 3EMDA 5TMDA 3I2HA 3JQPA 3SFZA 2XB9A 1SVWA 1NPDA 2QTZA 1CF9A 3V4SA 2YHAA 3JQ9A 4KVAA 1G3UA 2GTPA 3PUJA 1E5DA 1R0CA 1W4ZA 2V6MA 1IOWA 4KDCA 4ND8A 1C30A 2WWGA 2FEMA 3EZ9A 4TYQA 3TCKA 4A92A 4C5AA 4D3ZA 2PSSA 1A69A 4G4SO 1E58A 1PKEA 3D2BA 4TKZA 5E95A 4EVQA 2OPHA 4ZVNA 1XQ9A 2EU8A 3C3CA 2VHUA 3A25A 4PYMA 3K9QO 3LF2A 3WYGA 3R3UA 3H16A 4WZBA 5EWLB 1ZMRA 4FGWA 1G4UR 1WMSA 3I9V1 2QAGB 3QXGA 4OFZA 1HT3A 1VYUA 1TEHA 5KQSA 3GQBA 1HEIA 3NH6A 4XX1A 2OT3B 4XZ3A 5TJ9A 1XD2A 3SYMA 3JQQA 3LK7A 3WMEA 4BMYA 4PFKA 1B6GA 2BSQA 2L19A 1T25A 1BX3A 1DCFA 4MWBA 3RABA 1G9TA 4HRYA 1SNYA 2GKSA 2PMFA 2YWXA 4Z7NB 3RT7A 3ZYCA 3MWGA 3A27A 4D9HA 4JQZA 5JYCA 3C87A 2VO1A 4HJXA 4YRRA 1E9AA 1KQNA 1Q92A 1N5DA 3AQ4A 4FFPA 1KY3A 4JJ8A 4MCQA 4RC9A 3DR5A 5JD3A 2HPAA 4F4CA 2IBSA 4W5JA 1Y7PA 4UTZA 2ISCA 1XNJA 3CVOA 3WL4A 4YRCA 5JVDF 1L5KA 1G8AA 2NO0A 1F12A 2Y71A 3A36A 3BAFA 2BFAA 3IAS1 1H1TA 1M8FA 5LP1A 4CFZA 1P45A 1Q77A 1QG4A 4ESHA 2P6OA 4JNCA 3RVRA 1YBAA 2H59A 4BUCA 3DL2A 2B83A 3N2NA 4K40A 2GDJA 5HGJA 2B2XA 1A0OA 3DWFA 4XB1A 1JX6A 3HSSA 2BBSA 2FLKA 1NL3A 4OBEA 5DM4A 4YPFA 4QJ4A 3TGWA 3O73A 5TV2A 1DFIA 3THWA 3FAKA 2XWSA 2HQOA 4OGFA 2C5LA 1NQXA 2ZU0C 2WT4A 2NO4A 4LGCA 1A7KA 3SC2B 2J08A 2G6BA 3LRPA 2Q6KA 3RF6A 3T7JA 5CB4F 4FM9A 2PKQO 5FOUA 3K1YA 2DWQA 2YWJA 2O4CA 3C1UA 3VH2A 3DF7A 1JWLA 4LNHA 1S3FA 1M7HA 4DMLA 1FDSA 3WK8A 3LGXA 3UT0A 4ZVTA 2ZBFA 2B8TA 3WJAA 3IMEA 3OOEA 2INGX 2FU5C 4I1RA 3O8OB 4E6PA 1R6TA 3IAEA 4HK4A 4S3MA 1Z5PA 1B3BA 3INTA 3UV3A 1BWQA 4KYTA 5KU7A 4BBAA 4ZTUB 1AUQA 2GILA 3OZAA 1SC9A 1NJ5A 3D3WB 3QMPA 1IB6A 1UXOA 1ZVQA 2CVQA 2ZWVA 1I80A 2Z6AA 3NHMA 3L8DA 1VKOA 1M74A 3V97A 1WQ4A 5KSYA 4WK2B 2JHAA 7AT1A 1AQYA 1J97A 3CNHA 3HLTA 6ABPA 3I32A 2QRNA 3WBFA 4CI9A 1QYIA 3HA7A 1Y5IA 2M6LA 2X77A 3AOGA 1DMSA 3RIHA 4BX9A 4JI7B 4ARVA 3KAQA 5CT8A 1XZNA 2B5VA 2FE1A 4DCNA 1CUJA 2BELA 1GGNA 4TYYA 3NX4A 1G17A 1K3UB 3I30X 3GJZA 3G59A 3IAM1 1P1KA 1XMIA 2PRJA 2FFQA 4I5GA 4K46A 1DRJA 2ZS8A 4LDQA 5FBKA 3V8RA 3PHHA 1CY4A 4CLDA 4HY3A 4CU2A 3B89A 3M5PA 4I4TA 2ZK7A 4KXVA 1BRMA 4AQDA 2FGKA 2GJKA 1RBYA 2NU8A 4A6PA 3HU1A 3L0IB 3NMUF 1RZ3A 4DHWA 2GJAA 1OZ0A 1H69A 4WN3A 4ECAA 2ZRHA 4HNUA 4JXJA 2HC9A 3K73O 4L5BA 3UMCA 1E1RD 1N3LA 1ZICA 3EQ7A 4Q39A 3EH2A 1DBIA 3P26A 1H1LA 2BI8A 2YDYA 1CW2B 1F6BA 3JAWA 1Z6YA 4QOSA 3EIXA 3WGNA 4U3JB 1V1MB 2JFZA 4AKTA 4IIYA 1Z07A 4L4UA 4D81A 3AJ9A 2UZ4A 4QGHA 3UOWA 4A8HA 1JN0A 3L4SO 1QNLA 2QD2A 2JASA 1RPZA 3VTFA 1Q1QA 3KT6A 3N3AC 3UBTA 4N3BA 1XDSA 2C07A 3KXKA 4IRUB 5E2BA 4UFPA 3S2GA 2DTDA 3PQEA 4BZZA 4HDAA 1E3QA 3OAAA 1XNHA 1SCUB 3BQNB 4KQWA 3NORA 1EAMA 5U4XA 1JXOA 2P62A 1DJPA 2QWXA 3A1UA 3VC1A 4F3KA 1FE8A 3ITKA 4YJ3F 2V03A 3KV1A 3L8ZA 1DWPA 3GRYA 3R0VA 3TQSA 4C43A 