3TLGB

Microcin c7 self immunity protein mccf in the inactive mutant apo state
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINWNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 109
structure length 335
sequence length 335
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
B PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlgB01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlgB02
3TLYA 4INJA 4EYSA 3T5MA 3TLZA 3TYXA 5JYBA 1ZL0A 4H1HA 3G23A 3SR3A 5F5XA 3TLEA 3GJZA 5F1YA 3U1BA 3TLBA 4JVOA 3TLGB 2AUMA 4IIXA 4MI1A 4E94A 4MJXA 3TLGA 3TLCA 1ZRSA 5K99A 3TLAA 5FD8A 5F9MA 4IIYA 2AUNA 4E5SA
chains in the Genus database with same CATH superfamily
2CDAA 4RTOA 3PC2A 3HTXA 3CRRA 5J2UB 1EFRD 5BN4A 2YS6A 2WW8A 1MRZA 1MEJA 3M34A 2Q4OA 1HMPA 4FFDA 4TM7A 1CQZA 3UAYA 3WJAA 1M34B 1RP7A 2X2EA 4CRWB 4YRAA 5LKRA 3TKAA 1H66A 4GX5A 3ZEAA 2ZWAA 4W7SA 1GTMA 1WDLA 1M34A 2GO1A 2GTHA 3R76A 4B71A 1U8AA 1UJ5A 3E0QA 4WEQA 3WNBA 3ZX5A 4QG7A 2VZ0A 4PYNA 3U9LA 2P4HX 4TLEA 4D0LB 5JDCC 5HX7A 1TDJA 3HP4A 1JHMA 1L3BA 1WSBA 2FFQA 1E69A 4CODB 4MQFB 4IGEA 2GJ9A 4IIGA 1BDJA 1YOVB 2OV2A 1JSZA 2X9VA 4YNBA 4DJTA 4EI2A 4B3BA 2OQVA 4JUBA 4DV0B 4MQFA 4BE7B 2C5QA 1YOVA 1KO5A 2G1JA 4R16A 1AQJA 3O83A 3ASVA 4F4DA 3T5TA 4C0HA 1WUKS 1WB9A 1ZBDA 4D81A 4CTJA 3GLRA 3B20A 1QH8B 2VOEA 4R4JA 4IJQA 1E1NA 1AHIA 1WXEA 4YA6A 1Y33E 3WMXA 1J2EA 1G9TA 3AZOA 4D8YA 3GLFE 4HLDA 1QH8A 4WWHA 1H85A 6ABPA 5IT0A 2A6PA 3H87A 4FTWA 4D96A 2V7BA 1YD7A 4MWTA 2JZNA 4LGCA 3Q7IA 4LOHA 5AK3A 1HNWB 5FUQA 2LD4A 1M1UA 2IUFA 2KS6A 5KSPA 3RG8A 1V9SA 3BZBA 1DU4A 1DRUA 3ROZA 5BV1A 1Z2DA 3PL5A 4XDZA 3GA7A 1IN1A 3HK2A 4F1JA 2IKSA 3ZI4A 2G82A 3OFJA 2OHIA 4FIDA 3S29A 2FW0A 1FDIA 5JROA 3MTQA 1RMTA 1AUPA 4R1QA 4D9HA 4CNQA 4UW9A 3BE6A 3VYTB 4AJLA 4MUGA 1IXKA 3X1WA 1YB7A 4PX2A 1IONA 4IV0A 5EIBD 4NOJA 2ZAYA 2J0EA 3TOSA 3GEBA 3GRCA 5LUAA 1NG1A 1PYDA 5KREA 5ISMA 3PRYA 1V9CA 1XXHA 2VQEB 2ZCJA 3IVGA 3Q2IA 1ADJA 4FLMA 1ESNA 4KGVA 1L5GB 3ZHUA 4DE5A 3QEBZ 2QUZA 2IZZA 1XMSA 3A1EA 2IS4A 2P4QA 2DH6A 4ZQFA 4D3YA 3UUFA 4B1FA 3CW8X 1BMFD 4B7XA 1F7UA 3ZE7A 4KMOA 3IAM6 3B2QA 1VJ1A 1B73A 2VYCA 3EVAA 2QRQA 3HBLA 4JQCA 4ZU6X 2LBPA 3P0FA 1Z68A 2XXAA 1TA9A 2ATEA 3T1NA 3OQNA 1DO0A 4D44A 3N5KA 2Q4BA 2JGNA 3CNBA 1FS4A 1RWBA 4P83A 4AY5A 2J3QA 4ZCIA 4ZYLA 2H4ZA 3M6IA 3TL6A 6REQB 4AT1A 3MJSA 1F6BA 3KTAA 1IN8A 3LDGA 4JLMA 4WLEA 1M0EA 1N0HA 2IQ5A 6REQA 1V95A 2BHRA 1J42A 2CGEA 5B7QA 1KZ1A 2QTAA 4FYXA 2RMKA 3IIIA 5I8WA 3U7RA 4BECA 4D4HA 3R2JA 1BSVA 3TOXA 1CDEA 1TIBA 2AB0A 2F67A 2YYZA 3B6ZA 1KGSA 4HZUA 4RQTA 4X91A 2OY0A 2ZTHA 3T1OA 1U0LA 1UPFA 4X66B 3K8ZA 2EAUA 1U0EA 3GG2A 2C4VA 4UMVA 3I4CA 1FMLA 2AUNA 2XNDA 2WVJA 1LDGA 3P0JA 5E9WA 1RLJA 3RCBA 1JDTA 4LQGA 2J09A 4DIDA 1NBWB 2JF0A 2ZRGA 2H5LA 3WYEA 1M1XB 2OGWA 2P2SA 3NOOA 1RRMA 3DZGA 2JGJA 3OCUA 3NYQA 1UBCA 4O3MA 2TYSB 1NBWA 2GBFA 2HV9A 2H16A 1UZAA 1GVHA 3DHEA 3L77A 3LRPA 5JBQA 3DXZA 1FYVA 4C8AA 2R7AA 1SM4A 3ZJ4A 1YR3A 3TEMA 1EMDA 4MQLA 3CX7A 3UMSA 5AKJA 1G6KA 4W1QA 3VOBA 3KOMA 1X80B 2PTHA 2I22A 2WI8A 1WXGA 5ADVA 4IVQA 2DULA 4JI6B 1X80A 4ASUA 1GTG1 4QRIA 1KRHA 4MUIA 4OXNA 5EJ7A 2XT6A 1OI4A 3NV7A 4X60A 1G64A 1RPAA 3GN2A 1ZD8A 1EXWA 2VCYA 3T9CA 3VZSA 1EBFA 2X0KA 1M2VB 3G8CA 3GG9A 4FILA 3V4VB 2OHJA 1XTZA 1M54A 2YY5A 3OIWA 1M2VA 2XKKA 4GVPA 1Q5XA 1HURA 1R18A 2LZ0A 5TS2A 5EPEA 2IVZA 2C2XA 4KQCA 2GBPA 3TX6A 3RIYA 2Z8ZA 2XB9A 4RL4A 1N2ZA 1G8JA 2YYYA 4ALIA 2WU4A 1K5GA 1S8OA 4BLRA 3C8UA 2JEOA 1C8BA 5I5GA 1SU4A 4KYUA 1Z56C 3H5NA 1BU8A 1U9ZA 1W6RA 2QPLA 3KSUA 3BHIA 2QP9X 1ZY2A 2UZ3A 1QANA 4YDSA 5FDFA 2H29A 4NMWA 2XQKA 1TJ3A 5FUYA 2C4NA 4RIEA 2QJOA 5JDIC 1A3CA 2WJHA 1F9EA 3ETNA 2FFHA 5CFMA 5JSUA 3LLUA 3GFVA 5DHTA 5GJWC 1UBEA 2KLHA 3ABRB 2UDPA 4NH0A 2VJBA 5DI3B 4B3SB 1SCQA 3SCZA 3DLBA 3GGJA 3CVOA 3IAXA 4ZMBA 3D0RA 1IB0A 1U7DA 1Z8FA 3CEAA 3DWEX 1HE2A 1NBIA 4J0KA 3GMTA 4RF4A 5DI3A 4EUSA 1XK6A 1ZOSA 5T5QA 2NQ8A 2X0IA 5DYNA 3FZEA 3ZU4A 4H2DA 1JIIA 1RP1A 1W36D 2PX8A 1WCXA 1LF0A 4C5BA 4U7WA 5H3CA 1Y1PA 1MVNA 3PDHA 2VYQA 3FPJA 1RT9A 2DFVA 2QMOA 3W6OA 3Q9LA 3H2JA 4RBNA 5D85A 2Z0MA 1J70A 3IULA 3L82B 2OFWA 4X5OA 4MV4A 4ENPA 2O5CA 3K30A 2HNKA 1I2DA 3PCXA 4RXMA 2I34A 4NDAA 2HPHA 1VFNA 2WLTA 2EW8A 1K7FB 1RZRD 1E5LA 2GN6A 3DGEC 2VDQB 3QUCA 4RV9A 3ST7A 2I6SA 1Z4LA 2KLBA 4IRUB 3LV8A 3G9QA 4ML3A 2IE8A 2W37A 1Z6GA 3DA8A 4QAJA 4CDMA 3RVDA 4YAUA 2D06A 2HWUA 3JZAA 3AFMA 5DM60 1HOXA 4UPEA 3COWA 4L7VA 4RMGA 2BGTA 2O8DA 3GLIB 1K7XB 3SLRA 4CKCB 2J45A 1K97A 3O82A 3ZWDA 1DX6A 3PPVA 4QPCA 5FOXA 3T0GA 3GLIA 4L0MA 5DPMA 3RIXA 1JFLA 2V4ZA 3MB5A 4KQ9A 4OLJA 5HQTA 4H3VA 2VQDA 1WIWA 2H4FA 1EFUA 3D8TA 2BZ0A 3KHKA 1JMYA 5LQAA 2O57A 3F6YA 1FZTA 2ANBA 2HF9A 2A0YA 4M9ZA 4I08A 1FPMA 1UT6A 4CLOB 2I7DA 3ZYZA 5FPKA 4N5NA 1CTQA 1R4ZA 1TYAE 2ECFA 1BVUA 1C29B 3K0CC 1OU0A 2HMTA 3X1DA 4DSZA 3RT1A 1G3IA 3GFTA 4FQ8A 5LQUA 5FL3A 3E9YA 1XYVA 3EIQA 3VKUA 1OXTA 4UHBA 1AK2A 3BE8A 4Q39A 5KYUB 1RM5A 3R5SA 4RAQA 5JYDA 1W85B 3FW1A 2WZDA 1M8JA 2I4MA 3OAAA 4RPGA 1A7AA 1Q95A 3FH0A 4HDOB 4MVJD 3HCRA 1YZYA 2IZ0A 2VN8A 3EN0A 3Q8XB 4FYWA 3LPMA 