3TLWA

The glic pentameric ligand-gated ion channel loop2-21' oxidized mutant in a locally-closed conformation (lc2 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlwA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlwA01
2BR8A 5L47A 4AFGA 5HEHA 3ZDGA 3U8NA 4XK9A 4TWDA 2ZJVA 3JAEA 4QABA 3PMZA 3RQWA 2QC1B 4HQPA 3WTOA 1OEDE 5KE4A 2XQ9A 2YN6A 1UX2A 2M6BA 3RQUA 5J5FA 2WNJA 3SH1A 5L4EA 4UY2A 2XNVA 4ZJSA 4BFQA 4ILCA 2BYPA 2BG9A 4TNVA 5IUXA 2X00D 4ZJTA 5AFMB 2W8GA 4QACA 5J5GA 3ZDHA 4AFTA 2BYNA 4EZ1A 1OEDC 4B5DA 4UM3P 4FRRA 5AFNA 4ILBA 2XNUA 2M6IA 4UM3A 3WTHA 4IL9A 3WTIA 4IREA 1OEDA 5HCJA 3TLSA 3U8KA 2XNTA 2MAWA 2XQ4A 4Z90A 3WIPA 2BJ0A 4ZZCA 4BQTA 4ZRUA 3T4MA 3RIFA 5HEUA 3WTJA 4ILAA 1OEDB 3RI5A 4DBMA 3SQ6A 4IL4A 5BP0A 3SQ9A 3WTNA 3LSVA 4ZZBA 3JAFA 2BYRA 3P50A 2LKGA 5BW2A 5J5IA 4LMJA 3EHZA 4Z91A 2BR7A 2XZ6A 2Y58A 3ZKRA 2PH9A 3TLTA 2X00A 4ZR6A 3U8LA 5KZUA 2LM2A 5HEJA 5AFMA 2BG9B 4HFEA 2VL0A 2XQ8A 3JADA 4COFA 2Y56A 4LMKA 3TLWA 4X5TA 5HEGA 2BYSA 5J5HA 3GUAA 2PGZA 2XQ3A 4NZBA 2BG9C 4AFHA 3C84A 2Y57A 2ZJUA 2Y54A 4HFCA 4HFIA 2WNCA 1UW6A 4LMLA 5LG3A 2XQAA 2XQ5A 4HFHA 3UU5A 2WN9A 2XZ5A 5BRXA 4QH4A 5CO5A 4ALXA 5HEOA 5AFJA 3UU6A 5J0ZA 3UU4A 4HFDA 5TVCA 5AFHA 3RIAA 4F8HA 5AINA 2XYTA 4PIRA 2W8FA 3C79A 5SYOA 5AFLA 3RHWA 5L4HA 3WTKA 3TLUA 3UU8A 2WNLA 2XQ6A 5FJVA 3U8JA 2XYSA 4A97A 5HCMA 1I9BA 4HFBA 1UV6A 4XHEA 2XQ7A 5CFBA 2KSRA 4TNWA 2UZ6A 4QAAA 2BG9E 4ZK4A 2LLYA 4QH5A 4UXUA 2YKSA 4TWFA 3UQ7A 3UQ4A 3SIOA 4TWHA 3UUBA 3P4WA 4NPPA 2LKHA 3IGQA 4QH1A 2WZYA 2YMDA 2BYQA 5AFKA 4D01A 5JMEA 4WV9A 3WTMA 5LXBA 4UM1A 3UU3A 2Y7YA 2C9TA 2YMEA 2YOEA 4A98A 4ZK1A 3WTLA 3TLVA 4UM3S 3EAMA 3EI0A 3PEOA 3U8MA
chains in the Genus database with same CATH superfamily
5L47A 3AE1A 3A5XA 2IC6A 4P0AA 5LNKA 3PMZA 3L09A 4EYYR 2ODUA 1BR2A 2HPJA 1WFDA 1NENA 5FVLA 1XMQT 2XUEA 4ZJTA 5LCYA 4C91A 2WQYA 3ANWA 4MFRA 2WS3A 2MBGA 3CVRA 2WBLA 3PUVF 3EDUA 1BR0A 4BA9A 1IJ5A 2V6YB 5H6RB 5HCJA 2MAWA 2XQ4A 3H3MA 4O4IE 3PJAA 3C64A 5HEJA 2XAFB 5L2LA 1YQ3A 4EAHA 3PDYA 4WZXA 1EZ3A 3SWHA 1MIVA 2V26A 3P4RA 2FUPA 4JLEA 5HEOA 3R6NA 4EIWA 4F8HA 2CE7A 4PIRA 5JQGE 5HXEA 4OFZA 3T8OA 4LFAT 3Q9DA 2WNLA 3ZCJA 3ZLIA 5LHIB 4X1KE 4IDQA 4LF6T 5AQTB 2YEVC 3P7IA 4QH1A 3QNUA 2JIWA 2DI4A 3L3PA 1X9BA 4UM1A 2YMEA 2L9QA 1BR1A 2WM9A 4I43B 5EK2A 3LFMA 4JI2T 2J1DG 2ES0A 4IE7A 3JC6D 3N2GE 4MHCA 4X20E 4XBFB 4KX6A 4A56A 5J5GA 2E8IA 1OEDC 3O9XA 3N2OA 3ETUA 4YTNA 1OEDA 4WNKA 5CA0E 2UXCT 1UURA 4BQTA 2C5JA 2V6YA 3U78A 4XAXB 4UVBB 3NRXA 3P50A 2WMOA 4GIWA 5LYJE 3ZMTB 3J7Yq 2BKNA 3A7MA 4GK0E 3RYHE 1VCTA 2QYWA 3O1IA 4X1IE 2BG9C 4OK0A 1HNZT 4OYKA 2W61A 4LMLA 4CN1A 4DVDA 5AINA 3ZMVB 2E5VA 4WW0A 3UT5E 2LHRA 1N36T 4IE4A 4A97A 5HCMA 1UV6A 4QAAA 2BG9E 1R8IA 3C4ZA 4DO0A 2YKSA 4TWHA 3PUXF 2K3WA 3AA0B 3K8PC 4A5XA 3RKOA 2LSKA 4QWNB 2C9TA 3EAMA 3N9PA 2BVMA 5JR9C 5IHYA 4GKKT 2DNXA 5DQWA 2W67A 3CWZB 3JAEA 4JUYA 1O3XA 4JI7T 3Q5DA 5FL0A 5AQJB 4DMVA 2ACZA 3FZFB 5L3CB 1KNPA 5AQSB 3SH1A 1FMVA 2Q9QC 4WYVA 4WBOA 5KMGP 2IAKA 5FYMA 2CXFA 1LKXA 3TLSA 1S94A 4AIUA 2V6XA 3T4MA 4ILAA 3AEEA 3I9WA 3LSVA 5HWYA 5LB7B 5IYZE 4KBMB 4KP3C 1FJGT 2LM2A 1HF8A 1NEKA 4NIQA 4AQGA 4O2BE 3OBVE 1YW0A 3L39A 1UCUA 5ETWA 3D0TA 1IZNB 1ZOYA 4HFDA 5BMVE 3ZSTA 1FIOA 4ZI7E 5M4YA 2XYTA 1T8BA 2XASB 3RYIE 5IWAT 4PK5A 2UZ6A 3C98B 2E9XC 4TZ4C 3HKBE 2V7MA 3AXJA 5HXHA 4AKHA 5CB4E 2LOSA 4DUZT 1SE7A 2Y7YA 5FXXA 2YOEA 2XAHB 2D2SA 5AQMB 3PEOA 3M65A 4AFGA 3ZDGA 3KVBA 2LSGA 3N9MA 4U33A 2IMLA 4IDNA 2KMFA 4NUUA 3RQUA 5AQGB 2NTXA 2B1EA 2ZM8A 2BG9A 5ADXL 2V7JA 1G73A 4IGUA 3GMIA 4YJ2E 1YQ4A 3WTIA 3FZKB 2KWHA 1MMAA 4LFCT 4ZI2C 4LMJA 4UF0B 3N5LA 5L3FB 2NP9A 2X0LB 3AA1B 3ZYKA 2W63A 1U5PA 3OPCA 2BS4A 4AKIA 3MA9A 2JJ9A 4AFHA 2ZMAA 4L9IA 5JDQA 1UW6A 4PJMA 4HWHA 3WAKA 2N2NA 3VRBA 3UU6A 2D0TA 2XTLA 3UTKA 2VQFT 1D1BA 2ZLYA 