3AJDA 2C6CA 4PEVA 1H4TA 3DPIA 4FFNA 4LZOA 4S05A 4FN4A 3R5FA 4GKKB 3MYYA 5JNUA 4E5SA 1MTOA 4ICIA 4HHEA 1WBDA 3QVKA 2ZYRA 1ECLA 1PG2A 2SNIE 3C41J 3L8HA 3N2KA 5GAJA 2ZYSA 3OM9A 3VVMA 3OFNA 2XF8A 4IGIA 1JFFA 2LZ0A 4IFEA 3ADBA 3ZNOA 2IPLA 2QMYA 1U1DA 3ZDRA 2E4XA 1B8OA 1LF5A 2R47A 3N05A 2BTEA 1HE3A 4H7KA 4HFMA 1CFZA 2ZR7A 4KEAA 2IU0A 4KQ9A 4QYWA 2XCSB 2PNJA 4E5DA 3GEPA 4X94A 1OWMA 4XFDA 1EFVA 3NVMB 4B3TB 3KQPA 2QJWA 4CKBA 3ZWKA 1E9DA 1BHSA 1X2EA 2I62A 3B3JA 4JGGA 1X0VA 2JFUA 1WUIS 2QX4A 3C1AA 3FZGA 3ILYA 2WD7A 3GAFA 4O4LF 4ID9A 4IJVA 3WIOA 4ZWNA 4A82A 1MC8A 3N0TA 5HGXA 4F06A 2VT6A 4OHKA 3ORQA 2BMFA 3OJXA 4C2TA 4R71A 1RAGA 2NVUA 1WHTA 1U7XA 4TWBA 2D1FA 1E32A 3WK7A 2K7ZA 3H5LA 2PUFA 4W5WA 2CKDA 4HCJA 3RU3A 5LQDA 2FFJA 1XNGA 3EG9A 5DDIP 4ERXA 2E1PA 4IHKA 4KXWA 3UXEA 2OLSA 2R8ZA 3H5WA 1P44A 2B7LA 1ZLYA 2BE9A 2POQX 2WIJA 3C0KA 3HKBA 4JZKA 1KO5A 3IBTA 4ANFA 5A2QA 1F9AA 1NQ5A 1ODKA 2BFDB 2BR4A 2W58A 3HCNA 4LIPD 4W7HA 5TMPA 3P2IA 1KQFA 3TTTA 1ES9A 3IUSA 3UK1A 1ZI9A 4EJ6A 1ISRA 4E21A 3EXHC 2R6AA 4LVNA 2ODWA 3SF0A 4F2GA 3DO6A 3D43A 5LR6A 4Z9AA 4MDYA 2DERA 1P61B 1KEVA 4LWZA 2XB6A 4NIMA 5FBWB 1HO3A 1GU1A 3RRFA 1VJ0A 5LWHA 2XWQA 4I1UA 1W5AA 5KNBH 4EB3A 3NETA 3GJ6A 2VQ3A 3LPMA 3AIKA 5A3SA 1WZ2A 1JJIA 2WSMA 2R1ZA 4KHZA 5BW6B 1ZESA 3E03A 5L95A 3VR3A 1N2EA 4B3HA 3V6MA 1UH5A 1RWMA 1KWGA 1YZKA 2AXEA 1DSSG 4GZ5A 1FP6A 1FS6A 1THTA 2BV3A 1CERA 2EGGA 2QTNA 2CMDA 2ZS9A 1R10A 1Y1TA 3A3YA 3NO4A 4H18A 4WCFA 2RKBA 3CY6A 5F1YA 1FVXA 3ELBA 4JOCA 4UKDA 4XQ0A 5F7OA 2QSZA 1WLSA 2AJTA 3FUWA 1SBTA 3T4UA 4DV4B 2EGUA 2VJYA 2G70A 2JLCA 4XQCA 2VJMA 1OWLA 1IUOA 4R2WA 5EJ6A 1RMTA 1ZA1A 3IXLA 2XR1A 2AFVA 3LQYA 4LJ7A 4J2TA 1C4XA 4MTLA 4AYXA 4EOGA 4UXIA 1Y3AA 3ZGXA 5KQRA 3ROEA 4GPEA 3HFRA 2PH3A 3NVDA 4R7TA 1P7WA 1WUTA 3IRUA 1ULBA 2D0PB 1D6JA 1HGXA 1GWNA 1QK3A 3ZIAA 3CTMA 3HGQA 5A1JA 1J0AA 1ZX1A 4NV3A 3OLCX 4X1YA 3SOZA 4ILEA 1GUBA 4KG7A 5C7LO 1Z2EA 4F2HA 1KO1A 1V48A 1LY1A 1XV5A 4FJ2A 4LJAA 5TX7A 3SQMA 1TKBA 3DDOA 1K0FA 1N78A 2FW6A 2H51A 1U2ZA 3MMSA 3L6EA 3CSDA 1OXTA 1X1AA 3IOCA 4M9QA 4UEKA 5B64A 2ERYA 4CNBA 1QS0B 4JWTA 3ZLUA 4B75A 1C2TA 4I1OA 1W0KA 5HKKD 4GXQA 1PJRA 4WECA 3QEMB 4GGOA 1V2GA 3PU6A 4Y9RA 4Z3OA 3FVQA 3HB4X 2GDZA 2ECPA 1A2BA 4EJ2A 1Q1GA 2EHDA 3A1WA 4BIIA 4DT1B 3L6CA 3UJ6A 1WZEA 5LB2A 5B57C 4QUEA 4A7PA 2ODNA 4GR9A 2WDPA 4Z5XA 2OB1A 3CZPA 4ER7A 1SG6A 4ENVA 1ECJA 2DF8A 2AVDA 4W8OA 3SVTA 5K2OA 3WYEA 1WKBA 5FULA 1PK8A 4S1PA 3QBDA 4TM8A 5ES3A 2ECQA 3PC7A 1B14A 4UUMA 4FVTA 1L3BA 1ZJ5A 2HGSA 3L41A 3OUUA 3AEQA 3H2ZA 4P80A 4Z1MD 4RO0A 3U7IA 2PRSA 2VP9A 3D6NB 1W4AA 3I01A 4I4TF 3UT5A 4B71A 1SXQA 5EZYA 3ESBA 1Y9EA 2JHGA 4V39A 1N8SA 3RVQA 3RWOA 4NY1A 4M38A 5UKDA 2IPNA 4M1EA 4X3RA 