5KYUA 1W85A 4ER3A 1DG9A 5ADUS 4UM7A 4B73A 5IANA 1KFKB 4Z4QA 4NI5A 1KFBB 1R74A 2H1VA 4JNKA 2C9BA 1CJUC 1VYTA 5M3BA 1NW4A 5EXPA 1IN5A 3GJZA 4WLNA 3DDNA 4CM3A 2C8LA 4JVSB 3OOYA 4LYFA 5DF1A 4AYXA 1M75A 5U9CA 1SUAA 2ABWA 4BUZA 4KKVA 3EEYA 4ARBA 1OTYA 3AEXA 2DZDA 2J9GA 5BSUA 4YRGA 4D1YA 3OX2A 1OVMA 2Q4RA 4GZ6A 1FRNA 3KD2A 1UKEA 4QEKA 4XTCS 1X6VA 5FEUA 4REOA 4YJFB 5LBIA 5AW4A 3RUIA 1OQAA 1Z37A 4NMLA 1ODIA 1M8KA 2ZXUA 2HZ7A 4YJFA 3S9LA 4IBOA 1NRIA 1N1DA 3PZRA 4Q3BA 2UAGA 3FG9A 2BEWB 4DLBA 2BFCB 5AO9A 4FGJA 1E1CB 3A4IA 4GEKA 5F7OA 1L6IA 3A6HA 1L4MA 3ESRA 4EW6A 5D2CA 4TMXA 4JJKA 2LXNA 4H7HA 2BFCA 3MJDA 4CU2A 1E1CA 2ZYHA 3KPJA 4Y9UA 5G3ZA 4BLWA 3R4CA 1UQRA 3ZDQA 5EXTA 3JQPA 2QIOA 4UPVA 3ANMA 4ZGGA 2BMAA 2W2LD 4WI1A 1YNOA 1ACMA 1ZGBA 1FNSA 2WUDA 3ZKWB 1N9GB 1PGJA 5SZIA 5CFOA 4MWZA 3U16A 1DV2A 2NXWA 1PNTA 2G9UA 3DE1X 2K6GA 1N9GA 4HLUA 3ZD8A 3P2OA 1GCGA 4DV5B 2EGUA 1TM2A 3RROA 2JGKA 3GFQA 4TMVA 8ABPA 1NLFA 1NVAA 4LVCA 4ZQBA 5JUWA 3JAMA 1QU3A 4KWEA 5E7QA 2E82A 3TUZC 2OD7A 4X8OA 1NJGA 2PXCA 2WM3A 1KQNA 1NIJA 1T2EA 2GI4A 3USES 5B12A 2V3CC 4GBGA 1UJMA 1ZOIA 4J0JA 4F6RB 4TN5A 4QEDA 4LK2A 1N1EA 5K8TA 1ABFA 2J5KA 2HRCA 2NPIA 4XYLA 2RGEA 3LO5A 4F6RA 4NBUA 2BHNA 3REFA 5JNVA 1B1CA 1SHUX 1TLFA 4PFQA 1FUIA 2V54A 1PJSA 3BK7A 4C87A 3O6VA 5BVHB 3LPCA 4JLSA 4QUBA 2VPPA 1DQNA 4G5OA 4IF4A 4RTRA 2NQ2C 2H31A 2YUIA 3Q9NA 1IEVA 5BVHA 3PYXA 3FDZA 1KRXA 1P45A 2V55B 2PCJA 1W34A 5AOCA 1CERA 3PTLA 3K20A 5BSHA 3TTYA 1GAJA 4AX4A 3EUAA 3LQRA 3MILA 1FOEB 2M1ZA 4L3OA 1ODFA 3ZWOA 3K7EA 1ATZA 3H7AA 1TUGA 4HGPA 4RC9A 3NBMA 2ADFA 1EE2A 2GLTA 3FIUA 4F3KA 4TJVA 2JS7A 1O6BA 2C03A 4XQ9A 1TUBB 5TS3A 1GFZA 5M04A 3SLGA 1TQ6A 3W3AD 1I94B 4JLVA 1Q7CA 2BF4A 3AM5A 1Y3HA 5K20A 5JU6A 1TUBA 3L8ZA 4JLWA 1D2CA 4RZXA 5CDGA 1T1EA 4YREA 5TVGA 5ILOA 2BTEA 3GX1A 1A76A 3DAHA 2Q7DA 2XVAA 3PNKA 1H23A 4B46A 4CZ1A 2AK3A 1G3UA 2HRRA 1A77A 4XEHA 5CR9A 1MZPA 1MQAA 3OJ0A 1IK6A 3HCOA 1P72A 3BRCA 2VXYA 1LPPA 4A82A 5FNVB 4MARA 3MQFA 5GV7A 1S8FA 4KFUA 3HGTA 1LKZA 1OGIA 4FYMA 4N7BA 4JWTA 2BKEA 1CDZA 2O7VA 2G7MC 3I0NA 1IM8A 1YJBA 5FNVA 5J4VA 1BWQA 1WZ2A 3UJ7A 4DXHA 4DPLA 4TKZA 3C6YA 1R0WA 3DSRA 3BH0A 4ZI7B 1UQTA 1Y5IA 2NTJA 5IVDA 3INGA 3WYCA 1ZS9A 2EF1A 3GRVA 3J81A 2I4OA 1GNPA 2XCLA 2D5IA 3EMDA 2IEIA 1NRXA 4ARZB 1QLHA 2G5CA 3O3OB 2ES4A 5I5EA 2O19A 2BE9A 1IY2A 4P3XA 2Y99A 3WIDA 4NEGA 2PD4A 3Q3EA 3RS8A 4ARZA 3ZY3A 5JI2E 4UAUA 1XZJA 1M5TA 3K9HA 3F3KA 4X41A 4CDJA 1XF1A 1P1BA 2FVYA 1NKSA 4IWXA 4PINA 4YCLA 1JVNA 2QNRA 5JBNA 3NANA 4DR7B 3DV9A 4FLFA 5JY6A 1DQSA 2ZM5A 3KCNA 3HY4A 2NTNA 1IAVA 4OSEA 2EQ5A 3QVSA 1MC1A 1Y3AA 4AO8A 4CLHA 4GI2A 5BNFA 1CVLA 4MXDA 3N8HA 3H9QA 3ROMA 4TLBA 1Q92A 1SURA 1QMGA 4KTTE 3ZQKA 1GGJA 4IO1A 4M83A 5ALRA 2O50A 1U2GC 4AZWA 4QBFA 3B9RA 3QV2A 4ZPJA 6Q21A 2G1PA 2GQ0A 3NBUA 3Q7PA 4MMZB 1R88A 4J91A 3GDHA 4HH3C 5CYOA 5EUQB 1TJYA 4PG4A 4WRRA 4X92A 2VJQA 5LXTF 1SN7A 3TB4A 3G2QA 4AYWA 3SYMA 4B7UA 3HY3A 2O1XA 5HCUA 5JSFA 2P79A 3R40A 4XDYA 2D0DA 1GNTA 1L5HB 3ZVLA 2YC2C 4S05A 1EZAA 1AXEA 2R8OA 2D00A 3VPCA 1L5HA 1U3TA 1TYZA 3IUPA 3L6OO 4FOOA 2P5TB 5CIWA 2KBFA 1J2TA 3LY7A 2FEAA 5ALVA 5SICE 5TMDA 2JDIA 1CRPA 1RACA 1W47A 1B0AA 1E3JA 2PKQP 2PPLA 3ETGA 2CF5A 3MCZA 4I1VA 3RK1A 4NZ9A 2F59A 2VSNA 1EA5A 3VNRA 4F46A 4ZK6A 1XMPA 4YV2A 4YYZA 1DCKA 2JRLA 2P8JA 3JAWB 1ZR2A 4E5UA 2F17A 3QX7A 3VR3A 1ZCAA 3T1VA 1DFGA 1SVLA 3JAWA 4RZ2A 4YPFA 4C7OB 2ZUBA 3H05A 4UCFA 4YCCA 2I33A 3F5QA 3RU2A 2ZB4A 1LQUA 4MNTA 5J2UF 1IN7A 3UAZA 3VR2D 4C7OA 5U4QA 4PM4A 5DYYA 3UWPA 3WO1A 3OD5A 3B1JA 2A4KA 2JI4A 3F5SA 2XLCA 3A11A 3CIFA 4BEWA 4Z7NB 4GM4A 5JZMA 1FDTA 1TMYA 2HT1A 4G86A 4DCGA 1TAGA 3AIMA 3E2IA 3SMVA 1XDDA 1G1AA 2IXBA 1HPLA 3EG9B 3FR8A 4JT9A 4P44A 1KKUA 1ZN2A 2JLRA 3DDHA 2YNMD 3F71A 1YIAA 2B4AA 4HFRA 4X7PA 1L4LA 2VLIA 2PZAA 3EG9A 3LGXA 1E2JA 4LYHA 4DQXA 2AMFA 4OVKA 2ACEA 2PGIA 4YMVA 1QP8A 1SQ5A 3I83A 3SQNA 4EUHA 4LF8B 3DVQX 4PFJA 2C83A 4MV7A 5LOVB 4OB7A 1LVHA 1U28A 1NNSA 4E88A 1AD2A 3HCWA 3DH0A 4LBVA 5LOVA 1DOAA 2CY0A 2ID9A 3TDNA 3I9MA 2RGWA 3C1UA 1ZUIA 3IE0A 3TI9A 4B33A 5IWCA 1UC4B 2YV2A 3F90A 1USWA 4OLAA 5ER6A 3P4YA 3QPUA 1DWUA 3TO5A 3U3ZA 3OM9A 3ME5A 3IBYA 2BHLA 3N87A 4ZANA 2SKCA 4JBIA 2D3TA 1K5HA 1N8NA 2HXYA 2OLJA 4C4TA 3FOAA 3WGZA 1T3LA 5C7LO 1W0JD 1XZCA 3CRZA 3N6XA 1VL2A 2VDKB 3OJWA 3PR3A 3VR1A 1N0IA 3MS2A 4TWZA 3T1YB 1ZU5A 3LP6A 1CUZA 2FN7A 4OMFG 1LWOA 1AZLA 4IINA 1KZ9A 1T3TA 3CLHA 3L8DA 1LW7A 1UPCA 5HIMA 3V1NA 1SOVA 2MSDB 2CD9A 2FX2A 1JEOA 1ZQ1A 4C3VA 4DSOA 4EYQA 1Z0IA 3ZOKA 2PKXA 2K2WA 4M8SA 2VTBB 1CDDA 5FI5A 4M99A 5TSDA 1OBVA 3PFBA 4KN6A 4RSHA 3PWSA 5JAHA 1ADYA 2G4CA 5LWHA 2VTBA 3KUCA 1BXKA 3L8CA 4PS1A 3K5PA 5CMLA 4C8TA 3AFOA 1EX9A 1YBFA 3RIHA 4PWYA 2PZLA 1WY5A 3U9SA 1F2TB 2QTCA 4CKZA 2PKYX 5JISA 1P0FA 1FRFS 3F6PA 5A5VA 3GL9A 2BFMA 5LP6B 1F2TA 4ZT3A 1M7BA 1NW3A 1Z5ZA 2IK8A 2QX8A 2B25A 4AIRA 1Q1AA 4YJKA 3H86A 4CG3A 4BMYA 2W2OA 3U3JA 5LP6A 3STYA 4C4RA 2AD5A 1ZU4A 1Q91A 1ZH6A 2JHFA 2GEJA 3GEDA 3NHZA 1T2CA 4N8EA 4RO0A 5A6SB 5A1TA 3HXQA 1VI2A 1CRWG 2CLDX 4OK3A 4X8HA 3S55A 5HKLA 3CVXA 4EF4A 3VDNB 3KZKA 5A6SA 3KXKA 