3TLWA

The glic pentameric ligand-gated ion channel loop2-21' oxidized mutant in a locally-closed conformation (lc2 subtype)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETCLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 92
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3tlwA02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3tlwA01
5AFMA 4IL4A 2BG9E 4UXUA 2XQ7A 3UU6A 4IREA 4Z91A 4UM3S 5J5IA 4WV9A 2W8FA 2WNJA 4LMJA 2LKHA 4HFCA 3P50A 3JAFA 1UW6A 5AFJA 4ZJTA 2YMEA 2BJ0A 3ZDHA 4BFQA 4TWDA 4F8HA 5AFLA 3U8KA 1OEDB 3WTMA 5KE4A 3TLWA 2WNLA 1OEDC 2X00A 4IL9A 2Y57A 3SQ6A 2Y58A 2BG9A 2WN9A 3EI0A 4TWFA 3EAMA 2X00D 4AFHA 4ZZCA 2C9TA 3EHZA 3SH1A 2KSRA 3C79A 4NZBA 4ZR6A 4B5DA 2XNTA 3WTOA 5AFKA 3TLTA 2LLYA 1I9BA 2XYTA 2XZ5A 2M6BA 2Y56A 5HEGA 3UU3A 2MAWA 5AFHA 4UM3A 4Z90A 2BYQA 4ILCA 5TVCA 4QH1A 3WTLA 2XYSA 4TNVA 2XQAA 2UZ6A 2ZJVA 2XQ4A 4NPPA 4HFBA 3GUAA 2BYPA 4QABA 5SYOA 3U8NA 4ZK4A 5CO5A 4HFDA 3RQWA 2PH9A 4D01A 2BYNA 4HFHA 3T4MA 5HEHA 5CFBA 2BG9B 2M6IA 3P4WA 2YOEA 3UU8A 4COFA 3IGQA 3PMZA 4HQPA 2BG9C 4QAAA 4ALXA 2QC1B 3LSVA 4A98A 3UU5A 1UV6A 5J5HA 5L47A 4QACA 2WZYA 3WTNA 4UY2A 4X5TA 5IUXA 4LMLA 4TWHA 4UM3P 5KZUA 3WTKA 2XQ8A 4ILAA 3UQ4A 5AFMB 2XQ5A 3UQ7A 4ILBA 3ZKRA 5BP0A 3RQUA 4A97A 5BW2A 2XQ6A 5FJVA 4BQTA 5J5GA 3UUBA 5AFNA 4HFIA 4TNWA 3RIAA 5J0ZA 2BR8A 3TLVA 3C84A 4PIRA 2XQ9A 2VL0A 2XQ3A 5LG3A 2YMDA 2YKSA 3U8LA 3JADA 2BYRA 2XNVA 3WTJA 4ZK1A 1UX2A 3RIFA 3ZDGA 5LXBA 5J5FA 4QH5A 5JMEA 2LKGA 2Y54A 4LMKA 3TLUA 4FRRA 5HEJA 2Y7YA 3UU4A 2BR7A 4ZJSA 3PEOA 4AFGA 1OEDA 2BYSA 4EZ1A 4DBMA 2W8GA 4QH4A 4ZRUA 4AFTA 5HCJA 5BRXA 5HEUA 2XNUA 5AINA 5HEOA 3RI5A 3SQ9A 2LM2A 5L4HA 3JAEA 3U8MA 2YN6A 4XHEA 5HCMA 1OEDE 4UM1A 4HFEA 2XZ6A 2WNCA 3WTIA 3U8JA 2PGZA 3TLSA 3SIOA 3WIPA 4ZZBA 3RHWA 3WTHA 4XK9A 2ZJUA 5L4EA
chains in the Genus database with same CATH superfamily
2XSBA 2BG9E 2J4GA 5AQUB 3C50A 2W8FA 2QYWA 4EXTA 4O2AE 4CXXA 3AA1B 3JAFA 3RLFF 3ZDHA 2ZM0A 5KE4A 3E0ZA 2MTQA 5JR9B 4DR5T 1UX4A 5AQSB 3UTKA 2B1EA 4DV1T 3C79A 3EVYA 4YHJA 5JDGA 3ZSTA 3UU3A 2UU9T 4DO0A 1WYBA 3GUAA 3ZMVB 5HXSA 2H7VC 3QB5K 5L3EB 3I9YA 4ZI7E 1KNRA 1S35A 4HFVA 2BG9B 2CBIA 5AQJB 2UUAT 5FXVA 3O1HA 4P0AA 3DTOA 3HKCE 3RYIE 2ODUA 1YQ3A 4YFSA 3OYZA 3U8LA 2PFVA 3IF8B 3CIRA 3MA9A 3AEFA 1E2AA 2LM9A 4JI4T 5JR9A 4GKJT 5BRXA 2JQKA 4P1NA 5AFUL 2CWOA 1IAPA 4X20E 5KDMC 2IIUA 3U78A 2KT9A 2X0HA 4PJNA 3GMIA 4YJ3E 3EUHA 3N9MA 2LKHA 5FL0A 4DUYT 3CMLA 4QWNB 2W61A 2BKOA 1HTJF 2OV9A 3RF1A 4DBRA 4Q25A 2BG9A 4E7SA 4ASKA 5BR8T 3P4PA 3JC6D 5L3DB 1HR0T 1ZKEA 3NKZA 5AQVB 4DUZT 4GIWA 4TNVA 2H3RA 2D2SA 4HFBA 5HXRA 3VKGA 1G73A 5DQVA 3V5UA 3ONJA 3AE2A 5LGTB 3CVRA 3DP7A 3CQGB 1I6ZA 3ZJ1A 4JUYA 3WTNA 2NW8A 1MMDA 4JEUB 5J0ZA 3PURA 4AIUA 5LA6E 4FI5A 5FL1A 2LEHA 5HXCA 2CHNA 3MACA 3ONLC 4ZJSA 4EEBA 3HKDE 3HA4A 4O2BE 5GONE 3KBUA 4QKNA 3C51A 1N34T 4JI6T 2WZIA 2UUBT 3C98B 2W00A 1UX5A 1M7KA 4XHEA 2HHHT 5HXHA 2IW5B 3SIOA 2KMFA 2LOPA 5L4EA 2WNJA 1FJGT 4WNKA 4YSXA 3U8KA 3VHLA 4G2AA 1OEDC 2C5JA 2IAKA 4O8SA 4KHZF 3F57A 3MZKB 2Y48B 2WMOA 4DV7T 3QOFA 2J1DG 5AFKA 3TLTA 2LLYA 3AEBA 1D0XA 2L8KA 3FZFB 2MOZA 4H63H 3WTLA 5ABHA 5DJQC 4JV5T 2CLYC 3IHRA 3O1IA 4ZK4A 2E5VA 2X9YA 4IDQA 3N9PA 4EEDA 4WBNE 1S94A 3PTRB 3RC3A 2AE9A 3GN5B 2HPLA 2X9XA 3ZMSB 5LXTE 2IC6A 2N2NA 1VCTA 4MFRA 4JI7T 3AE5A 1J5WA 4H9OC 1J1JA 3VRBA 3UQ7A 2UXNB 4EZHA 3O1JA 5AFNA 3Q2MA 2E9XC 1XDPA 3ZYMA 2VVNA 4DR4T 2CMRA 4DR2T 1HNWT 2K48A 4QH5A 5JMEA 2YU1A 4XZCA 4AFGA 2LE8A 4ZRUA 2C5KT 2BVLA 5LJMA 2V26A 2ZMAA 3AE1A 3JAEA 1US7B 4JI8T 2XZ6A 2XY8B 4MALA 3WIPA 3WTHA 4DBQA 3LDQB 5AFMA 2K24A 3F31A 5AQGB 2WU2A 3VRAA 1MNDA 3U3IA 1WYCA 5L2LA 1OEDB 1ZP0A 3AE9A 2EHOC 3GN5A 2OLTA 1EZ3A 3LFMA 3AVRA 4CN6A 4B3TT 1OWAA 3ZMUB 1UK5A 2XZ5A 5HEGA 3NBXX 4XBFB 3BQLA 3KINB 5TVCA 4QH1A 2VKJA 4AQFC 4CI2B 3RQWA 2PH9A 4PJLA 