3TLZA

Microcin c7 self immunity protein mccf mutant w186f in complex with adenosine monophosphate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINFNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 118
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlzA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlzA02
3TLZA 4E5SA 2AUMA 3TLBA 4MI1A 4MJXA 4JVOA 4INJA 4IIYA 4IIXA 4EYSA 1ZRSA 3G23A 3TLYA 3GJZA 3TLEA 4H1HA 3TLAA 5K99A 2AUNA 3TLCA 3U1BA 3T5MA 5F5XA 5FD8A 3TLGB 4E94A 3TYXA 1ZL0A 3TLGA 5F9MA 5F1YA 3SR3A 5JYBA
chains in the Genus database with same CATH superfamily
3Q72A 4DLYA 3I05A 3I09A 2BDEA 3GD7A 4MMYB 1Y5IA 2HC9A 1ZD5A 4Z9YA 4B5KA 3FZNA 4R68A 5AM2A 5JQGB 1XTVA 4YO8A 4KIGA 1L5ZA 4RZ2A 3VPSA 2W83A 5E8JA 1ZKMA 1TQ6A 9ABPA 3G5LA 2POQX 2GJ9A 3ZDXB 1EUYA 4LJAA 4J03A 1SEVA 1FDWA 1Q0TA 1GVHA 4X3PA 2W6OA 4G0YA 2PNFA 3UEOA 5JE8A 2X4LA 3NHRA 4OHCA 2C1EA 2ZRPA 3DCIA 1T5BA 5CM2Z 1Z38A 2ZJ1A 4G5HA 1IOZA 2PSFA 5CVDA 3TVDA 5I3CA 5CW1A 3ONWA 5IAKA 3BFKA 3OU6A 3G2HA 1GCUA 3RSHA 2VA9A 3NBFA 4BNWA 5A5GA 2V0GA 1NYTA 2UUCB 4INPA 2WSSD 2G04A 5DW3A 4BLSA 1PNRA 4MB6A 4J0DA 4DR2B 1XD8A 1XFAA 1SXHA 3CZ4A 2WQZA 1BWQA 4KN8A 5HTKA 2E5WA 2HA5A 1NV8A 3ADKA 3AGQA 4QJ5A 1O89A 4JI1B 3W5HA 2B0JA 3RS9A 2WJYA 2O8FA 1A5AB 2P67A 1E32A 1XQ1A 3E22A 3AEXA 3R5HA 4JI4B 2JJ8A 4LEIA 2CJFA 4ARZB 2MR5A 2NU7A 4F72A 4MHTA 4EYQA 1W75A 5LCXA 1DQNA 2P78A 1KY5A 3ZDZB 2EYQA 3O94A 3ZTYA 2PGDA 1PFVA 3ANNA 3E2MA 3VGPA 4UTPA 1DKUA 3Q6NA 2EOAA 3HADA 4PONA 5FBZA 2AX3A 4OXXA 5DCWA 2NUAB 1DQPA 1HKHA 1MOZA 2C96A 1N7HA 1U98A 2QV0A 3GFPA 3FJ1A 3N6XA 1XKTA 1V8OA 2B36A 3P26A 3AONB 4PYQA 4Q4HB 1ORTA 2G82A 4UARA 4UUMA 3UFBA 5ALXA 3ZGNA 2BFFA 3ZLTA 3NWJA 4EQZA 1H0KA 1P33A 2A1IA 2UZ0A 3QTTA 4GO1A 2C7GA 3FMOB 3I9V6 1ZLYA 1F8FA 4P2BA 3L6OO 2YX1A 3CJQA 4L5YA 4YRZA 1MTZA 1GUZA 4KXUA 4YCMA 1N5LA 1KI6B 1OFGA 3EDCA 2YUIA 4M3NA 2XNCA 1PD0A 4YMUA 1GNLA 3QU7A 4QDZA 4Q24A 2IS6A 3DP9A 2Q07A 4V0OA 1FJXA 2JBWA 4KMMA 4PFSA 5EOVA 5A3QA 1C3VA 1X0XA 5DOVA 2UXCB 2FK8A 1OT5A 3EFOB 2ZYVX 3EULA 3DE6X 1KXJA 4DA0A 1G2OA 3G2KA 3PDUA 1M76A 1ZK2A 3RC1A 4AG3A 2L69A 3HEAA 3FHJA 4EHNA 1VKJA 2PQ0A 3KEFA 1FF9A 3CN9A 4WA7A 3K9TA 3PS9A 4KR3A 5YASA 2LW7A 1PP4A 1UAGA 5LA6A 3T3DA 3R5TA 1K98A 2G17A 2EXXA 4MI6A 5BV0A 3PEYA 2VXCA 1G2IA 5TC4A 2YY5A 3TN7A 1W59A 1JJVA 5K3EA 2FPOA 3PKIA 4EEZA 1IULA 2DPLA 2IW1A 1QVVA 3R7BA 4D74A 4D8XA 2J45A 4AO7A 5LBTA 3SZUA 1DI0A 2L2QA 5C7YA 4BXOB 2GN1A 2DX7A 3CBGA 3T9BA 2FWAA 4KVAA 4BV9A 2ZVPX 3ISVA 3D3JA 3KU4A 4O33A 4YMHA 3WJ7A 3M5CA 1XE3A 3OCXA 4N0MA 4PBRA 3AP2A 2XEFA 1C7EA 3TJRA 3V8QA 1TYBE 3I76A 2A5JA 3LHFA 4TYPA 2AOVA 4IRMA 4W8OA 4AJJA 4GM1A 1N7IA 1U3WA 3LK6A 4PR0A 4TZKA 4E21A 1OPXA 3ZBTA 1KK2A 3SS7X 2NVOA 3N39C 1KARA 4AJPA 3UBMA 1NI4B 1SUPA 2BM9A 3HPRA 4IEIA 2YWGA 3O74A 3LBYA 3BXFA 2UVPA 1MC4A 2CXHA 4IMPA 3CEPB 4URFA 5AKHA 4HNUA 3QE9Y 2GCOB 2QB5A 3F5QA 4A0GA 4PC7A 3G23A 5ED4A 3NJ4A 2H8GA 2GUGA 2RGNA 3PHHA 1U1DA 1W0KD 2CLFB 1UQRA 4REOA 1E9DA 4MDFA 5CDSA 1LF0A 5L3ZA 1J2UA 1SBYA 2G4VA 4C6TB 2OBFA 2QM7A 2X58A 1S8AA 3GRPA 1ZL2A 1LPSA 3GUCA 4RS4A 3ZUPA 2WZDA 4L76A 4YCDA 4C2UA 1JQEA 3CB4A 4ZVRA 4I6EA 1I7SB 3PJFA 1I8TA 4CKCA 4G5SA 4ADSG 2VQSA 4Q9AA 1ZQ9A 3RRNA 3NYIA 1FFCA 1SCQA 3QOFA 1CS0B 1DT5A 2WFMA 2RCNA 2YMPA 4IDEA 5DKFA 2FFQA 4AJLA 4MRPA 3GAFA 4XX1A 4QXQA 1RC1A 4OFBA 1QONA 5HNKA 2UV8A 5AVJA 1SVWA 2G9VA 4OBEA 1N8SA 1YJ5A 2XCLA 2WJVA 2YKGA 4LQ4A 4J0CA 1UJ4A 2C07A 4E5MA 1JLLA 5DBOA 3SC6A 5HM6A 1B42A 1OWPA 2XX3A 2ZRAA 3LU1A 5D6NA 3CT4A 3ZNQA 4B40A 4MVJG 4ZIRB 3D6AA 4OJYA 4RTPA 4E1AA 1Y3AA 1EXVA 1S2IA 1RRGA 1TYAE 1BS1A 3MWLA 2WIBA 3W04A 3UAXA 4TUYF 2IXAA 2ZT7A 3ENWA 4B3CA 4CMJA 1JKJA 2V9ZA 1W5EA 2DH6A 2I0FA 3AEUA 3C1OA 4EJSC 3BD9A 3BERA 2B7LA 1Y3DE 5IM4F 5HDBB 2IYWA 2DMRA 4L3OA 1R00A 1R5NA 3BREA 5CFZA 3FSRA 1B15A 1BVUA 2E48A 2HV8A 2ZGVA 3JASA 3Q7TA 3VC3A 1S2MA 5D7NA 4LDQA 4CV1A 4Q5IA 4R01A 1VIDA 1YZLA 2OZEA 4LY9A 4AVYA 3HMKA 4N6OA 3M3DA 2V0CA 1EP2B 4UBNA 1Z5VA 2QJOA 3D8TA 4CR6A 4F2WA 4F3KA 2WINI 1KJJA 5DU2A 5I9SA 1AKYA 1IHUA 4NCJA 4JP2A 1U8CB 3E61A 2Q5QA 1I3KA 4NHOA 4EJMA 1I10A 4R16A 5AI5A 5A9RA 2PANA 3I0NA 1G8YA 2OB1A 3NHBA 4I9HA 3NCTA 4YAWA 5CVCA 5AKZA 4L8YA 4E15A 5HWSA 1M34E 4X00A 1QHSA 2QJRA 2OBYA 5AH0A 3CVOA 1W5FA 3P4XA 1KI4A 1A4IA 2H4JA 1RNLA 2QL6A 2RC5A 1WOYA 2TMKA 3C43A 1WMBA 4IHQA 4KSBA 4TV9A 3G0GA 2PL1A 4FR2A 1MTOA 2ZQ5A 2J9RA 2PK3A 2CYCA 3Q0IA 4RY8A 5JDIC 1US8B 2B92A 3QQ5A 5BNTA 1HR0B 2FHPA 4WA8A 5K51A 1H2AS 4MS1A 4TYQA 4XWAA 1NXWA 2X3FA 3G2NA 3DQPA 4NZZA 3S8YA 3FTNA 1J97A 2ZJZA 1Q91A 1EK5A 2YRFA 2Z04A 4OK5A 4XQ9A 4YCBA 1KU6A 1XTRA 3USES 2BKEA 2RI0A 4JFAA 4BVFA 1E2HA 2OQ2A 2QL9A 4B3HA 5JS1A 3RU3A 4D4MA 2G1PA 4PSAA 4NU0A 2F3TA 2QTNA 3DSRA 4JC4A 4PS1A 3B70A 1YRQA 3LW7A 3DEFA 4FN5A 4K0KB 3PJEA 4M9ZA 1PJ4A 3IEIA 3CLUC 4UCXA 4J0JA 3BIWA 4EG3A 4NPHA 3OC6A 2GTHA 4G41A 3ZGYA 1ZM2A 2XEIA 1XDZA 2IPXA 1O1YA 3ER6A 2DKNA 1WU7A 1OI7A 4HH4A 3RG8A 3OJCA 3SZOA 2K87A 2PV7A 1E5XA 1XHEA 3GJ4A 4YDRA 1S6YA 1CJSA 3DPSA 2YJVA 2JAWA 1TQ2A 1U3DA 2IHVA 3HNPA 4P82A 3H1PA 2CVOA 