4JLAA 5JSQA 3CGWA 2DIKA 1XMQB 2CWWA 2OPBA 1QK5A 3EJWA 3HXMA 2R60A 3PKJA 5JQGB 4TYWA 2C2WA 3KOXA 3WP0A 4KHZA 5JQGA 2P9GA 2Y8EA 1DRWA 2RE8A 2GSWA 2J48A 4Q3OA 3FYUB 1T43A 1A9SA 2E3JA 2P11A 3AJDA 4YRQA 1AIPA 1J20A 2DUUA 1ML4A 5DTEA 2B98A 2DBZA 2IYOA 5EZ6B 1PDVA 3FYUA 4DCVA 4ZO9A 2QMQA 3VVMA 3LY5A 4UBOA 1CF4A 5FBQB 2C2YA 2PL3A 1DHRA 1CEXA 2HM7A 3CRW1 4FN5A 5FB3A 1QH1B 4O4HB 1QGYA 4O4JB 2WSBA 1T5HX 1WP4A 3HDGA 4FDVA 1RLTA 5IJAA 3U60B 4MVJG 1YJ5A 2FRDC 5G0UA 1QH1A 4HG2A 4O4JA 4O4HA 3VI3B 1NN1A 3WGYA 1APBA 3UBTA 3PT5A 1GZVA 2AH5A 2IJGX 2PGLA 2X2OA 4JB0A 4QLAA 5IMBA 3S27A 5AUPB 1VIAA 2A14A 2G0TA 1PJ2A 1PIWA 5DM1A 4MKXA 1LQ2A 4BVGA 4F3CA 2Z5GA 2OV6A 1DX9A 3KOUA 2J87A 3QXCA 5TQVA 5EWLB 1TM3E 2PY6A 1F8YA 3BKWA 1NN3A 4GQBA 3LIIA 1EX6A 3U3RA 2E89A 5AKYA 4FYHA 4GC9A 4BMZA 2J7PD 5DHFA 3A6GA 2JLXA 1WXWA 4G9GA 2CC2A 1MZVA 2BISA 3FDJA 4BUCA 4MUKA 2MYTA 3IEVA 4HN4B 4QIHA 4NMHA 2WYIA 1FUKA 4D9JA 3L4JA 2IH5A 1SXJB 2ZTUA 4MA0A 5D5HA 5WRFA 4N4AA 1DKQA 2B7CA 4AJ1A 3OX1A 4N5LA 1O94C 1SXJA 4G85A 4IGFA 1E94E 4O1IA 5E3HA 3OZCA 5CLLA 3DGFC 5AICA 5BYKA 2BFEB 2VNHA 3LA6A 1RTTA 4WCDA 4H6WA 1YZFA 3TPZA 1IULA 3T7DA 1U4NA 1PNQA 4CL8A 5L6LB 4IGIA 1VE7A 2UXDB 2BFEA 2P4EA 1PI3A 3VSDA 4ALMA 1QVWA 1Z73A 2Z6VA 3FX2A 2ALJA 2GARA 1BEZA 1VDMA 4CV1A 2EK8A 1T3ZA 3JCZA 4EMBA 1F8FA 4CIAA 1PR4A 2WTNA 5CXQA 3BGVA 4IX9A 3WLNA 2VTVA 3UPTA 2R2AA 3EWSA 4GI3A 1M76A 3GY0A 1HUQA 4BNGA 1VG1A 1C9NA 2P68A 8ATCA 3K6SB 1E7WA 2QNIA 1YTLA 2XMPA 1CNFA 1DWPA 1XFAA 1Z4MA 2VUUA 3PTZA 2EFGA 2HJ9A 3HKBB 3SZ3A 5DNUA 1LTHR 5C3UA 1HY3A 4ZDKA 5KQPA 2XGOA 4G0XA 1EBBA 1U5CA 2GYWA 3IPCA 3HKBA 5FL7D 3I8XA 4IMPA 4KR7A 3PA8A 3E9QA 4M7WA 2HSJA 2XYGA 2C5AA 2EHJA 2E6KA 4H6VA 4LC1A 4MIEA 2IV7A 3TXYA 1EJ6A 4EPTA 5LQRA 1FDUA 5GMOA 4KR9A 2IGTA 2QUAA 1Z2OX 4W9NC 3ROPA 1W96A 4DT1B 5HZHA 4PWZA 3ACBA 2CXSA 2ZUVA 5HUQA 1AUQA 1S5PA 4LZAA 4NPHA 5BWOA 5L9AA 3MHTA 2X0NA 4TQGA 1AKEA 3M5DA 4DT1A 1G5IA 3EW9A 3ICPA 4GKVA 3GXBA 4J1SA 1G8PA 5SYMA 2H6EA 3HJUA 2NO0A 1E9EA 3QHAA 4HDNB 3RK4A 2CLLB 3KXPA 2VDOB 3VH2A 2VK2A 4HEA6 4HDNA 4GT1A 3QXSA 5IN5A 2ZJOA 3RNOA 1EG7A 1H4VB 4RZ3A 3ZLBA 1QR6A 1XTUA 1EHCA 3NEJA 4LHXA 4H15A 1AOXA 5AFSA 4Q03A 1EYZA 5JRZA 5EGSA 1OI7A 1I24A 1ULTA 4DMLA 1G7TA 1OFUA 1HT3A 3GPBA 4LA4A 1JQ5A 4E2ZA 1UMKA 3IUYA 3LZDA 3UWSA 3BL6A 4RCVA 4XGKA 1T8PA 2CDRA 3LVRE 5AHOA 3MTEA 5BN5A 4M36A 1GLVA 4ZXPA 4D6XA 1H1DA 4DR5B 3ZH2A 5JS6A 2IF2A 3FNRA 3HDHA 2NZJA 3PDCA 1C14A 1Y3DE 3NKLA 1E1RD 4HATA 3AIOA 4HYTA 2FW1A 1X1AA 5EEGA 3NMUF 1PKXA 2PGXA 2ZXFA 5EE3A 3EC7A 3CLUC 2GNAA 2D6FA 1C3JA 1K4KA 2FDRA 5EMKA 1BEEA 2XITA 4OMUA 4PQRA 3DTTA 3KBBA 3OQBA 2A9KA 4W8GA 5DCYA 2EW2A 3ANLA 3RKSA 3B78A 5AJTA 1QJ4A 3I5MA 5H7XA 2J5QA 1WQ3A 4UHJA 2OBXA 3SHTA 4ECEA 1JAXA 4RPHA 1Q0UA 4LDRA 4URFA 3HSYA 4HNGA 4BMCA 5IVHA 1BE6A 2VP4A 2ZUWA 3RIMA 1WPXA 3DMTC 4RH3A 5KTNA 4J0FA 5U1PA 3DFKA 1LBHA 1TFRA 3LD9A 2XF8A 4JUCA 4C22A 2C7QA 4JBXA 1R6XA 2PQ6A 3IVMA 3IX7A 3OZWA 1GTSA 4YONB 3S28A 1OHHA 3OJCA 2BM1A 3JYNA 3AHFA 1R6VA 2DFDA 3W6NA 1R6DA 4LY3A 4KCGA 4NCJA 1GFWA 1Y63A 1IEWA 5HFJA 3SX2A 3MJ4A 3PENA 2I1QA 3HJNA 1UBUS 3R5HA 3T9DA 2JIZD 3EC1A 4YP5A 5BO5A 4QU5A 2GN4A 3U4QA 5BR4A 4IY1A 2AJDA 2H7XA 4E2WA 2IPLA 5A4AA 2BSXA 2A5JA 4RW0A 3HB7A 4F92B 2C4KA 3SJEA 4JT2A 4REQB 4TKUB 1YQGA 5HSGA 3HYRA 1GDHA 4MI1A 2BMVA 1KK3A 1JDUA 4REQA 1G8GA 4TKUA 4UFNA 4WNCA 1ZVKA 4ENQA 3TQSA 2FPOA 3IOYA 3MRXA 4G0OA 3AUAA 3OCZA 5L3ZA 3HWX1 4FEYA 4Q21A 9ABPA 3KXDA 1KI4A 1M66A 1KWKA 1WJGA 3FA2A 4JP3A 4NPAA 1C80A 4LHSA 1HA3A 5GZ6A 4KWTA 4R1SA 4YQFA 4IRMA 3NNSA 4YRMA 1QMPA 4GRIA 2IW1A 4PQGA 3A6LA 1OBHA 2R1VB 4G1CA 5LA6B 2GHRA 2ZE5A 3NHFA 1ZLXA 2CW5A 2FMHA 2ODTX 4BCBA 4MZXA 3MQ4A 4C9BA 1G55A 5LA6A 3BJRA 2X13A 1RKUA 4H7IA 4MUEA 3TBFA 3VPAA 2WIGA 4YLEA 3QZUA 5TE9A 1RAGA 1E6LA 3SVLA 2E4YA 3SSAA 1U0NA 1PP4A 2NU9B 3UFBA 4F2WA 3WMRA 4QSHA 2HA7A 4Y2JA 5CAEA 4FMDB 4DC1A 3THOA 3GT7A 1EZBA 2XX3A 5KYTA 1QAOA 4KODA 4NU6A 1H4SA 1DXOA 3QUQA 4LMBA 1VLJA 1WZCA 3DEAA 4O8CA 4ZVSA 2VWGA 3CLRD 3V8MA 4DNPA 3OOWA 4NCHA 5CLQA 2PZBA 3DZDA 4MUBA 3HUDA 2REOA 5BRNA 4U6SA 3RRFA 1CD5A 2QHXA 4PGFA 3OHSX 3H9CA 2F9LA 3DHVA 4IJUA 5GOZA 3I1YA 1CEQA 4BE9A 3EBPA 4MRMB 4UHFA 5AJYA 1FS6A 2QUKA 2GZ1A 3LHKA 3KVYA 5D1NA 1MW8X 4EJ6A 3RTAA 3KE8A 2GZDA 1RZUA 3N1UA 4MRMA 4TLLB 5IC6A 3NT5A 3KR2A 3SI7A 2J31A 2Q4TA 4HXEB 5CFNA 3PF9A 3KZCA 1H2YA 2YDXA 4FE4A 4JK3A 1L7RA 2CL7X 2R87A 4YCDA 4YQZA 4CLXA 4N48A 1JI3A 4OH1A 1V7ZA 4OX9Y 1UFVA 2X19A 4GU5A 3J80A 2M6LA 1GA1A 3G7NA 3ZU6A 2ONKA 2A9VA 3PRJA 1TL7C 3W34A 4K8RB 1JHXA 5KCMA 4D3DA 4OJTA 3KASA 3KLOA 3HB4X 4R7TA 1L4HA 1UODA 2NUPB 3PYMA 2PX2A 4NV3A 5ALDA 5ALOA 3TB6A 3LXRA 2I7XA 4GLLA 4LOJA 1VP9A 1DXQA 2NUPA 4IDCA 3AY7A 4M88A 3GFPA 2B69A 2ORYA 4XUEA 5E1MA 5CDTA 4J1TC 4NBTA 4MKHA 3E6AA 4YCAA 3AX6A 4E22A 4H60A 2GCPA 4LTMA 5FNVF 5GZ1A 3GOQA 1TCVA 2HL6A 1QP0A 2P6RA 1N2HA 2Q2QA 4IFTA 3W5CA 3SIRA 3FZYA 1RI1A 1TQHA 3MJTA 4JBGA 3WGOA 1PL6A 1PO7A 2FMKA 2Q6OA 4P54A 4XVUA 1P61B 2C2HA 5E7MA 5BURA 4IZ6A 1JPNA 1SWVA 5JDIA 4ZI7F 1GARA 1F48A 1XDBA 2JZCA 5FV4A 2VKQA 1NMEA 4CTKA 3IMFA 1J21A 3PHLA 