4HFHA 4ISTA 4YTNA 3UU8A 3PMZA 3JCFA 2XAHB 3CPZA 3HR0A 4ISSA 5KXJA 3SFDA 2LHNA 3I0QA 2Z6EA 2E9XB 4E7ZA 2DNXA 5JDQA 1HFAA 4DV2T 3W15B 4ZK1A 4EZ4A 4KUMB 2CEAA 4GK5E 4UELA 4WYVA 5AQQB 3EDUA 4ADZA 3AXJB 1OEDA 5JRCB 4OX9T 2CM0A 2XNUA 3K3QC 1HX1B 3K1SA 2FJEA 3C4ZA 3Q9DA 3WAJA 5HCMA 5AQLB 3C4XA 5LP6E 2ZJUA 4OHFA 3I0OA 2M67A 2VURA 1IJ6A 4EIWA 1D1CA 3K3NA 2Y57A 2V8SV 4TUYE 4DR6T 1XWMA 4PW8A 2ES0A 3KBTA 4UF0A 2MAWA 2E9XA 4Z90A 4KX6A 3V5SA 3SOLA 4U31A 1MMNA 5HWYA 4NXMT 3FZLB 4D01A 4MLKA 4YXDA 3UUNA 2W2UA 4O4LE 5JTGA 3AXJA 2V1DB 4ALXA 1JNZA 1BR4A 2WDVA 2QRXA 2VK9A 5FVKA 5JRCA 2ACZA 1WCRA 1HG5A 5BP0A 1T98A 5TAOA 2V5DA 2D0UA 3OJAA 5AQRB 5FYMA 3RGLA 2WDQA 4CN1A 1HS7A 3N2OA 2KINB 4IE7A 3ZC0A 2PBIA 4FRRA 5AQOB 3P4SA 3UU4A 2EHOA 4UVCB 3PUVF 1HF8A 2XHEB 5ABGA 5HEOA 4MBQA 2JQQA 4U72A 2CXLA 2YDSA 4DVDA 1FMWA 2Y6XA 2JIWA 5LB7B 3FZMB 4C90A 3UUMA 2ODVA 4AQFA 4IREA 1D0ZA 2LT3A 1L0VA 4H9NC 3P50A 2BS2A 3P4RA 3T1YT 4H9PC 4AKGA 4LF8T 5LCYA 4ZI3C 5LMUT 3ZJ2A 3AE4A 4CI3B 2LRKA 5LBQB 5L3FB 4LFBT 2VQET 3SRZA 1T8BA 3F2EA 4PFOA 2X9WA 2L3LA 3NRXA 2XQAA 3CX8B 2ZJVA 3RKGA 1AJ3A 1ZHCA 4U7YA 4HWFA 3CX6B 3MJXA 2LSIA 2P9BA 1SA0E 3PUGA 3OVUA 2H89A 4HWIB 2XPKA 5ETWA 2WWVA 4JYAT 3N9OA 2CE7A 3OKQA 5IUXA 3ZC1A 4TWHA 4I0UA 4LF7T 2E5LT 5J5GA 1YKHB 2WSSV 4L9IA 5IYZE 4L5GA 2F4VT 5LXBA 3LG7A 1IBLT 3CQXC 1UGOA 1UURA 4LMKA 5HEJA 4PJJA 1ZOYA 2LSGA 3PEOA 5EK2A 4CXWA 1ZV4X 3GA8A 1U5PA 5H6RB 3KV4A 3PUSA 3A5XA 2YMEA 4DV4T 4A5XA 1YKEB 1YW0A 3S4UA 4UXUA 4ZHQE 3DJBA 4CQIA 4UV8B 2NTYA 5AFJA 1UUSA 4F8HA 5LGUB 3TLWA 2WNLA 2UXBT 4IE5A 1FEWA 2BZBA 4IDOA 4IDNA 5L3GB 4M1PA 4IE4A 4A56A 2CBJA 5LBMA 2X68A 1FMVA 2M6BA 2GK9A 4DV5T 4KMCA 3CQCB 4JEHB 1XMQT 1QLBA 2ACXA 2MPKA 1B7TA 2BS4A 4X65T 4LF4T 4YHHT 1YQ4A 3ZN1B 2XZEA 2YOEA 4O4JE 4HQPA 1D1BA 4QAAA 5FY7A 3RKOA 4X5TA 4ILAA 1MIYA 5LG4A 2I6HA 4L0RA 2BVMA 2BKNA 5J2TE 4IIJE 4ZI2C 2XNVA 2Q9QC 4HTEA 3NWIA 2LKGA 3N9NA 4U33A 4JI0T 3RYCE 2J62A 4WBOA 3OBVE 5AINA 2JQ9A 3RRCA 2YN6A 1Z8UA 2DI4A 3OYXA 3UULA 5AQHB 2WNCA 2D5UA 3ZCIA 3H37A 2JMHA 3UU6A 4UM3S 5J5IA 3UFEA 5LYJE 1OXZA 3AAAB 2CPTA 3ANWB 3H3AA 1UW6A 3L8RA 3WTMA 1HNXT 2X00A 2V7KA 4IL9A 3AE8A 3IA3A 3RYHE 2XAQB 3X1DA 3ABVA 4OK0A 3VKHA 2RP4A 4B5DA 4PFPA 5DABA 4BA9A 2LSKA 2XYSA 2XQ4A 5J2UE 1N32T 5LNKA 2BYPA 2VKOA 3SFEA 3ZYKA 5CFBA 3P4WA 3FXDB 2WCAA 4A98A 2DL1A 2QVAA 3FZHB 1UV6A 4CI1B 5L47A 5H6QB 5FY0A 5AFMB 3QC9A 5EZYE 4EYUA 3KV9A 3RC8A 3NZPA 5LG3A 2YMDA 3MXZA 2Q9QB 3AB3B 1Y64B 3LJCA 3NZQA 3ANWA 4DR1T 2W67A 4LFAT 2IMLA 3KVBA 3AE3A 4X66T 2VL8A 3GWHA 1OEDE 2UUCT 5J1GA 3IEEA 4UIGA 1BR1A 3RHWA 4DV6T 5HAXA 2XM2A 3ESLA 2CXFA 4DV3T 3L3PA 4X1IE 4PNIA 3EABA 3L09A 1WR0A 4ZJTA 5AQIB 4ZI2D 5LHIB 3SQ6A 3EAMA 4ZZCA 4JI1T 4U3CA 5AQKB 2KSRA 2HN2A 3NRYA 4NZBA 1Y01A 2QGSA 3RYFE 4CZZB 1SE7A 3T8OA 2BYQA 1W9RA 4DR7T 2XUEA 2UXDT 2Q9QA 4JLEA 4HFDA 3ZSSA 2BYNA 4U74A 3AA0B 2I59A 2V6XA 5CJ5A 4DR3T 2YEVC 5FP3A 4ZS2A 1HCIA 3AE6A 4IT4A 2N1GA 4AKRB 4UY2A 4FJOA 2PTFA 2XQ5A 4PK6A 2CLYB 3ZKRA 5BW2A 4UEMA 2D9DA 5CB4E 3N2KE 3C84A 2YKSA 2YDRA 4EAHA 4ZEYA 3ZMZB 3T1HT 2Y7YA 1BR2A 2BR7A 2NOXA 3E22E 4DBMA 1VRBA 4AFTA 5HCJA 3C64A 4U2YA 3LK42 3MKDA 1MIVA 4UF0B 4YLHA 2XTLA 2BKPA 1HNZT 4HFEA 2JJ9A 3UT5E 3ZMTB 3TLSA 3KDSE 4ZZBA 5F5WA 2IHR1 3WAKA 2CHOA 1T7SA 4UVBB 3OTOT 3J9X1 2MBGA 5CA0E 3G06A 2ZM2A 3VR9A 3AEGA 2WN9A 3EI0A 2K9AA 2PG8A 1KF6A 1MMAA 4UV9B 3RIUC 3Q5XA 4G63A 2DCFA 2XYTA 2Y56A 4PJMA 1G8XA 3A8YC 4ILUA 3I1AA 2E9XD 5LMNT 4QABA 2EHOB 5HYAA 4KI0F 1E7PA 3LBXB 2E8IA 2MYSA 2DLRA 5LOVE 2QC1B 3ZLIA 1VOMA 4HE8A 2OA5A 2CXDA 1QSDA 1N36T 4NXNT 4QXCB 1N33T 1KFYA 5KMGP 1SUMB 5ABFB 1XZYA 2XAGB 2DWGA 2BYRA 3WTJA 3SS1A 3RIFA 2WB5A 2Y54A 1W0BA 3Q5EA 4H9SE 4QH4A 2EHOD 2V7IA 1SHZC 4N78D 1J5ET 4AI6A 3U8MA 4PAGA 3PDYA 5C2TA 2PGZA 1IBKT 2RA1A 3AEAA 4QX7B 3LBXA 1XNQT 2WU5A 1BR0A 4AFHA 1XMOT 2C9TA 3PU8A 