2VG8A 2YWJA 3RIXA 3MYRA 3SQLA 4BO3A 4F86A 3NOOA 2P75A 4RPLA 3ETGA 4XSGA 2O1XA 6REQB 3VAYA 4RDXA 3I6IA 5E9WA 2VJOA 5J2UA 4FGZA 2JBKA 1V9SA 2PT6A 2QE6A 4ENWA 3H9JA 2RKOA 3HO8A 1EJ2A 1HL7A 5ALIA 4G97A 1A2OA 1KAQA 4J2TA 4WXPA 5BSMA 4UTOA 3AU9A 3QXHA 4RBNA 3U16A 4JNCA 3CJTA 1XMVA 5A2QA 4M1SA 2JA1A 2O3UA 2WJZB 1D0SA 1F60A 1JSXA 4PRZA 2XE7A 1L5QA 3FM9A 5DP2A 1T1GA 2GETA 3BGDA 1NW5A 3EXG1 3FDIA 3ZV7A 2WICA 1ZRHA 4AZSA 5HXAA 1H2XA 5IHXA 2VQ3A 3Q10A 1OLXB 3RVNA 2CJWB 1Z2PX 1QHHB 2BSQA 4TS3A 4JOQA 3RTAA 2EX0A 4LPKA 2YFHA 3SQOA 5HIJA 1JWAB 4D0LB 2ACKA 2W2TA 4U9IS 5KDDA 4I2NA 1PS0A 1VKNA 4JHXA 4UQPA 4ETWA 3ZD7A 2GXAA 4BE4A 5LP6F 1V3TA 1EGAA 4GT1A 2VJAA 1KFCB 3ZDEA 3BMNB 3NGMA 1NJ1A 3LWNA 4MQFA 4OJQA 1QNFA 2FN3A 3QELA 4ZD6A 3KUCA 4MO2A 2GF0A 2MSDB 2Q3JA 1U9ZA 1YI1A 4FNAA 1ZVJA 4GUDA 2J7PA 2ID8A 3GDGA 4OUDA 5IAAA 2JGDB 1OLSA 5DF1A 2W00A 3FCCA 4NAUA 2P30A 4I1YA 1KZYC 5IPFA 2AFHB 5ELYA 1X6VA 3EOBI 1NV9A 4LF8B 1NC1A 4OEHA 5F12A 1ZMRA 1AS3A 4GBGA 4OBXA 3O1IC 4D25A 2Z09A 2I71A 5JHGB 1LPAB 1UJ6A 2OMEA 2HBRA 4E5VA 3HA7A 4IOJA 5JC8A 1IWOA 3CCFA 3CKKA 1FS4A 3RVMA 4YLYA 3CZRA 3PQCA 4G0OA 2VSXA 1X7DA 1OZ0A 3HZOA 1QSGA 4X95A 1CYDA 4YJGB 2X3YA 4P4GA 3J7TA 1UK9A 1M2OA 2HZBA 2C7BA 2X5XA 3IEPA 3OSZA 1P81A 2R751 3Q8XB 2HI0A 1ZGGA 1J0CA 3QEKA 1NXSA 3E3AA 5M3BA 3SDBA 2YFYA 1GAQA 2GX6A 3PE3A 1P9OA 1QH1B 4UJ3A 3H5RA 2PKXA 4CMHA 4EPYA 4EX7A 2IX3A 1V5GA 1Z45A 2OC9A 4NCXA 1RJGA 2KW5A 1N75A 1MQ8B 1T10A 2DUWA 2RGYA 1XCBA 5EXDA 4BZXA 2OCKA 4ALNA 2J0SA 4Q39A 5M2QA 3EXG2 4H6PA 3UHJA 3KC2A 4HPWA 3RIHA 3O8CA 1UJCA 4B2PA 2BI4A 2HMVA 3QF7A 1O58A 4LRTB 2BT4A 3K6SA 2CZGA 2V3CC 4M0PA 1CUAA 4B6SA 3R7AA 4TV8A 3UMJA 3S7TA 5LZ9A 5CA1F 5B4VA 2HGSA 2Q3FA 1VSVA 3L0ZA 3MJRA 3T94A 4ZYZA 4R8SA 4N0PA 1KF0A 3BORA 2YV2A 1KDPA 2XQJA 1UEJA 3FY4A 3L40A 1FLDA 1QFMA 3PKZA 4MNTA 3FZYA 1AQLA 3F7OA 4BQSA 2E4YA 5JARA 3PK0A 4TJVA 1Y9EA 1IXZA 3A9CA 1BCSB 5LP1A 2C8VA 2VZEA 4YQZA 3S9LA 4KZPA 1TI7A 5CEFA 1Y98A 2UXDB 1X9IA 1II0A 4Q01A 4UPDA 1NFQA 2P4SA 4U8HA 4HAUA 1G8FA 1P31A 1B16A 4RD3A 1GRQA 3TW8B 1ENOA 3HKEA 3EZ7A 4G0NA 4TMZA 3A3OA 3JD2A 4NBRA 1HZJA 1IH8A 4XWYA 2ZEJA 1T2UA 2CLIB 4GE0A 1POXA 3FTQA 4JJGA 4QA9A 4ROTA 2X8LA 4UHBA 5TSDA 4EG5A 4HVCA 1E3SA 1W1IA 3VDRA 3DMPA 2J5BA 3IDAA 3K5IA 4ZO8A 1B73A 2G4LA 3ZXUB 2IYUA 5FBVB 4C9AA 4M8NE 2G5TA 5CVTA 3ZWBA 3U3DA 1E9BA 2WWRA 1GYRA 2ZRLA 3ADPA 5AICA 4M9QA 4ZP1A 2CNWD 4CW7A 3BWBA 3H5IA 4CXMA 2F62A 1EMDA 1X3LA 5E6SB 4L16A 1VHTA 3GVIA 4P4TA 3IP8A 3GFQA 3M6LA 1WXDA 4XJTA 3L7YA 3I04M 1W36C 3KQKA 4HEHA 1DBWA 2CLSA 3PC7A 3VTFA 4P4IA 3RTBA 1KPGA 1G1MA 3T5CA 2ZBRA 2WHQA 3LGXA 4MYHA 4OGLA 1DIGA 3FUCA 1IHOA 1AK1A 1E0DA 1MX1A 4XVRA 4ZHQB 3NI2A 1OX5A 3CH6A 2PHZA 1JG1A 2JGJA 5JASA 1NF2A 1FTGA 3PQEA 4D92A 3NWPA 2HWGA 2J59A 2FU5C 2RGGA 4TKVA 5BQFA 1TT7A 1XYGA 5DI9A 5GONF 4EW2A 2ZQZA 3LA8A 4TTQA 3UBTA 3BE5A 3DZCA 3NP9A 2XGGA 4FKBA 1T35A 4EH1A 1ZX1A 2AD5A 4L5JA 2JBHA 4WXYB 5BVGB 2QLTA 4M9CA 4AFNA 3W5DA 2C9MA 4N5IX 3QFFA 3KT6A 4TPKA 4R2LA 3WGNA 1Q11A 2VSYA 1Z2NX 1D2NA 1M6EX 3R6WA 3G9TA 4HGOA 3R0VA 1SO8A 2Y9PB 3FYSA 1P61B 2CKDA 4NMLA 5JCJD 5K09A 2GP4A 1FP4B 3LLMA 4PFQA 4B7UA 3T9CA 3CLRD 1LLUA 2R7LA 1CUUA 4FDVA 1NN0A 4C3UA 4P45A 3FCYA 3RE1A 1U31A 3T7IA 4DLWA 2IXEA 2Z6AA 2ORVA 2OQIA 3EVGA 4U7HA 5J1TB 3WYNA 1Z75A 2PG3A 5BV1A 3B1XA 3DHVA 4S1WA 2GRUA 3ZV4A 2ODBA 1XKXA 1CB0A 1Q0QA 1MAWA 2HA4A 3JARB 4RPCA 5IC5A 3W6OA 4C7KA 4CN8A 1KI9A 4URHA 2A8YA 4URXR 4X71A 1X7ZA 5CAEA 3PUIA 5DBFA 1ONPA 1D5WA 3CEJA 1JXAA 3AIKA 1LFAA 1PFKA 2YJ5A 4G5GA 1E98A 1H66A 2BSXA 2NTJA 3CW9A 3NOVA 3IT1A 5DCYA 1T3SA 3KFLA 4UHHA 2FX3A 1QO7A 4HX5A 5AVWA 3NIWA 1NVFA 2XAUA 1TA0A 2ZVQX 4BKOA 1E2FA 3F7TA 2B0AA 4OXRA 5B6IA 3KWLA 4O2BB 3X1WA 3FWZA 4FMCB 1GWNA 1DV2A 4RD6A 4R0MA 3U7FB 2C7RA 3M81A 4HAIA 1E3DA 4IYRA 5TE9A 4TRRA 4E2XA 4MQ4A 4Z99A 4YASA 3AHIA 4C4PA 3TQOA 4X62B 1NMEA 2O19A 5LB4A 2QP3A 2J4CA 2NO0A 3NOJA 4IIHA 1F1BA 1GQSA 2VRBA 3SJZA 2EW2A 4RTMA 5JSZB 5C1PA 1G7CA 3ORQA 3KZNA 1N2OA 3T15A 5EPUA 1UZAA 5ALEA 1Z4MA 2YXNA 4NZMA 1WUYA 2ZS8A 2ZB4A 5F64A 3S9NA 1RAEA 1ELOA 3AUUA 3AERB 4KCGA 4X1KA 2WJHA 4REQB 4MITA 3S2ZA 3D8BA 3WKAA 1BDBA 1NVEA 2COUA 3HPQA 1PZNA 1VIVA 4PW0A 4PLTA 1QP8A 2AI3A 1S89A 4XPIB 1NF8A 4MUAA 3R3XA 2GGSA 2P7HA 4YALA 2B99A 1J23A 4NRDA 1ECPA 2FOLA 5DT9A 3P9PA 3FDXA 1N1GA 3U39A 1Q83A 4HDKB 4AJ4A 4WJLA 1Q0HA 5KQLA 4UE6A 1D9ZA 1O96A 4PF1A 1VRVA 4L9SA 4OYHA 1ZNQO 1UBRS 4IKEA 4KQ1A 2IXFA 1N1EA 4HDNB 4MQBA 4FGJA 2IOFK 3TE6A 3URMA 5FEUA 2J5RA 5B1SA 1NDQA 3NYRA 4MWSA 2O7NA 4X6LA 1SWWA 2VK2A 1R66A 4R2XA 1W581 4N40A 2QTVA 2D13A 1UFRA 2O5EA 3QNMA 1XHFA 3CEMA 3LRTA 2QXYA 1HDZA 3OU2A 1KPHA 1YRLA 2HSEA 2JJ2A 4PQRA 1E2JA 2AYZA 2JI4A 4WAUA 3KSZO 4MARA 5A7HA 4J7CA 2H1CA 4JJAA 4LZNA 3FCXA 3OQMA 1U2GA 2P41A 5FTNA 1C1DB 5AESA 3ADDA 4ZFNA 3SZMA 1L4HA 6LDHA 1JEYB 2B5VA 3LO5A 4XRGA 1RM5A 5BSFA 3T9DA 2AEEA 2Q5OA 3BIXA 1XMPA 2W2NA 2W7TA 1H5QA 4I46A 4BASA 3QH4A 3IEXA 3TQSA 1QE3A 2NYVA 2NYAA 2FMTA 1RQ7A 3CX3A 2AUMA 1RLUA 2C2ZA 2E9SA 4J43A 1H2EA 1H4VB 4MA0A 3QKWA 1ADBA 3RYHB 2KBFA 5JAOA 1PL0A 2EWMA 