2V6JA 4PE5B 1PS8A 1M6YA 3CMCO 1MP0A 4EHHA 1L5VA 1XX6A 2WZBA 3QPCA 4KH0A 4LYGA 1Q0RA 4YT5A 2RB4A 1RQLA 3EQ7A 4A73A 1GSAA 3SOZA 1SUDA 5K09A 1NFRA 4ZTZB 5BMOA 1DAFA 4TS4A 5BR7A 2HU7A 1G2OA 4LYEA 4NDNE 2Z6AA 1K66A 1U5BB 2FGKA 1LS6A 3L7BA 2W6IA 2QGFA 3AB8A 4D45A 3BL5A 3DT9A 3EZFA 1U5BA 1T4CA 3R0IA 1YDMA 1EFKA 2D0IA 5HILA 1YE5A 5KYNA 3E2MA 3C5HA 2H92A 2ZBVA 3B70A 3VI4B 1JWBB 3ANXA 5A7FA 4JNCA 1IQPA 2IIPA 3LDAA 3D1JA 4OYYA 5H3LA 1DNPA 3CISA 3DFUA 4AWXA 4K9LA 4DJFC 3WLTA 1PZNA 2GCOB 3DZHA 1JA1A 2JLVA 3L8FA 5JO9A 4CMGA 3KPWA 5IU6A 3HJGA 1NR7A 1NJ1A 3OESA 4DCTA 1FDRA 3BK1A 2GCOA 3ICCA 121PA 4DARA 3M6MD 2F7SA 2ZBDA 3DE0X 2EFDB 3SOPA 2FWJA 4RE6A 3AEUB 5EXSA 3BMOB 1P33A 3KVOA 2IUUA 1VQ1A 1V26A 5L4NA 4J0EA 4DMKA 1ABEA 1YS1X 3OPYI 3AEUA 4QT0A 3BMOA 4JELA 2IHNA 5I9LA 3KR9A 4XA8A 1NF9A 1ZZGA 1ZNXA 1YU9A 3AVOA 2XE6A 5EJAA 3FI9A 3NNNA 2FE4A 4WZBE 4EEKA 4Z4GA 3ZV3A 4UTOA 4OQ4A 4IJ6A 2Q49A 4LXTA 3SJXA 1C7JA 3EZAA 4HGYA 3P26A 1JFRA 1V41E 2WQ6A 1HE5A 4JXKA 5AVRA 1TEXA 1MFPA 3K0CA 4IIYA 1IBRA 2M32A 2RGDA 3NGLA 5J43A 2I6QA 1UBNA 1R10A 3WJ1A 4F2DA 4K6MA 4BV9A 2CWDA 4KPUB 5I7WA 2J4FA 3UW3A 1CETA 3RF7A 2NUTB 4G09A 4FEAA 1XTQA 4EA8A 3OTOB 2BDEA 4DFDA 3PQ5A 5DNAA 2JLYA 4B3TB 3ZXSA 2AK2A 3UXYA 2NUTA 5D84A 3W8FA 1HFKA 1TF5A 4IILA 1WF6A 1JIUA 3CG0A 4Q02A 2APJA 3BWYA 3TAXA 3MCAA 1BMTA 4AQ7A 3AHCA 3NDJA 3TZQA 3QLVA 3WR5A 4MI9A 3ZCTA 1LI4A 4P7KA 3GH3A 5EIWA 5FO0A 1YQUA 4HNUA 1YB4A 1AUVA 5LOVF 4DANA 4WGGA 1ZXXA 2ZIWB 2ZAOA 5BWNA 1EDOA 4TS1A 3N5CA 5HS6A 2IVFA 3CX8A 4C6RA 1T1SA 4FQ7A 4U3JB 3P32A 1XRNA 5TNXA 4UDXX 4H1WA 2ZU6A 3QMWA 3NFRA 4WY8A 2YVAA 1K98A 2OV1A 1OPRA 2JFFA 1WR8A 1E89A 2OECA 2DT5A 4OHPA 4TOIA 1PNOA 1E62A 2QR5A 3GLTA 5EESA 4ECAA 2P2ZA 4BUJA 2AI2A 3NHWA 4UEJA 4K86A 1COZA 3PEYA 3E8XA 4H7KA 4YEDA 2RGUA 5DHSA 4XRGA 4Z4IA 1NQAO 3H04A 2XGSA 1OAKA 1HKUA 1Q2UA 3CRNA 1QK3A 4DPMA 5IC5A 1U1DA 2ZB8A 5EJ5A 1YS7A 5EZ5A 3B1ZA 3H65A 2XPCA 1E9FA 4C4SA 4R8MA 1PAUA 2FX3A 4D41A 5TEVA 1KXJA 2H2AA 2IPMA 5P21A 3U6BA 2WPDD 1RKXA 3U1VA 1HLFA 3GU3A 1A2KC 1MAHA 1AKQA 3EDQA 4MITA 1XZLA 4PHTA 1EFLA 3G2JA 1ESMA 1RI5A 1T2AA 1H6AA 3M5CA 3G85A 3QKRA 3I6BA 1YQEA 2DHCA 4FFLA 4KGZA 2JARA 2XKBA 4LZZA 5JAPA 2BY4A 1TU3A 3MWLA 5LP6F 3PLAE 2UXCB 5EE1A 4PO3X 1DMRA 4JZYA 5I7FA 4IV5A 1PR2A 3VGJA 2FFRA 1X7XB 4EY5A 4FB4A 2HA6A 1HETA 2QTNA 4Q7JB 2QRNA 4Q4CA 5LQCA 2H7CA 4R84A 1N5DA 5E8RA 3D4LA 1AQUA 1X7XA 2XNSA 4LXUA 1YC2A 1ITZA 4D9IA 4LFAB 1G20B 2J9YB 1Y48E 1Z2CA 3IV7A 3R5KA 1ODLA 1V6CA 2JEYA 2JJYA 4PNHA 4WLOA 4XD7A 4PZ9A 3OZIA 1DE4C 1G20A 3B2NA 3W0LB 4C8PA 1KYIA 2C6CA 2XOEA 3A3KA 4JB8A 5JQGF 4LTDA 5LU8A 4F4JA 3GDGA 4ZOAA 4ZAZA 1QCYA 1E2UA 2H1HA 1WS6A 2GLXA 3VR4D 3OF2A 1HDRA 1W75A 4LY9A 1QUEA 1NXWA 4RY8A 5TXGA 5KOYA 2BEVB 4IJMA 1S2IA 4ND4A 4HPWA 4RELA 4P84A 4A10A 4BYGA 1X1TA 2IXAA 3T4UA 3IBCA 2BEVA 1RRGA 4IKOA 4CF4A 1NV9A 1W93A 3H7IA 4OBBA 4W99A 2G7ZA 1XMIA 2A0XA 4O4HF 4O4JF 1KSHA 3VO9A 4G5RA 1J8QA 1MO4A 3JWHA 1HDOA 1LRJA 4MOWA 2RJOA 2Z30A 4RHYA 3SMQA 4ZAYA 4JBYA 1PVOA 3HBFA 5BV0A 2YWDA 3FRJA 4GNRA 4MS4B 2J5XA 3M70A 1KE1A 5FOQA 3R7AA 3ZPXA 4HJXA 4II2A 4GP9A 5B2EA 2FY8A 2V7VA 4JQYA 5DJ5A 1I7SB 4MS4A 4MP8A 3WK9A 2ZSKA 3RBAA 2FSGA 3KQTA 4YRKA 5CD1A 3QX8A 4ZYWA 3TCNA 2IF0A 4MVJM 4IDEA 3JQCA 4IMRA 4ZU3A 4ZT5A 5K3CA 1VRVA 2UYQA 3EGVA 2C9OA 3UT6A 3TAHA 5DGDA 2GNPA 4F72A 1GZUA 2F8TA 5F9FA 4EO9A 1QFJA 4LKRA 3TAUA 3FJOA 4MVYA 5CA1F 3ETHA 2C9CA 4MW9A 4DWWA 5LBUA 3TLZA 2FRXA 4U4AA 3UIEA 2DY1A 2BMEA 5AI5A 1PJ4A 2A1UB 5E9JA 3VKHA 5FWYB 2AHRA 1IEXA 2CHEA 3CCBA 4DWOA 1F2UB 2IU0A 1CB7A 3SS7X 4NYJQ 2JGRA 2A1UA 3NHYA 2C00A 2Q62A 2P41A 4POAA 1VXRA 1QYCA 2ODPA 4QOEA 4YJDA 5FWYA 1F2UA 1IBCA 2W11A 3ZCPA 2HRBA 1DHTA 4YP1A 3IEPA 1NLUA 3GEHA 4D46A 2JAHA 4BZQA 2XE8A 1NONA 5IABA 2ZLBA 1U2GA 1NOKA 1TM1E 2FPXA 2PRIA 3CZQA 4MPDA 3VGPA 1JHDA 1UC9A 2MSNA 3FPGA 5IBCA 4HD8A 3G17A 3PC3A 3CSUA 1GJRA 4UNNA 1XPJA 4YRCA 1QVAA 4FOLA 3OZBA 5ITWA 5KOJB 3ZJVA 4Q4AB 1MX5A 2G0NA 3ZU2A 1F06A 4U5XA 4EA7A 5KOJA 4OLFA 4NL4H 4Q4AA 4W9MC 3PE4A 2YXDA 2O23A 3HYLA 1JXQA 1UBOS 1P2SA 4JEHA 4H77A 3IBTA 5ICSA 5REQB 2B2CA 1H5UA 2AQHA 1ORDA 4Q24A 1H8HA 1TMOA 3ISTA 4V24A 3WDKA 5EIXA 4BRWA 2MT9A 5A4IS 3BD6A 3LX6A 4WNYA 4I14A 2M6RA 4UCWA 1XALA 4ZEWA 1ZSVA 3C5CA 2OFFA 4F5YA 5BT8A 3TX2A 3WWDA 3UXEA 4L9AA 3WYNA 3D6VA 4QQRA 4Z49A 1NBME 4MVJE 2I3DA 1EFPB 2ZITA 2QJTA 4Z9AA 1YV9A 2DBQA 2W58A 4JYBA 4MW4A 3W78A 1EFPA 2FQYA 2QQGA 3X1MA 2VRBA 2FHSA 5CRIA 3F74A 3KOZA 2X1MA 5CT4A 3ZHSA 2JJMA 1SCBA 3K1YA 4HWPA 5KPDA 2CXNA 4M1YA 5IT9A 3QQ5A 5PNTA 4X97A 2GRAA 2J5BA 3OD1A 4EG3A 5KTKA 2HCTA 4G41A 4BQOA 5G02A 4C08A 3T1TA 4H17A 1EWKA 1C8VB 2W5UA 4JVMA 1S0UA 4KKXB 1MB0A 3LF2A 3A4MA 4DQDA 4EJ2A 1E1DA 5JZ9A 1WZEA 2IZ1A 3EOBI 4B2PA 4KXUA 4G25A 1EDDA 5DWVA 4KXMA 4E70A 5BRJA 5C8DA 2WT4A 4CCAA 1I0IA 3W4JA 4CR7A 3MWKA 1PFKA 4D02A 5DNEA 3MS7A 5C4MA 2VK8A 4BKUA 1LS1A 5JS7A 2GHTA 4KK3A 4XUGB 3TVTA 2O2ZA 3UMFA 5JHGB 4CIVA 5JJCA 4NVRA 5BNWA 4FBMA 1JALA 1GADO 1A8QA 3LO8A 4TV9B 5DOVA 4LCEA 2VF7A 4X44A 4KYIB 2O48X 4HZGA 4KQFA 5DSTA 5GV8A 2JKYA 2I67A 4KDRA 4Z1OA 3BIWA 2ZRKA 