4IE6A 4CXYA 1IJ5A 1GQEA 5AFHA 4V1Av 4CN4A 3KVAA 3ZYLA 3CK6A 4EGWA 5ABFA 3E08A 2UZ6A 1NEKA 1KNPA 4DMWA 1WR6A 1IBMT 5IHYA 2NW7A 4JBWF 1H7CA 2CCQA 3T4MA 4JI5T 4I4TE 2VVSA 2KWIB 4H9QC 3BQIA 2H7OA 2HH7A 5JVDE 3PJAA 3D0TA 2VWAA 5J5HA 2B76A 5CGMA 3JC6C 3WI3A 4OYKA 3AE7A 3ETVA 2C0SA 1O3XA 1Z0PA 5AQNB 5LJNA 1R8IA 2LRLA 1E1HB 1MMGA 2W0GA 2XAJB 3TLUA 4WZXA 3ZEFB 5FMNA 3Q5WA 4EZ1A 2W8GA 1XDOA 2LHRA 4JI3T 2WP9A 1UCUA 4O4IE 4GYRA 2YK0A 3RIUA 2IUBA 1XNRT 4KP3C 4X64T 4AKHA 4NUVA 1HX8A 3B5MA 3PUYF 5L3CB 2XAFB 3AA7B 3A7MA 5ADXL 3FZKB 5L3BB 2CRBA 4EB6E 2Y58A 2KXPB 3NVOA 4YY3T 2FJBA 2LSYA 3HL6A 4GK0E 2CWYA 4TX5A 4HEAA 4QXHB 4DIDB 4ZR6A 1LVFA 3KFWX 5EK3A 5CA1E 4IDZA 2Y8DA 3QUJA 3CX7B 1MNEA 3HKBE 5FVLA 4BJNA 2A3DA 2NP9A 3CWZB 4EOZB 2VQFT 3HI2A 3FBLA 2VKDA 4QX8B 3UU5A 3BK9A 3MK7C 3LK3B 4HN9A 5JH7E 4YT0A 3CKDA 3KV6A 4A97A 1JNRA 2VB6A 4TNWA 3OPCA 2YU2A 2VL0A 2XQ3A 5FKYA 4U2ZA 2FJAA 2C5IT 5J5FA 2K5BB 5KX5E 3ZCJA 2SPCA 3PU3A 2KWHA 2A2FX 4QXBB 4ZI3D 1LRZA 5HEUA 2NR4A 4P09A 1KEYA 4AKIA 2V6YB 4ANJA 3WTIA 2W4XA 4XK9A 3TKLB 4IL4A 2XQ7A 1CUNA 3O9XA 2N9DA 1LVKA 3AAIA 3N5LA 2IDOB 2BBHA 2JRKA 2WM9A 2H88A 4TWDA 4IE0A 3ETUA 2KZ7B 4J2CA 5FXZA 3LK2B 4DNDA 2X00D 3AEEA 4MHCA 5FNVE 4AISA 5F3JA 4KBMB 4LF6T 2WQYA 3SH1A 4AXPA 4I55E 2HPJA 2YINA 3EDVA 3ONXA 2DHRA 4B3MT 5M4YA 5LGNB 4B3RT 4NPPA 3QNUA 2FUPA 2NTXA 2X66A 4TV8E 3RRWA 2W66A 5A1LA 3B57A 2WMNA 3WTKA 2V6YA 4HWHA 3ZT5A 5HXEA 2XQ6A 5FJVA 4U7IA 4BQTA 2IC9A 3UUBA 4HFIA 1WRDA 1YD8G 4YSYA 4QHOA 3J7Yq 4AQGA 1QUUA 4H63V 4PK4A 3ZT7A 2V7MA 2W63A 2HN1A 3K3OA 5FXWA 3K8PC 4GKKT 4EV6A 1DU2A 2W62A 3SQ9A 2DWKA 5L4HA 2XASB 1M62A 2JMKA 5ABEA 4X1KE 3PE0A 5JREA 4HWCA 4LFCT 4Z91A 1NWMX 2WWUA 4LMJA 3IBPA 4DMVA 5AQMB 4BFQA 4X62T 1NENA 5FXXA 2X51A 4AKLA 4OYJA 2WZHA 2XNTA 2BDEA 1KK7A 3B13A 3I9WA 2D0TA 2G0UA 4C91A 2Q9QD 2J47A 4YJ2E 5HWXA 2PJQA 3IGQA 2NW9A 1KNZA 2A9UA 1D0YA 3FB2A 3N9QA 2E2AA 5JDNA 4LMLA 1FIOA 3UFGA 3UQ4A 3AA6B 4YSZA 2BR8A 4GYSA 3M65A 4B3ST 5F8PA 1UX2A 3L39A 3ZT6A 4XAXB 2V5CA 4LF9T 4Z8XA 2V7LA 4I43B 4F6RC 2LSJA 2X67A 2YDQA 2LM2A 5FY1A 5DQWA 5BMVE 4X1YE 3U8JA 4TN7B 1YXRA 4UVAB 2L9QA 3SWHA 3KV5A 3AVSA 5EK4A 4IHJE 3VU7H 4BAYB 2ZM8A 2XQYA 4WV9A 5C8YE 2RPAA 2A72A 2BJ0A 5AFLA 3VR8A 4EYYR 2X0LB 5IWAT 1VCSA 3PUAA 1V9DA 2R6GF 4NUUA 5AQFB 1IZNB 1I9BA 3RH3A 3Q5DA 1T72A 4UM3A 4ILCA 1X9BA 3R84B 4YTPA 4ZOLE 5CO5A 4HWDA 2XSAA 4OFZA 3H3MA 4HKAA 3PUQA 5HEHA 2M6IA 3O4XE 4COFA 4JI2T 3UUXB 4LF5T 4IGUA 2WZYA 1MIWA 2WAUA 3PV0F 4UM3P 2XQ8A 2LJLA 4ILBA 2LOSA 5JDFA 2UXCT 3RIAA 3P8CD 3PUWF 4PIRA 2XQ9A 2I0MA 3PUZF 4ZS3A 5JDHA 4K0UA 2FJDA 2AXDS 3FXEB 3JADA 4B6XA 2BS3A 3P7IA 4PK5A 5LHHB 2XM1A 4AQYT 3RI5A 2BBJA 1NAFA 3AEDA 4UR9A 3QB5A 4I50E 5JQGE 4UM1A 4ERRA 3FHNA 2XJ7A 5LHGB 3ZPOA 4HFCA 1HG2A 3QK6A 3BQKA 1LKXA 1W09A 2JQHA 3AAEB 2UXXB 2WBLA 4TWFA 5JR9C 4YTMA 5AQPB 1CHUA 2FBWA 3EHZA 3FBZA 4O4HE 3M3ZB 4WW0A 2WDRA 4P0BA 4TV9E 2WS3A 4K0KT 3WTOA 5C3JA 4UXNB 3HKEE 3C4WA 4DV0T 4HGAA 3P4QA 5JDLA 2K3WA 3ZN0B 1D1AA 5SYOA 2ZM6T 5AQTB 3U8NA 3R6NA 3N2GE 4IDPA 2BG9C 3LSVA 2QA7A 5E0OA 4QACA 1W0AA 5KZUA 2CA5A 3N9LA 3RQUA 4BJMA 1WLXA 3PUXF 3TLVA 1X79A 2V7JA 3PJAJ 2KLQA 1I94T 3ZDGA 1U4QA 2NWBA 3RPUA 2WY2A 2VASA 2BYSA 2JPFA 4KHPT 3RX6A 2VKHA 2X9HA 4H9RC 2ZLYA 1WFDA 1ZEEA 4ZXLA 3AECA 4GOUA 2KNDA 5JDMA 4TZ4C 2X0YA 4NIQA
chains in the Genus database with same CATH topology