2AMVA 3QPWA 3PFCA 1CNMA 1ZVJA 3HUEA 4UBOA 1RQPA 4AL4A 5GZ3A 4W99A 5EE3A 5TE9A 3T15A 4AKSA 1VKRA 1AUOA 1J5PA 3HN2A 3HK2A 3ITEA 4D3XA 3TUJC 1E0KA 2ALJA 3JQ7B 4H1TA 3JASA 1UM9B 3UXYA 2R6GA 3CKLA 3W3AH 2ZAGA 2G88A 3OMLA 4MQ6A 4JI6B 1G38A 5D3MA 5K8JB 3W8NA 1P7CA 3JAKB 2GPYA 2FJUA 1FYXA 2R3SA 4FFVA 5CYPA 3ZHTA 3KR1A 4NF2A 5EG5A 2YXLA 3B3AA 4MPRA 1XZPA 3TXXA 2ZROA 1QZZA 3CXRA 2K2QB 2G06A 2PSEA 2CV2A 4INZA 1WB9A 3PNOA 4JVMA 5I9TA 1PT9A 5ARDA 2YZGA 3GT3A 2X40A 3GQVA 4CIXA 4NAHA 4Y6LA 4YRMA 1KZ1A 3T38A 3GH1A 3MWDB 5KJEA 1RDFA 2BBOA 2BTQA 1FOEB 1P4GA 4FDAA 3RE1A 5IVPA 3CWQA 5K01A 3RKUA 2GFIA 4TL7A 3ESQA 1N3BA 1YJ5A 3NOOA 2Z0MA 2P9TA 5HZKA 5THQA 1BH2A 3GMSA 3ORYA 1T9DA 5DYNA 5AM5A 4BLQA 4RTMA 5EJEA 2PX0A 2Y67A 3M6WA 1Z7BA 2EL9A 3L8EA 3FNIA 1Z6QA 3G5UA 5REQB 3IMKA 1QHHA 1CS0A 3H86A 3HWRA 1OX5A 4MUJA 4QL3A 4Z6KA 3I6QA 4XB2A 4DWOA 1MABA 1UDCA 4F4JA 5JV5A 2DJ5A 4YPVA 1A72A 1VBKA 2C4UA 3C7AA 3TSWA 1PL6A 3BK2A 2XEDA 3PGMA 2KB0A 4GW3A 4KN8A 2G1PA 1E5LA 2VZ0A 5H8WA 3TIIA 1BU5A 4A8TA 1EWQA 1T36A 3GLTA 2B3DA 5K0JA 3SZMA 1XCBA 4AS1A 3KALA 4PTZA 2EKPA 1KQ3A 2CB0A 2E89A 1O96A 3SIRA 2A14A 2AMYA 2OQRA 5EESA 3W5UA 5K4AA 5ADWA 4EJSA 1XEFA 5HRCA 4Z49A 2OBLA 3JQEA 3EIUA 1YK1A 1QHXA 2RGNC 1O6GA 1OKKD 2FVYA 2WVGA 4C14A 1SIBE 2C2KA 3OY2A 3A37A 3FMVA 4EHLA 2D1TA 3ZOKA 1TJPB 1AJEA 2FMXA 1XTSA 4F9TA 4NYIR 1PJZA 1K5PA 2IZ6A 4B3IA 3EF1A 3NRJA 3TSOA 4RHXA 4JOSA 1UJBA 3GDWA 4C86A 3RJTA 1WF6A 1LS6A 3G79A 3E5HA 1MJ5A 4REQA 2FPIA 1OZAA 4ACBA 2CYBA 3IJRA 3HVKA 2PMCA 2O8CB 4R1MA 2AVNA 4L08A 2H3HA 4KMSA 1ETHA 3KT3A 4Q3OA 4B7AA 3PUWA 2FWRA 5TNXA 1TGYA 4IXWA 4RWEA 3F6CA 4LJRA 2BFBB 2WG2A 5LOVA 3U7FB 2HCBA 5DGXA 1QH1B 2GPJA 3VYWA 2WHPA 1MQSA 2C7PA 1NZDA 2XAAA 4KL8S 1TXGA 1HT0A 3L7KA 5E6RB 5AK3A 3ROPA 4ZOCA 4BVJA 3BXMA 3QI7A 1ORDA 1G41A 1NVTA 2FN4A 1F06A 3LHSA 4NENB 1AMNA 1PS8A 3LIIA 1DB3A 1IDN1 4ZZ0A 3FYUC 1B41A 1WZCA 4MCJA 3REOA 4CT5A 4MDEA 2WV7A 1JMYA 2L0XA 4GEKA 4P4SB 1DIBA 6ADHA 4IGEA 3CB4A 5FWXB 3RHFA 3EARA 1JH8A 4PSUA 1K8ZB 1UODA 2Z8ZA 1JU4A 1PG0A 2A1UB 1CQJA 5E3IA 4F92B 4XWAA 2ET6A 3RAJA 4FMPA 1NP7A 1G8FA 2Q6OA 3VR6D 2ZRQA 4B3BA 6PFKA 1KWKA 4W9MC 5K09A 5EJ9A 3CVXA 4DV7B 5E7JA 2RGBA 3Q3VA 4O63O 2FWPA 2P6RA 1FDWA 2ZYWX 5ALPA 4XGKA 1KE2A 5AVKA 2V0CA 1MG5A 4BC1A 2QNBA 2ZCJA 1TD1A 3NBXX 4O4IB 1WULS 3AHGA 4DIBA 1PK7A 3EUWA 4K9MA 3RSCA 4QYXA 8OHMA 1VZ3A 4HOYA 4BQRA 5BNZA 1YXMA 1X7DA 2J09A 4N0PA 3C1OA 3O47A 1C7IA 4JKIA 4Y9SA 3HCPA 1VHWA 5LNK1 4ECEA 1WXIA 4KSBA 1EJ2A 1GKKA 2A86A 5EQDA 3U4IA 2ZBEA 3GVIA 3L1KA 4A2CA 1H0KA 2EP8A 3KRTA 4I8XA 4BAGA 4DFDA 5L4SA 2EFGA 5D6OA 3ZGOA 4CDKA 2GK4A 1F6DA 1N0VC 3QVVA 4BNTA 1A2KC 1J0EA 1XP8A 2DP4E 2QUZA 1KQOA 3FPEA 3IP1A 4QIHA 3VZBA 1MB2A 1T5LA 