3BMCA 3A1CA 3CPJB 3JALB 4NBNA 1CUEA 2VPPA 1ND6A 4OQLA 4E4RA 3LVRE 3JAKA 3A14A 3PNOA 3VKVA 4AO8A 2OVFA 2XRYA 3OX1A 2PZKA 1WG8A 2NVWA 3W7VA 1U81A 5ADWA 5A4IS 4BO0A 2GPBA 2GT1A 3MT0A 4P3YA 1GG2A 2P1RA 4OQPA 3WA6A 4FJ1A 3KJZA 2WAMA 4NCHA 3IP3A 4E11A 5IAOA 1ZESA 2B83A 3KTOA 3E70C 5KJCA 3QITA 3EZ6A 3OKCA 1DWQA 4INAA 3MERA 3KQMA 3BRCA 2DPYA 3O8QB 4UKDA 3K5HA 3TG8A 3IE1A 1TPYA 3I61A 2DR2A 1IN1A 4CM3A 3QHQA 5BN1A 1DX6A 4M9UA 4PAOA 4MV6A 5LOVF 1U3FA 1XBTA 1UK8A 1DZ3A 1CY8A 4E1BA 2BISA 2PRIA 4M0KA 2VCEA 1P2TA 3WAGA 1AXRA 4S12A 5IF9A 4O1IA 3VAAA 3I12A 5H70A 1WE2A 4PZEA 2IZ0A 4OYLA 1EJBA 4B9AA 1KEZA 1G2QA 1LWNA 1BG6A 1NR7A 1V25A 3KXKA 5ALKA 3M83A 5FUXA 4AQDA 2FN4A 3LLUA 2YBEA 1CUJA 1IN8A 2FRXA 1HQKA 3LBHA 3KSMA 3EVTA 1T3TA 4MGKR 2CV2A 3D7DA 4TWBA 1TK2A 3EAFA 1LBQA 3GB9A 1U2TA 1UK7A 1FP6A 3DBOB 1VYHA 3HYSA 2BFBB 1BX0A 3OG9A 1BX3A 1YRAA 4A1FA 1LF5A 3IAAA 3D4PA 2VT3A 5IK2D 1JAHA 3BMQA 4IO0A 1E18A 1WSBA 1A8UA 3D8UA 2J0UB 4IW3B 1GUAA 3GDHA 2O7QA 4MUEA 4U6NA 1TIBA 2WWVD 3T4XA 1C0IA 5KOYA 3OZBA 2EKPA 2GK4A 2DT8A 3OFNA 1ACJA 2QRUA 4WK2B 3U09A 1QCDA 4CMEA 4EX6A 3ZZUA 1T26A 4RKEA 4DDTA 3L8HA 3R3HA 1QU2A 3PUXA 2OA0A 1V5EA 4R8LA 2OK7A 5HKKD 1CIPA 1EUCB 1X70A 1WHTB 1TU4A 4KTVE 1LJLA 4J9UE 1LBTA 4RSMA 1ONBA 3ILXA 2XB6A 3ZVMA 4CU5A 4HZIA 2FPUA 3NR2A 2I1VB 4Q3NA 1YASA 4LWOA 4C4TA 4F12A 4I9NA 4DT1B 5JZSA 3C8MA 4Q3DA 5J59A 3VVBA 1QUFA 5TT1A 1JHZA 3W7AA 3DWGA 2PFSA 3B6JA 1BJRE 3OJ0A 1FDUA 3I4FA 1MVLA 1FNBA 1VPEA 3BE4A 3F6YA 3PQ8A 1DAKA 3CWCA 4HYYA 3M4JA 1PQYA 4E4YA 2VTEA 1H2WA 3D31A 4WXHA 3DLBA 1B74A 2DUJA 5C8VA 2UXBB 4S35A 2NXNA 4LVNA 4HFNA 1TUIA 3H99A 4E13A 1AKEA 3B2EA 4J4BA 2V55B 2OV2A 2QRLA 3MJTA 4C4AA 2W6MA 1FYFA 2Y05A 5AVKA 3TZEA 4F4DA 2B8JA 3UWKA 1P6QA 5KKNB 1WMSA 2IPMA 1J8QA 4P36A 2XOEA 4HDQB 2ZWPA 4OG2A 4U7DA 1O5OA 1NE7A 3DTYA 4JOSA 2VQEB 2FSPA 3R24A 2OQRA 4GOMD 1YBHA 3LA6A 4BVKA 2O8BA 4MJ7A 3WB0A 2MR6A 1GADO 1IAVA 4EWLA 4O4IB 1A9YA 3OETA 3T5PA 1C9YA 2HHAA 4IDOA 2G83A 4AF8A 1SRQA 4C07A 2UYQA 1OWNA 2P65A 5JRJA 3G0HA 2G9QA 2H63A 3C6BA 1ITZA 1L4NA 4OO3A 1F20A 4AZ3A 5GTDA 4A6PA 1FFXB 4ZV4A 3TCKA 3CUVA 2FF7A 3UGJA 3PP8A 1I2CA 1HI9A 2GZRA 3E6AA 4PO8A 1LPNA 3KTAB 2AB0A 1MABA 2XXJA 2JIQA 2OO5A 5JMTA 3WIUA 1WRBA 4EMUA 5AVUA 3CE9A 3Q7SA 1WPQA 1NBMA 3QYPA 3ZQKA 2QSUA 1E2PA 3NXKA 1LBHA 4N47A 3EGEA 2ODEA 5CVUA 3C15C 3AUXA 1AE1A 2Y1OA 4BNIA 3D7HA 1QS0A 1HLFA 2E3JA 3QE2A 4U8GA 3KAKA 1ADYA 2AXEA 1SVUA 4WBNA 2QYOA 1UP4A 3L0IB 4YRLA 4R1NA 3TLCA 3T4PA 2I6UA 4NH0A 3LX5A 3C7DB 3OEEA 4JROA 1E79A 3KNZA 1E1QA 4JBXA 4FFBB 4EQ6B 4AJOA 5HK9A 4D96A 1XF1A 2WMYA 4IDQA 4EAAA 2C2XA 5BSVA 2ZBFA 1PK8A 1W35A 4GP6A 3FCEA 3RHZA 1ESDA 3HBJA 3LT2A 2P5TB 4CDJA 2ZE5A 1RP1A 1GL3A 1Y8CA 4Y6OA 5F4BA 4JB0A 3OESA 1A50B 2ZYUX 4N54A 4EW1A 2JCXA 2FZLA 4DB4A 2A94A 3MJEA 1TC1A 2RGWA 4AI6A 4WINA 7MHTA 2ZT6A 4Y2YA 3F4BA 4QATA 3AF5A 3WBFA 1RAFA 3MCVA 2IXTA 1COWD 5DTEA 1RXUA 3DEAA 1KJ9A 4IQ0A 3EGCA 4DRXB 4RVOA 2I6FA 5LKAA 1JWBB 4LX0A 1M1UA 5K05A 4HATA 3FOWA 2SKCA 5JY6A 5KHOC 3TIFA 2BI8A 2MIIA 4ZQIA 1J8MF 2J5QA 1ARZA 1ISJA 1XDBA 2YYYA 4CDNA 1U28A 3A6GA 1F06A 2ZSUA 4N8DA 1I30A 1BA3A 4QO8A 4NU5A 4DNPA 1TX4B 2R2AA 2W8BA 3QMMA 3DB1A 4FEYA 4COGA 3V55A 4H31A 2ZRQA 3WNCA 5M04A 2A1TR 3VJLA 4UEJA 1F4LA 1XT6A 5HF6A 1YA4A 1DC3A 3RDPA 1RM0A 2H1LA 1KZ7B 1P1RA 1QQ6A 4H4CA 4GPBA 3STYA 1MPXA 3NVAA 5CVVA 4KR9A 2WA2A 4LMBA 2F1HA 3V7YA 1SBTA 1QE0A 2PU7A 1QC5A 3OICA 4TXMA 4YDQA 1ZMOA 4OGKA 1AKWA 3CKYA 1SQGA 1ZD8A 3IVGA 4FE7A 3DHYA 3S7ZA 2ONZA 2EFGA 4KW7A 3O7MA 1UKAA 3OZFA 5EJ7A 2CNDA 4YRDA 4B81A 3RF6A 3GLHB 4OSOA 2OHHA 3A1VA 5BNWA 1NSYA 3VPFA 5C37A 2JA2A 4ZEOA 1QFJA 1QUEA 2W2XA 4K0RA 5J40A 1KVQA 2NV2B 5AKYA 1EBBA 5F52A 1XQ6A 2B7CA 3AEQB 1LQTA 1Q19A 4TTJA 3OLVA 2OC4A 1E7RA 1CPYA 5LA6F 5EJ6A 4BVBA 4WZAB 5K1ZA 2I65A 1Q0SA 4AZ0B 4GZ5A 3DZDA 1N9GB 4QYXA 1R0CA 4EZBA 1V43A 1L9XA 2UUOA 4XR4A 3AOGA 3DAYA 4EA7A 5IVPA 1EFAA 2X2PA 1DCTA 2WE8A 2SECE 2HIGA 3T5AA 5F9HA 5C1IA 1OHHA 4A8JC 1SN7A 4RHUA 2AN4A 4IY1A 1USIA 2H0AA 2BJHA 1KRHA 2IYRA 4HQFA 2HTFA 5TPZD 1LZKA 1V3UA 2Z43A 2GN8A 3EAQA 2VTKA 3PGKA 4O2AF 3CLTC 3SKXA 4AD8A 3WGZA 2NWQA 1HG0A 3PI7A 1S2OA 1OXBB 1N8TA 4TVSA 1A97A 3A4NA 1D0IA 2H7VA 3IQDB 1YONA 3QKRA 4MKFA 4R8VA 1ZITA 2GLXA 3MILA 2XTMA 1PGQA 4MUYA 4Y9SA 1XVUA 1SXQA 1PQPA 1DRUA 1Z56C 1JFRA 2M32A 3FBTA 3JQ7B 3OZSA 3JYLA 1ZR2A 5JXIA 3RSOA 2H2IA 3L5KA 1DOHA 1P0IA 3N5CA 5AJHA 1UBOS 5JECA 1GPNA 2BFEB 1QVWA 4RC9A 1JF8A 2AF4C 4CMEC 3HJBA 1SD2A 4R4JA 4B3MB 3FFXA 3GUHA 4Y9DA 3FMIA 1Z2AA 2ZTSA 5BT8A 2DWOA 4BQQA 3QV1A 2FFHA 3ZG6A 2J4FA 3SZLA 3UGQA 4EGJA 1O54A 3UV7A 6ADHA 1H9CA 5KSWB 4ZZ3A 4P4EA 2E85A 3DCNA 4IXWA 1XRPA 1U5CA 1P0QA 3K1ZA 2VJLA 5KJ6A 1WMFA 3R0IA 4DNXA 2O0KA 3EIHA 1FRNA 1X3SA 4B9EA 3MS4A 1C41A 3F8TA 2IA5A 3FRIA 5EYPA 3U49A 4EUKA 2VNSA 1E1RA 3LECA 4C7BA 1VCNA 3QW2A 5EWLA 3TJZA 3I1YA 5L4NA 5J3JA 1NIJA 1K5PA 2ZIWB 4H3SA 2I4LA 4Q7KA 1B6TA 1SQ6A 1C80A 2VF4X 3IAM1 3AM3A 2NG1A 3W0LB 1BVHA 2ZCVA 5GAJA 4MW4A 1E5DA 2ET6A 4HZUB 2UZ1B 3V4PB 3AB3A 4BY9E 2AI1A 4NP6A 1XCLA 3B52X 3K8ZA 4DR1B 2NUBA 3WLJA 3IRUA 5A3JA 