3E9EA 4QO7A 4TV9A 5F52A 5FOVA 5TV2A 3C8ZA 1P74A 2NVUB 3AL3A 1BS1A 4R3WA 3TRJA 4LXQA 4OK6A 2HI6A 4QHSA 4BFWA 5CPFA 1KBOA 4BVAA 3GOHA 1TT7A 1TX4B 1ZONA 2O6LA 2A8YA 3I73A 3LBNA 1XR3A 4IQFA 3WWOA 1JQLB 1FFXA 3D8HA 3M82A 1VYUA 1E2PA 4G8DA 5DYIA 4D7AA 4LJSA 4LSZA 2ORED 2A57A 2RI6A 5A62A 5JAMA 4HL6A 1ZI6A 2UYYA 4UHEA 4X85A 3T7SA 2F1OA 5HFNA 1GAWA 4HFNA 3KVNA 3AVYA 4FFMA 1GNSA 4QUHA 1XNQB 1OYOA 1T9GS 3RTDA 4UJ5A 3FLEA 4NCAA 1Q83A 2W6ZA 4QYIB 3HJCA 1EEHA 4ETIA 5B6PA 1QQ6A 3ZWYA 5IUNC 1OXKB 3G9UA 2L17A 2OBYA 4QYIA 3OJLA 2JI9A 2YINC 1L5MA 3CU5A 1LVUA 4KIGA 5DYWA 5C31A 1P1KA 1A4UA 1PWYE 3CG4A 1A88A 2ZTVA 1YR8A 3M33A 1BKDR 3SJZA 3GK3A 3MELA 4X54A 3S2FA 4RKRA 5CCBA 3L4KA 3ANNA 4DA4A 4RTSA 3UA3A 3RKUA 3E5HA 3A2LA 1POXA 2R84A 1A9RA 2CBGA 1YZHA 1K06A 2OG2A 5LA6F 3WLEA 3HCFA 4JQOA 5K0NA 3WYBA 1ENZA 3PDIB 4QJ3A 4BWFB 4BQNA 3V1TC 2H51A 4EW2A 1JX6A 5TJ9A 2O5EA 3PDIA 4G4SP 1U90A 5L7TA 1MLDA 2O2EA 2FWPA 2PUBA 3RU3A 3C6ZA 4COOA 3GHHA 5IAKA 3T7IA 4FMDF 4L51A 1OLUA 2DUWA 4AS3A 3EGDB 4C03A 5KOHB 2XZPA 4UBIA 1NMYA 4PSVA 5CBPA 4MR7B 3EGDA 3IV9A 3NVDA 1RM4A 1JR4A 1WKVA 3PLNA 4YRPA 5KOHA 2AF4C 2IUEA 4G8JA 3V5NA 3ECSA 3ZK8A 4MR7A 3W8DA 2LKDA 3B3AA 4JBHA 4X00A 4OLHA 2WF5A 1PD1A 1QGAA 1DADA 3SHOA 3SS8A 3WQSB 4PG8A 2XEIA 2I0FA 4BFXA 5A9SB 4ZAFA 2H2IA 2QA5A 3AZQA 4YALA 2FRDA 5IBQA 1ZD1A 2GHQA 3K1JA 1CBUA 3SBDA 5A9SA 2JKVA 3K9LA 3N28A 4BNWA 2FQ1A 2RSLA 2ZB2A 4JYCA 4P98A 3R9KA 3TNFA 2NTVA 3ND7A 4P4SB 5D86A 1KDZA 2YS7A 1Q0PA 3DL2A 2V0CA 2J85A 2PJZA 4XOIA 2Q3MA 3G0HA 4FJ0A 4P4SA 4YMHA 2B21A 2YZ2A 3EXG2 2A1TS 4LV8B 1GDDA 3HBNA 1VXOA 3FMOB 3R5TA 4NQRA 4OHRA 1FX0B 4O4IB 4RAOA 4AO7A 4BO1A 1ZESA 3K70C 5B4VA 3H4IA 3ZHCA 3TJRA 1R9JA 2ACWA 3O4RA 5IH3A 3VC3A 3ZDEA 1FX0A 2FQXA 3F1LA 3H2ZA 4O4IA 4LE2A 5KBYA 2BGJA 3JYOA 2HSGA 1KPGA 4GEGA 4EPVA 5HOQA 2GZMA 5IDQA 2EL9A 1U7WA 4LSGA 2EFHB 4WE3A 4H6PA 1QDEA 1N1GA 1ZEJA 3EH1A 4I4TB 4OFBA 3QHPA 1IWPB 1CZRA 2HQBA 3B9PA 5FHQA 5BV2P 3NDBB 2C57A 4IIXA 4I4TA 3G0BA 3DP9A 4OF4A 1RR6A 4G5SA 4MUHA 2Q3EA 3BWXA 4MUAA 4RK0A 4W9RA 5FOSA 4EVIA 1V48A 3LP5A 2X0RA 1JDNA 4P0TA 1RXSA 2V97A 1URPA 2I29A 2LRHA 3NBZC 4YRFA 4ZVQA 3TR0A 2QW8A 1XTTA 3ZZ1A 2R6R1 1G42A 3N0XA 4XQCA 1EK2A 2ODQA 3O9VA 3TZCA 4DMHA 2EZBA 4P45A 3RBUA 1JB9A 3TFOA 2ANCA 2B4TO 2ZETA 3AJRA 3WIUA 4HEQA 3A9WA 4JT4A 1MJNA 4RM3A 2IX9A 3QVXA 1UH5A 4Q1AA 3FROA 3PX3A 4MLCA 4YRBA 2PO5A 3INTA 5T4BA 3DFMA 1QXSA 3L0ZA 4ZQIA 3GJYA 3SQMA 4RFVA 2XD4A 4R7GA 1SU6A 3GIDA 4I46A 2VPQA 2X23A 2XEFA 3I42A 4ITVA 4KAXA 1G1MA 4C78A 4LF9B 2WAYA 2NUBA 2DM6A 5DGCA 2PMCA 1RHJA 2IYAA 3C3DA 3SICE 3L7KA 4CHTA 3KSBC 1X92A 4QC2A 3RTGA 3BXEA 1TCAA 4PZEA 4NKRA 4BWYA 2GAFA 2EZ4A 1NZJA 2PK3A 4H9GA 4OMCA 4W9NA 4ZQEA 5DK4A 3F4LA 4GBED 4NH4A 4PZ0A 4QDXA 5EWMB 3DZCA 4D43A 1N32B 2FOXA 1DUVG 2GRUA 2C6GA 1FQJA 2JIQA 2G5GX 1RI4A 3D2LA 5DNDA 5FBRB 2FLKA 1W36C 5EWMA 4AC9A 3E4DA 4G2NA 1VHLA 2PUVA 4AJHA 4IL5A 3SXUB 3H5IA 4GPEA 4AKSA 3CLSD 4D3ZA 1G3MA 2ZIEA 3FCXA 3GB9A 2PL5A 3HFJA 3AV3A 3OE4A 4Y1FA 3C8DA 3SXUA 3DFFA 4CM1A 5TIIA 4G0YA 5DOZA 5JC1A 2X7HA 4DS3A 3TVYA 4PFKA 2NVOA 4KWIA 4N5HX 5IAOA 3OA2A 3U81A 2D2FA 2QF7A 1KF0A 4HGQA 4BBPA 1QIDA 4ZRMA 621PA 4JJ8A 3UJNA 3GROA 4YJHB 2Q1UA 3SZRA 3ZE9A 2H1OA 4EJSC 5BW8A 3R20A 2BW0A 1JA9A 3T34A 4DR3B 4YJHA 4UUBA 2PT9A 1JUDA 2AZXA 1U1IA 3S7TA 3BYZA 4JB3A 1QO0A 5EKXA 3LQFA 4OP2A 4W5HA 3R8XA 3NOJA 1D2MA 3VSBA 4CQMB 4B6FA 2G1AA 1T29A 5CJPA 4RHXA 1I33A 5B1EA 2HYDA 1Z34A 2OBBA 3D3QA 3FPKA 5LDHA 1NULA 3UT5B 3ZVNA 4CQMA 3PFGA 1P77A 2IUTA 5A7GA 1POWA 3UT5A 2P77A 3JASA 4HBZA 4KQGA 3N8KA 3UB3A 5FPPA 1B1AA 4XIFA 5J9FA 5THQA 3DB2A 3AFIA 2ZR0A 1OR8A 5KYGA 3C3AA 3HUEA 3I53A 2PBRA 3DMTA 1XAJA 3E3LA 1QRUA 3LH5A 4KRFA 2AW3A 4RKEA 1RQXA 4RTNA 1MIOB 3PXXA 1J33A 1GVNB 2NU7B 1LWNA 2Z2JA 1IE3A 3PCTA 2BKAA 5DN9A 5IHPA 1P44A 2XEJA 3IAHA 3NDRA 4PU0A 4ETMA 2DTXA 1MIOA 1UKYA 4N6GA 3WMEA 2X15A 5G1NA 2NU7A 2MSCB 3E7XA 1G5PA 2JBHA 3OQMA 4M0MA 1UFKA 4ND5A 2Y77A 1A8UA 4L6CA 1UZLA 3NS7A 4OQEA 2JCXA 4R05A 2WJVA 5FWDA 3U7QB 1MOZA 1G2QA 2FJ0A 3TLGB 2C42A 5HKKA 1BA3A 3U7QA 1YWGO 3PUHA 4Y9TA 3TLGA 3OG9A 2L82A 3PNOA 3F3SA 4IDHA 5EHIA 3KT6A 2J08A 4EF6A 3K9CA 1A04A 5FTWA 1YT5A 1NVVR 5DDIP 1D3AA 1U3CA 3U3XA 1G5TA 1FDOA 3FWYA 1GU7A 3O74A 4RF2A 4FZRA 1O6FA 1G5QA 2VC2B 2ZJ5A 3DF7A 2C7GA 3CHYA 3ILVA 2H2HA 5EINA 5C1PA 4JYWA 2ZJYA 4FS3A 3DOEA 3EPPA 3A3YA 2JH9A 1D9ZA 3FCEA 3NTXA 4E11A 1C0PA 3T5DA 4B6GA 1KNQA 4X62B 5KSZA 1J0XO 3N2EA 4H35A 3QVMA 4YO7A 3ZU3A 2RK3A 1RFLA 1JFVA 3DOOA 4HQOA 4Z3DA 5I01A 3ID6C 1CB0A 1VSTA 1ZNZA 1PLLA 2JPDA 4LGVA 4MW5A 4HYEA 3H8VA 4DJDC 5AW5A 2F8MA 3O94A 2IIQA 2LGJA 2NO6A 5EP2A 1RXWA 1V3UA 4DUYB 1ZH2A 2FF5A 3PC8C 4MRNA 4BO9A 2JLWA 2QLFA 1L6RA 1ACLA 5HHTA 3UJ8A 2A94A 2DMRA 2EGGA 4ZCSA 3WVNA 4CKXA 5C32A 3I8OA 4B4OA 1XV5A 3LBAA 2J6BA 2VPIA 3A0RB 1BRTA 4MO2A 3R9XB 3D5EA 2O2SA 3FFXA 1B41A 2O20A 4N41A 4FC7A 2P6NA 4PQFA 5TGTA 2FAXA 3KCQA 4JKOA 3IPYA 2IPOA 1EGQA 3MRVA 1XHEA 5D6NA 3ZI0A 2ERYA 2XZDA 1UPAA 1T9GR 3P1JA 2QL5A 4ABYA 1O7JA 2GO7A 3ZWVA 1LJ8A 2R66A 5B1DA 1J23A 3PD7A 1L7EA 2QN8A 2B1QA 4R9NA 3ZY4A 4HOYA 1EHIA 