2IXDA 1VHTA 4JMLA 3KVYA 2QMHA 1OFUX 3LUJA 4OK6A 3MAAC 4C5CA 3QWBA 3Q6MA 5EZYF 5C5CA 2LPMA 4NQZA 2QTCA 2AD1A 5CT4A 4N7RA 5MGBA 3K9LA 2CVHA 2OVBA 2B1GA 2P9JA 3RDPA 4HXEB 4JY7A 1HE2A 2W98A 3CMCO 4S0XA 4P4BA 3TW6A 9GPBA 1KOFA 4PSVA 1DXHA 2XI4A 2BI4A 2X0NA 4IQFA 3ESYA 3AC0A 3U4HA 1NXPA 3UJHA 5BUCA 3TW0A 5INTA 4O8ZA 4GQIA 4ZU6X 2PBFA 4FE7A 3ENNA 4R2KA 4RIGA 2DR2A 2J3IA 1SA0B 3O1IC 4KN6A 1CLUA 2YBDA 3UKOA 1VG0B 3GEGA 3M1LA 1CHNA 1QTQA 5DK6A 3OP4A 3WYDA 2D8AA 3FD8A 3FB1A 4MHSA 4AG6A 4PBRA 3LOUA 4Q6WA 4YONB 1FFXA 3ZQUA 3SVLA 2QZPA 5A1TA 1Z6AA 1ZK0A 1PD0A 2A78A 2D1QA 3CWCA 5H83A 3CCCA 2JH3A 1R64A 3AB7A 3AM3A 3FBWA 2HLDD 2Z3ZA 3IKJA 3PPWA 1S2NA 4MVJP 4OP3A 4AJIA 4C9AA 4BKQA 4ALMA 2V8OA 3RRJA 3U44A 1H4VB 2VP4A 1GZSA 1GTVA 2ZIGA 4CTKA 4E7PA 4BKOA 3K94A 4DIEA 1BJKA 5DP1A 1H8HA 2QN3A 3NDJA 1RWVA 4C6RA 2PUJA 2BEVB 4GP7A 1UWLA 3BYZA 2OWDA 2YIVX 1R50A 2HJRA 3EMVA 3G5TA 3MUEA 4FWBA 5A3RA 5I8WA 3TSAA 2QSJA 3WJ2A 4NLLA 1UEXC 4LMBA 3RHTA 3DJYA 4OHYA 1BRTA 1LDYA 2IODA 2RB4A 3C2QA 1QGZA 2DZDA 1IQ0A 2FZCA 4XVRA 1MR3F 3E05A 4UU0A 3DAHA 2C2XA 2C2BA 3WYAA 2O59A 1Z25A 2YY5A 2W42A 2DH6A 1DC5A 1WUYA 2JZOA 4KOEC 2Q41A 4OQXA 2NU7B 1UQUA 1UOPA 2CXHA 4TLAA 1YHZA 1H0SA 3E22B 4HPXB 1FDRA 3RCBA 3D2CA 4JU9A 5KDOA 3FM9A 5EYPA 1SXPA 2FX3A 1VKNA 1QOQB 2XNKA 5FPHA 2Y4NA 1VL6A 1M2GA 2KSQA 3V1UA 2IOHA 3IAHA 4NL4H 4GX0A 4IQ4A 3KAKA 4CKWA 2J0QA 4M6WA 1SBZA 3QYJA 5C8ZA 3MLBA 4XCXA 1ZONA 4HAOA 1XVTA 2GZAA 4OK5A 4ZI7A 2WMNB 3JPWA 1EP3B 3JQBC 3VZRA 2OGWA 3P0HA 1V2HE 5TF0A 4AUEA 1A76A 4MKHA 2I8LA 4C7KA 1XG5A 2FNAA 1G19A 4HLCA 1ZOIA 2OXCA 4MGHA 4CQLA 5IDWA 4A0QA 1KSJA 3SSOA 3GLGE 2M6SA 4AURA 5CB6A 4N3AA 1I5EA 3V33A 3FLBA 4YRGA 1LPSA 4BLUA 3IMGA 2EZ9A 3PL5A 1A50B 1YMVA 1XTKA 1USVA 2FHPA 3OE7D 4ZODA 4ZKEA 1Z0FA 2VNKA 2YVQA 1O95C 1V35A 2DPHA 5AI9A 1RRMA 3B12A 1EFKA 1B0AA 3BFXA 3K1AA 4PNZA 2XMBA 3I8XA 3P0JA 4RJIA 3IVGA 4XGQA 5LOVF 3H1GA 1X1EA 3IEUA 3OX4A 5DV9A 4P0TA 2WYOA 1BFKA 1VCIA 1Y5MA 4TKVB 1B76A 3A26A 4I9GA 1SQ6A 4TN5A 3QWHA 1JE1A 5B1DA 2NUTB 2DCMA 2WTBA 3CS3A 4N9QA 4O2BB 4RE5A 3EN0A 1SAYA 4BFTA 2JDID 1FY2A 5AKLA 4EVRA 2VSYA 3SKYA 4LBZA 3K0HA 1OVMA 3SDBA 4RULA 521PA 2WFAA 2I1VB 1Z6GA 3H18A 2NUBA 2JGDA 2YNMA 3LGAA 4HF7A 4DEXA 3AVUA 3A32A 2ZIFA 1HLPA 2JRCA 1P6QA 4OJNA 4FDLA 3HKCA 2KM1A 1XWIA 3TVYA 1P1BA 5TXGA 2I6TA 2RGYA 3QBEA 4P7JA 5HM8A 5AICA 1OFUA 2VNIA 2WKQA 4NZYA 2CMFA 4R8RA 3BPSA 2HF2A 1EZZA 2WAOA 2C5EA 2J3KA 4GL2A 1W93A 2XMRA 3C5WP 3KYDA 4IDAA 3UUGA 1RAHA 3JR3A 2I6SA 5AI0A 9MHTA 3LY8A 1G42A 2IBTA 2GSWA 1LC3A 1M6HA 1L9KA 4DZZA 2H9AA 3UMGA 3DQZA 3PE4A 3UBMA 4DKXA 4EG3A 2JLUA 4PIVA 4XIJA 1II9A 4BEVA 4EHKA 1R4MB 1LLFA 3LF1A 4GMFA 2WEKA 2R8PA 4ML3A 4LZNA 2W9XA 5DNUA 3G9XA 