1DU2A 4AKLA 4O4LE 3AB3B 4UXUA 4TWFA 3SS1A 1NWMX 4CN6A 2WDVA 4NPPA 2WP9A 4H9QC 5AQFB 4X1YE 2BYQA 2NTYA 4AKGA 3HKCE 1I6ZA 5C3JA 3T1YT 5FP3A 4BJNA 3K3NA 4LF4T 4IDZA 3EI0A 2JMKA 4I50E 1MMNA 3CKDA 4ISTA 4TWDA 1WYCA 2XAGB 2XQYA 3WTOA 1UGOA 5JR9B 2YDSA 5AQIB 2WWVA 2BYPA 4MBQA 2E9XB 4DR2T 3ZDHA 4AFTA 1KEYA 3C50A 4F6RC 2WDRA 3AA6B 4IE5A 4DBMA 3KV6A 2F4VT 1UX4A 5J5IA 3AVRA 4ZR6A 2DWGA 2R6GF 5F3JA 3PUGA 4HFEA 2XY8B 2Y6XA 3NZPA 1XNQT 4ILUA 3SOLA 2E2AA 5J5HA 3RF1A 4TN7B 2VL8A 4H63H 2EHOA 5LG3A 5H6QB 1IBKT 3B13A 5AFJA 3I9YA 4L5GA 3HA4A 4UV9B 4DR1T 3JC6C 1MMGA 2CM0A 1FMWA 5HWXA 4JI1T 1FEWA 4U31A 3TLUA 3U8JA 3P4PA 4HFBA 5FVKA 5KXJA 3N9LA 3SIOA 4O8SA 2LKHA 4X64T 1UK5A 4B3ST 2ACXA 2XPKA 2IIUA 4HE8A 2LT3A 1LVFA 3K3OA 3DJBA 4QABA 2DWKA 4BJMA 3RGLA 2WMNA 3M3ZB 1J1JA 4GKJT 3ZN1B 2H88A 2CWOA 2X9WA 3AAEB 1W0BA 2DLRA 2WAUA 2W8GA 3AEFA 2EHOD 2MOZA 5JTGA 3AAAB 4O4HE 2VKHA 3CX7B 3UFGA 3G06A 1U4QA 3I0OA 3LG7A 2QGSA 3ANWB 3A8YC 1Z0PA 5DQVA 5AFMA 2NOXA 4AI6A 2ODVA 2IW5B 5HEGA 4B6XA 2FJDA 5L3DB 2LSYA 5JDGA 2XAQB 2XQ5A 1MMDA 2FJBA 5GONE 1MIWA 5TAOA 4DV0T 2W8FA 3ZT6A 3LBXA 5FY1A 2I0MA 2J4GA 3N9NA 4AQYT 4LF5T 2IUBA 3AXJB 2B76A 3ONJA 4O4JE 2LJLA 4HKAA 2CHNA 3AEDA 3C51A 3PUQA 3RIUA 5AQLB 5LXBA 4JBWF 3OVUA 1HCIA 3WTLA 3QC9A 3RH3A 2A72A 3T1HT 5L3BB 3GN5B 2YN6A 2WNJA 5JDLA 4GYSA 5JDMA 3L8RA 3AE9A 4EZ1A 1QLBA 4B3MT 2XNUA 5JVDE 4EEBA 4AQFA 4I0UA 3ZYLA 3ZCIA 3RI5A 2V7KA 4DV3T 2V7LA 4H63V 2Y58A 2D0UA 2D9DA 4YY3T 2VVNA 5FNVE 5AQNB 4YSZA 3CMLA 1ZKEA 3GUAA 3H3AA 3PTRB 5L3GB 3ZSSA 1UX5A 2UXNB 2LOPA 3DTOA 2XQAA 1KFYA 3ZJ2A 2BKOA 5AFHA 4HWFA 5AFLA 2W66A 3RHWA 3AE4A 3ZN0B 3MJXA 2C5IT 2N1GA 3UUMA 5A1LA 3PJAJ 3ZMSB 4TX5A 2CPTA 3F57A 2X9HA 5LP6E 5JRCA 4PAGA 2J62A 3ESLA 3OYZA 4DV6T 4ANJA 4LF8T 4IDOA 3WI3A 2K48A 4CI1B 3ZMUB 1H7CA 4U3CA 3UUXB 5L4EA 3NKZA 4ZS2A 2HH7A 4YFSA 3ETVA 3QOFA 5KX5E 5AFNA 3R84B 3U8KA 3WIPA 2BJ0A 2Y48B 3PUWF 1ZP0A 2KT9A 2YK0A 2XZ6A 4CI3B 5FXWA 2LSIA 3IA3A 3CPZA 3TLWA 4KUMB 3RKGA 4IDPA 2XAJB 4HEAA 2JQQA 2PFVA 5JDHA 3MACA 4DV5T 3KVAA 5JR9A 4QH4A 3O1HA 1HS7A 4AKRB 4EOZB 1IBLT 4H9NC 3V5UA 1AJ3A 4TNWA 3X1DA 4N78D 4ZI2D 3K1SA 5AFUL 2LRLA 2DCFA 2HN1A 4P0BA 3H37A 2UXXB 4HTEA 5ABHA 2YU2A 4J2CA 3IBPA 4CZZB 4E7SA 2CMRA 3PUSA 4UELA 5C2TA 4YTPA 4XK9A 4U2ZA 3AEAA 4YSYA 2BS3A 1HX8A 2C0SA 4NXNT 5F8PA 3KV4A 3ABVA 4ILCA 5AFMB 5LJMA 3RC3A 2XM2A 4UVAB 3ZPOA 5JDNA 1T72A 3PE0A 3EVYA 3FBLA 3RPUA 2X9YA 2NW9A 4KHPT 3WTHA 3AA7B 4JI5T 3BQIA 3FB2A 3RLFF 3RIFA 5HEUA 1OEDB 1N32T 2BZBA 3SQ9A 4DIDB 3WTNA 2LKGA 4QHOA 4AQFC 2BR7A 2X00A 4E7ZA 5FMNA 4DR6T 2NWBA 3BQKA 3Q5EA 4COFA 2M67A 3TKLB 5J2TE 3RYCE 4EZ4A 3C4WA 3ONXA 3EDVA 1XDPA 3AEBA 3VU7H 2X0HA 5J1GA 4ZI3C 2X67A 4PFPA 2DHRA 3UU4A 3ZT5A 5JDFA 4H9PC 2VASA 4ADZA 5AQRB 1LRZA 3ZEFB 2BVLA 2V5CA 4XHEA 5FXVA 2LLYA 1J5WA 1HTJF 4DR4T 3O1JA 1IBMT 1W9RA 1KNZA 2D5UA 2V7IA 3UFEA 4YHJA 2VKOA 2JQ9A 2NW7A 2WU2A 2KNDA 4DBQA 3FBZA 4KHZF 5E0OA 5LOVE 2X0YA 2UUBT 2VKJA 4HQPA 1YXRA 5HXRA 5KE4A 3CIRA 4JEUB 1XNRT 2KINB 4QACA 3VR8A 2JPFA 4B5DA 3HKEE 5ABFA 1KF6A 3PUAA 3HI2A 4EEDA 4ILBA 2M6IA 4UM3A 2DL1A 2L3LA 4UXNB 4ZRUA 4G63A 2W62A 4U2YA 4UVCB 2OLTA 3SQ6A 4IL4A 3VKHA 4BAYB 4KI0F 4QXCB 4YT0A 5KZUA 2BG9B 2XQ8A 5LBMA 2H89A 2FJEA 2Y56A 4I55E 3CQGB 2HN2A 1MNEA 4CXXA 4NZBA 3C84A 3CQCB 3OYXA 2W0GA 3AAIA 1D1CA 5DJQC 4WBNE 4DNDA 4DBRA 2PG8A 1WLXA 2XYSA 2X9XA 3IEEA 1D1AA 3N2KE 2WWUA 3J9X1 3K3QC 3UQ4A 1UUSA 2OV9A 4P1NA 4AXPA 1X79A 3Q2MA 4YSXA 3WTMA 5LMUT 4PJNA 3ZC1A 4IE6A 3RRCA 4H9RC 3NBXX 2ZM2A 1SA0E 1Y64B 2VWAA 2X51A 2QC1B 4CQIA 3KDSE 4B3RT 2KZ7B 1Z8UA 2XQ9A 1UX2A 4BFQA 4HWIB 4ZJSA 2JQKA 2RA1A 2W00A 4UEMA 5CJ5A 1IJ6A 4UM3P 4DMWA 3EUHA 4ZXLA 4ASKA 5HYAA 5HXCA 4JEHB 4K0KT 4AISA 3EHZA 3U8LA 2PH9A 1XDOA 5AQKB 2IDOB 2V1DB 5ABFB 1BR4A 3QUJA 2KXPB 2WSSV 3Q5XA 2XQ3A 2Y57A 2ZJUA 1HG2A 1JNRA 4HGAA 