3TLWA

The glic pentameric ligand-gated ion channel loop2-21' oxidized mutant in a locally-closed conformation (lc2 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlwA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlwA01
5HEHA 1UW6A 4PIRA 2QC1B 3JAEA 3JAFA 3U8JA 4ALXA 2BR7A 5BP0A 4LMLA 2X00D 1UX2A 2Y58A 4COFA 3SIOA 2Y56A 5CFBA 4TNWA 5KE4A 4ILCA 5SYOA 3UU8A 3TLVA 5L4EA 3RQUA 2WNCA 2PGZA 3UU3A 5TVCA 2M6BA 4QH4A 2VL0A 3RIFA 5AFNA 5AFHA 5HCJA 2WNJA 2WZYA 2XQ5A 3WTMA 4ZK1A 3SH1A 4TNVA 2XQ3A 3UQ4A 4A97A 4XHEA 4ZRUA 2XQ6A 2LM2A 4NPPA 2BYNA 5L4HA 2Y57A 4HFEA 4ZZBA 4XK9A 2XQ9A 5J5IA 2BG9C 4UM1A 2YMDA 4HFBA 2ZJUA 3RI5A 3WTKA 4UM3S 2YN6A 5CO5A 3SQ6A 1OEDA 3RQWA 4IL9A 2BYSA 4UXUA 4EZ1A 4QH5A 4UM3A 4UM3P 2BYRA 2BG9A 3JADA 2XNUA 3LSVA 3ZDGA 2X00A 5J5HA 4HFHA 3WTNA 4ZR6A 5KZUA 2W8FA 2BJ0A 3TLSA 5LG3A 2MAWA 3TLWA 3T4MA 3WTHA 2XQ7A 4LMJA 3UUBA 4Z91A 3EI0A 4F8HA 4QABA 2WNLA 3P4WA 2M6IA 4B5DA 3ZKRA 3U8MA 4ILAA 3GUAA 2XZ5A 5AFKA 5BRXA 5J0ZA 2XNTA 1OEDC 5J5GA 3UU6A 3EAMA 5HEGA 4BQTA 2BYPA 4ZJSA 2LKGA 4IL4A 4DBMA 4AFGA 3U8LA 2LLYA 4UY2A 1OEDB 4QAAA 5HEUA 2W8GA 2KSRA 2XQ8A 5AFMA 5HEJA 3C79A 3SQ9A 2BG9B 2XYSA 2Y7YA 4Z90A 3WTOA 2BR8A 4ILBA 5HEOA 2XQ4A 3UU4A 3WTJA 4TWDA 4BFQA 5JMEA 4FRRA 4HQPA 5LXBA 5AFJA 4A98A 2YOEA 5FJVA 3C84A 2YMEA 4NZBA 4QH1A 3U8KA 3RIAA 4ZZCA 3TLUA 4AFHA 4ZJTA 2UZ6A 3P50A 4TWHA 3UQ7A 2XYTA 5IUXA 4ZK4A 3WIPA 3WTLA 4TWFA 2ZJVA 3IGQA 2XQAA 1UV6A 4HFCA 2PH9A 4IREA 4D01A 2C9TA 2WN9A 2BYQA 3RHWA 3UU5A 2Y54A 3WTIA 5BW2A 4QACA 5J5FA 4HFDA 1OEDE 2XNVA 3PMZA 1I9BA 3U8NA 5AFMB 5HCMA 3PEOA 2BG9E 2LKHA 5AINA 3EHZA 4HFIA 5AFLA 5L47A 2XZ6A 4WV9A 4X5TA 4LMKA 4AFTA 2YKSA 3TLTA 3ZDHA
chains in the Genus database with same CATH superfamily
3P4QA 2E5VA 4C90A 2UXCT 5CJ5A 1JNZA 4LF7T 3UFGA 2V7JA 2BS3A 1KF6A 2LSJA 1UX5A 5JREA 3KINB 4ZI2D 4YHHT 2I59A 4EAHA 3CK6A 3NRYA 1KEYA 5TVCA 2WZYA 5AQSB 2HHHT 4K0UA 4YY3T 5LGNB 2D0TA 3E08A 2XQ6A 3MXZA 4EV6A 2XAJB 3CX8B 4H9NC 4U31A 4AI6A 4V1Av 5AQQB 3EABA 5FYMA 4CXXA 1FMWA 4UV8B 3SQ6A 2LRLA 2Q9QA 1FIOA 1MIWA 4DUZT 2ES0A 4OYJA 2W8FA 3L09A 3WTHA 2P9BA 4JI3T 4DUYT 2WBLA 3ZKRA 2CWOA 1N36T 5BRXA 5J0ZA 2WP9A 2A72A 3AAIA 2K5BB 1UK5A 5FKYA 3LK2B 5F8PA 1HG2A 4XBFB 4I55E 3ABVA 2CMRA 3FHNA 3C79A 1QLBA 4U2ZA 2HPJA 5M4YA 2XQ4A 2WB5A 2BBJA 4WBOA 3KV9A 2IC6A 2C5KT 3LJCA 3ZJ1A 1E2AA 5C8YE 2DLRA 3HKBE 5FY7A 3PUSA 4X64T 4ISTA 3B13A 2XM2A 3NWIA 3ETVA 3PMZA 2W0GA 3QOFA 1D1BA 5LG4A 1Z0PA 2X9XA 1UX2A 2XM1A 1W0BA 3HKDE 1US7B 4WZXA 2WNCA 1YQ4A 2A9UA 2QA7A 2E5LT 1D0XA 2L8KA 3AE7A 2XY8B 4X1IE 2KINB 5IYZE 2K48A 4CN1A 2PTFA 2WQYA 5LXTE 1XNRT 2W61A 3H3MA 4HN9A 2IC9A 3TKLB 3L8RA 4JI1T 3TLSA 4DV3T 3PUVF 4ILAA 4YTMA 2X51A 4UEMA 3ZMSB 3OYZA 2Y6XA 4UF0B 4ADZA 2VURA 4QAAA 4MLKA 2XYSA 3WTOA 1UCUA 4ILBA 5HEOA 3ZEFB 2YK0A 3CIRA 4FRRA 5AFJA 3WAKA 3FZKB 4GIWA 5JTGA 5ABGA 1UX4A 4WW0A 3IGQA 3EUHA 4IREA 2WN9A 2Y54A 3UU5A 2W63A 5EK2A 2UXDT 2JQHA 5JDMA 4CI2B 3BQKA 3BQIA 3RIUC 4DO0A 2DNXA 2V7LA 3PV0F 4DNDA 5GONE 4TUYE 4ALXA 2ZM2A 5ABFB 4U3CA 5EZYE 2XUEA 2YU2A 4UELA 4UVAB 4NXNT 3T8OA 3IA3A 4YJ3E 3LDQB 4AKRB 2JQQA 3RLFF 5AQVB 1S35A 2KT9A 5AQKB 2X0LB 1VOMA 3QC9A 4AKIA 4JLEA 2LSGA 1J1JA 5F3JA 5KXJA 2VVNA 3FZLB 4BA9A 2X00A 3WTNA 4CQIA 2DL1A 4LFCT 2LSIA 3NBXX 5DQWA 2CWYA 5KDMC 3EDVA 5TAOA 2XTLA 2D9DA 5HEGA 3F57A 5JDQA 1WCRA 2X9WA 3L3PA 3BQLA 5JDHA 2IIUA 3AXJB 4MFRA 3P4RA 3CMLA 5J1GA 1U4QA 2W67A 2UUBT 2D5UA 4AISA 4P1NA 5FJVA 2NP9A 3AE1A 4CI3B 2V5DA 3M3ZB 3WTLA 1WLXA 4X66T 2CXDA 3F2EA 4JI5T 3PTRB 3FZFB 2BG9E 4HEAA 5AINA 3AE6A 2OA5A 2H3RA 1W9RA 4O4IE 3LG7A 4XZCA 2W4XA 5AQLB 3PU8A 3M65A 2EHOC 3RX6A 3S4UA 2VB6A 4QH4A 3QB5K 4UF0A 3RKOA 1W0AA 1UGOA 3LBXA 1MNDA 4EGWA 4IDZA 5LBQB 4G2AA 4JEUB 4HFEA 2EHOA 2JIWA 3A5XA 2LM9A 3SFDA 4HGAA 4ZI3C 2KLQA 2KNDA 4H9SE 4OK0A 4UXUA 4EZ1A 3ZC0A 2MBGA 