2ZB2A 3GMDA 521PA 5SY4A 4TLMB 4M6WA 2WV7A 3RFFA 3PD0A 4EPTA 1Y4ZA 4A91A 1IEQA 3KELA 3OX4A 4L0QA 5AOVA 1KC1A 4PYIA 3A9VA 3RS8A 2QXTA 3K2QA 1E9RA 1S4QA 3PICA 4NBLA 3ZBUA 1CBUA 4FFMA 2XMCA 3M33A 2YWRA 1V7ZA 4HGRA 5FPPA 4DXHA 1TUEA 3A1NA 5LYJF 4YQEA 4QDOA 4PG8A 1NY6A 3HJAA 2HBZA 3RFUA 4TTPA 2WYIA 3A4IA 2XT9A 3B1YA 4NYMQ 1BQ4A 1JQAA 1CX9B 4D0RA 4RJ2A 1IBLB 4MKGA 5HSGA 4J1SA 1E3TA 3GBSA 3PYLA 4NOJA 3HDYA 3JATA 1FMLA 3OBBA 1Q1AA 4M9RA 1EHIA 3J81A 2QG9A 1U4OA 3ABIA 4JLOA 1UBMS 2HHJA 3S8EA 3QX3A 1M8GA 3F3KA 3ML1A 2XXAB 1WQ3A 3GN1A 1QO0D 1A8QA 1WAMA 3L84A 4P80A 4Q93A 5F5NA 3RBXA 3ZZNA 1IXYA 3IL2A 4KIWA 3V1KA 4MXDA 1RYDA 1X8JA 1YDWA 4AT1A 1G64A 3ZCQA 1DPGA 3ZJ4A 1E0AA 5BW8A 5SV2A 4TXLA 4JR1A 1P0CA 1CS4C 4OU5A 4Q05A 5EJAA 1M1YB 4PPNA 4PG4A 1GEGA 4RV9A 4XA8A 1E6CA 2DWCA 4HQKA 4PQYA 2FRVA 1WSDA 1XVTA 4X3RA 4YP7A 4YJ3F 5CG2A 4XR9A 4TWEA 3F6PA 3VMFA 1G4UR 2X5JO 4X8MA 4XOIA 4IIDA 2FB9A 1JFVA 1FRZA 2GBLA 2GQ0A 2WU3A 5LOVB 1J0BA 4DG8A 1GG9A 2BEVA 4ND5A 3DTNA 3L8MA 5THXA 3OQPA 4TRNA 2H1RA 4DW8A 3GLIB 3SEQA 3E9CA 3G6KA 3AHJA 1XCMA 2EKZA 2XUZA 3DXXA 2QD3A 2CBZA 3O1JC 4J07A 4D80A 5BOSA 5BVHB 1EUDA 3CYFA 2B7BA 4WOKA 3HR7A 4G5QA 5EZSA 4AMGA 2OBNA 2JD1A 4AMYA 2Q4RA 2HIMA 2WPDA 4INJA 2QMOA 3OFVA 4XYGA 3TWOA 1MX5A 4AP5A 2IHKA 5LZ2A 2WU8A 3OZDA 1C3JA 4TMFA 2GAAA 3S70A 2QQEA 3NAMA 4PFJA 3KEOA 1ATZA 1U28C 3IWWA 1QOZA 2XEDA 3DONA 1HOXA 4TLEA 1NONA 2JFHA 4JS0A 3B1WA 1R15A 4ZU3A 4YT8A 3AOEA 3P2EA 3AF0A 2OAGA 4J0QA 4UNQA 2NZVG 3FI0A 1PK9A 3H2HA 2JIOA 4PIPA 1YQXA 1WCV1 3CSUA 3E9RA 5DBHX 3ZWYA 1SU7A 2ECOA 1QFYA 2P35A 2FVYA 3TMAA 4CHGA 3IMKA 2LZ0A 4XGKA 3TSOA 2Q9BA 2XDAA 1A8PA 1I9CA 5CIQA 1DJLA 4R1UA 1ZRMA 2XEGA 1ISMA 1GZSA 5JOQA 1DJPA 1U6KA 3H1AA 4RE6A 5I4KA 4YHHB 2CDRA 4WLOA 4B3GA 3T0TA 2D1RA 2AOTA 3L04A 1W4LA 3PA6A 1RLOA 1SIWA 1ZWKA 3SS9X 2C03A 1AA9A 4G1MB 3NYWA 4IRUB 4BMCA 4MV4A 1L1QA 3NRJA 3S2FA 3UICA 1WETA 2RBEA 2R8OA 1XI2A 5JQGF 3WOHA 4B8ZA 1E3LA 1F38A 2G07A 4P4BA 1AMNA 4QOSA 2WWTA 4UHJA 2A88A 3HZRA 3JQAA 1V2GA 5IWAB 1ESEA 2WFLA 1CNMA 1N0UA 1SHUX 1VOTA 2GPSA 3EGIA 4PTZA 5IAEA 4B6EA 4F0JA 1KXZA 1A4RA 3ZE6A 3X43A 2H3HA 2Q5CA 5A3SA 4N5MA 1N5DA 3O8NA 4YJDA 4CWAA 5C8ZA 1LI5A 1YRWA 4RGVA 4P7BA 2RHWA 1DAOA 4GLLA 4JZYA 2XE4A 3IIEA 5K0ZA 4Z0PA 2H1OA 2JGFA 2NZXA 2H7YA 2PEYA 3D8HA 4Q4AA 4RF4A 1VBNA 2DT5A 3C14C 3GVPA 4X20A 3SHFA 2EG9A 3BM5A 4KI0A 5L6MB 3DDNA 4UM8B 4GPTA 1VKOA 3G9QA 5EE0A 3HL4A 2WD7B 2A1UB 3JTMA 4KXQA 4AN0A 2KYRA 3O47A 5IZCA 4QQFA 3AG6A 5G1OA 4MS3B 4QASA 4A36A 2DSTA 1JXMA 1T5TA 3G8YA 3M4NA 5DO9A 3IMCA 3DDCA 5C34B 4TM7A 4KK4A 1OQAA 2ZW9A 4G0QA 2EZAA 5LP6A 1KQGA 3JAWA 1I3CA 4HWRA 4BVHA 2Q1XA 4ZARA 2WQ6A 4P44A 1QX3A 2WZCA 4X65B 1E61A 3EGOA 3ZV5A 3NMUF 4C8FA 1W7AA 221PA 4QNNA 2V3WA 4Y2GA 5B4UA 5IW8A 4CQMB 4Z9BA 1FC0A 1D1SA 1GKYA 4AULA 4FINA 4M7PA 2MINA 4P3OA 5GJBA 2ONKA 1N2CA 2C9CA 3SYLA 5K2OA 3TLGB 4MUKA 3U7RA 2RH8A 4BNKA 2PFKA 2I87A 4Q4JB 1RYNA 5J23A 1M1YE 4A0RA 1VLZA 3L8CA 1QCCA 3K15A 4KXVA 1P5JA 3OEHA 1X7WA 1AO3A 4TYWA 5IUJC 2J09A 1Q1NA 3GLQA 4AX4A 4CQNA 2VYVD 1CQIB 5HZMA 1EKXA 1E6UA 1R10A 2NPIA 1F12A 4RYLA 1JJIA 3SLKA 2IT1A 3SHQA 2Z9CA 4EENA 4GYKA 1I4WA 1T5IA 1QTQA 1DMRA 4R31A 2Q8NA 1YVPA 2IYVA 4TJXA 5A3VA 3TINA 5DHFA 1PNQA 5TPWB 1UK6A 1E9FA 1N4AA 4WFIA 3BWXA 2LPMA 2OHGA 2X1LA 5J43A 1CF4A 1XCJA 3TLJA 2QK4A 1GTZA 3M1IA 3S28A 1HQDA 4JBNA 1L0BA 3LNCA 1XNHA 3KB6A 3MAGA 4JLDA 4KBFA 4D8VA 5IN5A 5TMBA 1TB4A 4H7KA 4RO0A 2WUGA 1GR0A 3U1VA 2Y2VA 2AT1A 1WCIA 5JSYA 3WQBA 4Q1VA 4DA6A 1H1TA 1JQJC 2A35A 1K4MA 3Q7EA 4UTXA 3ZQ4A 1HXHA 1KGSA 4NDZA 3L6UA 4IP0A 3RKRA 3QVJA 2FOXA 1KIFA 3NWBA 1QIKA 3QKSB 5CHYA 4EY8A 4EA6A 2E21A 3A70A 3VI4B 1BYIA 3FOZA 1NC3A 4IMIB 1HFWA 1YR6A 3TDMA 4IQFA 5HJ7A 2A3NA 3AY7A 3OLZA 3LXUX 3AK4A 3ZDAA 3T7TA 1USVA 1YD7A 1WA5A 3K72B 4NG5A 5EEGA 4PIMA 3JQGB 2CLDX 4PFKA 1B76A 3IAUA 1KDTA 5HS6A 1YMUA 3WBKA 1XSEA 5FXMA 1N2XA 3HYNA 4KMSA 2JFFA 4TM8A 4B6PA 1DX4A 2R87A 3FUUA 4V0KA 2BN4A 2BHRA 2YZGA 3LQ2A 4CKXA 1Y9ZA 1SMKA 2KE5A 2C98A 2WSSA 3MWFA 3CB2A 2HUPA 2HY7A 1JNXX 4O4JB 4QQNA 3I8OA 1O94D 2NSHA 3PSHA 5H3LA 5JNTA 1YIDA 3TI9A 4BMNA 4EL5A 4OFXA 3ZWNA 2VCYA 2PUCA 3RNOA 4XGQA 5JUWA 1K4YA 1RXCA 3KZMA 1QBGA 3QV2A 1EDZA 4K87A 4HDMA 4MW1A 1YOBA 3RTEA 2UUAB 3ZJUA 1X1AA 2JAHA 2Q4OA 3PXCX 1BDJA 2DFDA 1NM5A 5HIIA 2A1TS 3BH7A 1GVNB 4HQ0A 4FT4A 4UBKA 4C06A 4D46A 4ZC1A 1VJ5A 4JMLA 4CKEB 3DMYA 1R2QA 2BGGA 2EEPA 2VXYA 5T64A 3BAZA 3CX4A 4M9XA 4PX2A 1R9GA 1TVCA 4DJEC 3TB4A 1SBHA 5C35A 1FDVA 3QUBA 4FB5A 3LP5A 4OCZA 2Y77A 3IEMA 2BZ1A 5KOJB 1G5HA 3MTAA 2VXBA 3Q8KA 4J0NA 3P20A 1FSSA 2JGMA 2NZYA 3ORFA 4L73A 1BCRA 2QLBA 3A4LA 4XDHA 5KJ1A 3QWAA 1DQSA 1EX6A 3C3KA 4QGSA 4OPMA 3DR5A 3FWYA 3RS3A 3O3NB 1K6JA 3K05A 3EF1A 4B46A 1E9VA 2GBLC 1DFHA 1XZLA 3DQZA 3R5KA 4MUJA 4QPCA 5D86A 1CE8B 4PZ9A 2EIHA 3DA8A 1K6EA 3NASA 3C0KA 2XUDA 1V37A 2Q3BA 4PG7A 3R6DA 3TIVA 2YW2A 4HLNA 2FGJA 1H8ED 3PNMA 3LFHA 4DCSA 4WGFA 3DFIA 4PXSA 4GLJA 5AJZA 1OGJA 3ZHOA 3MWEA 3W6ZA 1BHQ1 4O0MA 5EIXA 1X74A 1XTBA 1UJ5A 2CV0A 3GQVA 3PFFA 5AP9A 1G21A 2ZUBA 3PGVA 2JIBA 3EAGA 1FNMA 3MK31 