4CM9D 3KUKA 2Q3EA 4QDXA 1FYWA 5CYOA 4DANA 3IUYA 5J4HA 2YOHA 2AG8A 5A71A 1Q16A 3THOA 2VBFA 4KIGA 5IM4F 3WOHA 5H82A 3PHCA 4W1SA 3M5WA 4RAQA 1U4NA 1Z8HA 2B82A 3HDYA 5ALJA 1HYEA 5ALKA 3MBKA 1BXRA 4JVSB 4XYGA 3HCFA 4Q9IA 1XALA 2VWQA 4KK4A 4DLTA 1T4CB 5C46F 4L22A 2O52A 5KTPA 3ZWPA 4NCKA 1K6IA 3MRVA 1B73A 4LV8B 5JY6A 1ZGBA 3EVDA 4EYOA 1G8GA 3N70A 3WGKA 3EBLA 1N3IA 2X6TA 4B76A 2BKVA 4HH1A 1WR8A 3TW8A 3VSCA 4CM3A 1QRUA 3CN7A 2C4MA 4MUKA 1RWXA 1NU8A 2FUG1 3RBZA 2JAUA 2FAXA 4URVR 3C1TA 3B7PA 3EVNA 4KQEA 5KTNA 1E4OA 1JHAA 4XFJA 5E3HA 1U7UA 2N3ZA 2XUOA 4QXRA 4TXNA 4UM7A 2SKDA 4QGAA 4O5OA 3SP1A 1DT3A 4RPIA 1J24A 1L4FA 1J9EA 3WKBA 1F0NA 2MTBA 2VPZA 2WI8A 1SHKA 5LMZA 3VQTA 3I1JA 3C3YA 1F14A 1SXJE 4B35A 1QOZA 3PVSA 3O03A 5DT9A 1U5AA 2AH5A 2XZLA 1XJ0A 3BN3A 4ZOEA 2QAJA 3QLVA 1ZNZA 3LL7A 1QDEA 3HCDA 1ZNXA 4N49A 3RIEA 1PD1A 2D1YA 1IK4A 1ZMBA 3E23A 3QYFA 3AI7A 4L4ZA 4C0QC 3QMVA 5JAHA 2DYKA 4Z2YA 3F9CA 3SHWA 1VDMA 4EKGA 2FWAA 3C3XA 2B37A 3I1YA 5ESXA 5FBQB 4GYYA 5I9LA 1T8SA 2WHEA 4EPYA 5K0GA 4EPRA 1R4NB 2EQBA 3L7OA 4IDNA 3PFIA 2PXAA 4CYMA 1CUFA 1XVLA 2OCAA 4JA2A 1TYEB 3FYSA 3WGJA 5CDFE 1OA0A 5H3HA 2QNIA 4GI1A 4BS9A 4CL8A 5B5SA 1ACMA 4IGAA 2Q5LA 3ADOA 3KPVA 1SULA 2Z1NA 4FFLA 1NGSA 2QRQA 2GA9A 3BD8A 3JD3A 4KFSA 1A8HA 4RGVA 4QBKA 4AY4A 3R7WB 1MX1A 5GWXA 3OOSA 4YAEA 4JIMA 4HAYA 3QHQA 2FDCA 5J9FA 4OQEA 4YS6A 5JSFA 3GGGA 4HBGA 1KOGA 4AB1A 1ZM4A 3FPKA 2FSPA 4CQMA 1MIOA 1PJSA 2Y05A 3N5CA 4IUDS 1ZVVA 2P2YA 1T4GA 3HH8A 1NI5A 2FA9A 3KKQA 2FTKE 3IP6A 4DARA 2R751 1D09A 2WPNA 1KBQA 4J94A 4LJ4A 4N8DA 5JG7A 3T3EA 5HILA 4K9PA 1C9KA 3RASA 1TT5A 2GHRA 2DETA 3CSUA 3KM0A 4TTVA 3BL5A 5E7IA 3R7DA 3J81k 3WLKX 2QL9A 2K7FA 5JC8A 1HFEL 2J6IA 1NMSA 4IF6A 1YR3A 4JIGA 2VAXA 3NDRA 4ME6A 4YLGA 3ZKWA 1CUAA 2OGUA 4L5AA 4DB4A 3OSZA 3EEFA 1MD9A 2AI1A 2PJZA 4RD3A 2O8EA 4NCJA 2F64A 4W8HA 4CU5A 1F2TA 3D4OA 2F3QA 4HI0E 2ZUBA 3D7LA 4EGSA 4RKFA 1E6EA 4Z9XA 4ZI7F 3UTDA 3H83A 3WK4A 1PV2A 4C22A 4IEFB 2YHBA 4RETA 4BMCA 3S2FA 3WICA 2Z1MA 2QL6A 2COUA 2GVZC 1ZNQO 2BUCA 4DZTA 1XVVA 4GM4A 1IUKA 2MYTA 4G86A 1KPIA 1X8LA 2I1WA 1VLJA 2IITA 4IJ5A 3RS2A 3WDKA 1IXYA 1Y42X 3AWDA 2QAIA 1B43A 3C15C 5CLQA 5EWMB 4ZYTA 1JDZA 4DV2B 2I91A 3EOZA 4PQRA 5FL7D 2H1VA 3DLPX 3KX2A 1M54A 2BH9A 2G4VA 4CM1A 1QX4A 5JY1A 2Z3VA 4K9SA 4JSRA 4G8JA 3DDCA 4ZYXA 3BIWA 2V9ZA 3KZXA 2JVIA 3UFXA 4BMNA 2RBGA 3NU1A 1D8TA 1UBLS 2ZQYA 4P7BA 1M8JA 3R77A 3IYLW 2XWJI 3HJHA 4OY3A 4R2IA 2F55A 1VJ5A 2VNJA 2XB8A 3PEUA 4OF4A 3TEFA 1JXMA 3DAPA 3NHUA 4ZOLA 2PCLA 2Q5CA 4YRIA 2QRVB 4G1MB 4KMOA 5TQ2B 5KHLB 1MJGA 3SYLA 5C8XA 3H8WA 1AQLA 4IKPA 4LX0A 2IYFA 3U5TA 4O1HA 1CIJA 1F2UA 1Q7RA 3C3JA 3GZTB 4L74A 1Z4QA 2QTTA 2GXUA 1WXXA 4PZ0A 3B1YA 4H7IA 1EDZA 3KQTA 