4QX7B 4XAXB 3I9WA 1HX1B 3AA1B 2OV9A 4B6XA 1MMGA 5LJNA 2VKHA 4DV7T 1I94T 3U8MA 2XZ5A 3MZKB 3P4SA 5EK3A 3ZYKA 4LF8T 4LF6T 2XAFB 4OHFA 4LFBT 2LKGA 3OVUA 2LLYA 2WU2A 2WS3A 3PU3A 3UUNA 3SQ9A 2C0SA 4O4LE 4PFPA 5C3JA 1NENA 4DV4T 4WYVA 5HAXA 3CQCB 2C5IT 1MMDA 2CHNA 3HKEE 2CBIA 5KMGP 2LSKA 4D01A 4PAGA 3G06A 4L9IA 1T98A 2QYWA 4IE5A 3ONLC 3I0OA 3PDYA 5FMNA 4CXYA 3P7IA 4ZS3A 2WMNA 1UW6A 1Z8UA 3KBTA 5IHYA 2HN2A 2L9QA 2BR7A 2WY2A 1KNRA 5SYOA 2X0YA 2IDOB 2M6BA 2XAQB 2PJQA 2D2SA 2V1DB 5FVLA 3CVRA 3GMIA 4NPPA 3Q9DA 2FJBA 4QXBB 4UM1A 2YMDA 3P8CD 4TN7B 4HWHA 3CQXC 4AKHA 2MTQA 2BG9A 2M67A 1G73A 3AB3B 4PK5A 3GN5A 3O1HA 5JVDE 4ZOLE 1OEDC 4BQTA 1N34T 2X68A 4A56A 4JBWF 1G8XA 3DJBA 2W8GA 2KSRA 4JV5T 3NKZA 5LXBA 1N33T 3C84A 4WBNE 3AE5A 4NUUA 5EK4A 4ZJTA 3ZJ2A 4ILUA 5FXVA 2BVLA 3ZN1B 2PH9A 3NVOA 4IDOA 5L2LA 5BW2A 2WZIA 1NAFA 3PURA 4EOZB 5L47A 2H7VC 2YINA 4GYSA 3HL6A 5HXHA 4LF5T 2LOPA 3N5LA 3K3QC 2ZM6T 2LE8A 2X9YA 5KE4A 5C2TA 2PBIA 3AE2A 3AXJA 5H6QB 1VCSA 2PGZA 4EYUA 2CBJA 2XQ5A 2PG8A 4DR5T 2UXBT 5LHGB 2YDSA 1M7KA 3NZQA 5L4HA 2CHOA 3ESLA 1I6ZA 3V5SA 3RI5A 2YN6A 1MNEA 5LGUB 2BYSA 3PJAJ 4IDQA 1Y01A 3N2OA 5J5HA 3X1DA 3TLWA 2LHNA 4LFAT 4HKAA 2M6IA 3FZHB 4O8SA 5CGMA 4I0UA 2IMLA 4JI7T 2K3WA 3O4XE 5FXXA 1XZYA 3Q5EA 2CPTA 2BKOA 3K8PC 3AA6B 3RC3A 5AFMA 3UULA 2BG9B 3JC6D 3F31A 3KVAA 2R6GF 1KNZA 4NZBA 4ZZCA 4EYYR 3MA9A 4DBRA 3OPCA 4DV6T 3I9YA 2ZJVA 3OBVE 1UV6A 1DU2A 3OTOT 3N9LA 3CWZB 3AECA 2VQET 3ZT6A 4PJNA 3U8NA 3AE3A 2DWKA 4ASKA 1ZV4X 4UIGA 4JI6T 2CM0A 3VU7H 2CCQA 4GK5E 4PJJA 3U3IA 1MMNA 4IT4A 3C4XA 5AQMB 5HWXA 3RF1A 4IGUA 5AFUL 1NEKA 4U2YA 2WCAA 2XZEA 2N1GA 1HNWT 2XQ9A 1WR6A 2XSBA 3UTKA 2CEAA 4KI0F 2ZJUA 3WTKA 4AQFA 5L3GB 1BR4A 2FJAA 2L3LA 4U7YA 1SE7A 3ZMTB 3JADA 1YKHB 2X0HA 4G63A 4IIJE 3BK9A 1OWAA 5JRCA 2XPKA 5JR9A 3C50A 2W66A 2BS2A 4QXCB 2E2AA 4MBQA 3N9OA 2PFVA 4N78D 3UU4A 3WTJA 3IHRA 4ERRA 3U8KA 3NRXA 2WMOA 4PJLA 3KDSE 3UQ7A 3VKGA 3WIPA 1Y64B 5AQRB 4H63H 3FBLA 3PEOA 1IBMT 4KMCA 4DV1T 2Y48B 3AE4A 3I0QA 2QC1B 3JAEA 2EHOB 3AVRA 1WYBA 3RQUA 2JPFA 3AAAB 5AFNA 4ZXLA 4OFZA 5HYAA 5LB7B 1XDPA 4ZI2C 5LOVE 1NWMX 4UVCB 3SS1A 4EZHA 2JMHA 3EVYA 4UM3S 5FVKA 1BR0A 3RYCE 2K24A 4ISSA 5JR9B 2XQ7A 4LMJA 4F8HA 4CI1B 1HS7A 4O4JE 4U7IA 3HA4A 2NTYA 2XNTA 1KFYA 3ZPOA 4ZJSA 2CE7A 3PUAA 3T1HT 4X62T 2XAHB 4AQYT 2CXFA 1YKEB 5HEUA 2AXDS 4GOUA 1WFDA 3AEDA 4Q25A 2WSSV 4YFSA 3W15B 4BFQA 2BDEA 2CLYB 3L39A 1XWMA 2YMEA 3DP7A 3GWHA 4U33A 4DV0T 5AQJB 4AIUA 3FXDB 1D0ZA 2C9TA 3MACA 4QACA 5J5FA 2XSAA 4JI4T 2B76A 3EHZA 2V6YB 4WV9A 4AFTA 3VRAA 3ONXA 2J62A 4X1KE 5HXRA 3UUXB 2WWVA 3P4PA 3U8JA 5JDNA 1GQEA 2Y58A 3RH3A 1FEWA 1U5PA 5L4EA 4HWIB 3KVBA 2VL0A 5CB4E 3AAEB 4YSYA 4B3MT 3UQ4A 4JUYA 2XAGB 1HX8A 2I6HA 2BG9C 3I1AA 2QGSA 2LJLA 2V8SV 3KV4A 4JI2T 5JR9C 4PJMA 2VK9A 4DBQA 3AE8A 3ZDGA 5AQIB 2V7KA 2MAWA 4YHJA 2CA5A 2KMFA 3AA7B 4PW8A 3AE9A 2IW5B 4AQFC 3PUXF 2BYPA 3FBZA 4DBMA 2WDVA 1HNXT 5JH7E 1MIVA 3ETUA 2Y7YA 3R84B 1HFAA 2YU1A 5A1LA 5JDFA 1V9DA 4YXDA 4AFHA 4TWHA 3H3AA 5IUXA 2VKOA 4ZI7E 2X66A 1D1CA 4IE6A 3PE0A 4HFDA 2XNVA 3HI2A 5HCMA 3E22E 4ZI3D 3Q5WA 5JRCB 2NTXA 1M62A 4UVBB 3SFEA 3ZDHA 4O4HE 4YJ2E 2UU9T 4HWDA 3JAFA 3ZLIA 4QXHB 3AEBA 2WU5A 3KFWX 4COFA 1CHUA 3RGLA 2RA1A 4X1YE 4FI5A 3AEFA 2E9XC 2FJEA 4KBMB 4K0KT 3N9PA 3AEGA 2WAUA 2RP4A 3SWHA 4WNKA 5ETWA 3N9MA 5L3BB 3UUMA 2IHR1 4YTPA 4P0AA 2Z6EA 4NUVA 4UM3P 1LVFA 3MK7C 2LSYA 5CA0E 3ZC1A 2FBWA 3PUQA 5L3CB 3UUBA 3EI0A 3ZT7A 4YSZA 4B5DA 2KWIB 3C4WA 3LK42 1S94A 4C91A 5LMUT 3U8LA 5LNKA 4UY2A 4DR4T 3ONJA 4O2BE 2BR8A 3R6NA 3ZMUB 3EDUA 5AQHB 3RYFE 2W2UA 5J2TE 1H7CA 2G0UA 4PK6A 4LF9T 4HFCA 4ANJA 2BVMA 2JMKA 2BYQA 5H6RB 3RC8A 1OEDE 3ZMVB 2XHEB 3C4ZA 4JI8T 5FL1A 1D0YA 3IF8B 4HFIA 5DABA 1ZKEA 3RRCA 2V7IA 4PIRA 1HG5A 4IE7A 2MYSA 1VCTA 2BZBA 4EEBA 3ZCJA 3U78A 4KHPT 2H89A 3MJXA 5HCJA 2NR4A 