4U6SA 3PJGA 1JECA 2ID7A 3BXPA 3SD7A 1SHZA 1CZHA 3IP5A 3TNFA 4D42A 4RVNA 1AMUA 2HU8A 3KE8A 5F73A 4C1BA 2I7CA 5TIIA 1J9ZA 4QUGA 2VDUE 1CUXA 1JR2A 2I33A 3UY4A 5LFAA 1LDEA 1GCIA 2HJHA 4I5DA 3GN2A 4N7MA 1N3BA 4ZTZB 1JI0A 1XZCA 4QJ3A 1A1SA 2NQ2C 4IWNA 3KQHA 1XJ0A 4LHVA 5T3UA 1M2VB 1KMHA 4U7FA 5A03A 4CM1A 5A4JA 3ILYA 4ZCSA 3GT4A 3GLFE 5IEJA 1QE5A 1XDGA 2D62A 4NGTA 2DLNA 3WKEA 3BGVA 3FPAA 5IXYA 4GR9A 1Z4NA 3ELUA 4U7TB 3TSAA 1HE5A 4D3DA 8ABPA 5ARDA 1Q3HA 3H17A 2PLAA 3DCJA 5E4TA 4JEIA 4YAIA 3VZQA 2IUUA 3F9RA 4NNJA 5IKXA 4JBYA 2X2FA 4QYIB 4C9UA 3RFVA 1N2BA 5IJAA 1Z5PA 3VTAA 2I4TA 3PE4A 3ZK9A 1KSFX 3MM4A 4EJSB 2W2MA 2YHIB 2F1JA 3QA3E 1ZOIA 2DHEA 2GEFA 2QTLA 1Z07A 2R65A 1Z4JA 4WWHA 5CLIA 3WYAA 5AJWA 4WKPA 1AN9A 1MZVA 2FUEA 1XL0A 5DSZA 4A0QA 3AY6A 3ZEAA 4JIGA 3SMVA 1W0KA 3I28A 1Q5XA 1PDVA 5GVSA 5A5EA 3B9PA 3UJ7A 1WDTA 1P45A 1TO6A 2W4QA 2VHWA 3KPWA 4IIJB 3FKSD 1PEYA 4FDUA 2OPHA 1KC3A 3V9AA 1OD6A 5FLXA 2WB2A 4FPXA 1SIOA 3AH8A 1NXQA 4W63A 4W5NA 3WBJA 1O3YA 2HXYA 2REQB 5IZCC 1AKTA 2M6SA 3ROKA 1IVSA 3ETDA 5JBIA 1VBKA 2ZRDA 2PUVA 3NBQA 1R6UA 1MVOA 1RYMA 3QBJA 2GAOA 2HA0A 4MR8A 2C4MA 1GPMA 1XWWA 2EL9A 2Z8YM 2LGJA 5JYEA 3MGKA 5F2EA 2XUOA 5C0OE 3KWMA 3TTUA 5LDHA 3ZHYA 3P5BA 2KHZA 2OZLB 2XA9A 4QQRA 3IHWA 2P27A 1YBFA 3I1JA 4RENA 4YAUA 1MAAA 3O8RA 4XCXA 1TM3E 4GXQA 2HMTA 4RM2A 5J58A 1J2RA 5FR2A 1ZCJA 3G8BA 4LJLA 1SUAA 1Z06A 1KBZA 3SX0A 2DBVO 2Q7OE 2HO4A 2R6AA 3DNFA 4AS3A 5BY2A 2RFLA 3IXMA 1W4BA 3PFNA 3Q7PA 4J0FA 2CLHB 2FPIB 3NHKA 3D7MA 4BYMA 3T7AA 4R8RA 5A5VA 3SFZA 2YN2A 4KFRA 1IMJA 4OX9B 1K92A 4WCFA 3I3SR 4NGNA 1SBNE 2GZ1A 1DUIA 1S9DA 2AK3A 2QVZX 2ZI9A 4G1EB 5H68A 5IP5A 4YI3A 1E5TA 3NHPA 4W1SA 1V6CA 2CMKA 3LYLA 1LEHA 3WJAA 4I99A 2OOTA 2EBHX 2ZSJA 4BO2A 3BJZA 1H69A 3OE7D 2Q0XA 2XQVA 1BO6A 2P2CA 3CRQA 4NOLA 5AFSA 2C3OA 3X1JA 3OZ7A 5DRYA 5IG2A 1QV7A 3HC7A 3E22B 3FCOA 4ID3A 2FPRA 1ZFNA 1TYEB 4JAVC 4DQVA 2DUNA 2R6CA 1GD1O 3RJMA 3V8VA 3ZE7A 4W5OA 3SYKA 2ZE6A 1U3UA 2E28A 2JI6A 4WZ6A 2PUTA 3OP4A 2JHFA 5LC1A 4WFKA 5J1SB 4DEXA 3PNQA 5FRDA 2BFPA 3N7TA 1LVGA 3EPRA 2E4VA 3DB2A 3I72A 3K96A 4RK6A 5KINB 1W1WA 1PEKE 1B6SA 1CDDA 4FLEA 1T4BA 3PNVA 3RQSA 1NJSA 1U5AA 1ZGHA 3DEHA 2BFFB 4Q9NA 1WY5A 5GZ1A 1BWPA 3GJ8A 3NPMA 4OJKA 5H02A 2WOJA 4MI9A 3F74A 2ZIGA 1R0YA 1RQXA 3AVQA 3MTDA 1BQ3A 1TKBA 3MRSA 4LNUA 3K8OE 3GF4A 1YQ9A 3CMMA 3B6EA 3OPVA 3MTJA 4HUTA 2FG7C 1BFUA 1VHQA 2HFJA 3COPA 4YRCA 4EK9A 1MIOA 1MUUA 4RF2A 1F0NA 3SZGA 4ZCMA 2XUPA 2R79A 2W0MA 4R7ZA 4P3PA 2IIBA 2YHSA 2A5LA 5DYTA 4BLRA 3BXXA 2BGUA 2KS6A 4RABA 4BGVA 3HFGA 2H5JA 3ADOA 1C50A 4XGIA 2BGMA 2G72A 3IERA 4YA6A 1C5KA 2YUTA 3G0BA 1G8HA 5KAPA 4EW3A 2NO1A 3SNHA 4W5JA 1Z2OX 2VWGA 5GM2A 3KZOA 3KKKA 4UZSA 4YRPA 3VXKA 5B37A 2ZRHA 3UYKA 1EDDA 1X38A 1PUXA 3OCZA 5DGHA 3GFGA 3NRCA 1Q0ZA 3R09A 4IJMA 1KHTA 5H81A 3PC8A 4N49A 3SR3A 4IXDA 3IR6A 5AW0A 4BX2A 4HLQB 1NM5C 4ARIA 1ID1A 2AXNA 1GGVA 4JCCA 1A9ZA 4QYSA 2IEBA 3G0IA 1LH0A 5AVVA 3CN7A 5F23A 2Q3DA 5KNDH 1D4AA 3SN6A 1AUXA 1CQJB 3HR4A 4QTZA 4M8DA 3D2LA 1BD3A 2YZKA 4JT2A 3C7TA 4IQ8A 1C4KA 5E9AA 3EQZA 1XQWA 5ABPA 3LZ6A 2B20A 2C4TA 4HB0A 3ROGA 2VTVA 3Q5DA 5H80A 4UDOA 1ZJWA 4N3BA 3DMRA 4C8PA 1B14A 1B3BA 3E1GA 2C4KA 3PYXA 4YGYA 5JRDS 4I50F 3RU2A 1W49A 3D8RA 3JQ6A 1J9GA 3FBWA 3O6VA 4FYWA 5K3SA 4BMXA 3LT5A 1HQYE 3D3WA 2EGGA 4LHEA 1W6RA 4O59O 3SHWA 4CUKA 2VP5A 3H6HA 4B09A 4QT4A 4ZMBA 3G79A 2Q8QA 2ZFUA 5DYIA 1ZP6A 4DMKA 2UVPB 3LCVB 5FT9A 1DQYA 2BZGA 3QU4A 5IULC 3BJRA 4F3YA 2DAPA 2GAIA 4L74A 3DE1X 3EFHA 5HQTA 4YRRA 4GQIA 3BHIA 3LI2A 2CMGA 1QF6A 4MEJA 3Q87B 3KV3O 5CB4A 3KR0A 3NEYA 4P0PB 1E1LA 2EP8A 2WTNA 3L7MA 5IKOA 3FNHA 4PZDA 3WS7A 2R00C 1II9A 1DO2A 3VR5D 3ZD8A 2HR1A 3PXEA 1P5ZB 2WF6A 3IRVA 2QRZA 1DVRA 1GQQA 1DNPA 2C3UA 5I8PA 4LF9B 1CNEA 1M2JA 3EEFA 3GPCA 4HQLA 4KE9A 3C2QA 4OLJA 5I9MA 4A2CA 4Q9LA 4DXDA 3X1DA 3VAZA 4DG9A 1ULSA 2QMZA 4AKIA 1SELA 4RJKA 1R4ZA 4DDHA 1DPFA 1MB0A 3ROFA 1DCFA 4TLCA 4Z0HO 2DJ5A 2WAXA 1JA9A 1RP7A 4OHXA 3CX6A 5ECGC 1NQOA 2LKCA 3DPIA 1CDOA 1YB1A 3ES9A 4EGCB 4HDCA 3PFGA 2OLKA 1XZPA 5CXUA 3LWDA 5JVLA 2O5VA 3G2OA 5HUJA 2IBMA 2ONYA 4XWWA 2DKOA 1T9BA 4MCQA 1QWSA 4FBGA 2CHUA 4MKZA 2YV5A 2AW5A 3QEMB 1XKQA 2R6ZA 2OM2A 1JKJB 1KA9H 5ED0A 4EHJA 1EQ2A 2JANA 4CI9A 4M0EA 4QDXA 5HFNA 4NE7A 1OGYA 1J8YF 4RVFA 1LVUA 2O07A 3JASB 1H8HD 2MCFA 4AJ2A 2LBPA 5F3RA 4AS2A 5IDWA 1Y8QA 2I91A 5JO0A 3U7HB 2H0QA 2JAPA 3RLFA 5FPHA 1K0UA 2O8CB 3PSAA 1FIUA 4WOCA 3ETJA 5EERA 4IOMA 4JL8A 2AJTA 3FPJA 4RHYA 1TA4A 4FR0A 3WYDA 1CFJA 4CTKA 5LL6P 3KAQA 4KQHA 1D6JA 3GCZA 2GFIA 2XDQA 4XTCS 4MUMA 1USKA 2EBWA 5K3AA 5TGZA 1CJUC 2NU8B 4BZQA 1KMMA 2FETA 4P4LA 1Y6QA 3GFOA 2BHLA 4IKPA 4CDKA 1I7PA 1J8DA 5BO5A 1IZ9A 4L2IB 3E5HA 2WKRA 4NF2A 3UGKA 4EF5A 2WSBA 4TV9B 2WT8A 1W36B 1GL9B 1R5BA 4RNCA 5EJ8A 2QRGA 1OXXK 2I66A 3QHAA 5C31A 3FR7A 3ND5A 2BMJA 3QE0A 4RY9A 3JYQA 4YCCA 4C7OA 1VZ3A 2V6IA 4TXNA 3E5MA 4MS1B 1NOKA 9MHTA 2P1ZA 2R11A 1PD1A 4FMDB 2IDMA 5EE1A 4EKGA 2XTNA 3GDOA 1JIIA 5EZYB 8MHTA 2P2YA 1XNRB 5M34A 3HP4A 1SPXA 1GFWA 1Y89A 3GRZA 1RTTA 5EPEA 1YVEI 2OORC 2WVJA 4LCEA 4C0XA 2QRNA 1ISFA 1R37A 