3KYJB 1B8PA 4HDRA 4JLMA 3GA7A 1SCAA 3LPCA 1NVAA 4KGDA 3AJ8A 3T7AA 5LQKA 5DHRA 1M1YA 1S1CA 5BRNA 3T4EA 1O8BA 2XHEA 4DTCA 3OSUA 3NOXA 2CDBA 2I0FA 4B2YA 1TJYA 4EUKA 1W581 1KOLA 3ZDAA 2YASA 4C0SA 1YS9A 3EEQA 3IUPA 4GZ6A 2G83A 3U6BA 3PRKE 5AVTA 2ADOA 3DKVA 5DBFA 3VZCA 3QU4A 2C7OA 3DE0X 5B3AA 4RJ2A 4C4RA 5TSDA 1J9GA 3BICA 3NW9A 3VH4A 4BLPA 3WZ2A 4OD0A 4XD7D 4M1WA 1A3CA 5DGDA 3RYCB 2ZRAA 2C98A 4KX5A 1FX1A 3QFSA 2DLNA 2Q4EA 2RG7A 1PJ2A 2B34A 4DMCA 3R3HA 3WNDA 1Z0JA 3DL4A 3O3NB 1D2GA 4IIDA 7YASA 4LDJA 3Q3IA 4WJZA 4JVNA 1KI8A 2QSUA 2ZYUX 3H3XA 2HRZA 4DMRA 4ZEWA 5HQ3A 5FF9A 5IT5A 2IPMA 1K1EA 4ZRNA 4C0JA 2J0UB 2OR3A 4XJXA 2Q0HA 3B1ZA 3KDSE 4OM8A 5EKSA 2O1WA 4XLTA 5BV0A 4JV5B 1QQ7A 1N2GA 1WQ1R 4IH1A 3BWDD 2QUHA 4DLLA 4GGMX 4GKVA 2YVUA 2CLMB 4ZYWA 4XYBA 4I36A 4B6RA 2X9QA 2BEJA 13PKA 4MR7A 2JIZA 4PG4A 2UZ0A 5CX1B 2ZUFA 1YCFA 4HWGA 4BTLA 1C1XB 4UBMA 4AMVA 4C03A 3VHXB 4P22A 4C99A 4M0KA 4ZRMA 2ZI5A 2H06A 3M33A 1II8B 3FOBA 1GUFA 4CKCA 3D6AA 3H2JA 3MF4A 5IJ9A 1WM1A 4QO8A 3GRCA 1Y3IA 2AOXA 3FCYA 1AN9A 2F3PA 4Y9TA 2RKOA 3KEMA 4D9CA 2ECKA 5HXAA 4NCAA 4GHWA 2OAQ1 3UG6A 3H3JA 1BD3A 4XJTA 5G0SA 3GRKA 3CUTA 3NOQA 5EHNA 2PEYA 2HQSA 1Q0UA 4RS3A 2YWHA 3CF2A 1DCMA 4BNNA 2DT5A 4LYAA 4N7MA 5KTTA 3M6UA 2XUIA 3H42B 4YUVA 5I3ZA 4FXPA 5H02A 3REGA 4BNZA 1IWOA 1EFPA 4L0MA 4UTXA 2JJ2D 1SXIA 3DVAA 2CMGA 3L0OA 3KQKA 4TPKA 2IDJA 5A0VA 3M6LA 3SDSA 3ZVMA 3W77A 3IOEA 2WTMA 3V4LA 3I61A 2BDEA 4V1CA 3R9IA 1ODLA 4G56A 4KV7A 3QPCA 5FL3A 5I7AA 3TYXA 1KMMA 3ENWA 5B7PA 1FFDA 2DFDA 2EFEB 3AV3A 1CUCA 4PG7A 1QANA 4AUNA 2R4QA 2ZR8A 1DWQA 3KOZA 4UVIA 2RI0A 4DLKA 2QRKA 2YC4C 4BNVA 1KEUA 3DUWA 2PPLA 4M9CA 3G2QA 3D54D 3AUUA 1YJ8A 4RHTA 2HGZA 1R16A 4BX8A 4GMHA 3SBOA 5JLAA 1R74A 1X7HA 3OKPA 1AX9A 4Z54A 1A1SA 221PA 4TQ9A 4TLEA 3SNHA 3U39A 5AQEA 5JDIA 1SD1A 2VJDA 1E60A 2QKYA 3V4OA 4YQFA 1D2HA 1FVOA 2PRZA 1ZK2A 3PT5A 2NSYA 4BB0A 3V4PB 2QX8A 1DQNA 1D4OA 2Y0EA 3JD4A 3FN4A 4M7WA 4OPMA 3DMTA 4EPWA 2GUWA 1QZUA 4UCXA 4UDXX 3LKDA 1F7UA 2LTAA 4M88A 2VDRB 3UMYA 2IC5A 3RHSA 1LX7A 1N92A 4YJKA 1U9IC 5JQGF 1V7ZA 3DYVA 2CK3A 3EVFA 5M3BA 2VAMA 2UDPA 1LI5A 3CJQA 1X70A 3IQFA 2OESA 3KQVA 3L6RA 3KOMA 4QGFA 3TOVA 4C5BA 1V8FA 4DOMA 2HHCA 1C9MA 3EAQA 4RLQA 2PN1A 3THYA 1RJ9A 3CU5A 3CKMA 1E1QD 5F12A 5K0SA 1NXJA 2K5UA 3HVIA 3FE2A 4M37A 1WUHS 3V2HA 1SBHA 1TEVA 2PGLA 5HJEA 1EWYA 5EC8A 1S3IA 1AUPA 1JGTA 1GQRA 2CJWA 4HWRA 5ALWA 2G9RA 1NW7A 2Z2XA 3P2EA 4M98A 5A0FA 1N34B 1MLDA 2AFIE 4NONA 1RYEA 4EF4A 1EFTA 3L0DA 4AK9A 2D0OB 2C6GA 3ZWBA 1VRWA 2FYTA 4XASA 5B58T 3T1TA 4JXZA 2WJYA 1S7CA 2IYTA 1MC1A 4CR7A 1WCV1 4NGPA 2OVFA 2AZ4A 5EFOA 5HQJA 2IP4A 3WWOA 1RKBA 2XNDD 2H2HA 3SIWA 1RYDA 1QCDA 3DEFA 3K0FB 3EHDA 3L82B 1EXDA 1Y4SA 2XVAA 