4H9PC 1N32T 4A97A 3ZYMA 4JYAT 1T7SA 1IJ5A 3WAJA 2YEVC 4HFBA 3RQWA 4IE0A 1KK7A 3LSVA 5L3FB 4Z8XA 1FMVA 3RYIE 2J4GA 1SHZC 2HN1A 3AEAA 2W00A 4YTNA 4I50E 5AQPB 2V26A 4YSXA 3OKQA 4DVDA 2J1DG 2YDQA 5J5GA 4KX6A 4UV9B 2XQYA 2OLTA 5FP3A 1T8BA 3HKCE 5HEJA 1O3XA 4DR2T 4GKKT 1AJ3A 3VHLA 4HQPA 2C5JA 4QH1A 2Q9QC 4IDPA 5LMNT 1XMOT 2EHOD 1YW0A 3SOLA 3O9XA 4CN4A 3LK3B 1KNPA 2UUAT 2XZ6A 3KV6A 2YKSA 2LT3A 1HR0T 1D1AA 5LJMA 2Q9QD 2CXLA 3KV5A 3ZMZB 4UXNB 5LA6E 5CFBA 4TNWA 3TLVA 2LRKA 2CLYC 5FXWA 2WM9A 1HNZT 4AQGA 3C98B 2Q9QB 3OJAA 3SH1A 5L3DB 2WWUA 2LM2A 3K3NA 4X20E 2BBHA 2WDRA 2Y57A 5LP6E 4P09A 4IL9A 2ODVA 3K3OA 4BJNA 4CN6A 1HF8A 5HXEA 4AXPA 1MMAA 5LG3A 4PNIA 1XMQT 4QABA 2V5CA 3AVSA 5FXZA 5AFKA 1E7PA 2E9XB 2HPLA 3UU6A 3N9NA 5L3EB 2H88A 4KP3C 2IUBA 3SRZA 4QKNA 5KX5E 5AQTB 4GK0E 5AQUB 2YDRA 5JMEA 3C51A 5F5WA 2E9XD 3B5MA 1WR0A 4EZ4A 3TLUA 4CZZB 4TWFA 3LBXB 4TZ4C 3UT5E 3WTIA 2ZLYA 3ZCIA 2WDQA 2MPKA 4DV5T 4NIQA 5ABHA 5JQGE 4F6RC 2UZ6A 2VKDA 1L0VA 4LMLA 2JRKA 4MALA 5JDLA 4ILCA 1IBLT 4LF4T 3RRWA 2JQKA 3CKDA 2WNJA 2VVSA 3ZSSA 4OX9T 4EIWA 2E9XA 4H9OC 3JC6C 2BYNA 4TX5A 5ABEA 3JCFA 1EZ3A 3CX6B 3N2GE 5J5IA 4KUMB 2GK9A 3E0ZA 5CO5A 4QH5A 2ACXA 5FY1A 4A5XA 3Q5XA 4H9QC 4Z91A 3HR0A 5BR8T 3P4WA 4IDNA 3GUAA 4H63V 2H7OA 2D0UA 3Q5DA 5LHIB 2Y8DA 2DHRA 1MIYA 4AFGA 2V6YA 4U72A 2XQ8A 5DQVA 5BMVE 3ANWB 1HTJF 2BKNA 1IBKT 2XJ7A 2X9HA 3P50A 3QB5A 3IEEA 3Q2MA 2HH7A 1BR2A 2ZM8A 3CX7B 4PFOA 3QNUA 2DCFA 4DR6T 4EXTA 5ADXL 2F4VT 5FL0A 5FNVE 3PJAA 2LKHA 1ZP0A 4HWFA 4AKGA 2UUCT 3RIUA 2IAKA 4BJMA 3TLTA 1X79A 1B7TA 1LKXA 5HEHA 1FJGT 2BKPA 1J5WA 4YT0A 5BP0A 2X00D 2NWBA 3SIOA 3C64A 4L0RA 3K1SA 1BR1A 5AQOB 3RIFA 3WI3A 1W09A 3WTMA 4ZK1A 3VKHA 4YLHA 4L5GA 1ZOYA 4XHEA 5DJQC 3CPZA 1XDOA 2NOXA 2NW8A 4IHJE 1SUMB 2JJ9A 2LHRA 4HFVA 4O2AE 2I0MA 4XK9A 4EB6E 3RYHE 4H9RC 2VASA 3D0TA 2FUPA 2CRBA 3CQGB 3ZN0B 1LRZA 2BYRA 2XNUA 2A3DA 2A2FX 3PUGA 3O1JA 2E8IA 5FY0A 1JNRA 3FXEB 3RPUA 2LOSA 3NZPA 2N9DA 5AQNB 1R8IA 4Z90A 1OXZA 3OYXA 4JEHB 4A98A 1CUNA 1QSDA 3GN5B 3RIAA 2XASB 3J9X1 3V5UA 2V6XA 1HCIA 4TV8E 2KZ7B 4PK4A 3N2KE 4X5TA 4UM3A 4JI0T 4DV2T 3A7MA 2MOZA 3PUYF 2Y56A 5HWYA 3PUZF 1ZHCA 2SPCA 3MKDA 3UU8A 4GKJT 3J7Yq 4TV9E 5AFHA 4DR3T 5E0OA 1XNQT 2ZMAA 2XQ3A 3FB2A 5LYJE 1WYCA 1QUUA 3UFEA 2VL8A 3QK6A 5LGTB 3RKGA 4J2CA 2QVAA 4I43B 1OEDA 4MHCA 2FJDA 4GYRA 2DI4A 3H37A 2ZM0A 1VRBA 3VR8A 3QUJA 4ZEYA 1UUSA 3ZT5A 4QWNB 4ZR6A 2NW9A 2BJ0A 3IBPA 4U74A 4HE8A 2WNLA 4FJOA 4DMVA 5IWAT 1E1HB 3GA8A 1LVKA 1T72A 1IJ6A 1J5ET 3EAMA 2WZHA 4IL4A 4CXWA 4ZS2A 2ODUA 5LCYA 2RPAA 5J2UE 4E7SA 3ZSTA 5ABFA 4NXMT 2DWGA 3KBUA 2X67A 4ZK4A 5HXCA 1X9BA 2XQAA 4AKLA 3VR9A 1SA0E 4HTEA 3RHWA 3ANWA 5AFMB 2J47A 5AFLA 2VWAA 4E7ZA 3DTOA 4OYKA 1YD8G 3UU3A 4UR9A 5HXSA 4B3RT 4TNVA 4ZRUA 2UXNB 1ZEEA 4X65T 3B57A 3LFMA 3AEEA 2LEHA 4ZZBA 5LHHB 2VQFT 2JQ9A 1YXRA 2N2NA 3PUWF 4EEDA 4DIDB 3N9QA 5LBMA 2QRXA 3ZYLA 3FZMB 4HFHA 5KZUA 3AA0B 3T4MA 1IAPA 2VKJA 1IZNB 4M1PA 5AQGB 4QX8B 2ACZA 2BS4A 2KXPB 4B3TT 4QHOA 2B1EA 4ZHQE 4BAYB 2K9AA 3T1YT 1OEDB 3VRBA 2AE9A 4DMWA 4DR7T 2UXXB 4DR1T 4IE4A 3O1IA 1WRDA 4TWDA 5AQFB 2YOEA 5CA1E 2KWHA 2XYTA 1YQ3A 2NW7A 4HWCA 2W62A 4KHZF 4I4TE 4B3ST 4P0BA 1I9BA 5JDGA 1UURA 3A8YC 4LMKA 2V7MA
chains in the Genus database with same CATH topology