5AFMA 4IL4A 2BG9E 4UXUA 2XQ7A 3UU6A 4IREA 4Z91A 4UM3S 5J5IA 4WV9A 2W8FA 2WNJA 4LMJA 2LKHA 4HFCA 3P50A 3JAFA 1UW6A 5AFJA 4ZJTA 2YMEA 2BJ0A 3ZDHA 4BFQA 4TWDA 4F8HA 5AFLA 3U8KA 1OEDB 3WTMA 5KE4A 3TLWA 2WNLA 1OEDC 2X00A 4IL9A 2Y57A 3SQ6A 2Y58A 2BG9A 2WN9A 3EI0A 4TWFA 3EAMA 2X00D 4AFHA 4ZZCA 2C9TA 3EHZA 3SH1A 2KSRA 3C79A 4NZBA 4ZR6A 4B5DA 2XNTA 3WTOA 5AFKA 3TLTA 2LLYA 1I9BA 2XYTA 2XZ5A 2M6BA 2Y56A 5HEGA 3UU3A 2MAWA 5AFHA 4UM3A 4Z90A 2BYQA 4ILCA 5TVCA 4QH1A 3WTLA 2XYSA 4TNVA 2XQAA 2UZ6A 2ZJVA 2XQ4A 4NPPA 4HFBA 3GUAA 2BYPA 4QABA 5SYOA 3U8NA 4ZK4A 5CO5A 4HFDA 3RQWA 2PH9A 4D01A 2BYNA 4HFHA 3T4MA 5HEHA 5CFBA 2BG9B 2M6IA 3P4WA 2YOEA 3UU8A 4COFA 3IGQA 3PMZA 4HQPA 2BG9C 4QAAA 4ALXA 2QC1B 3LSVA 4A98A 3UU5A 1UV6A 5J5HA 5L47A 4QACA 2WZYA 3WTNA 4UY2A 4X5TA 5IUXA 4LMLA 4TWHA 4UM3P 5KZUA 3WTKA 2XQ8A 4ILAA 3UQ4A 5AFMB 2XQ5A 3UQ7A 4ILBA 3ZKRA 5BP0A 3RQUA 4A97A 5BW2A 2XQ6A 5FJVA 4BQTA 5J5GA 3UUBA 5AFNA 4HFIA 4TNWA 3RIAA 5J0ZA 2BR8A 3TLVA 3C84A 4PIRA 2XQ9A 2VL0A 2XQ3A 5LG3A 2YMDA 2YKSA 3U8LA 3JADA 2BYRA 2XNVA 3WTJA 4ZK1A 1UX2A 3RIFA 3ZDGA 5LXBA 5J5FA 4QH5A 5JMEA 2LKGA 2Y54A 4LMKA 3TLUA 4FRRA 5HEJA 2Y7YA 3UU4A 2BR7A 4ZJSA 3PEOA 4AFGA 1OEDA 2BYSA 4EZ1A 4DBMA 2W8GA 4QH4A 4ZRUA 4AFTA 5HCJA 5BRXA 5HEUA 2XNUA 5AINA 5HEOA 3RI5A 3SQ9A 2LM2A 5L4HA 3JAEA 3U8MA 2YN6A 4XHEA 5HCMA 1OEDE 4UM1A 4HFEA 2XZ6A 2WNCA 3WTIA 3U8JA 2PGZA 3TLSA 3SIOA 3WIPA 4ZZBA 3RHWA 3WTHA 4XK9A 2ZJUA 5L4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFM A;  4IL4 A;  2BG9 E;  4UXU A;  2XQ7 A;  3UU6 A;  4IRE A;  4Z91 A;  4UM3 S;  5J5I A;  4WV9 A;  2W8F A;  2WNJ A;  4LMJ A;  2LKH A;  4HFC A;  3P50 A;  3JAF A;  1UW6 A;  5AFJ A;  4ZJT A;  2YME A;  2BJ0 A;  3ZDH A;  4BFQ A;  4TWD A;  4F8H A;  5AFL A;  3U8K A;  1OED B;  3WTM A;  5KE4 A;  3TLW A;  2WNL A;  1OED C;  2X00 A;  4IL9 A;  2Y57 A;  3SQ6 A;  2Y58 A;  2BG9 A;  2WN9 A;  3EI0 A;  4TWF A;  3EAM A;  2X00 D;  4AFH A;  4ZZC A;  2C9T A;  3EHZ A;  3SH1 A;  2KSR A;  3C79 A;  4NZB A;  4ZR6 A;  4B5D A;  2XNT A;  3WTO A;  5AFK A;  3TLT A;  2LLY A;  1I9B A;  2XYT A;  2XZ5 A;  2M6B A;  2Y56 A;  5HEG A;  3UU3 A;  2MAW A;  5AFH A;  4UM3 A;  4Z90 A;  2BYQ A;  4ILC A;  5TVC A;  4QH1 A;  3WTL A;  2XYS A;  4TNV A;  2XQA A;  2UZ6 A;  2ZJV A;  2XQ4 A;  4NPP A;  4HFB A;  3GUA A;  2BYP A;  4QAB A;  5SYO A;  3U8N A;  4ZK4 A;  5CO5 A;  4HFD A;  3RQW A;  2PH9 A;  4D01 A;  2BYN A;  4HFH A;  3T4M A;  5HEH A;  5CFB A;  2BG9 B;  2M6I A;  3P4W A;  2YOE A;  3UU8 A;  4COF A;  3IGQ A;  3PMZ A;  4HQP A;  2BG9 C;  4QAA A;  4ALX A;  2QC1 B;  3LSV A;  4A98 A;  3UU5 A;  1UV6 A;  5J5H A;  5L47 A;  4QAC A;  2WZY A;  3WTN A;  4UY2 A;  4X5T A;  5IUX A;  4LML A;  4TWH A;  4UM3 P;  5KZU A;  3WTK A;  2XQ8 A;  4ILA A;  3UQ4 A;  5AFM B;  2XQ5 A;  3UQ7 A;  4ILB A;  3ZKR A;  5BP0 A;  3RQU A;  4A97 A;  5BW2 A;  2XQ6 A;  5FJV A;  4BQT A;  5J5G A;  3UUB A;  5AFN A;  4HFI A;  4TNW A;  3RIA A;  5J0Z A;  2BR8 A;  3TLV A;  3C84 A;  4PIR A;  2XQ9 A;  2VL0 A;  2XQ3 A;  5LG3 A;  2YMD A;  2YKS A;  3U8L A;  3JAD A;  2BYR A;  2XNV A;  3WTJ A;  4ZK1 A;  1UX2 A;  3RIF A;  3ZDG A;  5LXB A;  5J5F A;  4QH5 A;  5JME A;  2LKG A;  2Y54 A;  4LMK A;  3TLU A;  4FRR A;  5HEJ A;  2Y7Y A;  3UU4 A;  2BR7 A;  4ZJS A;  3PEO A;  4AFG A;  1OED A;  2BYS A;  4EZ1 A;  4DBM A;  2W8G A;  4QH4 A;  4ZRU A;  4AFT A;  5HCJ A;  5BRX A;  5HEU A;  2XNU A;  5AIN A;  5HEO A;  3RI5 A;  3SQ9 A;  2LM2 A;  5L4H A;  3JAE A;  3U8M A;  2YN6 A;  4XHE A;  5HCM A;  1OED E;  4UM1 A;  4HFE A;  2XZ6 A;  2WNC A;  3WTI A;  3U8J A;  2PGZ A;  3TLS A;  3SIO A;  3WIP A;  4ZZB A;  3RHW A;  3WTH A;  4XK9 A;  2ZJU A;  5L4E A; 
#chains in the Genus database with same CATH topology
 2XSB A;  2BG9 E;  2J4G A;  5AQU B;  3C50 A;  2W8F A;  2QYW A;  4EXT A;  4O2A E;  4CXX A;  3AA1 B;  3JAF A;  3RLF F;  3ZDH A;  2ZM0 A;  5KE4 A;  3E0Z A;  2MTQ A;  5JR9 B;  4DR5 T;  1UX4 A;  5AQS B;  3UTK A;  2B1E A;  4DV1 T;  3C79 A;  3EVY A;  4YHJ A;  5JDG A;  3ZST A;  3UU3 A;  2UU9 T;  4DO0 A;  1WYB A;  3GUA A;  3ZMV B;  5HXS A;  2H7V C;  3QB5 K;  5L3E B;  3I9Y A;  4ZI7 E;  1KNR A;  1S35 A;  4HFV A;  2BG9 B;  2CBI A;  5AQJ B;  2UUA T;  5FXV A;  3O1H A;  4P0A A;  3DTO A;  3HKC E;  3RYI E;  2ODU A;  1YQ3 A;  4YFS A;  3OYZ A;  3U8L A;  2PFV