1LC3A 3BFJA 3U13A 3GMIA 1TRKA 3Q40A 4EBBA 5ELMA 5SY6A 3LUKA 3JV7A 3INNA 2ZUTA 1Q44A 5JALA 1KDTA 4HDRB 2ZG6A 1ABBA 2GKSA 5KNCD 2F3PA 1X7GA 3X2EA 1ORWA 2PJUA 2FSSA 2H8KA 2YHSA 3HU1A 2JKZA 4HDRA 2HWGA 1L7BA 2H7YA 1L7NA 1R2QA 1EXVA 3GJRA 4RXTA 4BNDB 2NN3C 2EZ8A 1E3QA 2BC9A 5HRUA 1OT3A 1DQPA 1O96B 1RCTE 1U8YA 1EXMA 3NHKA 4BNDA 1H2BA 4F5ZA 1OW3B 3AIIA 1OKKD 3RQIA 1DELA 1CUAA 3SZUA 1LPNA 1Z2EA 1AN0A 1O96A 2GKOA 3QJGA 1FW8A 3ETLA 1KIAA 1IIBA 1QBGA 2WD9A 4Z0TA 3RSZA 4DDHA 1KQGA 3AUTA 1GU1A 3N7AA 3O1IC 1Z5GA 3HYNA 5AW7A 1UPTA 1SULA 3U37A 3H5OA 5DBFA 3V3KA 1CRZA 1R0XA 4RK6A 5AIBA 4QXMA 1JTEA 1NN5A 3RSSA 5I7OA 4TUYB 3KT3A 4EITA 3B9QA 2Z2ZA 4PX5A 1VHWA 2DBVO 3S68A 5JCZA 4DV3B 4OIMA 2JD1A 1GQSA 1U3FA 4NULA 1UEJA 4OQYA 4TUYA 1QZXA 1JRLA 1WXHA 4J1TA 3T5BA 4AZTA 4F9EA 1C8LA 3GJ3A 4MTLA 3GLQA 3H4MA 2J1LA 3AL0C 5CHYA 5I48A 1KHHA 3M9WA 3B1FA 2FMXA 1T8UA 3LC7O 2FMFA 3D1VA 1E3WB 2NX2A 5HTKA 2C8KA 2HQRA 3ZVKA 3I32A 1RC1A 4OHXA 1WKBA 3QG1A 4RLFA 5FWAA 1BNCA 1E3WA 3EQ2A 5EMLA 3CB4A 2QYOA 4JUDX 4DDMA 3LYUA 4TVSA 1R50A 1A7JA 4AS1A 2WT9A 4CT0A 2SHKA 4BN0A 4GPD1 4MRVA 1N2IA 1TZCA 1XRMA 1GIAA 1ZIPA 1ZBQA 4J7CA 3B6KA 3LQQA 4OAPA 5G1OA 4CFSA 3JYQA 1ONOA 2C88A 2VJPA 1O57A 1JHAA 2WSMA 3BMNB 4J4TA 4R69A 5CEJA 4KAAA 1B76A 1SVOA 3SP1A 2D62A 1WKCA 2HBZA 2V0NA 1A1SA 3BMNA 3UK2A 5IDWA 1GPLA 4TYPA 4R3UC 1J1UA 1M1YB 4C0WA 1DEOA 5IRCD 4R0NA 3MCTA 3E53A 1UFRA 4R8VA 3MGBA 3RW9A 3GRAA 2A88A 1M1YA 4RTQA 2PFGA 4B84A 2XUFA 4MJXA 2XTMA 4K87A 1L4BA 2Y1GA 1EFDN 3F6RA 2IHVA 2AG8A 3AI2A 4DIUA 1GAQA 3QI2A 3K9QO 5CHEA 3ZDZB 4TTPA 1F3OA 5BN3B 2GYYA 2O3UA 1XTPA 5AW0A 5T67A 2EBWA 3CUWA 3LFUA 1E4OA 5BN3A 1ECPA 1U65A 1XN1A 2B37A 3L93A 2V4MA 2R47A 4BGDA 3O5AA 3QBDA 3C3KA 1VIMA 5AI9A 5ICCA 5JC8A 3D2CA 3L49A 1YQTA 3I3SR 2MR5A 1KZ7B 2JL1A 1PT8A 1G19A 5A4FS 3RRYA 4YP6A 2GEBA 4OH7A 1QC5B 1I9CA 2NYUA 4CG2A 4Q6WA 1ZRHA 2O4CA 4IW3B 4KLNA 1XJ0A 4OGLA 5JXHA 5LD2B 3UG6A 3L0SA 2W6PA 1QC5A 1C2TA 2FQQA 3O21A 3OPXA 2BH9A 4ESEA 1R6UA 4C1NA 1TGYA 4QYWA 2OFXA 2GZ2A 4MW6A 3DXFA 5LYJB 4BYMA 3DC7A 5TPZA 3RVBA 4X84A 2JFQA 3O8BA 4ND2A 2UVDA 4ZCTA 5B57C 2RHOA 3FPLA 1IHYA 1ULSA 4HX5A 3SQOA 3BSFA 2A9PA 2G9NA 2A5DA 3NAQA 4EGSA 1SUSA 3HCDA 4ZHQB 1P2GA 4WL0A 1QF9A 2XNJA 4NHEA 1II0A 3F73A 1NVXQ 2Q5QA 2HT6A 4ZHQA 1LI7A 2XECA 1FJ2A 3GUZA 5ITSA 3UMMA 3VJRA 1U0TA 5IT5A 1Y7PA 4MUFA 1E6MA 2PA3A 3THYB 1GLGA 1P2BA 2DTEA 2V74B 4IXTA 4K6GA 5HQJA 3V7YA 4C07A 1SVSA 1A27A 1MNQA 4O0LA 3O31A 4IEFB 3I1FA 3AKCA 2OCXA 2QMHA 1GN9A 3VTKA 4S2EA 4TL6A 4D5GA 4GR4A 1H0RA 2VDWA 4L6IA 1WOMA 2XE4A 3TJZA 1YS9A 3HL4A 4F8EA 2AVNA 4S1TA 5E4YA 3OBIA 1U99A 3PC4A 2ODWA 1JSLA 1DC8A 4KUHA 3U4GA 5JAIA 3AEYA 2MMGA 1BXGB 3INYA 3RO7A 1FYEA 1T2DA 5E4TA 1PGQA 3REOA 3UKOA 1VFPA 3CRQA 5JS8A 1BXGA 2VYVA 3G68A 1GPMA 4W6ZA 3WA6A 5A0TA 5JXIA 2J3MA 2NV0A 4TV9F 3G5MA 3E23A 5MGBA 2DPLA 3B53X 3PJEA 1Y8CA 2QROA 2FOLA 4A8JC 5IEJA 3VYVA 4B75A 3M49A 1Y9EA 1M6HA 3OLWA 3TZHA 3BBPA 3N58A 5DHQA 1N7JA 3WL4A 3E8MA 1WQ1R 2YWGA 3O91A 4MVJI 5C1IA 1ZAYA 1MF7A 3UCFA 2ZEJA 1DI0A 5GTDA 3OT4A 1D4ZA 4PLFA 4UNIA 3MMNA 5EJ2A 4EFKA 5K01A 1CIJA 3B51X 4WJLA 4WBNA 1KI1A 2D13A 2FPGB 2WUEA 4L9RA 5FOWA 1CUUA 1V3QE 4LXHA 3AB7A 3I0ZA 5JCJD 3WMWA 5MFPA 1N4AA 2DT8A 4HDAA 2FPGA 3IIEA 3KAPA 3OHMA 3BS4A 2AFIE 4C88A 5DULA 4Q05A 2DHDA 1ZJJA 2HQOA 3OLXA 2OILA 2EATA 2UYCA 3W90A 3L04A 3R3UA 2BDUA 3OE1A 2OQIA 4Q16A 3MT9A 2BFBB 2BF7A 5D3QA 4ARSA 1L5ZA 1L7VC 4M2LA 2DFNA 2BFBA 3EZNA 2Z3VA 5G4LA 3GLFB 1C2YA 3S2UA 1B0ZA 2D59A 3H1GA 3QSGA 4I0WB 4M46A 4YX9A 3GNQA 4A36A 4JI0B 4ARCA 1ST2A 3DB1A 2QE7A 3PUKA 3GLFA 1G18A 1TB4A 5J4LA 2NOAA 3ICUA 3FEDA 1Y6QA 1ZRMA 2YC4C 4P53A 3UC5A 1D2HA 2FRVA 1BHQ1 1AX9A 3I58A 3MTAA 4FUQA 2CLIB 4LV6A 3W2HA 1JEYB 2RIRA 3EIOA 1DIHA 3EWNA 1IFXA 4KLRA 4Y0AA 4UBKA 4NBWA 1D04A 4R8RA 1JEYA 3QQPA 1SO8A 1J09A 4HXFB 4XM2A 2XMRA 4J07A 1QRAA 5BOSA 1HNXB 2AS0A 4N3GA 4S24A 2VRCA 2CLFB 1YQQA 2B7LA 2MJLA 2RFLA 1ISMA 2TMDA 1WB4A 2Q9BA 6NULA 4DM4A 3BSSA 1II9A 4ND1A 4XQGA 3A1TA 2OBNA 1OH7A 2B83A 3KB2A 4Y98A 1B6RA 2K2QB 4AJ9A 4AN4A 3LUBA 1AGRA 2AG0A 3PQ2A 1AUXA 2CB0A 3AK4A 1O6GA 4N3AA 4QFDA 1CZKA 1D03A 1AKMA 2Z4RA 4BO8A 5K1ZA 5TF4A 1PSZA 2HTEA 3C3YA 3C5WP 5ARBA 4I6EA 2CV2A 4FNGA 3DLCA 4M8DA 2ZSHA 3DT6A 2FQWA 2W6MA 3I2FA 4EB3A 3GBVA 4DMCA 1IHDA 4MB0A 721PA 2HZBA 3AHDA 1B15A 4LXXA 2YFKA 3A14A 4B3XA 3ULKA 3VKFA 4O4IF 3HXOA 3D3WB 1S02A 2YW2A 2Z4SA 4MDHA 2F1HA 2FZGA 2O8VA 2GT1A 4LDAA 4TMTA 1P91A 4ZAVA 3D3WA 1J56A 1QK4A 2OZKA 1TD9A 4UEKA 4LPKA 4WJZA 2BD0A 2YRXA 2BCGY 4NEHB 4NRDA 3EZ2A 3N05A 3OMXA 4CMEC 1AMNA 2KQUA 3L7NA 4PCAA 2PUFA 3ZWMA 3ZWBA 1R5JA 3VNVA 2B4KA 1SVKA 1KBZA 4I4TF 3DEJA 4GLFA 3OJXA 5AJHA 1EDZA 1JBEA 2PX6A 2WYWA 1LB1B 3E61A 4CF3A 4I4CA 4JHLA 3MGGA 5FLKA 2AOUB 1D4OA 1ZD2P 4ZYTA 3MSXA 4QICA 4S1VA 2AOUA 1KWGA 1EP3B 2C5FA 4AKGA 1DJQA 5IAJA 1PK7A 2JFPA 3GCXA 4H7PA 2OM6A 5AK4A 1U04A 4KO8A 5JZVA 1SRQA 1H22A 4ZKEA 3LW7A 3KLBA 2XGJA 4D4JA 3IQHX 2V59A 3LSTA 4Q00A 3EHEA 3DQPA 5AVTA 4U2KA 1AQIA 1WD7A 3JAKB 1ZPDA 5AOAA 3L6BA 4PGAA 2OHFA 4X3OA 5IKOA 2IT1A 3SJAA 4B79A 4DB2A 4P4GA 4EHDA 2IHBA 2IYFA 