5HEHA 1UW6A 4PIRA 2QC1B 3JAEA 3JAFA 3U8JA 4ALXA 2BR7A 5BP0A 4LMLA 2X00D 1UX2A 2Y58A 4COFA 3SIOA 2Y56A 5CFBA 4TNWA 5KE4A 4ILCA 5SYOA 3UU8A 3TLVA 5L4EA 3RQUA 2WNCA 2PGZA 3UU3A 5TVCA 2M6BA 4QH4A 2VL0A 3RIFA 5AFNA 5AFHA 5HCJA 2WNJA 2WZYA 2XQ5A 3WTMA 4ZK1A 3SH1A 4TNVA 2XQ3A 3UQ4A 4A97A 4XHEA 4ZRUA 2XQ6A 2LM2A 4NPPA 2BYNA 5L4HA 2Y57A 4HFEA 4ZZBA 4XK9A 2XQ9A 5J5IA 2BG9C 4UM1A 2YMDA 4HFBA 2ZJUA 3RI5A 3WTKA 4UM3S 2YN6A 5CO5A 3SQ6A 1OEDA 3RQWA 4IL9A 2BYSA 4UXUA 4EZ1A 4QH5A 4UM3A 4UM3P 2BYRA 2BG9A 3JADA 2XNUA 3LSVA 3ZDGA 2X00A 5J5HA 4HFHA 3WTNA 4ZR6A 5KZUA 2W8FA 2BJ0A 3TLSA 5LG3A 2MAWA 3TLWA 3T4MA 3WTHA 2XQ7A 4LMJA 3UUBA 4Z91A 3EI0A 4F8HA 4QABA 2WNLA 3P4WA 2M6IA 4B5DA 3ZKRA 3U8MA 4ILAA 3GUAA 2XZ5A 5AFKA 5BRXA 5J0ZA 2XNTA 1OEDC 5J5GA 3UU6A 3EAMA 5HEGA 4BQTA 2BYPA 4ZJSA 2LKGA 4IL4A 4DBMA 4AFGA 3U8LA 2LLYA 4UY2A 1OEDB 4QAAA 5HEUA 2W8GA 2KSRA 2XQ8A 5AFMA 5HEJA 3C79A 3SQ9A 2BG9B 2XYSA 2Y7YA 4Z90A 3WTOA 2BR8A 4ILBA 5HEOA 2XQ4A 3UU4A 3WTJA 4TWDA 4BFQA 5JMEA 4FRRA 4HQPA 5LXBA 5AFJA 4A98A 2YOEA 5FJVA 3C84A 2YMEA 4NZBA 4QH1A 3U8KA 3RIAA 4ZZCA 3TLUA 4AFHA 4ZJTA 2UZ6A 3P50A 4TWHA 3UQ7A 2XYTA 5IUXA 4ZK4A 3WIPA 3WTLA 4TWFA 2ZJVA 3IGQA 2XQAA 1UV6A 4HFCA 2PH9A 4IREA 4D01A 2C9TA 2WN9A 2BYQA 3RHWA 3UU5A 2Y54A 3WTIA 5BW2A 4QACA 5J5FA 4HFDA 1OEDE 2XNVA 3PMZA 1I9BA 3U8NA 5AFMB 5HCMA 3PEOA 2BG9E 2LKHA 5AINA 3EHZA 4HFIA 5AFLA 5L47A 2XZ6A 4WV9A 4X5TA 4LMKA 4AFTA 2YKSA 3TLTA 3ZDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HEH A;  1UW6 A;  4PIR A;  2QC1 B;  3JAE A;  3JAF A;  3U8J A;  4ALX A;  2BR7 A;  5BP0 A;  4LML A;  2X00 D;  1UX2 A;  2Y58 A;  4COF A;  3SIO A;  2Y56 A;  5CFB A;  4TNW A;  5KE4 A;  4ILC A;  5SYO A;  3UU8 A;  3TLV A;  5L4E A;  3RQU A;  2WNC A;  2PGZ A;  3UU3 A;  5TVC A;  2M6B A;  4QH4 A;  2VL0 A;  3RIF A;  5AFN A;  5AFH A;  5HCJ A;  2WNJ A;  2WZY A;  2XQ5 A;  3WTM A;  4ZK1 A;  3SH1 A;  4TNV A;  2XQ3 A;  3UQ4 A;  4A97 A;  4XHE A;  4ZRU A;  2XQ6 A;  2LM2 A;  4NPP A;  2BYN A;  5L4H A;  2Y57 A;  4HFE A;  4ZZB A;  4XK9 A;  2XQ9 A;  5J5I A;  2BG9 C;  4UM1 A;  2YMD A;  4HFB A;  2ZJU A;  3RI5 A;  3WTK A;  4UM3 S;  2YN6 A;  5CO5 A;  3SQ6 A;  1OED A;  3RQW A;  4IL9 A;  2BYS A;  4UXU A;  4EZ1 A;  4QH5 A;  4UM3 A;  4UM3 P;  2BYR A;  2BG9 A;  3JAD A;  2XNU A;  3LSV A;  3ZDG A;  2X00 A;  5J5H A;  4HFH A;  3WTN A;  4ZR6 A;  5KZU A;  2W8F A;  2BJ0 A;  3TLS A;  5LG3 A;  2MAW A;  3TLW A;  3T4M A;  3WTH A;  2XQ7 A;  4LMJ A;  3UUB A;  4Z91 A;  3EI0 A;  4F8H A;  4QAB A;  2WNL A;  3P4W A;  2M6I A;  4B5D A;  3ZKR A;  3U8M A;  4ILA A;  3GUA A;  2XZ5 A;  5AFK A;  5BRX A;  5J0Z A;  2XNT A;  1OED C;  5J5G A;  3UU6 A;  3EAM A;  5HEG A;  4BQT A;  2BYP A;  4ZJS A;  2LKG A;  4IL4 A;  4DBM A;  4AFG A;  3U8L A;  2LLY A;  4UY2 A;  1OED B;  4QAA A;  5HEU A;  2W8G A;  2KSR A;  2XQ8 A;  5AFM A;  5HEJ A;  3C79 A;  3SQ9 A;  2BG9 B;  2XYS A;  2Y7Y A;  4Z90 A;  3WTO A;  2BR8 A;  4ILB A;  5HEO A;  2XQ4 A;  3UU4 A;  3WTJ A;  4TWD A;  4BFQ A;  5JME A;  4FRR A;  4HQP A;  5LXB A;  5AFJ A;  4A98 A;  2YOE A;  5FJV A;  3C84 A;  2YME A;  4NZB A;  4QH1 A;  3U8K A;  3RIA A;  4ZZC A;  3TLU A;  4AFH A;  4ZJT A;  2UZ6 A;  3P50 A;  4TWH A;  3UQ7 A;  2XYT A;  5IUX A;  4ZK4 A;  3WIP A;  3WTL A;  4TWF A;  2ZJV A;  3IGQ A;  2XQA A;  1UV6 A;  4HFC A;  2PH9 A;  4IRE A;  4D01 A;  2C9T A;  2WN9 A;  2BYQ A;  3RHW A;  3UU5 A;  2Y54 A;  3WTI A;  5BW2 A;  4QAC A;  5J5F A;  4HFD A;  1OED E;  2XNV A;  3PMZ A;  1I9B A;  3U8N A;  5AFM B;  5HCM A;  3PEO A;  2BG9 E;  2LKH A;  5AIN A;  3EHZ A;  4HFI A;  5AFL A;  5L47 A;  2XZ6 A;  4WV9 A;  4X5T A;  4LMK A;  4AFT A;  2YKS A;  3TLT A;  3ZDH A; 
#chains in the Genus database with same CATH topology
 3P4Q A;  2E5V A;  4C90 A;  2UXC T;  5CJ5 A;  1JNZ A;  4LF7 T;  3UFG A;  2V7J A;  2BS3 A;  1KF6 A;  2LSJ A;  1UX5 A;  5JRE A;  3KIN B;  4ZI2 D;  4YHH T;  2I59 A;  4EAH A;  3CK6 A;  3NRY A;  1KEY A;  5TVC A;  2WZY A;  5AQS B;  2HHH T;  4K0U A;  4YY3 T;  5LGN B;  2D0T A;  3E08 A;  2XQ6 A;  3MXZ A;  4EV6 A;  2XAJ B;  3CX8 B;  4H9N C;  4U31 A;  4AI6 A;  4V1A v;  5AQQ B;  3EAB A;  5FYM A;  4CXX A;  1FMW A;  4UV8 B;  3SQ6 A;  2LRL A;  2Q9Q A;  1FIO A;  1MIW A;  4DUZ T;  2ES0 A;  4OYJ A;  2W8F A;  3L09 A;  3WTH A;  2P9B A;  4JI3 T;  4DUY T;  2WBL A;  3ZKR A;  2CWO A;  1N36 T;  5BRX A;  5J0Z A;  2WP9 A;  2A72 A;  