4HFHA 2G0UA 4MALA 2XZ5A 4LF7T 5BRXA 3E0ZA 2LE8A 2LRKA 5J0ZA 1Y01A 2K5BB 4FI5A 5EK3A 3PU8A 4EZHA 2FJAA 5FJVA 3KINB 3KV5A 2BBJA 4IE0A 3FZLB 4ZOLE 1ZEEA 1WRDA 3IGQA 5AQHB 2Q9QD 4CI2B 3SRZA 2V5DA 4ZK1A 1QSDA 3PURA 3W15B 3GA8A 3OTOT 4P09A 3FHNA 2CCQA 3LBXB 4OYJA 4QX7B 2CLYB 1E2AA 3O4XE 2VKDA 3LK42 5FY7A 2CWYA 5J2UE 4X62T 3IHRA 2GK9A 5IUXA 2K24A 2I59A 5FY0A 4JYAT 2LM9A 4IREA 4ZZCA 4TV8E 5BP0A 4UV8B 2CXDA 2BYRA 4JI6T 2AXDS 3N9OA 3LK2B 1VRBA 3TLTA 2VL0A 5LGUB 5AQQB 4MLKA 3AE2A 1YKEB 1WCRA 3CK6A 4Z8XA 5LA6E 1HR0T 1E1HB 2Y54A 3CX6B 4QXHB 4PK4A 4PNIA 1OXZA 1WR0A 4YTMA 2WY2A 4JV5T 3ZMZB 2WN9A 2W2UA 2LHNA 4CXYA 4UR9A 4QXBB 4ALXA 3C4XA 2XZEA 3RIAA 5LXTE 3VR9A 5HXSA 2UUCT 2N9DA 2A3DA 2P9BA 1HG5A 5L4HA 1T98A 2MTQA 1I9BA 5ABEA 3WAJA 1D0ZA 3AE3A 3NWIA 3BK9A 3UUNA 4EB6E 3OKQA 4GK5E 3AE7A 4CN4A 2WZIA 4IT4A 4X65T 4QX8B 3HR0A 2CXLA 2J47A 3U8NA 4U72A 2EHOB 3U3IA 1T7SA 3MZKB 5KDMC 4DR5T 5J5FA 3E08A 1XMOT 2JMHA 5JH7E 5LG4A 2CRBA 2XJ7A 3FZMB 2ZM6T 3CQXC 4FRRA 3AVSA 4TV9E 2UXBT 2ZM0A 5C8YE 4U74A 4DUYT 3EABA 2WCAA 2PJQA 3JAFA 4O2AE 5CA1E 4ZHQE 4Z91A 1KNRA 4EGWA 1J5ET 3MKDA 2E9XA 2YINA 3B5MA 4EYUA 2BKPA 4PJJA 4H9SE 4I4TE 2XM1A 4DR7T 2UXDT 5LGTB 4HFIA 3BQLA 3VRAA 3KFWX 2X68A 3UU5A 1ZV4X 3HKDE 5TVCA 4HWCA 4IIJE 2IC9A 3C79A 1YD8G 1M7KA 2X66A 2C5KT 3WTKA 3QB5K 5CFBA 2NR4A 4JI0T 3I1AA 3SFDA 4PJLA 4DV7T 3IF8B 3ZJ1A 4XZCA 5AFKA 5JMEA 1WYBA 1XZYA 3RYFE 1US7B 3TLVA 5DABA 3FXDB 3V5SA 4OX9T 2BR8A 5HEHA 2CHOA 2KWIB 2FBWA 2CLYC 3B57A 2XSBA 4TNVA 1IAPA 2LEHA 2XHEB 4V1Av 3KV9A 4UIGA 3KBTA 3PUYF 1OWAA 4IL9A 3NVOA 4U7IA 4Z90A 4ZS3A 2CBIA 4L0RA 3FXEB 3AECA 1G8XA 2IHR1 2HHHT 4NUVA 5HAXA 2NW8A 2E9XD 2BDEA 4C90A 3ZKRA 5L3EB 4GOUA 2H3RA 3JADA 5FXZA 5LGNB 2BYSA 4B3TT 4TUYE 3P8CD 2WNCA 2JQHA 2CEAA 2L8KA 5LHGB 4X66T 3CX8B 5AQPB 5JREA 3LDQB 5LBQB 4G2AA 5F5WA 2RPAA 2OA5A 2W4XA 3FZHB 4EV6A 4NXMT 5LJNA 2VB6A 2XQ6A 2YU1A 2UU9T 2PBIA 4ZK4A 3PUZF 4Q25A 3UQ7A 1VCSA 3UUBA 1V9DA 4ISSA 3RRWA 3E22E 2WZYA 2BBHA 4D01A 4GYRA 3QB5A 4A98A 3I0QA 4UM3S 4HWDA 2VK9A 3U8MA 4ERRA 2Q9QA 4H9OC 4K0UA 2MPKA 1SUMB 1N34T 2VURA 4YXDA 4LFBT 3ZC0A 1E7PA 2KLQA 3LJCA 2Z6EA 1ZHCA 2X00D 1GQEA 4UF0A 4PW8A 4FJOA 1LVKA 2WU5A 4LF9T 1CUNA 1JNZA 4JI8T 3DP7A 2XNTA 3F2EA 5ABGA 2PTFA 3OJAA 5FL1A 1L0VA 4ZZBA 5CGMA 5BW2A 5EK4A 3UULA 4LMKA 2UUAT 3GN5A 2PGZA 4JI3T 4OHFA 4HFCA 2BS2A 1SHZC 5LHHB 1QUUA 1YKHB 2A2FX 3GWHA 5CO5A 4HFVA 3NRYA 3S4UA 5JRCB 3VHLA 2JRKA 4DV4T 2CA5A 2Q9QB 3AE8A 3RIUC 3RX6A 1B7TA 2KSRA 3MK7C 2Y8DA 3Q5WA 3P4WA 2AE9A 3P4SA 4WV9A 3UU3A 4DV2T 3ZYMA 2HPLA 5AQUB 4PK6A 2WZHA 1D0XA 4EXTA 1KK7A 1WR6A 1HX1B 2ZJVA 3RQWA 4QKNA 4YLHA 3HL6A 4DV1T 1OEDE 4M1PA 3RC8A 2M6BA 3LK3B 5FKYA 4UY2A 2XNVA 1MIYA 4HN9A 3AE6A 3AEGA 2BYNA 1S35A 1XWMA 4DR3T 2A9UA 4JI4T 3ZT7A 2VVSA 3NZQA 1VOMA 2H7OA 2K9AA 2XSAA 2WDQA 3WTJA 1N33T 1D0YA 2QRXA 4U7YA 2WB5A 1HFAA 3PU3A 1W09A 1MNDA 2QVAA 2SPCA 3ONLC 3MXZA 4CXWA 5BR8T 3VKGA 4X5TA 3N9QA 3SFEA 2YDRA 5EZYE 4IHJE 4ZI3D 3PV0F 2V8SV 3JCFA 1HNXT 2QA7A 3F31A 3AE5A 1W0AA 1NAFA 2VQET 2LSJA 2MYSA 5SYOA 1I94T 3KBUA 2I6HA 2E5LT 4PFOA 3UU8A 2EHOC 5AQVB 1HNWT 2XQ7A 2CBJA 3QK6A 1CHUA 1M62A 2YDQA 4QH5A 4YHHT 2H7VC 4ZEYA 3P4QA 2YMDA 2RP4A 5LMNT 5AQOB 4KMCA 4YJ3E
chains in the Genus database with same CATH topology