3JAKA 2HWXA 2RKOA 3VKWA 3WO0A 3TLBA 3TPCA 4RY0A 3QTTA 2DR3A 4KWCA 1ZIDA 2VH5R 1V1RB 2JLQA 3EIUA 3OLZA 5AI4A 3ZJYA 4D4IA 3T94A 4B9AA 1TXGA 1ZK4A 4OJNA 3TINA 3FMVA 1V1RA 4COKA 4HYYA 1E9VA 2PZJA 2EGHA 3EYWA 4RX1A 4QGSA 1LFAA 2XUKA 3A9CA 4N3NA 4HY3A 1KSFX 4PIPA 5K0ZA 5DBGA 1L5YA 4C85A 2C54A 2WIAA 4YLGA 4IS3A 3O2QB 1HSZA 2NO7A 2PLRA 4RF3A 2Q3FA 4ZI3A 5BWMA 5AVVA 1O4WA 2ZRJA 3T0FA 2JLCA 2RH4A 4XVCA 5LNK6 3ENZA 3DZFA 3N9IA 7AT1A 1KO4A 5E9AA 1C3LA 3NDIA 3H13A 1S9DA 3OQVA 4FT4A 1MJFA 1VPWA 3P9CA 2WC1A 3VVLA 4QJ4A 3AVXA 2DWUA 3CZ4A 4DG5A 1RJEA 1US8B 2QUJA 4UVGA 2RJNA 2R6HA 4LOLA 4B6QA 2XGMA 1CY8A 2FM4A 4G97A 1US8A 1UAAA 1AMOA 1CPYA 1OWOA 1K0FA 1OYYA 2H1WA 3H6GA 4QDZA 3U9TA 1UDCA 4BVBA 4GP6A 1GRCA 4ID9A 1Q7RA 4HNTA 2YASA 3LHIA 3R74A 3G3EA 4A0GA 1XDWA 4RJKA 3DR3A 3T9EA 4ISCA 4MAAA 5DLEA 4MHSA 3RS5A 2YY6A 3JQAB 5KTOA 4C89A 1N5RA 2C3UA 3B52X 2MCFA 3U44A 4LDQA 4BFTA 3HV0A 1EIZA 2A30A 2QD1A 1Y89A 3JQAA 1B0UA 5T7BA 2ACKA 1Y6JA 2BFAA 4ILKA 4PG7A 4RZQA 3U4DA 4NARA 4GDFA 2CXRA 5EFZA 5LPNA 4R2JA 2P9FA 3AR6A 3IV6A 4E4RA 2R65A 4GH5A 4IWYA 4P3KA 3TTTA 4Z7JA 1IUNA 3BXFA 2EKLA 3S70A 4LRXA 4AZVA 3NYWA 2I2FA 1SZCA 3W6UA 4KVFA 4LUCA 2HLNA 4NBSA 2LDBA 4JJZA 5GJVC 2HK9A 5HA5A 2AWNA 1JDZA 5C53B 3Q3JB 4H59A 4FYVA 4B4VA 4H08A 5IBPA 4ZYZA 1CRQA 4C3OB 4HSGA 1NZFA 1JG7A 3FMFA 5KTYA 1K5DA 2C7VA 2X40A 3P9QA 5DTIA 5EMHA 2CUTA 1E2HA 4NE7A 3CV3A 3EBLA 4A8PA 3MN1A 3A32A 4D97A 3GGCA 1OD6A 3G2HA 4DAEA 1WXQA 5BSEA 2BOVA 3ESYA 1SHJA 2DHQA 1GQ2A 3OC6A 3QWAA 2RI1A 1VL5A 2EVWX 3SR0A 1UBGA 1FP1D 1I6MA 5GIPE 1P7YA 3CKYA 1W0KA 1JT9A 1MNAA 4GL4A 3AR5A 4Y2PA 2G72A 1CEYA 1P3Y1 2O0KA 4I3FA 5DWDA 1J00A 3OY7A 2XMSA 1V8PA 3B5JA 1DIBA 3FKSA 4JDUA 4TXLA 5G2OA 2RHLA 4NAHA 2G28A 3D3NA 4KW7A 1D0SA 1YRWA 4LOIA 2BBWA 4OXIA 1BGVA 4X65B 1RS0A 1OY1A 3I6SA 5CGZA 2QDKA 3ZH9B 2OK8A 4NCIA 1M0TA 2QY9A 2W2XA 3ZE8A 4UZSA 2ZYRA 1P6UA 2ZFUA 2QLLA 2WSYB 3IHLA 2PVPA 1QR2A 4PPQA 4ALJA 1ONSA 1CJKC 4OHOA 3R7NA 1VMIA 2DPXA 4LXYA 5ALTA 2C04A 2ZCUA 3ZR4B 5IKEA 1G63A 1E79A 2YUTA 3FUWA 4FKBA 4RJIA 2QUIA 1NF8A 4NGPA 2C07A 1EUQA 3QKSB 2YRWA 2C84A 1TYDE 5J1SB 1ESEA 1HQYE 2QRKA 3RADC 3GUUA 4O33A 4JP8A 3VDQA 1A8IA 1V2GA 3MAAC 3QKSA 4ENVA 3CTPA 1MHTA 2DKNA 2ZCVA 2L69A 3BGWA 3L7MA 2DPHA 1ICIA 4EA9A 5AJVB 3ROEA 1Z9BA 1AUOA 1UBRS 1P6QA 2BTQB 1H9BA 2Q5OA 3OZRA 1RM0A 1H2HA 2OMKA 2XNDD 5FAXA 3OKAA 1V5GA 2BTQA 5DNVA 2VXBA 1KJIA 1RFGE 3IT3A 3QEMB 3EODA 3I2IA 4RULA 1BGWA 2GX6A 1YB2A 4BRSA 1XNRB 1HH4A 5ES3A 4P4FA 4C8FA 3LOPA 5HF6A 1MAAA 2KSQA 2RGCA 3D6JA 3QEMA 3IQXA 3ZWQA 1FTYA 2IYVA 3U17A 3E1SA 1ODTC 2VH2A 5T4HA 3LPNA 4WCFB 1KGDA 2ZIFA 4GXQA 1ST3A 3CRVA 4R9SA 4E5MA 2WD8A 1LXCA 4UASA 2BUCA 5C8ZA 5F9MA 4WCFA 2XR1A 1H0SA 3I9OA 3L3BA 5JD3A 5KSOA 4LMRA 1PRYA 4M9CA 3K70B 1SQ6A 4HCJA 4ASUD 3FHJA 3BHXA 3PF8A 3WV5A 4L4UA 1XNJA 4HRXA 5AWFC 2OCAA 4JUAA 3UM9A 5IYZB 4GMFA 4XPZA 5JNUA 1D1PA 2VBCA 3OOHA 4QBHA 2IU4A 5IYZA 1XLWA 3KU1A 1V8ZA 2FMTA 2QD3A 5EIHA 5I47A 1OXUA 2YVUA 5AM5A 1AGPA 1XIVA 2X0DA 5EYPB 3PQDA 4Z1MA 3IBSA 2B5OA 2B8NA 1ZNQO 1K8YB 2I1VB 5EYPA 1Y7HA 2HDWA 3VC1A 1X9HA 4L5YA 3VR5A 5NLLA 4AUKA 1I1NA 1R4MB 4K2HA 1VKZA 2EDAA 4BLPA 4P33A 4KN8A 1DLJA 2XEDA 3REQB 1ZLYA 3DBOB 2R8YA 4TX1A 1NI4B 3VZPA 1R4MA 1B3BA 3FGOA 3G7UA 3M1YA 3REQA 3UY4A 4ACAA 4CUKA 1JDEA 1NI4A 2LPMA 4C20A 4C8CA 3QX3A 3JSXA 4IOJA 2Y9PB 3FN4A 2FZ4A 4WOCA 3QM1A 1ZW1A 2VZ8A 4WXYB 3UJ3X 2FH5B 3HVIA 1E7QA 3HPQA 1P4JA 5EXDA 5FYQA 3H19A 2I4RA 2VNIA 1D4AA 3AWDA 2QRPA 4DC9A 1FJGB 3CNEA 3ZHVA 1YZTA 3HH8A 1V96A 3HMKA 3ZVMA 1YJ8A 3MUOA 2P9JA 4AMVA 3T3IA 4UD2A 1H2FA 1PFQA 2GXUA 3K5WA 3OEEA 3TIVA 4R68A 3WNDA 2EX0A 3H9UA 3UMRA 3ZCRA 2QD5A 1CS0B 5ALQA 3OU2A 4Z3KA 5EKSA 3N0WA 1P7PA 4DRXB 4C3ZA 5K0FA 1CS0A 2OZEA 4XH9B 5L3QB 1RAIA 1W36B 2ETVA 3FRHA 4C43A 2GXQA 1BWRA 4YP7A 2F48A 2GOYA 3EA4A 3QXHA 2BI7A 2X9GA 4PYIA 2YJVA 4DUPA 5L3QA 4HZIA 1RVDA 2P3OA 3NT2A 3OTQA 4LQDA 4WUVA 2X77A 1E3IA 1IN6A 2X8WA 3KJXA 3X2FA 3UKDA 3M5WA 1SK8A 4GYKA 4N1AA 5E7JA 3T41A 4DL9A 5LQNA 4RIHA 1KDVA 1JHQA 1PSWA 1I5RA 5B6IA 1WBBA 1YMUA 2SCUB 3IDOA 1NQUA 3LT0A 4J4HA 3FCUB 3DXXA 4UATA 4CKEB 5L4SA 2ORVA 3LQ2A 4S0XA 1T5IA 2SCUA 1RHKA 3OECA 4ZMRA 1E6EA 4EJSB 2AE2A 4CKEA 3B3JA 1LDEA 4ZT7A 1I2AA 5I7SA 5A3VA 4DA8A 3OPYA 3TBKA 4C4OA 1Y3FE 4MVJH 2XYHA 2Q6LA 4YP9A 4EJSA 1XAIA 1F4PA 1JAIA 3WL7A 1WSDA 2FN9A 1N1MA 2OD9A 4HAYA 5ILGA 5IG2A 5IKPA 1JFSA 3T5GA 3M8KA 3AF2A 3ETJA 4L78A 1W1IA 1GA6A 3F1KA 2C99A 3IJRA 3NBYC 1CYEA 5HRCA 3ZV6A 3Q8LA 4Z8YA 2GJ4A 1CJCA 3DJYA 4FZ3A 4AJIA 4MI3A 2F3UA 1IK4A 1QG0A 1XQ9A 9MHTA 1G8KA 4MYTA 5JCXA 2WT8A 5LYJF 3RVMA 4R2WA 1OA0A 2ROQA 5DWQA 4EY4A 3CXUA 4P4BA 3I5AA 4B6RA 2J9RA 1VIYA 2N3ZA 4O2BB 5DT2A 4LJRA 2CVPA 1N6NA 4BDTA 4IDNA 1MB4A 5A6VA 4Y30A 4GOOD 4JL6A 4PGGA 4NX2A 2WJWA 3SKXA 2CLKB 4O2BA 3SZMA 3TZBA 4ZHQF 1AH2A 1XTRA 2MINB 1FFEA 3PJGA 2QPOA 2HDOA 2R9VA 4J7AA 3SQLA 3CVUA 3LUFA 5F7ZA 4F38A 1YJAA 2MINA 4CFZA 1U1FA 3VDXA 2QTTA 3ZHTA 2WFAA 4KOAA 5EQDA 4LGYA 1PT5A 5CFLA 4HVLA 5D5QA 1DIOB 2WHYA 1FUEA 1GPBA 2A0WA 3NP9A 4C4PA 1DAMA 1I5OA 2I55A 5A0VA 3E7DA 5F7JA 5DISB 2MSLA 5K3FB 1IDOA 