3AAI A;  2K5B B;  1UK5 A;  5FKY A;  3LK2 B;  5F8P A;  1HG2 A;  4XBF B;  4I55 E;  3ABV A;  2CMR A;  3FHN A;  3C79 A;  1QLB A;  4U2Z A;  2HPJ A;  5M4Y A;  2XQ4 A;  2WB5 A;  2BBJ A;  4WBO A;  3KV9 A;  2IC6 A;  2C5K T;  3LJC A;  3ZJ1 A;  1E2A A;  5C8Y E;  2DLR A;  3HKB E;  5FY7 A;  3PUS A;  4X64 T;  4IST A;  3B13 A;  2XM2 A;  3NWI A;  3ETV A;  3PMZ A;  2W0G A;  3QOF A;  1D1B A;  5LG4 A;  1Z0P A;  2X9X A;  1UX2 A;  2XM1 A;  1W0B A;  3HKD E;  1US7 B;  4WZX A;  2WNC A;  1YQ4 A;  2A9U A;  2QA7 A;  2E5L T;  1D0X A;  2L8K A;  3AE7 A;  2XY8 B;  4X1I E;  2KIN B;  5IYZ E;  2K48 A;  4CN1 A;  2PTF A;  2WQY A;  5LXT E;  1XNR T;  2W61 A;  3H3M A;  4HN9 A;  2IC9 A;  3TKL B;  3L8R A;  4JI1 T;  3TLS A;  4DV3 T;  3PUV F;  4ILA A;  4YTM A;  2X51 A;  4UEM A;  3ZMS B;  3OYZ A;  2Y6X A;  4UF0 B;  4ADZ A;  2VUR A;  4QAA A;  4MLK A;  2XYS A;  3WTO A;  1UCU A;  4ILB A;  5HEO A;  3ZEF B;  2YK0 A;  3CIR A;  4FRR A;  5AFJ A;  3WAK A;  3FZK B;  4GIW A;  5JTG A;  5ABG A;  1UX4 A;  4WW0 A;  3IGQ A;  3EUH A;  4IRE A;  2WN9 A;  2Y54 A;  3UU5 A;  2W63 A;  5EK2 A;  2UXD T;  2JQH A;  5JDM A;  4CI2 B;  3BQK A;  3BQI A;  3RIU C;  4DO0 A;  2DNX A;  2V7L A;  3PV0 F;  4DND A;  5GON E;  4TUY E;  4ALX A;  2ZM2 A;  5ABF B;  4U3C A;  5EZY E;  2XUE A;  2YU2 A;  4UEL A;  4UVA B;  4NXN T;  3T8O A;  3IA3 A;  4YJ3 E;  3LDQ B;  4AKR B;  2JQQ A;  3RLF F;  5AQV B;  1S35 A;  2KT9 A;  5AQK B;  2X0L B;  1VOM A;  3QC9 A;  4AKI A;  4JLE A;  2LSG A;  1J1J A;  5F3J A;  5KXJ A;  2VVN A;  3FZL B;  4BA9 A;  2X00 A;  3WTN A;  4CQI A;  2DL1 A;  4LFC T;  2LSI A;  3NBX X;  5DQW A;  2CWY A;  5KDM C;  3EDV A;  5TAO A;  2XTL A;  2D9D A;  5HEG A;  3F57 A;  5JDQ A;  1WCR A;  2X9W A;  3L3P A;  3BQL A;  5JDH A;  2IIU A;  3AXJ B;  4MFR A;  3P4R A;  3CML A;  5J1G A;  1U4Q A;  2W67 A;  2UUB T;  2D5U A;  4AIS A;  4P1N A;  5FJV A;  2NP9 A;  3AE1 A;  4CI3 B;  2V5D A;  3M3Z B;  3WTL A;  1WLX A;  4X66 T;  2CXD A;  3F2E A;  4JI5 T;  3PTR B;  3FZF B;  2BG9 E;  4HEA A;  5AIN A;  3AE6 A;  2OA5 A;  2H3R A;  1W9R A;  4O4I E;  3LG7 A;  4XZC A;  2W4X A;  5AQL B;  3PU8 A;  3M65 A;  2EHO C;  3RX6 A;  3S4U A;  2VB6 A;  4QH4 A;  3QB5 K;  4UF0 A;  3RKO A;  1W0A A;  1UGO A;  3LBX A;  1MND A;  4EGW A;  4IDZ A;  5LBQ B;  4G2A A;  4JEU B;  4HFE A;  2EHO A;  2JIW A;  3A5X A;  2LM9 A;  3SFD A;  4HGA A;  4ZI3 C;  2KLQ A;  2KND A;  4H9S E;  4OK0 A;  4UXU A;  4EZ1 A;  3ZC0 A;  2MBG A;  4QX7 B;  4XAX B;  3I9W A;  1HX1 B;  3AA1 B;  2OV9 A;  4B6X A;  1MMG A;  5LJN A;  2VKH A;  4DV7 T;  1I94 T;  3U8M A;  2XZ5 A;  3MZK B;  3P4S A;  5EK3 A;  3ZYK A;  4LF8 T;  4LF6 T;  2XAF B;  4OHF A;  4LFB T;  2LKG A;  3OVU A;  2LLY A;  2WU2 A;  2WS3 A;  3PU3 A;  3UUN A;  3SQ9 A;  2C0S A;  4O4L E;  4PFP A;  5C3J A;  1NEN A;  4DV4 T;  4WYV A;  5HAX A;  3CQC B;  2C5I T;  1MMD A;  2CHN A;  3HKE E;  2CBI A;  5KMG P;  2LSK A;  4D01 A;  4PAG A;  3G06 A;  4L9I A;  1T98 A;  2QYW A;  4IE5 A;  3ONL C;  3I0O A;  3PDY A;  5FMN A;  4CXY A;  3P7I A;  4ZS3 A;  2WMN A;  1UW6 A;  1Z8U A;  3KBT A;  5IHY A;  2HN2 A;  2L9Q A;  2BR7 A;  2WY2 A;  1KNR A;  5SYO A;  2X0Y A;  2IDO B;  2M6B A;  2XAQ B;  2PJQ A;  2D2S A;  2V1D B;  5FVL A;  3CVR A;  3GMI A;  4NPP A;  3Q9D A;  2FJB A;  4QXB B;  4UM1 A;  2YMD A;  3P8C D;  4TN7 B;  4HWH A;  3CQX C;  4AKH A;  2MTQ A;  2BG9 A;  2M67 A;  1G73 A;  3AB3 B;  4PK5 A;  3GN5 A;  3O1H A;  5JVD E;  4ZOL E;  1OED C;  4BQT A;  1N34 T;  2X68 A;  4A56 A;  4JBW F;  1G8X A;  3DJB A;  2W8G A;  2KSR A;  4JV5 T;  3NKZ A;  5LXB A;  1N33 T;  3C84 A;  4WBN E;  3AE5 A;  4NUU A;  5EK4 A;  4ZJT A;  3ZJ2 A;  4ILU A;  5FXV A;  2BVL A;  3ZN1 B;  2PH9 A;  3NVO A;  4IDO A;  5L2L A;  5BW2 A;  2WZI A;  1NAF A;  3PUR A;  4EOZ B;  5L47 A;  2H7V C;  2YIN A;  4GYS A;  3HL6 A;  5HXH A;  