1KVUA 3KFXA 5F35A 5J5AA 5JMOA 1G59A 2P67A 1T2UA 3BBLA 1A88A 4HR7A 1VMEA 2E6KA 3FR7A 5DYIA 4DIOA 1USUA 2WU0A 4BFYA 2QP3A 2FETA 3WBKA 3K0CA 3PDUA 4QBIA 1N2JA 5E6SB 1J42A 2O2IA 4P3NA 5M29A 2P6UA 2SBTA 2NVBA 3VNUA 3WGGA 3UAWA 5C81A 4ZOLF 1U6JA 4MINA 3DFIA 1MZPA 4KR6A 3GFVA 5DHAA 1Z3IX 1E2PA 3MFYA 3ORSA 5EUCA 4JLJA 4U2DA 3W3ZB 5DMXA 4B7ZA 5FD8A 2ZBUA 1G1MA 1B00A 4MVYA 1VJDA 3GLKA 3WBJA 4DYVA 1XD8A 1YGYA 4BE7B 3HMQA 4M83A 2NTVA 4WXPA 2FF7A 3MT7A 4CEJB 2VJPA 3M34A 3OCXA 4WEOA 3WJ1A 2GCPA 3LO8A 3WXBA 1L2TA 4CMIA 1BDIA 5ALRA 2IZ7A 3PZRA 1RR6A 3L7CA 4HEJA 3Q98A 4JSYA 2HA7A 2NZYA 3C39A 3W4JA 5HW0A 2AG0A 4UUOA 1E63A 2QL7A 5DGCA 5IH3A 1TCVA 3B82A 4XX0B 1QQAA 4DBVO 1C80A 4JP5A 1EEXB 2O5RA 4NHEA 1L5LA 2OCPA 2NG1A 1MFZA 1QFYA 3KCNA 4L2IB 4YGYA 2HB6A 1B8UA 3LBFA 4GDFA 1MUUA 2O1SA 2OFOA 2NQ2C 2PVSA 3EGWA 3DUFB 3L5OA 2W2XA 2P8SA 2WF9A 2YUIA 3HR7A 4CTJA 1TEZA 4ZTBA 4FZVA 3OLXA 1ZUWA 4PZYA 4UUNA 3ZY6A 1WD5A 2D3WA 4QU5A 5IKEA 2R6DA 1V5WA 3GEEA 4Y1RA 4RUKA 4C08A 1E9BA 2AQIA 2RK3A 1W73A 1E7QA 3QXCA 4TT3A 3TJRA 4WAUA 2C7RA 3QEKA 1IJBA 5IW8A 4L51A 4RA9B 3HCEA 1YWGO 4RHYA 1H9CA 1Z17A 2VUHB 4URYR 4B3RB 3VBEA 1MRNA 2PCJA 3GNLA 1U81A 3I3OA 2PL1A 2G8NA 3AETB 4LSWA 4AO6A 1AXRA 2FOIA 2Z3WA 2HSJA 5B6PA 4CM4B 3OEHA 2AR9A 4JKYA 5JC1A 3W5AA 3P2MA 4Z86A 1JEJA 3D7DA 4LISA 3TG8A 1IHYA 1P4SA 4M87A 3HL4A 4ND3A 1P9RA 4PLWA 4BLWA 1EE1A 5IU6A 2TMGA 3MRXA 4H6WA 2AGVA 1JKIA 5LP6A 5IC4A 2PUCA 2EFHB 3EVCA 3IHWA 3G2MA 1G63A 4MW5A 3FKJA 4PC7A 2ZFUA 4U7TB 1VP9A 2G0TA 2RC5A 4J8PA 3EPPA 5FTWA 4TTJA 5LC1A 3E84A 4Y3UA 3BZBA 4PAOA 1LBQA 2DBZA 3C6XA 4ZP1A 4CIBA 1T0JB 5G02A 3PCTA 4YAIA 3GCZA 1WL8A 2NT3A 2WNSA 3HB9A 2GMWA 1M2VB 1SIWA 3BE4A 4DAOA 3A6PC 4NVRA 1ONOA 1DTWB 1AXGA 3EEYA 2Z4SA 3S2EA 4R3WA 4EA8A 4WIAA 3W9UA 1TAQA 1FIUA 3BMNA 2UUPA 2C5QA 3S2YA 1ISHA 1OB5A 3QF7A 4KUHA 4MRPA 4NMLA 5K05A 5KYXB 2QVYX 3PEVA 2EW2A 3E2PA 1H4QA 3R20A 1E61A 1WV0A 3MINA 5CDYA 1QJCA 3EZYA 1L5NA 1KH2A 1EX7A 2G7ZA 4EQ6A 3EAFA 4ALKA 4YJFB 4G5RA 4O3FA 2H2FA 4X24A 5IUNC 2QVXX 4B80A 2G1JA 2QRGA 2HF7A 4IX1A 1ZMOA 2RBEA 3ZZUA 1CJBA 2QYHA 1VZ2A 3ZVKA 2FR1A 3FNRA 5A4KA 4C6HA 1Q84A 3NIDB 2Q7OE 2XTMA 1OI3A 3BUSA 5HA5A 5IASA 1PGOA 4RZXA 2GJSA 3U26A 1NATA 1YB1A 1PQWA 1ZVKA 1C8LA 1N5JA 2ZBDA 4A2PA 1KGDA 1Q12A 1S5PA 5BSEA 4ZDIA 2P77A 1SIUA 2GBPA 1FF9A 1R0ZA 3CB2A 3WE7A 4C4YA 2QUKA 4M53A 5KC9A 2GNAA 3CO5A 4A6XA 4CMKA 1OJ7A 3AVYA 2VATA 3OIYA 3TZBA 3I2GA 1NRJB 1A2QA 4IIJB 4JBNA 1J8YF 3BJIC 1GR0A 4L72A 2D0IA 3VV3A 4PPFA 3VPDA 4B6PA 3TQQA 3OT1A 5F3WB 1KEWA 2GN2A 4WQMA 5A5FA 2DULA 2WJIA 1Z13A 2OCBA 3OZBA 2ZWIA 3G7SA 2W8BB 4GXTA 4P45A 4XFKA 5A5GA 4GT1A 3ROQA 1PEYA 1EGMB 2WICA 2B4AA 4JOQA 3NHBA 2PUWA 4X5OA 1FCJA 1IXSB 3MNFA 4YIHA 