2BR8A 5L47A 4AFGA 5HEHA 3ZDGA 3U8NA 4XK9A 4TWDA 2ZJVA 3JAEA 4QABA 3PMZA 3RQWA 2QC1B 4HQPA 3WTOA 1OEDE 5KE4A 2XQ9A 2YN6A 1UX2A 2M6BA 3RQUA 5J5FA 2WNJA 3SH1A 5L4EA 4UY2A 2XNVA 4ZJSA 4BFQA 4ILCA 2BYPA 2BG9A 4TNVA 5IUXA 2X00D 4ZJTA 5AFMB 2W8GA 4QACA 5J5GA 3ZDHA 4AFTA 2BYNA 4EZ1A 1OEDC 4B5DA 4UM3P 4FRRA 5AFNA 4ILBA 2XNUA 2M6IA 4UM3A 3WTHA 4IL9A 3WTIA 4IREA 1OEDA 5HCJA 3TLSA 3U8KA 2XNTA 2MAWA 2XQ4A 4Z90A 3WIPA 2BJ0A 4ZZCA 4BQTA 4ZRUA 3T4MA 3RIFA 5HEUA 3WTJA 4ILAA 1OEDB 3RI5A 4DBMA 3SQ6A 4IL4A 5BP0A 3SQ9A 3WTNA 3LSVA 4ZZBA 3JAFA 2BYRA 3P50A 2LKGA 5BW2A 5J5IA 4LMJA 3EHZA 4Z91A 2BR7A 2XZ6A 2Y58A 3ZKRA 2PH9A 3TLTA 2X00A 4ZR6A 3U8LA 5KZUA 2LM2A 5HEJA 5AFMA 2BG9B 4HFEA 2VL0A 2XQ8A 3JADA 4COFA 2Y56A 4LMKA 3TLWA 4X5TA 5HEGA 2BYSA 5J5HA 3GUAA 2PGZA 2XQ3A 4NZBA 2BG9C 4AFHA 3C84A 2Y57A 2ZJUA 2Y54A 4HFCA 4HFIA 2WNCA 1UW6A 4LMLA 5LG3A 2XQAA 2XQ5A 4HFHA 3UU5A 2WN9A 2XZ5A 5BRXA 4QH4A 5CO5A 4ALXA 5HEOA 5AFJA 3UU6A 5J0ZA 3UU4A 4HFDA 5TVCA 5AFHA 3RIAA 4F8HA 5AINA 2XYTA 4PIRA 2W8FA 3C79A 5SYOA 5AFLA 3RHWA 5L4HA 3WTKA 3TLUA 3UU8A 2WNLA 2XQ6A 5FJVA 3U8JA 2XYSA 4A97A 5HCMA 1I9BA 4HFBA 1UV6A 4XHEA 2XQ7A 5CFBA 2KSRA 4TNWA 2UZ6A 4QAAA 2BG9E 4ZK4A 2LLYA 4QH5A 4UXUA 2YKSA 4TWFA 3UQ7A 3UQ4A 3SIOA 4TWHA 3UUBA 3P4WA 4NPPA 2LKHA 3IGQA 4QH1A 2WZYA 2YMDA 2BYQA 5AFKA 4D01A 5JMEA 4WV9A 3WTMA 5LXBA 4UM1A 3UU3A 2Y7YA 2C9TA 2YMEA 2YOEA 4A98A 4ZK1A 3WTLA 3TLVA 4UM3S 3EAMA 3EI0A 3PEOA 3U8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BR8 A;  5L47 A;  4AFG A;  5HEH A;  3ZDG A;  3U8N A;  4XK9 A;  4TWD A;  2ZJV A;  3JAE A;  4QAB A;  3PMZ A;  3RQW A;  2QC1 B;  4HQP A;  3WTO A;  1OED E;  5KE4 A;  2XQ9 A;  2YN6 A;  1UX2 A;  2M6B A;  3RQU A;  5J5F A;  2WNJ A;  3SH1 A;  5L4E A;  4UY2 A;  2XNV A;  4ZJS A;  4BFQ A;  4ILC A;  2BYP A;  2BG9 A;  4TNV A;  5IUX A;  2X00 D;  4ZJT A;  5AFM B;  2W8G A;  4QAC A;  5J5G A;  3ZDH A;  4AFT A;  2BYN A;  4EZ1 A;  1OED C;  4B5D A;  4UM3 P;  4FRR A;  5AFN A;  4ILB A;  2XNU A;  2M6I A;  4UM3 A;  3WTH A;  4IL9 A;  3WTI A;  4IRE A;  1OED A;  5HCJ A;  3TLS A;  3U8K A;  2XNT A;  2MAW A;  2XQ4 A;  4Z90 A;  3WIP A;  2BJ0 A;  4ZZC A;  4BQT A;  4ZRU A;  3T4M A;  3RIF A;  5HEU A;  3WTJ A;  4ILA A;  1OED B;  3RI5 A;  4DBM A;  3SQ6 A;  4IL4 A;  5BP0 A;  3SQ9 A;  3WTN A;  3LSV A;  4ZZB A;  3JAF A;  2BYR A;  3P50 A;  2LKG A;  5BW2 A;  5J5I A;  4LMJ A;  3EHZ A;  4Z91 A;  2BR7 A;  2XZ6 A;  2Y58 A;  3ZKR A;  2PH9 A;  3TLT A;  2X00 A;  4ZR6 A;  3U8L A;  5KZU A;  2LM2 A;  5HEJ A;  5AFM A;  2BG9 B;  4HFE A;  2VL0 A;  2XQ8 A;  3JAD A;  4COF A;  2Y56 A;  4LMK A;  3TLW A;  4X5T A;  5HEG A;  2BYS A;  5J5H A;  3GUA A;  2PGZ A;  2XQ3 A;  4NZB A;  2BG9 C;  4AFH A;  3C84 A;  2Y57 A;  2ZJU A;  2Y54 A;  4HFC A;  4HFI A;  2WNC A;  1UW6 A;  4LML A;  5LG3 A;  2XQA A;  2XQ5 A;  4HFH A;  3UU5 A;  2WN9 A;  2XZ5 A;  5BRX A;  4QH4 A;  5CO5 A;  4ALX A;  5HEO A;  5AFJ A;  3UU6 A;  5J0Z A;  3UU4 A;  4HFD A;  5TVC A;  5AFH A;  3RIA A;  4F8H A;  5AIN A;  2XYT A;  4PIR A;  2W8F A;  3C79 A;  5SYO A;  5AFL A;  3RHW A;  5L4H A;  3WTK A;  3TLU A;  3UU8 A;  2WNL A;  2XQ6 A;  5FJV A;  3U8J A;  2XYS A;  4A97 A;  5HCM A;  1I9B A;  4HFB A;  1UV6 A;  4XHE A;  2XQ7 A;  5CFB A;  2KSR A;  4TNW A;  2UZ6 A;  4QAA A;  2BG9 E;  4ZK4 A;  2LLY A;  4QH5 A;  4UXU A;  2YKS A;  4TWF A;  3UQ7 A;  3UQ4 A;  3SIO A;  4TWH A;  3UUB A;  3P4W A;  4NPP A;  2LKH A;  3IGQ A;  4QH1 A;  2WZY A;  2YMD A;  2BYQ A;  5AFK A;  4D01 A;  5JME A;  4WV9 A;  3WTM A;  5LXB A;  4UM1 A;  3UU3 A;  2Y7Y A;  2C9T A;  2YME A;  2YOE A;  4A98 A;  4ZK1 A;  3WTL A;  3TLV A;  4UM3 S;  3EAM A;  3EI0 A;  3PEO A;  3U8M A; 
#chains in the Genus database with same CATH topology
 5L47 A;  3AE1 A;  3A5X A;  2IC6 A;  4P0A A;  5LNK A;  3PMZ A;  3L09 A;  4EYY R;  2ODU A;  1BR2 A;  2HPJ A;  1WFD A;  1NEN A;  5FVL A;  1XMQ T;  2XUE A;  4ZJT A;  5LCY A;  4C91 A;  2WQY A;  3ANW A;  4MFR A;  2WS3 A;  2MBG A;  3CVR A;  2WBL A;  3PUV F;  3EDU A;  1BR0 A;  4BA9 A;  1IJ5 A;  2V6Y B;  5H6R B;  5HCJ A;  2MAW A;  2XQ4 A;  3H3M A;  4O4I E;  3PJA A;  3C64 A;  5HEJ A;  2XAF B;  5L2L A;  1YQ3 A;  4EAH A;  3PDY A;  4WZX A;  1EZ3 A;  3SWH A;  1MIV A;  2V26 A;  3P4R A;  2FUP A;  4JLE A;  5HEO A;  3R6N A;  4EIW A;  4F8H A;  2CE7 A;  4PIR A;  5JQG E;  5HXE A;  4OFZ A;  3T8O A;  4LFA T;  3Q9D A;  2WNL A;  3ZCJ A;  3ZLI A;  5LHI B;  4X1K E;  4IDQ A;  4LF6 T;  5AQT B;  2YEV C;  3P7I A;  4QH1 A;  3QNU A;  2JIW A;  2DI4 A;  3L3P A;  1X9B A;  4UM1 A;  2YME A;  2L9Q A;  1BR1 A;  2WM9 A;  4I43 B;  5EK2 A;  3LFM A;  4JI2 T;  2J1D G;  2ES0 A;  4IE7 A;  3JC6 D;  3N2G E;  4MHC A;  4X20 E;  4XBF B;  4KX6 A;  4A56 A;  5J5G A;  2E8I A;  1OED C;  3O9X A;  3N2O A;  3ETU A;  4YTN A;  1OED A;  4WNK A;  5CA0 E;  2UXC T;  1UUR A;  4BQT A;  2C5J A;  2V6Y A;  3U78 A;  4XAX B;  4UVB B;  3NRX A;  3P50 A;  2WMO A;  4GIW A;  5LYJ E;  3ZMT B;  3J7Y q;  2BKN A;  3A7M A;  4GK0 E;  3RYH E;  1VCT A;  2QYW A;  3O1I A;  4X1I E;  2BG9 C;  4OK0 A;  1HNZ T;  4OYK A;  2W61 A;  4LML A;  4CN1 A;  4DVD A;  5AIN A;  3ZMV B;  2E5V A;  4WW0 A;  3UT5 E;  2LHR A;  1N36 T;  4IE4 A;  4A97 A;  5HCM A;  1UV6 A;  4QAA A;  2BG9 E;  1R8I A;  3C4Z A;  4DO0 A;  2YKS A;  4TWH A;  3PUX F;  2K3W A;  3AA0 B;  3K8P C;  4A5X A;  3RKO A;  2LSK A;  4QWN B;  2C9T A;  3EAM A;  3N9P A;  2BVM A;  5JR9 C;  5IHY A;  4GKK T;  2DNX A;  5DQW A;  2W67 A;  3CWZ B;  3JAE A;  4JUY A;  1O3X A;  4JI7 T;  3Q5D A;  5FL0 A;  5AQJ B;  4DMV A;  2ACZ A;  3FZF B;  5L3C B;  1KNP A;  5AQS B;  3SH1 A;  1FMV A;  2Q9Q C;  4WYV A;  4WBO A;  5KMG P;  2IAK A;  5FYM A;  2CXF A;  1LKX A;  3TLS A;  1S94 A;  4AIU A;  2V6X A;  3T4M A;  4ILA A;  3AEE A;  3I9W A;  3LSV A;  5HWY A;  5LB7 B;  5IYZ E;  4KBM B;  4KP3 C;  1FJG T;  2LM2 A;  1HF8 A;  1NEK A;  4NIQ A;  4AQG A;  4O2B E;  3OBV E;  1YW0 A;  3L39 A;  1UCU A;  5ETW A;  3D0T A;  1IZN B;  1ZOY A;  4HFD A;  5BMV E;  3ZST A;  1FIO A;  4ZI7 E;  5M4Y A;  2XYT A;  1T8B A;  2XAS B;  3RYI E;  5IWA T;  4PK5 A;  2UZ6 A;  3C98 B;  2E9X C;  4TZ4 C;  3HKB E;  2V7M A;  3AXJ A;  5HXH A;  4AKH A;  5CB4 E;  2LOS A;  4DUZ T;  1SE7 A;  2Y7Y A;  5FXX A;  2YOE A;  2XAH B;  2D2S A;  5AQM B;  3PEO A;  3M65 A;  4AFG A;  3ZDG A;  3KVB A;  2LSG A;  3N9M A;  4U33 A;  2IML A;  4IDN A;  2KMF A;  4NUU A;  3RQU A;  5AQG B;  2NTX A;  2B1E A;  2ZM8 A;  2BG9 A;  5ADX L;  2V7J A;  1G73 A;  4IGU A;  3GMI A;  4YJ2 E;  1YQ4 A;  3WTI A;  3FZK B;  2KWH A;  1MMA A;  4LFC T;  4ZI2 C;  4LMJ A;  4UF0 B;  3N5L A;  5L3F B;  2NP9 A;  2X0L B;  3AA1 B;  3ZYK A;  2W63 A;  1U5P A;  3OPC A;  2BS4 A;  4AKI A;  3MA9 A;  2JJ9 A;  4AFH A;  2ZMA A;  4L9I A;  5JDQ A;  1UW6 A;  4PJM A;  4HWH A;  3WAK A;  2N2N A;  3VRB A;  3UU6 A;  2D0T A;  2XTL A;  3UTK A;  2VQF T;  1D1B A;  2ZLY A;  1DU2 A;  4AKL A;  4O4L E;  3AB3 B;  4UXU A;  4TWF A;  3SS1 A;  1NWM X;  4CN6 A;  2WDV A;  4NPP A;  2WP9 A;  4H9Q C;  5AQF B;  4X1Y E;  2BYQ A;  2NTY A;  4AKG A;  3HKC E;  1I6Z A;  5C3J A;  3T1Y T;  5FP3 A;  4BJN A;  3K3N A;  4LF4 T;  4IDZ A;  3EI0 A;  2JMK A;  4I50 E;  1MMN A;  3CKD A;  4IST A;  4TWD A;  1WYC A;  2XAG B;  2XQY A;  3WTO A;  1UGO A;  5JR9 B;  2YDS A;  5AQI B;  2WWV A;  2BYP A;  4MBQ A;  2E9X B;  4DR2 T;  3ZDH A;  4AFT A;  1KEY A;  3C50 A;  4F6R C;  2WDR A;  3AA6 B;  4IE5 A;  4DBM A;  3KV6 A;  2F4V T;  1UX4 A;  5J5I A;  3AVR A;  4ZR6 A;  2DWG A;  2R6G F;  5F3J A;  3PUG A;  4HFE A;  2XY8 B;  2Y6X A;  3NZP A;  1XNQ T;  4ILU A;  3SOL A;  2E2A A;  5J5H A;  3RF1 A;  4TN7 B;  2VL8 A;  4H63 H;  2EHO A;  5LG3 A;  5H6Q B;  1IBK T;  3B13 A;  5AFJ A;  3I9Y A;  4L5G A;  3HA4 A;  4UV9 B;  4DR1 T;  3JC6 C;  1MMG A;  2CM0 A;  1FMW A;  5HWX A;  4JI1 T;  1FEW A;  4U31 A;  3TLU A;  3U8J A;  3P4P A;  4HFB A;  5FVK A;  5KXJ A;  3N9L A;  3SIO A;  4O8S A;  2LKH A;  4X64 T;  1UK5 A;  4B3S T;  2ACX A;  2XPK A;  2IIU A;  4HE8 A;  2LT3 A;  1LVF A;  3K3O A;  3DJB A;  4QAB A;  2DWK A;  4BJM A;  3RGL A;  2WMN A;  3M3Z B;  1J1J A;  4GKJ T;  3ZN1 B;  2H88 A;  2CWO A;  2X9W A;  3AAE B;  1W0B A;  2DLR A;  2WAU A;  2W8G A;  3AEF A;  2EHO D;  2MOZ A;  5JTG A;  3AAA B;  4O4H E;  2VKH A;  