2Q9AA 4NSNA 5FPKA 4OXYA 4LZAA 4G01B 3ZLJA 3CCCA 3F98A 1FFBA 1FVFA 3FDZA 1EM8A 4P54A 4OAPA 4RAQA 3VX4A 3KOZA 1MV5A 4WCFC 3HJNA 2P0AA 1Q2UA 1OC2A 1E69A 1PZEA 4HNRA 4O2BF 2ATCA 1YZTA 1FFGA 2AMYA 2VJYA 3IUMA 5KHAA 5IB9A 4GWKA 1RCTE 5JAQA 1NQXA 4PZYA 3ANLA 4HRAA 5REQA 1AF7A 3FAKA 3BCRA 5DMHA 5JDCA 2VA8A 1JZTA 4LQLA 2VI5A 4C78A 5E7IA 1N7GA 1XVIA 2X15A 1MDFA 3CISA 3QOYA 3F47A 5LLTA 2WSLA 4IVNA 1SAYA 2IYPA 4B3JA 2HHCA 4QKQA 4RIIA 1H3EA 4MMXB 2CNWA 3IIMA 2KM1A 3ID6C 4R8MA 4P33A 1AJEA 2IHYA 3KE9A 4KYTA 5AM1A 3UB3A 5L3SA 1ZOOA 1CJBA 5AHXA 5GOZA 1ODIA 2HQ1A 3HSKA 5TQ2A 1P0FA 2CBXA 2PUHA 3FE2A 3N6VA 4PPYA 5J2UB 3UWSA 3SQXA 2O57A 2IVZA 4BRWA 4EJ2A 3L05A 3GROA 3WLAA 1I6WA 1OXMA 4A8PA 4ER7A 1RI5A 4ZCRA 3GHHA 3MMNA 1PFYA 2PPLA 3P45A 1OV4A 1PT8A 2WHPA 3ED1A 4G0PA 2QGNA 3ICCA 4CHTA 3I8XA 5IXJA 2MU1A 3NXSA 4GNKA 4A10A 1HTTA 1SBIA 3PT9A 3QBEA 5KB3A 5KQPA 4IFTA 1RWXA 1L1EA 1XNGA 3HB1A 4M86A 5E0KB 4GH5A 2DOKA 2HK9A 4NC9A 4M8LA 3SOPA 1OI3A 3OE4A 4F7WA 2IEIA 4KLNA 5TMEA 3RFCA 4ZRDA 3DGFC 3PC2A 3NRBA 2G1AA 5CCBA 3OQHA 3BJIC 1EHYA 5LM3A 1NN3A 3UK2A 3A6KA 3DXZA 1KP3A 3TXAA 4DTCA 2KLHA 5U1PA 2WJIA 1DJQA 3AM1A 4ZEXA 5K4GA 1GTL1 1I7DA 5JCJA 2NZWA 4XLTA 4OQMA 3MD9A 5FYQA 1P9WA 4NLLA 1OXUA 2QU8A 4GFDA 4ARCA 3EXAA 4FZ3A 1F2VA 2HT1A 5B12A 1OXSC 4BP8A 4MQFB 3PC8C 3PGMA 4LE1A 1KQPA 1N34B 3GR6A 2HWUA 1KWKA 3GQBB 4OMEA 2ZJOA 4JGIA 4P4JA 4TKMA 3MGBA 3REOA 3D7KA 1LV8A 1SKBA 2QSZA 1WCWA 2EERA 3ETLA 3GEDA 3KUKA 3MMPA 1G6KA 3ORSA 3HA3A 1M6NA 4DIFA 1BXZA 4QFMA 3STXA 4Z7NB 3VPHA 3GPBA 5BMVA 4OUDB 1ADFA 4Z1OA 4JK3A 5JS6A 4JI7B 3F2VA 1ISRA 2HTEA 4J29A 4N39A 3TRIA 4F06A 5FV7A 3ESCA 4MUBA 4EGFA 2RB5A 1D2RA 5EP3A 2QUHA 5IZ4A 3TRDA 1O95D 1I5OA 5K3BA 3A6DA 4F96A 1QVAA 1OB5A 3ZHRA 1QVZA 1Q7BA 2IYFA 1U9IA 4EYSA 3NIDB 1LI7A 4LBVA 5F4ZA 4YV0A 4X94A 2HDNB 2OAEA 3RRMA 3PQ2A 3TMKA 2O48X 4UPEA 1EVYA 1AH2A 1NNEA 2DY1A 2XYPA 5BYJA 4BBZA 1LU9A 3AB8A 3B7PA 3LTNC 1NF9A 3A4MA 3FCAA 3HV0A 3NEAA 4U9HS 3OPYA 2V7WA 1Z16A 5J4KA 5TVKA 3RWOA 4DF3A 5LR6A 1FFWA 1A9XB 3X2FA 1EGQA 2XNDA 4M0DA 1LTKA 2Q4EA 3KEMA 2APJA 3LKBA 4ZAVA 4OGFA 3T7CA 4YLEA 4F11A 4B6QA 3TG2A 2HMWA 3CTMA 2P4HX 3FW1A 3LCRA 1P1IA 3PXDA 4JB8A 3DMTA 3RR2A 5AVXA 4Q1BA 2QOEA 4PRLA 1IJKA 1O6CA 2D2XA 3UHAA 1J21A 1CUSA 4F21A 4FDTA 2NO9A 1GARA 1CY4A 1FXWA 3DBVO 5IXSA 2PVVA 4B4OA 3PEEA 3ILVA 8AT1A 1B8NA 4JYWA 3O1LA 3GNSA 4RA9A 2WJ3A 3WV4A 2IKQA 2ZYSA 2EX1A 2EFHB 2GEDA 1A76A 1M54A 1UT6A 2WTBA 2J41A 1E1YA 2HDOA 3CX7A 3EXEA 1U0LA 3PRKE 1WXWA 4FYMA 1O0SA 4PPGA 2Z2IA 4QOGA 4RMJA 3NH6A 1OBVA 5JRZA 1XAGA 3CMCO 4QTTB 2RH9B 5JC1A 4D9EA 3RTDA 2IUTA 2P77A 1N2IA 1K3UB 3LPNA 1ZPDA 4K86A 2C4HA 3SJBA 1BC5A 4F2GA 1AA6A 3ICUA 1O9GA 3RHSA 3QUCA 2BR3A 1QK5A 3PQFA 3S99A 3K73O 2FWIA 4MJXA 1JXQA 3FIUA 4RJLA 1A0OA 1FY2A 4YACA 5FBRB 1J0XO 2KBEA 3QU5A 5K8JB 2H2AA 2D5CA 4CBVA 5CFPA 5D5PA 3WK4A 2R0QC 2PAFA 1XRQA 3OIWA 2BGKA 1JEEA 1NOIA 2FKNA 2M6RA 3FTCA 3QBTA 5TEWA 2W70A 4ER5A 2X5KO 1U3GA 3O4HA 2AJ8A 3WWZA 3GIWA 3T1VA 1Q1ZA 4ZVKA 5A4FS 2Z56A 3AFGA 2XXBA 3PDHA 3I0ZA 1JQKA 3K31A 4WERA 4X6XA 4DMRA 4W4TA 3I39X 2VYND 1OZAA 4RMIA 1YK1A 1QZZA 5H3HA 4Z4IA 1IBSA 4W1RA 5KCZA 2MDTA 3B6MA 3WDLA 3R0ZA 1NI3A 4Q03A 1BZYA 3LC1O 2P9EA 5JD4A 2GVDC 3MTIA 1U90A 1V41E 3ESBA 1CJMA 2IIQA 3O5AA 5ECWA 4GRIA 3FVQA 2PGJA 2UZ3A 3CIFA 3QPCA 3ROMA 3BMOB 2N75A 3OPNA 4LYEA 5CLQA 2WR8A 3IH5A 5I3ZA 4L9RA 1G1AA 4RNDB 1C30B 3JS5A 3EX7C 2OLEA 3N1UA 1U0BB 2Q50A 3PU6A 4CDMA 2FRDA 3FLEA 3M6MD 1IMOA 4CI0B 4ARSA 3WMFA 2CVQA 1VMAA 2A57A 4O4IF 1JIKA 1U7XA 2QNBA 4J2OA 1LBIA 4C0LA 2QX9A 3VNSA 2FSHA 4PNHA 2DQKA 5ALMA 5LBUA 3NPAA 2OGSA 4YCNA 4MYUA 1JLKA 4P5DA 4JELA 4RK0A 1NKTA 1FNNA 1K7FB 2GWHA 2ISSD 4CQMD 4JV5B 5NLLA 3MUFA 4ANFA 1USWA 2YDXA 1EK1A 3HWWA 1ECLA 2XKAA 5MDHA 2A9KA 2PX0A 1EGHA 2B4TO 3FKJA 3HSSA 1EE2A 2I2FA 2DYKA 4K3UA 3FNQA 3RAGA 5EIHA 6Q21A 2YL2A 3QUTA 1C0PA 1IQUA 2RHHA 1YQTA 3WLHA 3EG9A 9LDBA 1XWFA 5CM9C 5ALWA 4FHZA 4KBYA 4NECA 3Q3JB 4W7SA 4YP5A 4ZCQA 5JDCC 4BNXA 3RSQA 3KT0A 3R9KA 3K0HA 3U61B 2O8EB 4JVOA 4UJ5A 1XZAA 5L9AA 4L57A 5LMNB 1O6BA 4TZ0A 1E2LA 3I4CA 5IK2A 2FEPA 3C3CA 3LV8A 4INZA 5TF0A 1N9KA 2HFKA 5D5QA 2CXRA 4EKDA 3R7SA 1JYEA 3I73A 5G41A 3M6FA 5FOTA 2O8VA 1Z8LA 2IU3A 4KDRA 3VU0A 4DSNA 1U02A 4YHBA 1CR4A 1KDVA 4EI2A 5CLJA 1Y7TA 3OMWA 1HE1C 2B9VA 5BXYA 1VLHA 3AT1A 1M8PA 3GEHA 3R6GA 4L72A 2AFVA 4Z3DA 3WRYA 4A8TA 2DLCX 1D4ZA 1BGWA 5HKKA 2PJDA 3UJHA 3EQ9A 3MXTA 3P9YA 4MHSA 4U02A 2Y6UA 1Y7PA 9LDTA 4WLUA 2Q2WA 3CBQA 1ZJJA 5BYAA 1M2GA 4K2HA 5HHTA 5JD5A 3ZDDA 3FTDA 1D8TA 4MCAA 3G7NA 6GPBA 2ZATA 3A3NA 3IAS1 3KQNA 4U2EA 4A03A 4CMGA 1Z6YA 4K28A 3L1IA 3IILA 1S9HA 4RV5A 5A0FA 3MQ2A 3ESXA 3V7UA 4BN0A 1JIQA 4HLUC 3KHKA 1Q14A 2N46A 2VDOB 2HRQA 3ICOA 3H9UA 3FLAA 1UXGA 3SI7A 2FI1A 2PSSA 1RLTA 1VXRA 4B84A 3UK1A 4JI5B 1G8PA 2EATA 2JAQA 2Q21A 3P27A 2IL1A 3PUJA 3JQDA 1SC1A 1X9HA 4R83A 3GP8A 2ACWA 2QZSA 1DAPA 3U62A 2EZ8A 4XQ0A 1DKRA 4BFTA 3CLRC 4BAGA 4DS3A 1HURA 2GH1A 3NC1C 3I6QA 2DUMA 1OPRA 2W2QA 3IOEA 3EPKA 4QPNA 1RBYA 2H4ZA 4UVIA 2EGUA 2P7IA 2V97A 4PU0A 4QDUA 3FB4A 2V8BA 3IR5A 5LZ8A 3ZK7A 