4LF5 T;  2LOP A;  3N5L A;  3K3Q C;  2ZM6 T;  2LE8 A;  2X9Y A;  5KE4 A;  5C2T A;  2PBI A;  3AE2 A;  3AXJ A;  5H6Q B;  1VCS A;  2PGZ A;  4EYU A;  2CBJ A;  2XQ5 A;  2PG8 A;  4DR5 T;  2UXB T;  5LHG B;  2YDS A;  1M7K A;  3NZQ A;  5L4H A;  2CHO A;  3ESL A;  1I6Z A;  3V5S A;  3RI5 A;  2YN6 A;  1MNE A;  5LGU B;  2BYS A;  3PJA J;  4IDQ A;  1Y01 A;  3N2O A;  5J5H A;  3X1D A;  3TLW A;  2LHN A;  4LFA T;  4HKA A;  2M6I A;  3FZH B;  4O8S A;  5CGM A;  4I0U A;  2IML A;  4JI7 T;  2K3W A;  3O4X E;  5FXX A;  1XZY A;  3Q5E A;  2CPT A;  2BKO A;  3K8P C;  3AA6 B;  3RC3 A;  5AFM A;  3UUL A;  2BG9 B;  3JC6 D;  3F31 A;  3KVA A;  2R6G F;  1KNZ A;  4NZB A;  4ZZC A;  4EYY R;  3MA9 A;  4DBR A;  3OPC A;  4DV6 T;  3I9Y A;  2ZJV A;  3OBV E;  1UV6 A;  1DU2 A;  3OTO T;  3N9L A;  3CWZ B;  3AEC A;  2VQE T;  3ZT6 A;  4PJN A;  3U8N A;  3AE3 A;  2DWK A;  4ASK A;  1ZV4 X;  4UIG A;  4JI6 T;  2CM0 A;  3VU7 H;  2CCQ A;  4GK5 E;  4PJJ A;  3U3I A;  1MMN A;  4IT4 A;  3C4X A;  5AQM B;  5HWX A;  3RF1 A;  4IGU A;  5AFU L;  1NEK A;  4U2Y A;  2WCA A;  2XZE A;  2N1G A;  1HNW T;  2XQ9 A;  1WR6 A;  2XSB A;  3UTK A;  2CEA A;  4KI0 F;  2ZJU A;  3WTK A;  4AQF A;  5L3G B;  1BR4 A;  2FJA A;  2L3L A;  4U7Y A;  1SE7 A;  3ZMT B;  3JAD A;  1YKH B;  2X0H A;  4G63 A;  4IIJ E;  3BK9 A;  1OWA A;  5JRC A;  2XPK A;  5JR9 A;  3C50 A;  2W66 A;  2BS2 A;  4QXC B;  2E2A A;  4MBQ A;  3N9O A;  2PFV A;  4N78 D;  3UU4 A;  3WTJ A;  3IHR A;  4ERR A;  3U8K A;  3NRX A;  2WMO A;  4PJL A;  3KDS E;  3UQ7 A;  3VKG A;  3WIP A;  1Y64 B;  5AQR B;  4H63 H;  3FBL A;  3PEO A;  1IBM T;  4KMC A;  4DV1 T;  2Y48 B;  3AE4 A;  3I0Q A;  2QC1 B;  3JAE A;  2EHO B;  3AVR A;  1WYB A;  3RQU A;  2JPF A;  3AAA B;  5AFN A;  4ZXL A;  4OFZ A;  5HYA A;  5LB7 B;  1XDP A;  4ZI2 C;  5LOV E;  1NWM X;  4UVC B;  3SS1 A;  4EZH A;  2JMH A;  3EVY A;  4UM3 S;  5FVK A;  1BR0 A;  3RYC E;  2K24 A;  4ISS A;  5JR9 B;  2XQ7 A;  4LMJ A;  4F8H A;  4CI1 B;  1HS7 A;  4O4J E;  4U7I A;  3HA4 A;  2NTY A;  2XNT A;  1KFY A;  3ZPO A;  4ZJS A;  2CE7 A;  3PUA A;  3T1H T;  4X62 T;  2XAH B;  4AQY T;  2CXF A;  1YKE B;  5HEU A;  2AXD S;  4GOU A;  1WFD A;  3AED A;  4Q25 A;  2WSS V;  4YFS A;  3W15 B;  4BFQ A;  2BDE A;  2CLY B;  3L39 A;  1XWM A;  2YME A;  3DP7 A;  3GWH A;  4U33 A;  4DV0 T;  5AQJ B;  4AIU A;  3FXD B;  1D0Z A;  2C9T A;  3MAC A;  4QAC A;  5J5F A;  2XSA A;  4JI4 T;  2B76 A;  3EHZ A;  2V6Y B;  4WV9 A;  4AFT A;  3VRA A;  3ONX A;  2J62 A;  4X1K E;  5HXR A;  3UUX B;  2WWV A;  3P4P A;  3U8J A;  5JDN A;  1GQE A;  2Y58 A;  3RH3 A;  1FEW A;  1U5P A;  5L4E A;  4HWI B;  3KVB A;  2VL0 A;  5CB4 E;  3AAE B;  4YSY A;  4B3M T;  3UQ4 A;  4JUY A;  2XAG B;  1HX8 A;  2I6H A;  2BG9 C;  3I1A A;  2QGS A;  2LJL A;  2V8S V;  3KV4 A;  4JI2 T;  5JR9 C;  4PJM A;  2VK9 A;  4DBQ A;  3AE8 A;  3ZDG A;  5AQI B;  2V7K A;  2MAW A;  4YHJ A;  2CA5 A;  2KMF A;  3AA7 B;  4PW8 A;  3AE9 A;  2IW5 B;  4AQF C;  3PUX F;  2BYP A;  3FBZ A;  4DBM A;  2WDV A;  1HNX T;  5JH7 E;  1MIV A;  3ETU A;  2Y7Y A;  3R84 B;  1HFA A;  2YU1 A;  5A1L A;  5JDF A;  1V9D A;  4YXD A;  4AFH A;  4TWH A;  3H3A A;  5IUX A;  2VKO A;  4ZI7 E;  2X66 A;  1D1C A;  4IE6 A;  3PE0 A;  4HFD A;  2XNV A;  3HI2 A;  5HCM A;  3E22 E;  4ZI3 D;  3Q5W A;  5JRC B;  2NTX A;  1M62 A;  4UVB B;  3SFE A;  3ZDH A;  4O4H E;  4YJ2 E;  2UU9 T;  4HWD A;  3JAF A;  3ZLI A;  4QXH B;  3AEB A;  2WU5 A;  3KFW X;  4COF A;  1CHU A;  3RGL A;  2RA1 A;  4X1Y E;  4FI5 A;  3AEF A;  2E9X C;  2FJE A;  4KBM B;  4K0K T;  3N9P A;  3AEG A;  2WAU A;  2RP4 A;  3SWH A;  4WNK A;  5ETW A;  3N9M A;  5L3B B;  3UUM A;  2IHR 1;  4YTP A;  4P0A A;  2Z6E A;  4NUV A;  4UM3 P;  1LVF A;  3MK7 C;  2LSY A;  5CA0 E;  3ZC1 A;  2FBW A;  3PUQ A;  5L3C B;  3UUB A;  3EI0 A;  3ZT7 A;  4YSZ A;  4B5D A;  2KWI