3CX7 B;  3UFG A;  3G06 A;  1U4Q A;  3I0O A;  3LG7 A;  2QGS A;  3ANW B;  3A8Y C;  1Z0P A;  5DQV A;  5AFM A;  2NOX A;  4AI6 A;  2ODV A;  2IW5 B;  5HEG A;  4B6X A;  2FJD A;  5L3D B;  2LSY A;  5JDG A;  2XAQ B;  2XQ5 A;  1MMD A;  2FJB A;  5GON E;  1MIW A;  5TAO A;  4DV0 T;  2W8F A;  3ZT6 A;  3LBX A;  5FY1 A;  2I0M A;  2J4G A;  3N9N A;  4AQY T;  4LF5 T;  2IUB A;  3AXJ B;  2B76 A;  3ONJ A;  4O4J E;  2LJL A;  4HKA A;  2CHN A;  3AED A;  3C51 A;  3PUQ A;  3RIU A;  5AQL B;  5LXB A;  4JBW F;  3OVU A;  1HCI A;  3WTL A;  3QC9 A;  3RH3 A;  2A72 A;  3T1H T;  5L3B B;  3GN5 B;  2YN6 A;  2WNJ A;  5JDL A;  4GYS A;  5JDM A;  3L8R A;  3AE9 A;  4EZ1 A;  1QLB A;  4B3M T;  2XNU A;  5JVD E;  4EEB A;  4AQF A;  4I0U A;  3ZYL A;  3ZCI A;  3RI5 A;  2V7K A;  4DV3 T;  2V7L A;  4H63 V;  2Y58 A;  2D0U A;  2D9D A;  4YY3 T;  2VVN A;  5FNV E;  5AQN B;  4YSZ A;  3CML A;  1ZKE A;  3GUA A;  3H3A A;  3PTR B;  5L3G B;  3ZSS A;  1UX5 A;  2UXN B;  2LOP A;  3DTO A;  2XQA A;  1KFY A;  3ZJ2 A;  2BKO A;  5AFH A;  4HWF A;  5AFL A;  2W66 A;  3RHW A;  3AE4 A;  3ZN0 B;  3MJX A;  2C5I T;  2N1G A;  3UUM A;  5A1L A;  3PJA J;  3ZMS B;  4TX5 A;  2CPT A;  3F57 A;  2X9H A;  5LP6 E;  5JRC A;  4PAG A;  2J62 A;  3ESL A;  3OYZ A;  4DV6 T;  4ANJ A;  4LF8 T;  4IDO A;  3WI3 A;  2K48 A;  4CI1 B;  3ZMU B;  1H7C A;  4U3C A;  3UUX B;  5L4E A;  3NKZ A;  4ZS2 A;  2HH7 A;  4YFS A;  3ETV A;  3QOF A;  5KX5 E;  5AFN A;  3R84 B;  3U8K A;  3WIP A;  2BJ0 A;  2Y48 B;  3PUW F;  1ZP0 A;  2KT9 A;  2YK0 A;  2XZ6 A;  4CI3 B;  5FXW A;  2LSI A;  3IA3 A;  3CPZ A;  3TLW A;  4KUM B;  3RKG A;  4IDP A;  2XAJ B;  4HEA A;  2JQQ A;  2PFV A;  5JDH A;  3MAC A;  4DV5 T;  3KVA A;  5JR9 A;  4QH4 A;  3O1H A;  1HS7 A;  4AKR B;  4EOZ B;  1IBL T;  4H9N C;  3V5U A;  1AJ3 A;  4TNW A;  3X1D A;  4N78 D;  4ZI2 D;  3K1S A;  5AFU L;  2LRL A;  2DCF A;  2HN1 A;  4P0B A;  3H37 A;  2UXX B;  4HTE A;  5ABH A;  2YU2 A;  4J2C A;  3IBP A;  4CZZ B;  4E7S A;  2CMR A;  3PUS A;  4UEL A;  5C2T A;  4YTP A;  4XK9 A;  4U2Z A;  3AEA A;  4YSY A;  2BS3 A;  1HX8 A;  2C0S A;  4NXN T;  5F8P A;  3KV4 A;  3ABV A;  4ILC A;  5AFM B;  5LJM A;  3RC3 A;  2XM2 A;  4UVA B;  3ZPO A;  5JDN A;  1T72 A;  3PE0 A;  3EVY A;  3FBL A;  3RPU A;  2X9Y A;  2NW9 A;  4KHP T;  3WTH A;  3AA7 B;  4JI5 T;  3BQI A;  3FB2 A;  3RLF F;  3RIF A;  5HEU A;  1OED B;  1N32 T;  2BZB A;  3SQ9 A;  4DID B;  3WTN A;  2LKG A;  4QHO A;  4AQF C;  2BR7 A;  2X00 A;  4E7Z A;  5FMN A;  4DR6 T;  2NWB A;  3BQK A;  3Q5E A;  4COF A;  2M67 A;  3TKL B;  5J2T E;  3RYC E;  4EZ4 A;  3C4W A;  3ONX A;  3EDV A;  1XDP A;  3AEB A;  3VU7 H;  2X0H A;  5J1G A;  4ZI3 C;  2X67 A;  4PFP A;  2DHR A;  3UU4 A;  3ZT5 A;  5JDF A;  4H9P C;  2VAS A;  4ADZ A;  5AQR B;  1LRZ A;  3ZEF B;  2BVL A;  2V5C A;  4XHE A;  5FXV A;  2LLY A;  1J5W A;  1HTJ F;  4DR4 T;  3O1J A;  1IBM T;  1W9R A;  1KNZ A;  2D5U A;  2V7I A;  3UFE A;  4YHJ A;  2VKO A;  2JQ9 A;  2NW7 A;  2WU2 A;  2KND A;  4DBQ A;  3FBZ A;  4KHZ F;  5E0O A;  5LOV E;  2X0Y A;  2UUB T;  2VKJ A;  4HQP A;  1YXR A;  5HXR A;  5KE4 A;  3CIR A;  4JEU B;  1XNR T;  2KIN B;  4QAC A;  3VR8 A;  2JPF A;  4B5D A;  3HKE E;  5ABF A;  1KF6 A;  3PUA A;  3HI2 A;  4EED A;  4ILB A;  2M6I A;  4UM3 A;  2DL1 A;  2L3L A;  4UXN B;  4ZRU A;  4G63 A;  2W62 A;  4U2Y A;  4UVC B;  2OLT A;  3SQ6 A;  4IL4 A;  3VKH A;  4BAY B;  4KI0 F;  4QXC B;  4YT0 A;  5KZU A;  2BG9 B;  2XQ8 A;  5LBM A;  2H89 A;  2FJE A;  2Y56 A;  4I55 E;  3CQG B;  2HN2 A;  1MNE A;  4CXX A;  4NZB A;  3C84 A;  3CQC B;  3OYX A;  2W0G A;  3AAI A;  1D1C A;  5DJQ C;  4WBN E;  4DND A;  4DBR A;  2PG8 A;  1WLX A;  2XYS A;  2X9X A;  3IEE A;  1D1A A;  3N2K E;  2WWU A;  3J9X 1;  3K3Q C;  3UQ4 A;  1UUS A;  2OV9 A;  4P1N A;  4AXP A;  1X79 A;  3Q2M A;  4YSX A;  3WTM A;  5LMU