4OFWA 1AUOA 2IHTA 3N2YA 1KI1A 4UFPA 3ECAA 3UC9A 4D81A 5KYNA 3B13B 4MP3A 4UNPA 1O96B 4FFDA 4W1QA 2NUAA 1CEEA 2UYHA 2C2HA 4MQMA 2ZAGA 4Q4HA 7AT1A 5J2TB 4L5CA 2O23A 3G82C 3QEBZ 1U9IC 2OKCA 4QE3A 2H3EA 4J0IA 5DGTA 1WR8A 4DCMA 2QTVB 3VC2A 4KR2A 2DTXA 2ETVA 2QPOA 1RSZA 2QT1A 3BEOA 2Y67A 4FWIB 2A14A 2COEA 5G4KB 1Y4AE 4E70A 4BZZA 2F59A 1M34A 5HDQA 3PQ6A 3IPYA 2YZ7A 4JGBA 1LSOA 1MR3F 1KL7A 4GOND 2AVDA 1H1DA 1MLDA 3EFOA 3IHKA 4LA4A 2IV7A 5ALHA 3CVXA 3U0VA 1YU6A 4M0CA 4EKNB 4C2TA 3DMTC 4BN4A 1YO6A 5HRAA 1F48A 1G66A 1ZGBA 1OWLA 3V1UA 1YF3A 3Q11A 4WZBB 4H9GA 3L4BC 4BMOB 1JHXA 5D8DA 2YJ6A 3HB7A 2Q1WA 1K66A 2JASA 3U80A 5E2AA 3GZNB 3CF6R 3DBIA 2ZI3A 1W5SA 3RSSA 3FEEA 3JRNA 2F9FA 2AH5A 4OF4A 4D9CA 4GPAA 1SK8A 1A7JA 1CC1S 3EISA 1MORA 1ODTC 3BMCB 3GOQA 4NVRA 5G40A 5GQSA 4TTVA 1UZNA 3JAKB 1JR3E 2LVBA 2VNJA 3K9CA 3RD5A 5J5AA 3EZYA 3ZZTA 4BXOA 1M0WA 5LQAA 1Y5RA 1H9AA 3H2YA 3HI4A 4PZCA 4WSOA 4LZPA 4E5PA 5JS7A 4H4EA 1COWA 3ORYA 4AIIA 4Q00A 4YYZA 3F1LA 1QFXA 1GQFA 1J8FA 2EZ4A 1DHRA 2GNPA 3BTVA 3IB6A 1BE1A 1T1RA 3MFYA 4UNSA 4OI0A 2RGXA 3QTLA 3COYA 3AR8A 4J0KA 2DP4E 2H8KA 5DHRA 4F8YA 5KNDA 5JSFA 1ZONA 3MUOA 3S1AA 4NATA 1YL7A 3OTIA 3TLZA 3QPBA 3WB2A 1YQEA 1LFDB 1YBAA 3G13A 1PBNA 1VHLA 4OI4A 4XDYA 2NN3C 4W5QA 1I0LA 2C88A 4BX9A 3T06B 5IX8A 3VSEA 2D0IA 1NRXA 4ECAA 3UWMA 2HQBA 1NAHA 3QNWA 1YULA 4A8JB 4AN4A 3WGUA 1SUSA 3K2BA 5A4AA 3SR4A 3FYTA 5LZ4A 3KD3A 1VG9B 4GXTA 1RD4A 4YAGA 3X1YA 4XWTA 1OF1A 4EYEA 2GCOA 2VSOA 4HFMA 3BKXA 4DCNA 4OAOA 2HJGA 3L82B 1S1CA 3RAEC 4F3TA 1OOEA 3NONA 1WZUA 1WMAA 3H0EA 3NFRA 4JYMA 1GAJA 4RDIA 2XF2A 3ZU4A 3D5EA 4P7GA 4E2ZA 2O9JA 4K7JA 1TRHA 2GK6A 4B43A 4EUFA 5KS2A 4IUCS 2YINC 2UYOA 1N2ZA 2PR2A 4B0OA 3KRVA 3DD1A 3LJKA 5CDHA 3WLFA 1BVRA 3BMQB 3GJSA 5KYUB 2OHXA 3OLQA 4FHEA 4MZDA 4X45A 3UAGA 3WZ2A 3DKPA 2R4QA 5F33A 3F96A 3NBXX 3KL2A 4ZXPA 3EBLA 3QLTA 4RPJA 2VQDA 1CS0A 2J6BA 3WL4A 1HTWA 4CLRA 4ID9A 3NC4A 2RAPA 1YB6A 3A9TA 3HKCA 3SEFA 2EW8A 3JU3A 4GLFA 5HVNA 3DLHA 4GDFA 1I24A 2A9PA 2YS6A 2X19A 3LTEA 2DQ4A 1RACA 2B34A 2CL0X 5DI3A 2PUBA 1Q6ZA 2I2CA 3EIWA 3KLMX 5FNVB 3DHEA 3UHOA 3GCDA 4ZQGA 4ESVA 1B23P 3VU9A 3L49A 1LSJA 4I14A 1N5KA 3S2YA 4ZIRA 1V1RA 3DTTA 4AYXA 2BFOA 3ZPXA 2OBLA 3TCNA 4NS4A 3ZVKA 4O63O 2GR9A 4E22A 3TLBA 4AJEA 3IJRA 1E3JA 3KVRA 1FQOA 1MH1A 3PNBA 5KTOA 5JU6A 2GBFA 3ICQB 4LQGA 3JYHA 3N2IA 5TPZA 3CWZA 4DIEA 3HVHA 1L8QA 3FYUC 5JTUA 3OLXA 2QROA 3L1JA 3ICVA 3LXXA 1KYYA 4OB8A 2IQ5A 2Q5EA 1T25A 2KI5A 4FX2A 5JNWA 3WLSA 4ZAYA 5AUOB 3OHPA 2AZDA 1L4FA 5LSAA 3VBEA 5CHEA 4MUXA 2Q1SA 4OB7A 2XZTA 3IUJA 3VTZA 4V1CB 1TO1E 4Y7DA 1NZDA 4LDJA 4FW9A 4QEKA 2FW6A 2XI4A 5SZKB 1Z36A 3JD3A 2XRMA 2ONJA 1N5MA 1QG2A 1VL1A 3QJGA 2O8BB 4CUJA 3W9BA 4RXUA 3I9MA 5HYVA 1RRPA 3GCGA 3KS9A 3DWEX 1R8SA 1QRRA 3UG6A 3UT5B 5BUZA 4UVHA 1XZFA 4Z3KA 2FWBA 5AVYA 3ROXA 1C0EA 4NICA 1Z4LA 2WC1A 1J56A 2GPYA 2QPAA 4AZ3B 1DOZA 1US8A 3FVRA 4HTFA 3A1UA 3HJUA 2ZXEA 3CH5A 3IT2A 1SUBA 3T3EA 3HR8A 1W9MA 3VPGA 1GNVA 1IZ8A 3ZWQA 3H9GA 4BTLA 4IXNA 1MABB 3I2IA 3LHKA 1DC4A 1S3FA 2XUJA 3BSSA 4LC9A 3ND6A 4E6PA 4C5CA 1Y8RB 1OA1A 2A0YA 3GDWA 5FQNA 2PZGA 1ODSA 1Y3CE 3FG9A 3GT3A 4K9QA 2JH9A 2A58A 3HDVA 1NXVA 3BXZA 4JJIA 4RV4A 4C4OA 1Q57A 1PZMA 4YRKA 4M1EA 1IBRA 4MQUA 3SJAA 1QS0B 3FMVA 2ZIEA 1PJRA 3USCS 1DRKA 1MC8A 3GVCA 4B4DA 1FUEA 3QF4B 2NVBA 3L79A 4WBNB 1ZHOA 1JDUA 1NLZA 4X61A 2FGKA 4ZI5A 2GSWA 3EFEA 1R7RA 3KEGA 2QR5A 2H59A 3GLVA 2OMKA 5L45A 1D0VA 3WHLA 4Q02A 2W42A 4I1PA 1N6KA 1AO0A 4DV7B 3HBLA 3MJ4A 3ZGXA 4XM2A 2OGUA 2XHEA 2BRUC 3CNBA 5AI4A 3ROPA 5I7UA 5AYVA 2JZCA 1UOEA 3BHMA 3RBAA 1UFVA 5DSTA 2VZ0A 1JJFA 2R5WA 3I0MA 3W1EA 2VP9A 4FB4A 3WA7A 1RQPA 4OC3A 3EIQA 5KO2A 3LUDA 3E1KA 3TD6A 4I9GA 3FOBA 3IVXA 5KZMB 2ZI4A 4NX2A 4Q3OA 2R7MA 1SU4A 2QYHA 2V6FA 4MQ6A 4BNNA 1PG0A 4MGEA 4RTQA 2IODA 3C4JA 3SSNA 4YCAA 3JQ9C 5EP1A 2EKBA 4Y6QA 2XZOA 3IIBA 4AY6A 2BF7A 3F46A 2EQAA 3F90A 1FRVA 3LVQE 4N0DA 5HFAA 2Y1GA 2DR3A 3O83A 3F3YA 2X7HA 3LKDA 4MV1A 3ZOKA 3LUFA 4CTOA 4B3SB 4BB5A 4F5WA 1T0PA 2GZHA 3AHEA 2AMFA 3DFZA 1QO0A 1G8MA 1W5AA 4Q16A 4V39A 2QZZA 3IB3A 5KYUA 1OLXA 1W5BA 4MI3A 3G89A 3VPAA 1XP8A 1ZD3A 1QJCA 3U31A 2WTMA 3AGPA 3ER9A 4KQIA 1V7QA 2RAUA 4R2HA 4RW0A 1PQUA 1RS0A 3B2QA 4BJ1A 2IUSA 2I3ZA 4QQ8A 1KOGA 4C3ZA 4MVJF 3EXIA 1FFEA 4CPDA 2JFWA 2OSVA 1K08A 3VJMA 2QU7A 1EA5A 1GKIA 2XCSB 1ENYA 4H7PA 2R8PA 4P4UA 1PFGA 1KI3A 3AY3A 2XADA 3INTA 4H17A 5AJXA 2OCAA 3I34X 4YJHB 1M9NA 3BK2A 3R2JA 3FAZA 3BMNA 2JHCA 4BATA 2QI9C 4HSGA 3BXEA 3KYJB 4YGXB 2Z6QA 4ZDIA 1XO1A 2ZYAA 1NJFA 1XZEA 2PM8A 4G09A 4PLCA 1E9EA 1UBJS 1Y6ZA 3KFVA 5FEMA 4DVGA 1U94A 2PMDA 4C84A 4BJHB 4TTRA 3V5NA 1MA0A 2QUJA 2B30A 2EHJA 3DYVA 4XB2A 5CP8A 2JGDA 3Q3HA 5DCLA 2AX4A 2PWPA 4R2JA 3MMSA 3BBLA 4MVJP 4A6DA 2XWPA 3TUIC 2XYGA 4FFRA 2AG6A 2H9YA 3C3AA 3CNEA 2OEPA 4QNRA 5BQ5A 3A6PC 1ZW1A 2GA8A 5KPDA 3HDJA 4EO9A 4ZYVA 1YZKA 1R0KA 2ZWAA 2HRZA 4L8VA 2GEKA 5BSKA 4ND4A 2OE2A 1FFAA 2UYYA 3VDMA 4XD2A 4TLAA 3EMDA 2HLDD 3VPDA 2P2NA 4DLPA 3EIOA 2GPWA 4YJGA 3A7DA 5CYFA 3WLIA 1RAGA 3AR6A 3KTFA 5I9NA 5JHHB 1YT5A 2E6KA 2XKKA 5GP1A 4YAJA 4LSWA 