A;  3IF8 B;  3CIR A;  3MA9 A;  3AEF A;  1E2A A;  2LM9 A;  4JI4 T;  5JR9 A;  4GKJ T;  5BRX A;  2JQK A;  4P1N A;  5AFU L;  2CWO A;  1IAP A;  4X20 E;  5KDM C;  2IIU A;  3U78 A;  2KT9 A;  2X0H A;  4PJN A;  3GMI A;  4YJ3 E;  3EUH A;  3N9M A;  2LKH A;  5FL0 A;  4DUY T;  3CML A;  4QWN B;  2W61 A;  2BKO A;  1HTJ F;  2OV9 A;  3RF1 A;  4DBR A;  4Q25 A;  2BG9 A;  4E7S A;  4ASK A;  5BR8 T;  3P4P A;  3JC6 D;  5L3D B;  1HR0 T;  1ZKE A;  3NKZ A;  5AQV B;  4DUZ T;  4GIW A;  4TNV A;  2H3R A;  2D2S A;  4HFB A;  5HXR A;  3VKG A;  1G73 A;  5DQV A;  3V5U A;  3ONJ A;  3AE2 A;  5LGT B;  3CVR A;  3DP7 A;  3CQG B;  1I6Z A;  3ZJ1 A;  4JUY A;  3WTN A;  2NW8 A;  1MMD A;  4JEU B;  5J0Z A;  3PUR A;  4AIU A;  5LA6 E;  4FI5 A;  5FL1 A;  2LEH A;  5HXC A;  2CHN A;  3MAC A;  3ONL C;  4ZJS A;  4EEB A;  3HKD E;  3HA4 A;  4O2B E;  5GON E;  3KBU A;  4QKN A;  3C51 A;  1N34 T;  4JI6 T;  2WZI A;  2UUB T;  3C98 B;  2W00 A;  1UX5 A;  1M7K A;  4XHE A;  2HHH T;  5HXH A;  2IW5 B;  3SIO A;  2KMF A;  2LOP A;  5L4E A;  2WNJ A;  1FJG T;  4WNK A;  4YSX A;  3U8K A;  3VHL A;  4G2A A;  1OED C;  2C5J A;  2IAK A;  4O8S A;  4KHZ F;  3F57 A;  3MZK B;  2Y48 B;  2WMO A;  4DV7 T;  3QOF A;  2J1D G;  5AFK A;  3TLT A;  2LLY A;  3AEB A;  1D0X A;  2L8K A;  3FZF B;  2MOZ A;  4H63 H;  3WTL A;  5ABH A;  5DJQ C;  4JV5 T;  2CLY C;  3IHR A;  3O1I A;  4ZK4 A;  2E5V A;  2X9Y A;  4IDQ A;  3N9P A;  4EED A;  4WBN E;  1S94 A;  3PTR B;  3RC3 A;  2AE9 A;  3GN5 B;  2HPL A;  2X9X A;  3ZMS B;  5LXT E;  2IC6 A;  2N2N A;  1VCT A;  4MFR A;  4JI7 T;  3AE5 A;  1J5W A;  4H9O C;  1J1J A;  3VRB A;  3UQ7 A;  2UXN B;  4EZH A;  3O1J A;  5AFN A;  3Q2M A;  2E9X C;  1XDP A;  3ZYM A;  2VVN A;  4DR4 T;  2CMR A;  4DR2 T;  1HNW T;  2K48 A;  4QH5 A;  5JME A;  2YU1 A;  4XZC A;  4AFG A;  2LE8 A;  4ZRU A;  2C5K T;  2BVL A;  5LJM A;  2V26 A;  2ZMA A;  3AE1 A;  3JAE A;  1US7 B;  4JI8 T;  2XZ6 A;  2XY8 B;  4MAL A;  3WIP A;  3WTH A;  4DBQ A;  3LDQ B;  5AFM A;  2K24 A;  3F31 A;  5AQG B;  2WU2 A;  3VRA A;  1MND A;  3U3I A;  1WYC A;  5L2L A;  1OED B;  1ZP0 A;  3AE9 A;  2EHO C;  3GN5 A;  2OLT A;  1EZ3 A;  3LFM A;  3AVR A;  4CN6 A;  4B3T T;  1OWA A;  3ZMU B;  1UK5 A;  2XZ5 A;  5HEG A;  3NBX X;  4XBF B;  3BQL A;  3KIN B;  5TVC A;  4QH1 A;  2VKJ A;  4AQF C;  4CI2 B;  3RQW A;  2PH9 A;  4PJL A;  4HFH A;  4IST A;  4YTN A;  3UU8 A;  3PMZ A;  3JCF A;  2XAH B;  3CPZ A;  3HR0 A;  4ISS A;  5KXJ A;  3SFD A;  2LHN A;  3I0Q A;  2Z6E A;  2E9X B;  4E7Z A;  2DNX A;  5JDQ A;  1HFA A;  4DV2 T;  3W15 B;  4ZK1 A;  4EZ4 A;  4KUM B;  2CEA A;  4GK5 E;  4UEL A;  4WYV A;  5AQQ B;  3EDU A;  4ADZ A;  3AXJ B;  1OED A;  5JRC B;  4OX9 T;  2CM0 A;  2XNU A;  3K3Q C;  1HX1 B;  3K1S A;  2FJE A;  3C4Z A;  3Q9D A;  3WAJ A;  5HCM A;  5AQL B;  3C4X A;  5LP6 E;  2ZJU A;  4OHF A;  3I0O A;  2M67 A;  2VUR A;  1IJ6 A;  4EIW A;  1D1C A;  3K3N A;  2Y57 A;  2V8S V;  4TUY E;  4DR6 T;  1XWM A;  4PW8 A;  2ES0 A;  3KBT A;  4UF0 A;  2MAW A;  2E9X A;  4Z90 A;  4KX6 A;  3V5S A;  3SOL A;  4U31 A;  1MMN A;  5HWY A;  4NXM T;  3FZL B;  4D01 A;  4MLK A;  4YXD A;  3UUN A;  2W2U A;  4O4L E;  5JTG A;  3AXJ A;  2V1D B;  4ALX A;  1JNZ A;  1BR4 A;  2WDV A;  2QRX A;  2VK9 A;  5FVK A;  5JRC A;  2ACZ A;  1WCR A;  1HG5 A;  5BP0 A;  1T98 A;  5TAO A;  2V5D A;  2D0U A;  3OJA A;  5AQR B;  5FYM A;  3RGL A;  2WDQ A;  4CN1 A;  1HS7 A;  3N2O A;  2KIN B;  4IE7 A;  3ZC0 A;  2PBI A;  4FRR A;  5AQO B;  3P4S A;  3UU4 A;  2EHO A;  4UVC B;  3PUV F;  1HF8 A;  2XHE B;  5ABG A;  5HEO A;  4MBQ A;  2JQQ A;  4U72 A;  2CXL A;  2YDS A;  4DVD A;  1FMW A;  2Y6X A;  2JIW A;  5LB7 B;  3FZM B;  4C90 A;  3UUM A;  2ODV A;  4AQF A;  4IRE A;  1D0Z A;  2LT3 A;  1L0V A;  4H9N C;  3P50 A;  2BS2 A;  3P4R A;  3T1Y T;  4H9P C;  4AKG A;  4LF8 T;  5LCY A;  4ZI3 C;  5LMU T;  3ZJ2 