T;  4PJN A;  3ZC1 A;  4IE6 A;  3RRC A;  4H9R C;  3NBX X;  2ZM2 A;  1SA0 E;  1Y64 B;  2VWA A;  2X51 A;  2QC1 B;  4CQI A;  3KDS E;  4B3R T;  2KZ7 B;  1Z8U A;  2XQ9 A;  1UX2 A;  4BFQ A;  4HWI B;  4ZJS A;  2JQK A;  2RA1 A;  2W00 A;  4UEM A;  5CJ5 A;  1IJ6 A;  4UM3 P;  4DMW A;  3EUH A;  4ZXL A;  4ASK A;  5HYA A;  5HXC A;  4JEH B;  4K0K T;  4AIS A;  3EHZ A;  3U8L A;  2PH9 A;  1XDO A;  5AQK B;  2IDO B;  2V1D B;  5ABF B;  1BR4 A;  3QUJ A;  2KXP B;  2WSS V;  3Q5X A;  2XQ3 A;  2Y57 A;  2ZJU A;  1HG2 A;  1JNR A;  4HGA A;  4HFH A;  2G0U A;  4MAL A;  2XZ5 A;  4LF7 T;  5BRX A;  3E0Z A;  2LE8 A;  2LRK A;  5J0Z A;  1Y01 A;  2K5B B;  4FI5 A;  5EK3 A;  3PU8 A;  4EZH A;  2FJA A;  5FJV A;  3KIN B;  3KV5 A;  2BBJ A;  4IE0 A;  3FZL B;  4ZOL E;  1ZEE A;  1WRD A;  3IGQ A;  5AQH B;  2Q9Q D;  4CI2 B;  3SRZ A;  2V5D A;  4ZK1 A;  1QSD A;  3PUR A;  3W15 B;  3GA8 A;  3OTO T;  4P09 A;  3FHN A;  2CCQ A;  3LBX B;  4OYJ A;  4QX7 B;  2CLY B;  1E2A A;  3O4X E;  2VKD A;  3LK4 2;  5FY7 A;  2CWY A;  5J2U E;  4X62 T;  3IHR A;  2GK9 A;  5IUX A;  2K24 A;  2I59 A;  5FY0 A;  4JYA T;  2LM9 A;  4IRE A;  4ZZC A;  4TV8 E;  5BP0 A;  4UV8 B;  2CXD A;  2BYR A;  4JI6 T;  2AXD S;  3N9O A;  3LK2 B;  1VRB A;  3TLT A;  2VL0 A;  5LGU B;  5AQQ B;  4MLK A;  3AE2 A;  1YKE B;  1WCR A;  3CK6 A;  4Z8X A;  5LA6 E;  1HR0 T;  1E1H B;  2Y54 A;  3CX6 B;  4QXH B;  4PK4 A;  4PNI A;  1OXZ A;  1WR0 A;  4YTM A;  2WY2 A;  4JV5 T;  3ZMZ B;  2WN9 A;  2W2U A;  2LHN A;  4CXY A;  4UR9 A;  4QXB B;  4ALX A;  3C4X A;  2XZE A;  3RIA A;  5LXT E;  3VR9 A;  5HXS A;  2UUC T;  2N9D A;  2A3D A;  2P9B A;  1HG5 A;  5L4H A;  1T98 A;  2MTQ A;  1I9B A;  5ABE A;  3WAJ A;  1D0Z A;  3AE3 A;  3NWI A;  3BK9 A;  3UUN A;  4EB6 E;  3OKQ A;  4GK5 E;  3AE7 A;  4CN4 A;  2WZI A;  4IT4 A;  4X65 T;  4QX8 B;  3HR0 A;  2CXL A;  2J47 A;  3U8N A;  4U72 A;  2EHO B;  3U3I A;  1T7S A;  3MZK B;  5KDM C;  4DR5 T;  5J5F A;  3E08 A;  1XMO T;  2JMH A;  5JH7 E;  5LG4 A;  2CRB A;  2XJ7 A;  3FZM B;  2ZM6 T;  3CQX C;  4FRR A;  3AVS A;  4TV9 E;  2UXB T;  2ZM0 A;  5C8Y E;  4U74 A;  4DUY T;  3EAB A;  2WCA A;  2PJQ A;  3JAF A;  4O2A E;  5CA1 E;  4ZHQ E;  4Z91 A;  1KNR A;  4EGW A;  1J5E T;  3MKD A;  2E9X A;  2YIN A;  3B5M A;  4EYU A;  2BKP A;  4PJJ A;  4H9S E;  4I4T E;  2XM1 A;  4DR7 T;  2UXD T;  5LGT B;  4HFI A;  3BQL A;  3VRA A;  3KFW X;  2X68 A;  3UU5 A;  1ZV4 X;  3HKD E;  5TVC A;  4HWC A;  4IIJ E;  2IC9 A;  3C79 A;  1YD8 G;  1M7K A;  2X66 A;  2C5K T;  3WTK A;  3QB5 K;  5CFB A;  2NR4 A;  4JI0 T;  3I1A A;  3SFD A;  4PJL A;  4DV7 T;  3IF8 B;  3ZJ1 A;  4XZC A;  5AFK A;  5JME A;  1WYB A;  1XZY A;  3RYF E;  1US7 B;  3TLV A;  5DAB A;  3FXD B;  3V5S A;  4OX9 T;  2BR8 A;  5HEH A;  2CHO A;  2KWI B;  2FBW A;  2CLY C;  3B57 A;  2XSB A;  4TNV A;  1IAP A;  2LEH A;  2XHE B;  4V1A v;  3KV9 A;  4UIG A;  3KBT A;  3PUY F;  1OWA A;  4IL9 A;  3NVO A;  4U7I A;  4Z90 A;  4ZS3 A;  2CBI A;  4L0R A;  3FXE B;  3AEC A;  1G8X A;  2IHR 1;  2HHH T;  4NUV A;  5HAX A;  2NW8 A;  2E9X D;  2BDE A;  4C90 A;  3ZKR A;  5L3E B;  4GOU A;  2H3R A;  3JAD A;  5FXZ A;  5LGN B;  2BYS A;  4B3T T;  4TUY E;  3P8C D;  2WNC A;  2JQH A;  2CEA A;  2L8K A;  5LHG B;  4X66 T;  3CX8 B;  5AQP B;  5JRE A;  3LDQ B;  5LBQ B;  4G2A A;  5F5W A;  2RPA A;  2OA5 A;  2W4X A;  3FZH B;  4EV6 A;  4NXM T;  5LJN A;  2VB6 A;  2XQ6 A;  2YU1 A;  2UU9 T;  2PBI A;  4ZK4 A;  3PUZ F;  4Q25 A;  3UQ7 A;  1VCS A;  3UUB A;  1V9D A;  4ISS A;  3RRW A;  3E22 E;  2WZY A;  2BBH A;  4D01 A;  4GYR A;  3QB5 A;  4A98 A;  3I0Q A;  4UM3 S;  4HWD A;  2VK9 A;  3U8M A;  4ERR A;  2Q9Q A;  4H9O C;  4K0U A;  2MPK A;  1SUM B;  1N34 T;  2VUR A;  4YXD A;  4LFB T;  3ZC0 A;  1E7P A;  2KLQ A;  3LJC A;  2Z6E A;  1ZHC A;  2X00 D;  1GQE A;  4UF0 A;  4PW8 A;  4FJO A;  1LVK