B;  3C4W A;  3LK4 2;  1S94 A;  4C91 A;  5LMU T;  3U8L A;  5LNK A;  4UY2 A;  4DR4 T;  3ONJ A;  4O2B E;  2BR8 A;  3R6N A;  3ZMU B;  3EDU A;  5AQH B;  3RYF E;  2W2U A;  5J2T E;  1H7C A;  2G0U A;  4PK6 A;  4LF9 T;  4HFC A;  4ANJ A;  2BVM A;  2JMK A;  2BYQ A;  5H6R B;  3RC8 A;  1OED E;  3ZMV B;  2XHE B;  3C4Z A;  4JI8 T;  5FL1 A;  1D0Y A;  3IF8 B;  4HFI A;  5DAB A;  1ZKE A;  3RRC A;  2V7I A;  4PIR A;  1HG5 A;  4IE7 A;  2MYS A;  1VCT A;  2BZB A;  4EEB A;  3ZCJ A;  3U78 A;  4KHP T;  2H89 A;  3MJX A;  5HCJ A;  2NR4 A;  4H9P C;  1N32 T;  4A97 A;  3ZYM A;  4JYA T;  1T7S A;  1IJ5 A;  3WAJ A;  2YEV C;  4HFB A;  3RQW A;  4IE0 A;  1KK7 A;  3LSV A;  5L3F B;  4Z8X A;  1FMV A;  3RYI E;  2J4G A;  1SHZ C;  2HN1 A;  3AEA A;  2W00 A;  4YTN A;  4I50 E;  5AQP B;  2V26 A;  4YSX A;  3OKQ A;  4DVD A;  2J1D G;  2YDQ A;  5J5G A;  4KX6 A;  4UV9 B;  2XQY A;  2OLT A;  5FP3 A;  1T8B A;  3HKC E;  5HEJ A;  1O3X A;  4DR2 T;  4GKK T;  1AJ3 A;  3VHL A;  4HQP A;  2C5J A;  4QH1 A;  2Q9Q C;  4IDP A;  5LMN T;  1XMO T;  2EHO D;  1YW0 A;  3SOL A;  3O9X A;  4CN4 A;  3LK3 B;  1KNP A;  2UUA T;  2XZ6 A;  3KV6 A;  2YKS A;  2LT3 A;  1HR0 T;  1D1A A;  5LJM A;  2Q9Q D;  2CXL A;  3KV5 A;  3ZMZ B;  4UXN B;  5LA6 E;  5CFB A;  4TNW A;  3TLV A;  2LRK A;  2CLY C;  5FXW A;  2WM9 A;  1HNZ T;  4AQG A;  3C98 B;  2Q9Q B;  3OJA A;  3SH1 A;  5L3D B;  2WWU A;  2LM2 A;  3K3N A;  4X20 E;  2BBH A;  2WDR A;  2Y57 A;  5LP6 E;  4P09 A;  4IL9 A;  2ODV A;  3K3O A;  4BJN A;  4CN6 A;  1HF8 A;  5HXE A;  4AXP A;  1MMA A;  5LG3 A;  4PNI A;  1XMQ T;  4QAB A;  2V5C A;  3AVS A;  5FXZ A;  5AFK A;  1E7P A;  2E9X B;  2HPL A;  3UU6 A;  3N9N A;  5L3E B;  2H88 A;  4KP3 C;  2IUB A;  3SRZ A;  4QKN A;  5KX5 E;  5AQT B;  4GK0 E;  5AQU B;  2YDR A;  5JME A;  3C51 A;  5F5W A;  2E9X D;  3B5M A;  1WR0 A;  4EZ4 A;  3TLU A;  4CZZ B;  4TWF A;  3LBX B;  4TZ4 C;  3UT5 E;  3WTI A;  2ZLY A;  3ZCI A;  2WDQ A;  2MPK A;  4DV5 T;  4NIQ A;  5ABH A;  5JQG E;  4F6R C;  2UZ6 A;  2VKD A;  1L0V A;  4LML A;  2JRK A;  4MAL A;  5JDL A;  4ILC A;  1IBL T;  4LF4 T;  3RRW A;  2JQK A;  3CKD A;  2WNJ A;  2VVS A;  3ZSS A;  4OX9 T;  4EIW A;  2E9X A;  4H9O C;  3JC6 C;  2BYN A;  4TX5 A;  5ABE A;  3JCF A;  1EZ3 A;  3CX6 B;  3N2G E;  5J5I A;  4KUM B;  2GK9 A;  3E0Z A;  5CO5 A;  4QH5 A;  2ACX A;  5FY1 A;  4A5X A;  3Q5X A;  4H9Q C;  4Z91 A;  3HR0 A;  5BR8 T;  3P4W A;  4IDN A;  3GUA A;  4H63 V;  2H7O A;  2D0U A;  3Q5D A;  5LHI B;  2Y8D A;  2DHR A;  1MIY A;  4AFG A;  2V6Y A;  4U72 A;  2XQ8 A;  5DQV A;  5BMV E;  3ANW B;  1HTJ F;  2BKN A;  1IBK T;  2XJ7 A;  2X9H A;  3P50 A;  3QB5 A;  3IEE A;  3Q2M A;  2HH7 A;  1BR2 A;  2ZM8 A;  3CX7 B;  4PFO A;  3QNU A;  2DCF A;  4DR6 T;  4EXT A;  5ADX L;  2F4V T;  5FL0 A;  5FNV E;  3PJA A;  2LKH A;  1ZP0 A;  4HWF A;  4AKG A;  2UUC T;  3RIU A;  2IAK A;  4BJM A;  3TLT A;  1X79 A;  1B7T A;  1LKX A;  5HEH A;  1FJG T;  2BKP A;  1J5W A;  4YT0 A;  5BP0 A;  2X00 D;  2NWB A;  3SIO A;  3C64 A;  4L0R A;  3K1S A;  1BR1 A;  5AQO B;  3RIF A;  3WI3 A;  1W09 A;  3WTM A;  4ZK1 A;  3VKH A;  4YLH A;  4L5G A;  1ZOY A;  4XHE A;  5DJQ C;  3CPZ A;  1XDO A;  2NOX A;  2NW8 A;  4IHJ E;  1SUM B;  2JJ9 A;  2LHR A;  4HFV A;  4O2A E;  2I0M A;  4XK9 A;  4EB6 E;  3RYH E;  4H9R C;  2VAS A;  3D0T A;  2FUP A;  2CRB A;  3CQG B;  3ZN0 B;  1LRZ A;  2BYR A;  2XNU A;  2A3D A;  2A2F X;  3PUG A;  3O1J A;  2E8I A;  5FY0 A;  1JNR A;  3FXE B;  3RPU A;  2LOS A;  3NZP A;  2N9D A;  5AQN B;  1R8I A;  4Z90 A;  1OXZ A;  3OYX A;  4JEH B;  4A98 A;  1CUN A;  1QSD A;  3GN5 B;  3RIA A;  2XAS B;  3J9X 1;  3V5U A;  2V6X A;  1HCI A;  4TV8 E;  2KZ7 B;  4PK4 A;  3N2K E;  4X5T A;  4UM3 A;  4JI0 T;  4DV2 T;  3A7M A;  2MOZ A;  3PUY F;  2Y56 A;  5HWY A;  3PUZ F;  1ZHC A;  2SPC A;  3MKD A;  3UU8 A;  4GKJ T;  3J7Y q;  4TV9 E;  5AFH A;  4DR3 T;  5E0O A;  1XNQ T;  2ZMA A;  2XQ3 A;  3FB2 A;  5LYJ E;  1WYC A;  1QUU A;  3UFE A;  2VL8 A;  3QK6 A;  5LGT B;  3RKG A;  4J2C A;  2QVA A;  4I43 B;  1OED A;  4MHC A;  2FJD A;  4GYR A;  2DI4 A;  3H37 A;  2ZM0 A;  1VRB A;  3VR8 A;  3QUJ A;  4ZEY A;  1UUS A;  3ZT5 A;  4QWN B;  4ZR6 A;  2NW9 A;  2BJ0 A;  3IBP A;  4U74 A;  4HE8 A;  2WNL A;  4FJO A;  4DMV A;  5IWA T;  1E1H B;  3GA8 A;  1LVK A;  1T72 A;  1IJ6 A;  1J5E T;  3EAM A;  2WZH A;  4IL4 A;  4CXW A;  4ZS2 A;  2ODU A;  5LCY A;  2RPA A;  5J2U E;  4E7S A;  3ZST A;  5ABF A;  4NXM T;  2DWG A;  3KBU A;  2X67 A;  4ZK4 A;  5HXC A;  1X9B A;  2XQA A;  4AKL A;  3VR9 A;  1SA0 E;  4HTE A;  3RHW A;  3ANW A;  5AFM B;  2J47 A;  5AFL A;  2VWA A;  4E7Z A;  3DTO A;  4OYK A;  1YD8 G;  3UU3 A;  4UR9 A;  5HXS A;  4B3R T;  4TNV A;  4ZRU A;  2UXN B;  1ZEE A;  4X65 T;  3B57 A;  3LFM A;  3AEE A;  2LEH A;  4ZZB A;  5LHH B;  2VQF T;  2JQ9 A;  1YXR A;  2N2N A;  3PUW F;  4EED A;  4DID B;  3N9Q A;  5LBM A;  2QRX A;  3ZYL A;  3FZM B;  4HFH A;  5KZU A;  3AA0 B;  3T4M A;  1IAP A;  2VKJ A;  1IZN B;  4M1P A;  5AQG B;  4QX8 B;  2ACZ A;  2BS4 A;  2KXP B;  4B3T T;  4QHO A;  2B1E A;  4ZHQ E;  4BAY B;  2K9A A;  3T1Y T;  1OED B;  3VRB A;  2AE9 A;  4DMW A;  4DR7 T;  2UXX B;  4DR1 T;  4IE4 A;  3O1I A;  1WRD A;  4TWD A;  5AQF B;  2YOE A;  5CA1 E;  2KWH A;  2XYT A;  1YQ3 A;  2NW7 A;  4HWC A;  2W62 A;  4KHZ F;  4I4T E;  4B3S T;  4P0B A;  1I9B A;  5JDG A;  1UUR A;  3A8Y C;  4LMK A;  2V7M A; 
#chains in the Genus database with same CATH homology
 5HEH A;  1UW6 A;  4PIR A;  2QC1 B;  3JAE A;  3JAF A;  3U8J A;  4ALX A;  2BR7 A;  5BP0 A;  4LML A;  2X00 D;  1UX2 A;  2Y58 A;  4COF A;  3SIO A;  2Y56 A;  5CFB A;  4TNW A;  5KE4 A;  4ILC A;  5SYO A;  3UU8 A;  3TLV A;  5L4E A;  3RQU A;  2WNC A;  2PGZ A;  3UU3 A;  5TVC A;  2M6B A;  4QH4 A;  2VL0 A;  3RIF A;  5AFN A;  5AFH A;  5HCJ A;  2WNJ A;  2WZY A;  2XQ5 A;  3WTM A;  4ZK1 A;  3SH1 A;  4TNV A;  2XQ3 A;  3UQ4 A;  4A97 A;  4XHE A;  4ZRU A;  2XQ6 A;  2LM2 A;  4NPP A;  2BYN A;  5L4H A;  2Y57 A;  4HFE A;  4ZZB A;  4XK9 A;  2XQ9 A;  5J5I A;  2BG9 C;  4UM1 A;  2YMD A;  4HFB A;  2ZJU A;  3RI5 A;  3WTK A;  4UM3 S;  2YN6 A;  5CO5 A;  3SQ6 A;  1OED A;  3RQW A;  4IL9 A;  2BYS A;  4UXU A;  4EZ1 A;  4QH5 A;  4UM3 A;  4UM3 P;  2BYR A;  2BG9 A;  3JAD A;  2XNU A;  3LSV A;  3ZDG A;  2X00 A;  5J5H A;  4HFH A;  3WTN A;  4ZR6 A;  5KZU A;  2W8F A;  2BJ0 A;  3TLS A;  5LG3 A;  2MAW A;  3TLW A;  3T4M A;  3WTH A;  2XQ7 A;  4LMJ A;  3UUB A;  4Z91 A;  3EI0 A;  4F8H A;  4QAB A;  2WNL A;  3P4W A;  2M6I A;  4B5D A;  3ZKR A;  3U8M A;  4ILA A;  3GUA A;  2XZ5 A;  5AFK A;  5BRX A;  5J0Z A;  2XNT A;  1OED C;  5J5G A;  3UU6 A;  3EAM A;  5HEG A;  4BQT A;  2BYP A;  4ZJS A;  2LKG A;  4IL4 A;  4DBM A;  4AFG A;  3U8L A;  2LLY A;  4UY2 A;  1OED B;  4QAA A;  5HEU A;  2W8G A;  2KSR A;  2XQ8 A;  5AFM A;  5HEJ A;  3C79 A;  3SQ9 A;  2BG9 B;  2XYS A;  2Y7Y A;  4Z90 A;  3WTO A;  2BR8 A;  4ILB A;  5HEO A;  2XQ4 A;  3UU4 A;  3WTJ A;  4TWD A;  4BFQ A;  5JME A;  4FRR A;  4HQP A;  5LXB A;  5AFJ A;  4A98 A;  2YOE A;  5FJV A;  3C84 A;  2YME A;  4NZB A;  4QH1 A;  3U8K A;  3RIA A;  4ZZC A;  3TLU A;  4AFH A;  4ZJT A;  2UZ6 A;  3P50 A;  4TWH A;  3UQ7 A;  2XYT A;  5IUX A;  4ZK4 A;  3WIP A;  3WTL A;  4TWF A;  2ZJV A;  3IGQ A;  2XQA A;  1UV6 A;  4HFC A;  2PH9 A;  4IRE A;  4D01 A;  2C9T A;  2WN9 A;  2BYQ A;  3RHW A;  3UU5 A;  2Y54 A;  3WTI A;  5BW2 A;  4QAC A;  5J5F A;  4HFD A;  1OED E;  2XNV A;  3PMZ A;  1I9B A;  3U8N A;  5AFM B;  5HCM A;  3PEO A;  2BG9 E;  2LKH A;  5AIN A;  3EHZ A;  4HFI A;  5AFL A;  5L47 A;  2XZ6 A;  4WV9 A;  4X5T A;  4LMK A;  4AFT A;  2YKS A;  3TLT A;  3ZDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...