A;  3AE4 A;  4CI3 B;  2LRK A;  5LBQ B;  5L3F B;  4LFB T;  2VQE T;  3SRZ A;  1T8B A;  3F2E A;  4PFO A;  2X9W A;  2L3L A;  3NRX A;  2XQA A;  3CX8 B;  2ZJV A;  3RKG A;  1AJ3 A;  1ZHC A;  4U7Y A;  4HWF A;  3CX6 B;  3MJX A;  2LSI A;  2P9B A;  1SA0 E;  3PUG A;  3OVU A;  2H89 A;  4HWI B;  2XPK A;  5ETW A;  2WWV A;  4JYA T;  3N9O A;  2CE7 A;  3OKQ A;  5IUX A;  3ZC1 A;  4TWH A;  4I0U A;  4LF7 T;  2E5L T;  5J5G A;  1YKH B;  2WSS V;  4L9I A;  5IYZ E;  4L5G A;  2F4V T;  5LXB A;  3LG7 A;  1IBL T;  3CQX C;  1UGO A;  1UUR A;  4LMK A;  5HEJ A;  4PJJ A;  1ZOY A;  2LSG A;  3PEO A;  5EK2 A;  4CXW A;  1ZV4 X;  3GA8 A;  1U5P A;  5H6R B;  3KV4 A;  3PUS A;  3A5X A;  2YME A;  4DV4 T;  4A5X A;  1YKE B;  1YW0 A;  3S4U A;  4UXU A;  4ZHQ E;  3DJB A;  4CQI A;  4UV8 B;  2NTY A;  5AFJ A;  1UUS A;  4F8H A;  5LGU B;  3TLW A;  2WNL A;  2UXB T;  4IE5 A;  1FEW A;  2BZB A;  4IDO A;  4IDN A;  5L3G B;  4M1P A;  4IE4 A;  4A56 A;  2CBJ A;  5LBM A;  2X68 A;  1FMV A;  2M6B A;  2GK9 A;  4DV5 T;  4KMC A;  3CQC B;  4JEH B;  1XMQ T;  1QLB A;  2ACX A;  2MPK A;  1B7T A;  2BS4 A;  4X65 T;  4LF4 T;  4YHH T;  1YQ4 A;  3ZN1 B;  2XZE A;  2YOE A;  4O4J E;  4HQP A;  1D1B A;  4QAA A;  5FY7 A;  3RKO A;  4X5T A;  4ILA A;  1MIY A;  5LG4 A;  2I6H A;  4L0R A;  2BVM A;  2BKN A;  5J2T E;  4IIJ E;  4ZI2 C;  2XNV A;  2Q9Q C;  4HTE A;  3NWI A;  2LKG A;  3N9N A;  4U33 A;  4JI0 T;  3RYC E;  2J62 A;  4WBO A;  3OBV E;  5AIN A;  2JQ9 A;  3RRC A;  2YN6 A;  1Z8U A;  2DI4 A;  3OYX A;  3UUL A;  5AQH B;  2WNC A;  2D5U A;  3ZCI A;  3H37 A;  2JMH A;  3UU6 A;  4UM3 S;  5J5I A;  3UFE A;  5LYJ E;  1OXZ A;  3AAA B;  2CPT A;  3ANW B;  3H3A A;  1UW6 A;  3L8R A;  3WTM A;  1HNX T;  2X00 A;  2V7K A;  4IL9 A;  3AE8 A;  3IA3 A;  3RYH E;  2XAQ B;  3X1D A;  3ABV A;  4OK0 A;  3VKH A;  2RP4 A;  4B5D A;  4PFP A;  5DAB A;  4BA9 A;  2LSK A;  2XYS A;  2XQ4 A;  5J2U E;  1N32 T;  5LNK A;  2BYP A;  2VKO A;  3SFE A;  3ZYK A;  5CFB A;  3P4W A;  3FXD B;  2WCA A;  4A98 A;  2DL1 A;  2QVA A;  3FZH B;  1UV6 A;  4CI1 B;  5L47 A;  5H6Q B;  5FY0 A;  5AFM B;  3QC9 A;  5EZY E;  4EYU A;  3KV9 A;  3RC8 A;  3NZP A;  5LG3 A;  2YMD A;  3MXZ A;  2Q9Q B;  3AB3 B;  1Y64 B;  3LJC A;  3NZQ A;  3ANW A;  4DR1 T;  2W67 A;  4LFA T;  2IML A;  3KVB A;  3AE3 A;  4X66 T;  2VL8 A;  3GWH A;  1OED E;  2UUC T;  5J1G A;  3IEE A;  4UIG A;  1BR1 A;  3RHW A;  4DV6 T;  5HAX A;  2XM2 A;  3ESL A;  2CXF A;  4DV3 T;  3L3P A;  4X1I E;  4PNI A;  3EAB A;  3L09 A;  1WR0 A;  4ZJT A;  5AQI B;  4ZI2 D;  5LHI B;  3SQ6 A;  3EAM A;  4ZZC A;  4JI1 T;  4U3C A;  5AQK B;  2KSR A;  2HN2 A;  3NRY A;  4NZB A;  1Y01 A;  2QGS A;  3RYF E;  4CZZ B;  1SE7 A;  3T8O A;  2BYQ A;  1W9R A;  4DR7 T;  2XUE A;  2UXD T;  2Q9Q A;  4JLE A;  4HFD A;  3ZSS A;  2BYN A;  4U74 A;  3AA0 B;  2I59 A;  2V6X A;  5CJ5 A;  4DR3 T;  2YEV C;  5FP3 A;  4ZS2 A;  1HCI A;  3AE6 A;  4IT4 A;  2N1G A;  4AKR B;  4UY2 A;  4FJO A;  2PTF A;  2XQ5 A;  4PK6 A;  2CLY B;  3ZKR A;  5BW2 A;  4UEM A;  2D9D A;  5CB4 E;  3N2K E;  3C84 A;  2YKS A;  2YDR A;  4EAH A;  4ZEY A;  3ZMZ B;  3T1H T;  2Y7Y A;  1BR2 A;  2BR7 A;  2NOX A;  3E22 E;  4DBM A;  1VRB A;  4AFT A;  5HCJ A;  3C64 A;  4U2Y A;  3LK4 2;  3MKD A;  1MIV A;  4UF0 B;  4YLH A;  2XTL A;  2BKP A;  1HNZ T;  4HFE A;  2JJ9 A;  3UT5 E;  3ZMT B;  3TLS A;  3KDS E;  4ZZB A;  5F5W A;  2IHR 1;  3WAK A;  2CHO A;  1T7S A;  4UVB B;  3OTO T;  3J9X 1;  2MBG A;  5CA0 E;  3G06 A;  2ZM2 A;  3VR9 A;  3AEG A;  2WN9 A;  3EI0 A;  2K9A A;  2PG8 A;  1KF6 A;  1MMA A;  4UV9 B;  3RIU C;  3Q5X A;  4G63 A;  2DCF A;  2XYT A;  2Y56 A;  4PJM A;  1G8X A;  3A8Y C;  4ILU A;  3I1A A;  2E9X D;  5LMN T;  4QAB A;  2EHO B;  5HYA A;  4KI0 F;  1E7P A;  3LBX B;  2E8I A;  2MYS A;  2DLR A;  5LOV E;  2QC1 B;  3ZLI A;  1VOM A;  4HE8 A;  2OA5 A;  2CXD A;  