3D59A 3ZY5A 1N92A 1HM5A 4N12A 5HG0A 5SY9A 1FK8A 3BGSA 5K3FA 1EI9A 2FETA 1XP8A 4IRXA 3EQ8A 4NESA 3MK31 1Z12A 4OXQA 1YR1A 4X7MA 4C21A 4KACA 4LYYA 5H68A 3HDJA 3AR4A 3PQ8A 5K0LA 4D2IA 2C1EA 2YQ5A 3QLUC 3CVYA 3G02A 3VO2A 5EPOA 4H3SA 4OK5A 4ZEXA 4P86A 2P4SA 4AAYA 2CKMA 1ZA1A 3GF4A 1Z28A 3S2GA 3UAVA 4Y6OA 1R4NB 2C92A 1PWXA 5JHHB 3KDPA 1R16A 4JA2A 4XWAA 2ZIAA 2XB2A 1R4NA 1XCGB 1GR1A 2O5VA 2ZSFA 2BMJA 1GLNA 3BDVA 3CLKA 3TGLA 2HCBA 3QKUA 2DPGA 3QK7A 1C50A 3ORYA 5IW8A 3PC8A 1Z4KA 1HF3A 3PNYA 1CF2O 3BDAA 5LZ8A 3IMEA 2QENA 4P4NA 4PSCA 3NB0A 4PGHA 3LCJA 4Q34A 5AVOA 4ZCQA 2CXQA 4QOFA 4RJTA 2GPNA 3BG5A 3LOQA 2D0OB 3K2QA 4EARA 3C3WA 1E9SA 3KKOA 3Q2KA 4ZO7A 4GYWA 3P2JA 1NOIA 1M83A 1OZFA 4Q3DA 2IWHA 5ICEA 4NK5A 2IEZA 4KIWA 3PEWA 5T3YA 3QVLA 2ZT8A 5T64A 2CE2X 3IHTA 2OB1A 2JFBA 3DVAB 3PQ6A 1WRBA 1GP2A 4P1ZA 5I7VA 5HTOA 3ZCQA 1QPZA 3D6TB 3LK6A 1UKVY 3W3AH 4AJNA 2OAP1 4OY3A 3DVAA 3ND8A 3F8TA 1JBKA 2ENWA 5M29A 1IUOA 2W2PA 1T34A 3GRPA 4P58A 4E5SA 1UOQA 3A4VA 2IYZA 2OCIA 4YAIA 4RDXA 1N2XA 4DVJA 2PGOA 3H4VA 1OV4A 1C7QA 1OLOA 4QPPA 5BSFA 2WU3A 1FBNA 1ZGGA 3L46A 2XDQB 5TR9A 2QUHA 1VYVA 1CHNA 2XDQA 1NVMB 4I9HA 3A2NA 3I9V6 4Z86A 3FMPB 3OZSA 4I1SA 1E58A 2FPLA 3ED5A 4MUXA 2YIJA 3C85A 4CLDA 1UAYA 2NQTA 2OCLA 4DADA 3EUWA 3G1UA 4M3NA 2Q3CA 2V5VA 3ONDA 3DCYA 4L0CA 5KIAA 5LKAA 5AJXA 2OB2A 3F2IA 1SBNE 2PD6A 3HKEB 1DZIA 2Y1EA 4HNHA 2G76A 4LPSA 5CXXA 1UINA 1J39A 2OXTA 2XUPA 3FGPA 5G1PA 5BQ5A 1GCOA 4L6AA 2ZRFA 3HKEA 1E2IA 4B3CA 1SIUA 1ZGCA 1ZVQA 4Y3UA 3WV4A 3YASA 1E1KA 3O8OB 2JVJA 4PRYA 2I6GA 1C30B 2VHQA 2X6TA 1MO5A 4RVDA 1XTBA 4RHFA 4OIFA 4Q9HA 3U1TA 3UMCA 5C81A 4ZARA 1HEYA 2I4IA 2QGNA 2VEOA 4TMFA 2J3IA 1C30A 1NDUA 4KQMA 2SNIE 3MLEA 3OE7D 2QKYA 5IDVA 3UMGA 3UWKA 4BQRA 1WBDA 2B4YA 3LL7A 3GGOA 5EG5A 1GFIA 4CG0A 3IGFA 4IV8A 1PE0A 1T13A 2VXOA 2P2DA 1WUYA 1DKRA 4J6EA 4Q4DA 3RJ9A 1FF9A 1H9AA 5JYEA 4LQLA 4HRVA 2BI4A 2JH3A 2YJGA 3IUNA 3RVRA 3VOTA 2IYUA 4TLCA 2WUVA 2ZE8A 4P3NA 1DEKA 4FYKA 3KQLA 3HHPA 3IO3A 4O1HA 1MJGM 2P9YA 2WWXA 3HCCA 5D29A 4NZZA 1U0HC 5CUQA 5AHRA 4A8HA 5IM4A 4MV8A 5D8DA 4W5OA 2BKUA 1Y3IA 1A5BB 3RQSA 5FPHA 5G41A 1XJ5A 4E33A 4UM9B 3AUYA 1HTBA 1SHKA 2A9OA 2DF8A 5JH7F 3SKVA 4L95C 2Y68A 4NATA 1RMQA 3MGKA 4GUAA 1P8JA 2CNWD 4QU9A 2R25B 5THXA 4OC3A 2XEGA 2Q9UA 1A50B 1VCMA 2BGKA 5I9BA 1DRVA 2D74A 5ERYA 1JKJB 1NAHA 5IJ9B 2VSQA 1XCOA 2YJ4A 1U11A 3H1BA 4FCVA 4P93A 5EKUA 4G1FA 5I3ZA 4XWWA 4TTSA 1JKJA 2Q2VA 1HFEL 3LYHA 3DLIA 2JLAA 1ISHA 2GCNA 4FKMA 5DX8A 2QM7A 2NAPA 3O4GA 4CV2A 4EVSA 1EP1B 1C3XA 4FK8A 2NSJA 4N18A 2DUMA 1H8EA 4J2TA 4EPXA 4DNOA 2C4MA 3HP1A 3RLFA 5CDUA 2E5LB 2F1IA 3RAGA 4KXXA 4B0OA 1M6WA 4ZIRB 1PZEA 4HKTA 1QFYA 4IJ5A 1FDSA 5EZQA 4E2FA 4MDEA 3SEFA 1TZBA 2PVSA 3I2HA 4JJFA 2AOWA 3BJZA 2WUWE 3M9LA 3LIPA 4RWEA 4ZIRA 5LWQA 3W04A 2D5BA 3WLRA 4CF6A 4AJ2A 2QXYA 2H9IA 2N1BA 4FXPA 4IEEA 4CT5A 3VR3D 3QGMA 4XB1A 4FOSA 4P6VF 2ZTMA 1DAHA 3H11B 3T3MB 4C76A 3P5SA 1ULUA 3OM8A 1ZI8A 4YJGB 4GX2A 3H11A 4Q9LA 1S6YA 2GPAA 3BRQA 2ZZMA 3C5EA 3QOFA 3BWBA 5AJUA 1S2GA 1I2MA 4YJGA 4V2UA 4CM9A 1UXJA 1E0KA 2R5FA 3AP3A 3RASA 4JLNA 4DHEA 5CW2A 1VKNA 1ZD4A 5EUBA 1UC8A 4UUAA 1ZM4A 4C6TB 1YL7A 4JVLA 3S6JA 1F0PA 1PEYA 4PSAA 5TY0A 2NSLA 4XB6B 1YZGA 2IY8A 3FYSA 4OM8A 3NHLA 3PGJA 4C6TA 1KJQA 2WKPA 1CUDA 1TE2A 2ZTLA 3ILYA 4RVCA 5H4HA 2IYEA 3F6EX 3ZQ6A 4DDWA 3GLKA 4Q1FA 3TIXB 2Y0DA 4E5VA 4Y0VA 3Q6MA 1MO3A 4IOMA 4MHTA 3DPIA 4V0MA 2BWJA 4GPIB 1P1RA 2XKAA 3KQWA 1QZZA 4FMCB 2ONZA 3DV0B 1QJCA 3IKLA 1KO1A 1R1DA 2YXLA 4K0RA 3A6EA 3AI1A 4TRNA 3BQ9A 2XCRB 4KEAA 4KQEA 2RD2A 1S3FA 5LMUB 1O5IA 3DV0A 4TQ9A 2H3EA 3S2SA 3T9BA 5IHXA 1I0LA 3KKKA 4DEYA 1RHMA 4QWWA 3FTDA 1WBJB 2C98A 1JECA 2ZJ8A 4Y2HA 5HF5A 1NC1A 1NSFA 5E8JA 4PN7A 2OCBA 1QCDA 3ZK7A 1KARA 1I4DD 2FZ5A 4NCNA 4A8JB 2QRMA 2PE5A 3IJ5A 4I1PA 1KMQA 1Z6XA 4NJOA 1KQOA 4IDPA 1O97C 3I5UA 4BZXA 3U3KA 4Z0PA 4A8JA 2Z98A 2ZPAA 3E22B 1UOEA 3S1AB 1QQBA 1PR1A 1QX4A 2FOIA 3V8NA 1GGKA 3FUCA 3SQDA 5I7UA 1MAVA 3LDFA 3E22A 4DV4B 4TTVA 4GDMA 4JR2A 1B6GA 1VRWA 1CNMA 4ZO8A 3S1AA 2ZWPA 4DLLA 5K7SA 1WMSA 2W98A 3Q3VA 3I2JA 4RENA 5L3SB 4HEJA 1COWA 2XNHA 2C3PA 1GL9B 4MLZA 4BX3A 2JZOA 3RU9A 5JS2A 4NK4A 3LFTA 2Q6KA 4ZJYA 5L3SA 2HU2A 3LW8A 2HSDA 4WDQA 3SEZA 1DB3A 1ZMXA 3EY4A 4RQBA 1EINA 2FW9A 2EJCA 2DTDA 1KOLA 1DQZA 4DNQA 2Y9MB 2X5XA 1UJ6A 2Z1NA 3LLCA 2NO4A 5AESA 2JATA 1Z17A 2F1RA 2FWAA 3ED1A 4AY3A 1EQ2A 1L8XA 4X61A 1OAOC 4CL2A 2ODEA 1QHEA 2NM0A 5ANRB 4BKPA 3SYNA 3L0PA 3WRVA 3L6EA 5CLIA 4LG1A 5JXWA 5J4YA 4Q9JA 1PKEA 1UMCB 2WTMA 4IIHA 3LK7A 4B3FX 1JAHA 1XVAA 2AJCA 1KMHB 5IASA 5AVKA 3TLKA 2I76A 1JSRA 3JQBC 1UMCA 4L74A 5A5FA 2OXCA 3K9GA 3NKFA 4R31A 5HMLA 1Q21A 4JWKA 4OYHA 3T3PB 3S9MA 1FTSA 1KMHA 1ID8A 2WY2D 5IUJC 1V71A 1PJLA 3AYZB 3TQQA 5MN4A 1FU8A 2Z3ZA 1D5CA 3PGLA 5IS2A 1R9MA 3HNOA 3R44A 2B4RO 4B31A 1V16A 1F1BA 1JH8A 1H65A 1Q1QA 4QDOA 3PICA 5CG1A 1G6OA 3DDSA 4WLFA 4D9KA 3GFSA 3QJYA 1R8YA 3DDUA 3K9BA 5DBIA 3TOCA 3WK6A 1MENA 1YAJA 2GUWA 4CMBA 1Y5LA 1T1IA 3PTAA 4G1MB 1KXZA 1UAGA 2GERA 5F78A 4ZC8A 4KLAA 4MWDA 1PQPA 2EKPA 3OCJA 3WP1B 1C7ZA 2E2WA 4HPJB 4NPCA 3GVCA 4DLUA 4QUIA <