4F8YA 4QARA 2UXDB 4EQZA 1NKTA 5DGTA 3WHKA 3KQNA 1WDKA 2MYPA 4H6VA 4D0RA 3VMMA 1LBIA 3D7KA 1BMFA 1CF4A 4C7VA 5FWYB 3T1VA 1NW6A 5HF8A 1B26A 1UBNA 4LTDA 3SE7A 4ZCMA 3I5XA 4JJ6A 5CBPB 2EX1A 3BWXA 5JNTA 4D74A 4DV3B 3JWEA 4CG0A 1ZM2A 2JGNA 5KO2A 3TZKA 3NM6B 2YJVA 1JF8A 3PQFA 2K4MA 1J0XO 4V0KA 2DOKA 2HL6A 3RU2A 3SI7A 3GLFA 4HRVA 4EI7A 4NR0A 1WXEA 2KLBA 4CKZA 4MLZA 3WKDA 1JAYA 4RK0A 1EDDA 3NBMA 2LXNA 3WV5A 1XXLA 4Y2PA 1Y0BA 3PA8A 3GLQA 3OEYA 5CJ2A 3REQA 2OZLA 3H1EA 3AR7A 4HAUA 1ISIA 3QE2A 1VI6A 3FUVA 3IKMB 3BQ9A 5KMGB 5C1OA 3IIBA 1H94A 4CQNA 1FTYA 1AZSC 2RHWA 3EIHA 4CM7A 2VK2A 1OYOA 4EB8A 1DAPA 1CIVA 2H17A 2KS6A 3P71T 1MH1A 3OQ6A 1BMTA 2RAUA 1PYOA 1VG1A 1XXHE 2GM4A 1RLMA 2CV1A 1QQ6A 4QDKA 4IOMA 1CUHA 2D5AA 5DM2A 3V6LA 1J4AA 3W8DA 3MN1A 5BT8A 2QUBA 1WU7A 4IQ0A 3GUCA 4NOKA 2NZVG 4D3YA 1IZ0A 1J33A 1HT1E 2GKGA 3LX5A 5F5LA 3FBTA 3PQDA 2XUGA 3PRJA 4RK1A 1GEGA 5LCXA 3TINA 4EBBA 4C3ZA 3O31A 2HRBA 2DE0X 4L0QA 3REFA 4TWRA 3SIXA 3SC4A 1X8KA 2J59A 3H4TA 3HI4A 1J8QA 2M6RA 3WISA 3E9QA 3B85A 2DAPA 2PGXA 2R66A 3RROA 1JPVA 1U7HA 3B53X 1XMJA 1C8VB 1Z4PX 1PJ4A 4RVSA 2Q2VA 4FFSA 4CR8A 4C8PA 3GWZA 4RIHA 4YDSA 1XZHA 2VZLA 3PUXA 4WH0A 5FADA 3ZNNA 1K7CA 1SMKA 4TV8A 4EFNA 3KU4A 1W52X 2JGFA 3M7IA 1BX1A 3LPLA 1T0PA 4J9VA 3SJGA 1I4EB 5JYBA 1A9QA 2J46A 2P3OA 3AEZA 3O4GA 2CLHB 3CGWA 1XPRA 1TM5E 1UIMA 3F3KA 4HX5A 4P84A 5D1HA 1L5HA 3EYAA 4KWIA 4QSHA 1NF9A 4O2AB 3EA0A 3O1LA 4YJ2A 1HDZA 2I7DA 1US8B 3PTLA 4V02A 5A5EA 4DPMA 4AYWA 3IQGX 3KOUA 4YP9A 1ECFA 2PZMA 5DSZA 2P3QA 4TT8A 4X45A 5JPIA 4E15A 5LP6F 3IOMA 2D1RA 2OXFA 3EVGA 4KGXA 4N12A 4B3SB 1L7AA 2H5EA 2OE2A 3CBGA 1OU0A 1Y8AA 4MR9A 5FB3A 4GWLA 4Z4EA 2R97A 4HDNA 3V46A 3A4IA 1N57A 1FP7A 1YCDA 4M0UA 3CZ4A 3IKTA 3A0RB 1JIXA 3HB1A 3I92A 4G1BA 4WCDA 5CB8A 4JOBA 5FXMA 1R7RA 5AXBA 1GLGA 3DC7A 1AKNA 3MGGA 2BFNA 2CNWA 1JTFA 2GYYA 1KOJA 1AC5A 4EX6A 1CLEA 3NV9A 4HV4A 2CNDA 2JIRA 3QM1A 3BM5A 3BXEA 1ST2A 5DI9A 2O05A 3GDHA 4INJA 3CPHA 1JKMA 2W7TA 2NN3C 3CONA 3JQAB 3NGMA 4AZTA 2BP7B 1M8KA 4EI9A 5BXYA 4CMGA 2QG4A 2IUUA 2CFCA 2Y1LA 1SZCA 5FBZA 4C3OB 5CA1A 4FCCA 1U7WA 3JQ9C 1I7SB 2XQKA 2XLBA 4UM8B 3TRIA 4WN9A 1R5JA 4LW8A 2GN9A 4CF7A 4HQRA 3FEDA 5JSHA 5EGNA 1DJOA 2OBXA 1GD1O 1XDUA 4D4JA 4AXXA 2NSJA 4FMDB 2JFFA 4K87A 1UEJA 2PKCA 1WG8A 2A4KA 2HA0A 3GDFA 3QNUA 4HGYA 4X7RA 3TI7A 2WAMA 3RODA 2JLVA 3TEJA 5A6SA 1VIVA 3UENA 2CVPA 3F5QA 1FYFA 1EQ2A 2IE0A 3VR5H 5MFPA 3KEOA 2H1FA 3Q8KA 2BKEA 2HMVA 4WV3A 3K71B 1CRLA 1YMQA 3DXFA 1KTIA 3KETA 5EKDA 2NPOA 3AUJB 3OFKA 2XNHA 5CAEB 1N2CA 4BNDA 3I74A 1W5BA 3M5DA 2RGDA 1GZ7A 4Q4LA 1GEEA 2CE2X 2Y6UA 3LUKA 5F1KA 4W4TA 3VDXA 3LCCA 4YUZA 1CY2A 1KSGA 1MF7A 4GYKA 1Q11A 3CVUA 4P9NA 1EP1B 1W59A 4YO7A 5EIWA 4AZWA 2LGJA <