1QSD A;  1N36 T;  4NXN T;  4QXC B;  1N33 T;  1KFY A;  5KMG P;  1SUM B;  5ABF B;  1XZY A;  2XAG B;  2DWG A;  2BYR A;  3WTJ A;  3SS1 A;  3RIF A;  2WB5 A;  2Y54 A;  1W0B A;  3Q5E A;  4H9S E;  4QH4 A;  2EHO D;  2V7I A;  1SHZ C;  4N78 D;  1J5E T;  4AI6 A;  3U8M A;  4PAG A;  3PDY A;  5C2T A;  2PGZ A;  1IBK T;  2RA1 A;  3AEA A;  4QX7 B;  3LBX A;  1XNQ T;  2WU5 A;  1BR0 A;  4AFH A;  1XMO T;  2C9T A;  3PU8 A;  4IE6 A;  4CXY A;  1IJ5 A;  1GQE A;  5AFH A;  4V1A v;  4CN4 A;  3KVA A;  3ZYL A;  3CK6 A;  4EGW A;  5ABF A;  3E08 A;  2UZ6 A;  1NEK A;  1KNP A;  4DMW A;  1WR6 A;  1IBM T;  5IHY A;  2NW7 A;  4JBW F;  1H7C A;  2CCQ A;  3T4M A;  4JI5 T;  4I4T E;  2VVS A;  2KWI B;  4H9Q C;  3BQI A;  2H7O A;  2HH7 A;  5JVD E;  3PJA A;  3D0T A;  2VWA A;  5J5H A;  2B76 A;  5CGM A;  3JC6 C;  3WI3 A;  4OYK A;  3AE7 A;  3ETV A;  2C0S A;  1O3X A;  1Z0P A;  5AQN B;  5LJN A;  1R8I A;  2LRL A;  1E1H B;  1MMG A;  2W0G A;  2XAJ B;  3TLU A;  4WZX A;  3ZEF B;  5FMN A;  3Q5W A;  4EZ1 A;  2W8G A;  1XDO A;  2LHR A;  4JI3 T;  2WP9 A;  1UCU A;  4O4I E;  4GYR A;  2YK0 A;  3RIU A;  2IUB A;  1XNR T;  4KP3 C;  4X64 T;  4AKH A;  4NUV A;  1HX8 A;  3B5M A;  3PUY F;  5L3C B;  2XAF B;  3AA7 B;  3A7M A;  5ADX L;  3FZK B;  5L3B B;  2CRB A;  4EB6 E;  2Y58 A;  2KXP B;  3NVO A;  4YY3 T;  2FJB A;  2LSY A;  3HL6 A;  4GK0 E;  2CWY A;  4TX5 A;  4HEA A;  4QXH B;  4DID B;  4ZR6 A;  1LVF A;  3KFW X;  5EK3 A;  5CA1 E;  4IDZ A;  2Y8D A;  3QUJ A;  3CX7 B;  1MNE A;  3HKB E;  5FVL A;  4BJN A;  2A3D A;  2NP9 A;  3CWZ B;  4EOZ B;  2VQF T;  3HI2 A;  3FBL A;  2VKD A;  4QX8 B;  3UU5 A;  3BK9 A;  3MK7 C;  3LK3 B;  4HN9 A;  5JH7 E;  4YT0 A;  3CKD A;  3KV6 A;  4A97 A;  1JNR A;  2VB6 A;  4TNW A;  3OPC A;  2YU2 A;  2VL0 A;  2XQ3 A;  5FKY A;  4U2Z A;  2FJA A;  2C5I T;  5J5F A;  2K5B B;  5KX5 E;  3ZCJ A;  2SPC A;  3PU3 A;  2KWH A;  2A2F X;  4QXB B;  4ZI3 D;  1LRZ A;  5HEU A;  2NR4 A;  4P09 A;  1KEY A;  4AKI A;  2V6Y B;  4ANJ A;  3WTI A;  2W4X A;  4XK9 A;  3TKL B;  4IL4 A;  2XQ7 A;  1CUN A;  3O9X A;  2N9D A;  1LVK A;  3AAI A;  3N5L A;  2IDO B;  2BBH A;  2JRK A;  2WM9 A;  2H88 A;  4TWD A;  4IE0 A;  3ETU A;  2KZ7 B;  4J2C A;  5FXZ A;  3LK2 B;  4DND A;  2X00 D;  3AEE A;  4MHC A;  5FNV E;  4AIS A;  5F3J A;  4KBM B;  4LF6 T;  2WQY A;  3SH1 A;  4AXP A;  4I55 E;  2HPJ A;  2YIN A;  3EDV A;  3ONX A;  2DHR A;  4B3M T;  5M4Y A;  5LGN B;  4B3R T;  4NPP A;  3QNU A;  2FUP A;  2NTX A;  2X66 A;  4TV8 E;  3RRW A;  2W66 A;  5A1L A;  3B57 A;  2WMN A;  3WTK A;  2V6Y A;  4HWH A;  3ZT5 A;  5HXE A;  2XQ6 A;  5FJV A;  4U7I A;  4BQT A;  2IC9 A;  3UUB A;  4HFI A;  1WRD A;  1YD8 G;  4YSY A;  4QHO A;  3J7Y q;  4AQG A;  1QUU A;  4H63 V;  4PK4 A;  3ZT7 A;  2V7M A;  2W63 A;  2HN1 A;  3K3O A;  5FXW A;  3K8P C;  4GKK T;  4EV6 A;  1DU2 A;  2W62 A;  3SQ9 A;  2DWK A;  5L4H A;  2XAS B;  1M62 A;  2JMK A;  5ABE A;  4X1K E;  3PE0 A;  5JRE A;  4HWC A;  4LFC T;  4Z91 A;  1NWM X;  2WWU A;  4LMJ A;  3IBP A;  4DMV A;  5AQM B;  4BFQ A;  4X62 T;  1NEN A;  5FXX A;  2X51 A;  4AKL A;  4OYJ A;  2WZH A;  2XNT A;  2BDE A;  1KK7 A;  3B13 A;  3I9W A;  2D0T A;  2G0U A;  4C91 A;  2Q9Q D;  2J47 A;  4YJ2 E;  5HWX A;  2PJQ A;  3IGQ A;  2NW9 A;  1KNZ A;  2A9U A;  1D0Y A;  3FB2 A;  3N9Q A;  2E2A A;  5JDN A;  4LML A;  1FIO A;  3UFG A;  3UQ4 A;  3AA6 B;  4YSZ A;  2BR8 A;  4GYS A;  3M65 A;  4B3S T;  5F8P A;  1UX2 A;  3L39 A;  3ZT6 A;  4XAX B;  2V5C A;  4LF9 T;  4Z8X A;  2V7L A;  4I43 B;  4F6R C;  2LSJ A;  2X67 A;  2YDQ A;  2LM2 A;  5FY1 A;  5DQW A;  5BMV E;  4X1Y E;  3U8J A;  4TN7 B;  1YXR A;  4UVA B;  2L9Q A;  3SWH A;  3KV5 A;  3AVS A;  5EK4 A;  4IHJ E;  3VU7 H;  4BAY B;  2ZM8 A;  2XQY A;  4WV9 A;  5C8Y E;  2RPA A;  2A72 A;  2BJ0 A;  5AFL A;  3VR8 A;  4EYY R;  2X0L B;  5IWA T;  1VCS A;  3PUA A;  1V9D A;  