A;  2WU5 A;  4LF9 T;  1CUN A;  1JNZ A;  4JI8 T;  3DP7 A;  2XNT A;  3F2E A;  5ABG A;  2PTF A;  3OJA A;  5FL1 A;  1L0V A;  4ZZB A;  5CGM A;  5BW2 A;  5EK4 A;  3UUL A;  4LMK A;  2UUA T;  3GN5 A;  2PGZ A;  4JI3 T;  4OHF A;  4HFC A;  2BS2 A;  1SHZ C;  5LHH B;  1QUU A;  1YKH B;  2A2F X;  3GWH A;  5CO5 A;  4HFV A;  3NRY A;  3S4U A;  5JRC B;  3VHL A;  2JRK A;  4DV4 T;  2CA5 A;  2Q9Q B;  3AE8 A;  3RIU C;  3RX6 A;  1B7T A;  2KSR A;  3MK7 C;  2Y8D A;  3Q5W A;  3P4W A;  2AE9 A;  3P4S A;  4WV9 A;  3UU3 A;  4DV2 T;  3ZYM A;  2HPL A;  5AQU B;  4PK6 A;  2WZH A;  1D0X A;  4EXT A;  1KK7 A;  1WR6 A;  1HX1 B;  2ZJV A;  3RQW A;  4QKN A;  4YLH A;  3HL6 A;  4DV1 T;  1OED E;  4M1P A;  3RC8 A;  2M6B A;  3LK3 B;  5FKY A;  4UY2 A;  2XNV A;  1MIY A;  4HN9 A;  3AE6 A;  3AEG A;  2BYN A;  1S35 A;  1XWM A;  4DR3 T;  2A9U A;  4JI4 T;  3ZT7 A;  2VVS A;  3NZQ A;  1VOM A;  2H7O A;  2K9A A;  2XSA A;  2WDQ A;  3WTJ A;  1N33 T;  1D0Y A;  2QRX A;  4U7Y A;  2WB5 A;  1HFA A;  3PU3 A;  1W09 A;  1MND A;  2QVA A;  2SPC A;  3ONL C;  3MXZ A;  4CXW A;  5BR8 T;  3VKG A;  4X5T A;  3N9Q A;  3SFE A;  2YDR A;  5EZY E;  4IHJ E;  4ZI3 D;  3PV0 F;  2V8S V;  3JCF A;  1HNX T;  2QA7 A;  3F31 A;  3AE5 A;  1W0A A;  1NAF A;  2VQE T;  2LSJ A;  2MYS A;  5SYO A;  1I94 T;  3KBU A;  2I6H A;  2E5L T;  4PFO A;  3UU8 A;  2EHO C;  5AQV B;  1HNW T;  2XQ7 A;  2CBJ A;  3QK6 A;  1CHU A;  1M62 A;  2YDQ A;  4QH5 A;  4YHH T;  2H7V C;  4ZEY A;  3P4Q A;  2YMD A;  2RP4 A;  5LMN T;  5AQO B;  4KMC A;  4YJ3 E; 
#chains in the Genus database with same CATH homology
 2BR8 A;  5L47 A;  4AFG A;  5HEH A;  3ZDG A;  3U8N A;  4XK9 A;  4TWD A;  2ZJV A;  3JAE A;  4QAB A;  3PMZ A;  3RQW A;  2QC1 B;  4HQP A;  3WTO A;  1OED E;  5KE4 A;  2XQ9 A;  2YN6 A;  1UX2 A;  2M6B A;  3RQU A;  5J5F A;  2WNJ A;  3SH1 A;  5L4E A;  4UY2 A;  2XNV A;  4ZJS A;  4BFQ A;  4ILC A;  2BYP A;  2BG9 A;  4TNV A;  5IUX A;  2X00 D;  4ZJT A;  5AFM B;  2W8G A;  4QAC A;  5J5G A;  3ZDH A;  4AFT A;  2BYN A;  4EZ1 A;  1OED C;  4B5D A;  4UM3 P;  4FRR A;  5AFN A;  4ILB A;  2XNU A;  2M6I A;  4UM3 A;  3WTH A;  4IL9 A;  3WTI A;  4IRE A;  1OED A;  5HCJ A;  3TLS A;  3U8K A;  2XNT A;  2MAW A;  2XQ4 A;  4Z90 A;  3WIP A;  2BJ0 A;  4ZZC A;  4BQT A;  4ZRU A;  3T4M A;  3RIF A;  5HEU A;  3WTJ A;  4ILA A;  1OED B;  3RI5 A;  4DBM A;  3SQ6 A;  4IL4 A;  5BP0 A;  3SQ9 A;  3WTN A;  3LSV A;  4ZZB A;  3JAF A;  2BYR A;  3P50 A;  2LKG A;  5BW2 A;  5J5I A;  4LMJ A;  3EHZ A;  4Z91 A;  2BR7 A;  2XZ6 A;  2Y58 A;  3ZKR A;  2PH9 A;  3TLT A;  2X00 A;  4ZR6 A;  3U8L A;  5KZU A;  2LM2 A;  5HEJ A;  5AFM A;  2BG9 B;  4HFE A;  2VL0 A;  2XQ8 A;  3JAD A;  4COF A;  2Y56 A;  4LMK A;  3TLW A;  4X5T A;  5HEG A;  2BYS A;  5J5H A;  3GUA A;  2PGZ A;  2XQ3 A;  4NZB A;  2BG9 C;  4AFH A;  3C84 A;  2Y57 A;  2ZJU A;  2Y54 A;  4HFC A;  4HFI A;  2WNC A;  1UW6 A;  4LML A;  5LG3 A;  2XQA A;  2XQ5 A;  4HFH A;  3UU5 A;  2WN9 A;  2XZ5 A;  5BRX A;  4QH4 A;  5CO5 A;  4ALX A;  5HEO A;  5AFJ A;  3UU6 A;  5J0Z A;  3UU4 A;  4HFD A;  5TVC A;  5AFH A;  3RIA A;  4F8H A;  5AIN A;  2XYT A;  4PIR A;  2W8F A;  3C79 A;  5SYO A;  5AFL A;  3RHW A;  5L4H A;  3WTK A;  3TLU A;  3UU8 A;  2WNL A;  2XQ6 A;  5FJV A;  3U8J A;  2XYS A;  4A97 A;  5HCM A;  1I9B A;  4HFB A;  1UV6 A;  4XHE A;  2XQ7 A;  5CFB A;  2KSR A;  4TNW A;  2UZ6 A;  4QAA A;  2BG9 E;  4ZK4 A;  2LLY A;  4QH5 A;  4UXU A;  2YKS A;  4TWF A;  3UQ7 A;  3UQ4 A;  3SIO A;  4TWH A;  3UUB A;  3P4W A;  4NPP A;  2LKH A;  3IGQ A;  4QH1 A;  2WZY A;  2YMD A;  2BYQ A;  5AFK A;  4D01 A;  5JME A;  4WV9 A;  3WTM A;  5LXB A;  4UM1 A;  3UU3 A;  2Y7Y A;  2C9T A;  2YME A;  2YOE A;  4A98 A;  4ZK1 A;  3WTL A;  3TLV A;  4UM3 S;  3EAM A;  3EI0 A;  3PEO A;  3U8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...