3CR8A 2JLUA 4HJRA 4QUBA 2NM0A 2FR0A 1X2BA 4RXMA 4C6SA 2IUYA 2O3QA 3MD0A 4F45A 1VRWA 4DC9A 5BV2P 4B45A 4QQKA 4FXPA 2E0IA 1UDAA 1DEOA 1KI2A 4X91A 4NS1A 2NSYA 3ZWDA 5HW0A 4YK7A 3CXRA 4DR7B 1UWLA 2XR1A 2FW8A 2H1WA 4NFSA 5KWJA 1B7GO 3UMBA 3LKZA 4IJUA 2NP6A 4XD7D 3ZVRA 4KIFA 1PR1A 2J6HA 2BWJA 1GLVA 3BHNA 1PLKA 2UKDA 3L07A 4D4HA 3BZBA 3PWSA 5G0TA 2AOWA 1RQLA 1W36D 1MG0A 2FZWA 4CVNA 2XGOA 5FHQA 4OP3A 1FVXA 4ZEWA 3RRFA 3ND8A 1SXJE 5I8WA 3IAS6 4KB5A 4BKUA 5AR1A 2Z2ZA 4HYQA 3VSCA 4EEXA 2VKQA 3U56A 5KTKA 1MT0A 1DBVO 3KQTA 1K5DA 1DKOA 2EIXA 3N3AC 4OQYA 5GJVC 5JV5A 1M6YA 3NHJA 4O4JF 1O6ZA 4CIVA 1E4YA 3LHDA 3IUEA 2O3JA 5KX5B 4D9HA 1G5PA 1NLYA 1U7WA 3IMEA 1BCSA 4KXWA 3VC7A 5EYPB 4BNUA 4OMFG 2XUAA 1QP7A 4GI3A 1ZL0A 1GUFA 3L6BA 5EWLB 4MRMA 1MC1A 4IIUA 2E4AA 4QGFA 1E7YA 3ZGVA 2A59A 1QRTA 4QDKA 5BW6B 4NNOA 5KU1A 3EC2A 3GYGA 3AKYA 1ZNZA 3AR5A 5LBIA 3AV0B 3TQCA 5I7FA 1EK0A 3TSYA 1V8ZA 3DEJA 1O9BA 3QVSA 4LG1A 3FEDA 4KJXA 4CYMA 2J31A 3IKVA 4YUXA 3JQBC 4EB0A 1WKBA 4M99A 4MWTA 1J5PA 2XHZA 1D6SA 1Z9BA 1DG1G 3OQOA 1LC3A 2EFYA 5HJ5A 4QOFA 3UJ8A 2Q45A 3FDJA 2X14A 3SXJA 2PD6A 4A0FA 1WD7A 3CH4B 1OH5A 1V3VA 4BLQA 3KT8A 2QN1A 4PCAA 3VR2A 1K5HA 5E6SA 1WBBA 1XPRA 2H1FA 3G9UA 2J9FB 1D7OA 1GG8A 1E2KA 3KLPX 1NBWA 1X1BA 3LQKA 3KSUA 4KN6A 1V95A 3ZKWA 5DNVA 3U6BA 1ORIA 3D6MA 3MOGA 1XL1A 4ZAGA 3X1MA 1BFKA 1OAAA 4RVCA 3T99A 4DJAA 3VVCA 4F3NA 2CVPA 2J0EA 2VYVA 4PPFA 5B7PA 4NEGA 1UADA 3V97A 4S1VA 2WU1A 3WDKA 3JATB 4ZHQA 2FSIA 1IRIA 2EC5A 2I5PO 4UASA 5CXSA 5A06A 1KZ9A 1KYQA 1T0JB 2GB4A 3ZBQA 3IV7A 1QTRA 3GL9A 3QFHA 3OWXA 1JILA 1A9OA 3RUAA 1P77A 3UOAB 1AUPA 3EEQA 5MHTA 2I2AA 5K3FA 2BTOA 3ZCSA 3LPCA 1OX4A 4EG6A 2HQRA 6AT1A 1W9HA 3AVWA 2H65A 4FEGA 2VBCA 3AUJB 4GMGA 1PLLA 1W29A 4ZT6A 2IV3A 2I80A 2O2YA 4FC6A 1NPDA 2AR9A 4M2LA 1UF9A 3U26A 4CL0A 2HF9A 5ITSA 2VYCA 4RLQA 4BFUA 3AQ4A 1QPGA 2QLMA 2P5YA 3AWDA 4D5EA 1CETA 1JDJA 4X8OA 3BEDA 3NTLA 3HKBA 3R44A 2I4MA 4PSKA 4AYWA 3AL0C 3NGXA 3U4MA 1EFLA 1NUSA 2AR0A 3IA7A 3TZQA 4PSUA 1HEIA 3TLYA 1FQKA 4BTEA 1NGSA 1U0NA 2FG6C 1UC5B 1UZMA 1OBOA 3KKQA 2XQFA 4WKBA 3SF8A 1OB2A 3AF2A 1M3SA 5KTYA 4RMNA 3JARA 3TIXB 3WL8A 4R69A 3MBOA 3JYPA 1GFIA 3KAPA 1TADA 3ISTA 5KDLA 4MLDA 8GPBA 1TVKA 2FCRA 3BWDD 1EUDB 4WXEA 2ZREA 3BDIA 3W8RA 3E9EA 2YC2C 1T3LA 3Q8LA 3ETHA 2FYTA 4AJ9A 1SUWA 1XLUA 4DLUA 1O94A 1RKVA 3DH0A 1AUQA 4S0ZA 5FCDA 4N6GA 4K6GA 3SVLA 1VSQA 5A1JA 1JLHA 3ME5A 4FHGA 1NQTA 1SVSA 2P62A 3BRWD 4CL2A 1VA5A 4M7RA 4X8LA 2I3GA 2NMVA 3KSRA 1VL2A 1NIPA 1Z29A 2P40A 3D2BA 3DAPA 1ECCA 2Z3WA 3PQ7A 3K0CA 3UJ6A 2QQGA 2FY8A 3VR4D 2VHZA 3GMSA 1EK2A 1F2DA 1RHRA 1ZW6A 4FWBA 2V7EA 1NJ6A 2XV1A 1C14A 3DDSA 1NVUQ 4PV7A 1NVAA 2I8LA 3HCDA 4FCCA 1BMTA 2VR1A 5CEJA 3NM6B 1WNTA 4B2LA 1DBPA 1HDGO 1CNFA 3LPAA 1C9MA 1H85A 2OG2A 2VNAA 3UA4A 4B31A 1J00A 1XU7A 4P7JA 1V45E 1HF3A 1HNWB 5LU8A 3HLYA 3MYYA 8LDHA 1FFSA 1GA6A 3L7CA 2JLAA 1AB5A 5M29A 2AOTB 1FSGA 4M4SA 1UJNA 3ZU2A 1JTFA 3WXMA 2QTGA 4GMXA 1UFQA 5F1OA 1KOLA 2GLUA 3D0QA 4XPIA 3PR3A 2VP4A 3GYBA 3IP7A 3EZGA 2DU8A 2FEWB 1HYBA 4L0CA 4QPDA 3TBKA 4US0R 1HNNA 5D3ZA 1JQDA 3B3JA 3JZMA 3OBIA 1JHVA 2TMYA 4IDDA 1KGDA 3JYNA 4X44A 4BC0A 4AMBA 2QNIA 2WFZA 3LUGA 1Y34E 2WFLB 4BKQA 1H8EA 3NCHA 4NCKA 4OQZA 4BBJA 3B6KA 4NGQA 4P84A 2PXHA 2ID9A 4P7KA 4RVUA 1F8GA 3PPVA 1E6EA 3OURA 4HDNA 4MVJH 2VLBA 4C86A 1RHKA 4V02A 1YZFA 5CLLA 1MOQA 2VDQB 2QG4A 5KNBD 2GAFA 1C7JA 1AVTA 4RS3A 1SUFA 2VNKA 2XMRA 1WVMA 2Y71A 4YUWA 4OHKA 2R7AA 3JXEA 2AC7A 4ZEVA 2WIKA 3K6JA 5T8KA 5FTLA 1FX1A 3IBCA 3RT7A 3HVJA 4YMGA 1D4FA 2WFAA 2Q99A 3A1DA 2VUTA 5KNCD 3O21A 2DHRA 2AHOA 2QRPA 5AO9A 3OOSA 3N5KA 1UXHA 4Y2HA 4H1UA 1ZXXA 2RCYA 2P4UA 2XNKA 3ESQA 4U2CA 2CKMA 5H9WA 1JEYA 1Z82A 5DNDA 3TX2A 3JAWB 3MUNA 1UPTA 2VJPA 2CK3D 4C0QC 2IEAA 4C6HA 4NU8X 3G0DA 1QH8B 4LVUA 4KPYA 4OC1A 1IONA 3CRZA 2R8ZA 3MPOA 4ZANA 1K7XB 4AM8A 2QD2A 3CLSC 4EARA 1MW9X 2BHNA 3CUTA 1DIAA 4HBZA 3EA0A 2VNIA 2AF3C 2VAMA 3Q6MA 4FDMA 5MN4A 3ELBA 3JALA 5AHKA 5CFNA 3M2PA 4OY3A 1NQVA 2DG2A 1KAGA 2FW0A 2EL7A 3QY9A 5FOVA 2DKFA 1N2CB 1JHYA 1PZGA 2IE0A 1WP4A 2QN3A 1G5FA 4JUBA 5UKDA 3S1LA 1VPWA 1A7UA 2Z2XA 3IT3A 5CBPA 3BTUA 1X7WB 3A28A 5FLEX 1Q7TA 4TRMA 3QI2A 3BRQA 4FUTA 4RPIA 1RPTA 3TOXA 1GOTA 2WI8A 4BB9A 5C5DA 4CZ1A 1ZN2A 3PWTA 1XEXB 2V7UA 1UBNA 2C5FA 3O8QA 2C2MA 3FKSA 3WHIA 4YJ2B 3FR8A 3AYXB 3FKQA 1J1UA 1PR5A 4NYJR 1E59A 1V5FA 3P2JA 3QVGA 3W5JA 2C54A 4P6VF 4JCOA 2YJTD 1GA1A 3H3XA 1XG5A 4ONEA 5THQA 5ALGA 1D2HA 2RGEA 2YH2A 4JVNA 3V2HA 1Y3FE 3MWYW 1PI3A 3LLVA 4RCZA 3F5MA 2OQVA 3UK6A 2F1IA 2H4YA 5FWXB 1O7JA 3SXUB 1THZA 3WL5A 1JR3D 1GNSA 1BU5A 4YPOA 4D99A 2HSWA 1K6XA 4E94A 1TEVA 5GV8A 4U3JB 2J3MA 3EEOA 2E5LB 4DC0A 1D03A 4C30A 4IL5A 1JSCA 1QFSA 3OVMA 4K6MA 3Q88A 1VQ1A 4E5DA 3G0CA 5LQMA 1Y42X 2WJWA 2JGEA 4R41A 1IG0A 2QVLA 2JLVA 4F46A 3WNVA 2ORWA 2D0OB 1JUDA 3AR2A 1NPYA 3NHFA 3WGGA 1QF9A 1U0RA 2ZZNA 3RC8A 4R54A 2VP0A 1SGWA 2JIDA 4YI5A 4RKQA 2O2CA 1H6AA 2XKBA 2Q9CA 4IRXA 3RRXA 2HCFA 4POOA 4Z4GA 3RVLA 1J9EA 1F7UA 3BUSA 4NGSA 4BC1A 4E12A 2WUWE 5KKAA 3KZXA 1HYGA 1AX9A 3OZIA 1BH2A 2ABWA 2EJTA 2JFVA 2VKTA 4X7PA