2R6G F;  4NUU A;  5AQF B;  1IZN B;  1I9B A;  3RH3 A;  3Q5D A;  1T72 A;  4UM3 A;  4ILC A;  1X9B A;  3R84 B;  4YTP A;  4ZOL E;  5CO5 A;  4HWD A;  2XSA A;  4OFZ A;  3H3M A;  4HKA A;  3PUQ A;  5HEH A;  2M6I A;  3O4X E;  4COF A;  4JI2 T;  3UUX B;  4LF5 T;  4IGU A;  2WZY A;  1MIW A;  2WAU A;  3PV0 F;  4UM3 P;  2XQ8 A;  2LJL A;  4ILB A;  2LOS A;  5JDF A;  2UXC T;  3RIA A;  3P8C D;  3PUW F;  4PIR A;  2XQ9 A;  2I0M A;  3PUZ F;  4ZS3 A;  5JDH A;  4K0U A;  2FJD A;  2AXD S;  3FXE B;  3JAD A;  4B6X A;  2BS3 A;  3P7I A;  4PK5 A;  5LHH B;  2XM1 A;  4AQY T;  3RI5 A;  2BBJ A;  1NAF A;  3AED A;  4UR9 A;  3QB5 A;  4I50 E;  5JQG E;  4UM1 A;  4ERR A;  3FHN A;  2XJ7 A;  5LHG B;  3ZPO A;  4HFC A;  1HG2 A;  3QK6 A;  3BQK A;  1LKX A;  1W09 A;  2JQH A;  3AAE B;  2UXX B;  2WBL A;  4TWF A;  5JR9 C;  4YTM A;  5AQP B;  1CHU A;  2FBW A;  3EHZ A;  3FBZ A;  4O4H E;  3M3Z B;  4WW0 A;  2WDR A;  4P0B A;  4TV9 E;  2WS3 A;  4K0K T;  3WTO A;  5C3J A;  4UXN B;  3HKE E;  3C4W A;  4DV0 T;  4HGA A;  3P4Q A;  5JDL A;  2K3W A;  3ZN0 B;  1D1A A;  5SYO A;  2ZM6 T;  5AQT B;  3U8N A;  3R6N A;  3N2G E;  4IDP A;  2BG9 C;  3LSV A;  2QA7 A;  5E0O A;  4QAC A;  1W0A A;  5KZU A;  2CA5 A;  3N9L A;  3RQU A;  4BJM A;  1WLX A;  3PUX F;  3TLV A;  1X79 A;  2V7J A;  3PJA J;  2KLQ A;  1I94 T;  3ZDG A;  1U4Q A;  2NWB A;  3RPU A;  2WY2 A;  2VAS A;  2BYS A;  2JPF A;  4KHP T;  3RX6 A;  2VKH A;  2X9H A;  4H9R C;  2ZLY A;  1WFD A;  1ZEE A;  4ZXL A;  3AEC A;  4GOU A;  2KND A;  5JDM A;  4TZ4 C;  2X0Y A;  4NIQ A; 
#chains in the Genus database with same CATH homology
 5AFM A;  4IL4 A;  2BG9 E;  4UXU A;  2XQ7 A;  3UU6 A;  4IRE A;  4Z91 A;  4UM3 S;  5J5I A;  4WV9 A;  2W8F A;  2WNJ A;  4LMJ A;  2LKH A;  4HFC A;  3P50 A;  3JAF A;  1UW6 A;  5AFJ A;  4ZJT A;  2YME A;  2BJ0 A;  3ZDH A;  4BFQ A;  4TWD A;  4F8H A;  5AFL A;  3U8K A;  1OED B;  3WTM A;  5KE4 A;  3TLW A;  2WNL A;  1OED C;  2X00 A;  4IL9 A;  2Y57 A;  3SQ6 A;  2Y58 A;  2BG9 A;  2WN9 A;  3EI0 A;  4TWF A;  3EAM A;  2X00 D;  4AFH A;  4ZZC A;  2C9T A;  3EHZ A;  3SH1 A;  2KSR A;  3C79 A;  4NZB A;  4ZR6 A;  4B5D A;  2XNT A;  3WTO A;  5AFK A;  3TLT A;  2LLY A;  1I9B A;  2XYT A;  2XZ5 A;  2M6B A;  2Y56 A;  5HEG A;  3UU3 A;  2MAW A;  5AFH A;  4UM3 A;  4Z90 A;  2BYQ A;  4ILC A;  5TVC A;  4QH1 A;  3WTL A;  2XYS A;  4TNV A;  2XQA A;  2UZ6 A;  2ZJV A;  2XQ4 A;  4NPP A;  4HFB A;  3GUA A;  2BYP A;  4QAB A;  5SYO A;  3U8N A;  4ZK4 A;  5CO5 A;  4HFD A;  3RQW A;  2PH9 A;  4D01 A;  2BYN A;  4HFH A;  3T4M A;  5HEH A;  5CFB A;  2BG9 B;  2M6I A;  3P4W A;  2YOE A;  3UU8 A;  4COF A;  3IGQ A;  3PMZ A;  4HQP A;  2BG9 C;  4QAA A;  4ALX A;  2QC1 B;  3LSV A;  4A98 A;  3UU5 A;  1UV6 A;  5J5H A;  5L47 A;  4QAC A;  2WZY A;  3WTN A;  4UY2 A;  4X5T A;  5IUX A;  4LML A;  4TWH A;  4UM3 P;  5KZU A;  3WTK A;  2XQ8 A;  4ILA A;  3UQ4 A;  5AFM B;  2XQ5 A;  3UQ7 A;  4ILB A;  3ZKR A;  5BP0 A;  3RQU A;  4A97 A;  5BW2 A;  2XQ6 A;  5FJV A;  4BQT A;  5J5G A;  3UUB A;  5AFN A;  4HFI A;  4TNW A;  3RIA A;  5J0Z A;  2BR8 A;  3TLV A;  3C84 A;  4PIR A;  2XQ9 A;  2VL0 A;  2XQ3 A;  5LG3 A;  2YMD A;  2YKS A;  3U8L A;  3JAD A;  2BYR A;  2XNV A;  3WTJ A;  4ZK1 A;  1UX2 A;  3RIF A;  3ZDG A;  5LXB A;  5J5F A;  4QH5 A;  5JME A;  2LKG A;  2Y54 A;  4LMK A;  3TLU A;  4FRR A;  5HEJ A;  2Y7Y A;  3UU4 A;  2BR7 A;  4ZJS A;  3PEO A;  4AFG A;  1OED A;  2BYS A;  4EZ1 A;  4DBM A;  2W8G A;  4QH4 A;  4ZRU A;  4AFT A;  5HCJ A;  5BRX A;  5HEU A;  2XNU A;  5AIN A;  5HEO A;  3RI5 A;  3SQ9 A;  2LM2 A;  5L4H A;  3JAE A;  3U8M A;  2YN6 A;  4XHE A;  5HCM A;  1OED E;  4UM1 A;  4HFE A;  2XZ6 A;  2WNC A;  3WTI A;  3U8J A;  2PGZ A;  3TLS A;  3SIO A;  3WIP A;  4ZZB A;  3RHW A;  3WTH A;  4XK9 A;  2ZJU A;  5L4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...