3TLZA

Microcin c7 self immunity protein mccf mutant w186f in complex with adenosine monophosphate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
335
structure length
335
Chain Sequence
PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINFNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords MccF
total genus 118
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlzA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlzA02
4MI1A 3GJZA 5JYBA 5F1YA 5F9MA 4E5SA 3T5MA 5FD8A 5K99A 4INJA 5F5XA 3TLAA 3TYXA 4JVOA 3TLCA 3G23A 4MJXA 2AUMA 3TLEA 3U1BA 3TLGB 3TLZA 3TLYA 3TLBA 3TLGA 4H1HA 4IIXA 1ZL0A 4E94A 2AUNA 4IIYA 1ZRSA 4EYSA 3SR3A
chains in the Genus database with same CATH superfamily
2GLUA 3HHPA 3O8OB 1SUCA 1KFBB 4C4XA 5E6RA 3ZBQA 3I05A 1NVBA 1DX9A 2Q1YA 1M6YA 3OKCA 4Z2YA 3D4BA 1RKXA 3EMVA 4RIEA 3LUKA 1U81A 2FMKA 1CX9B 1EHCA 1HWYA 2QTVA 4RANA 1SCIA 4ZAGA 3T9CA 2HLDD 2BFEA 1WULS 1Q1QA 2HA4A 4GMHA 1XDZA 2A5YB 3MMPA 4HHEA 4NX2A 4WXHA 4O02B 1XTSA 4TZTA 5BYKA 1LSSA 3ONEA 1VSVA 3FBWA 4NFLA 3S1AA 3TFWA 1YXMA 4AM8A 5LWQA 3QKSA 2JFYA 3LV8A 4NPHA 1HYQA 4BLPA 4UATA 1XEXB 3TPCA 3IELA 2OENG 3V1UA 1S2LA 3VAAA 4C0QC 4P7JA 5DTRA 2Q0SA 3NDJA 3EZEA 4IV0A 4RTLA 1NVWQ 1TM7E 2C84A 7ABPA 1AV7A 4GNRA 5IH3A 3RSOA 5L4SA 2XTNA 1PS8A 1R1DA 4NGMA 5FNVB 3WADA 5A4FS 1P4HA 2W83A 5HQ3A 1ZQ1A 1ZNYA 2ZJ6A 2GD0A 3JQCA 4WY5A 1IWPB 5A5FA 1A7JA 2OD9A 3BZBA 3OA2A 5LYJA 1WR8A 3WY9A 4CMEA 1EB9A 5E4TA 5EJAA 2EV9A 1PS9A 2OFWA 1GTMA 1XK6A 2WTEA 4OKIA 2WT9A 3FOZA 1SBQA 4ZIRB 1DTEA 1JQAA 1WHSA 1RMQA 2ONKA 1EGVB 3AI1A 3EYAA 3LP5A 1GRVA 2ENUA 4OGWA 5EESA 1EK0A 4KQWA 3DA8A 4C0SA 1C0EA 4FCTA 1Q16A 3AINA 3FDJA 2GBFA 4PLZA 421PA 3U7FB 5IUNC 4NCKA 2IYRA 2WHRA 4J3FA 2EU8A 1IEQA 4DCJA 4ETIA 3EIQA 1XMVA 3BG5A 1QNFA 1J1ZA 1RPAA 2FWBA 4RWZA 4D7AA 1T4BA 2V7EA 1TMKA 4DLRA 3RUEA 4OQPA 2V5AA 3EUWA 1UC4B 3L43A 3SHOA 3C74A 1VHDA 2P1ZA 2F1OA 2QQEA 4W5WA 2AEFA 1PUIA 2IYOA 1E1YA 5KVQA 3RE1A 3DG9A 1ZM9A 3L92A 4Z0TA 1P29A 4JNKA 4R5MA 3PD0A 3F9CA 4YQEA 2CL0X 5C1PA 2O7QA 2VYNA 5I4BA 4XQ9A 4OUDB 1P2DA 4L95C 1UWVA 4QJ5A 4H6PA 4RA6A 4RZ3A 1F8UA 2R1TB 2J4FA 2NO5A 4PYIA 3RRFA 5KJCA 3TQTA 1CJSA 2GZAA 3P0HA 5TGTA 5JNLA 1ZIXA 5CAEA 3NNDA 121PA 3F71A 4KX3A 1L5LA 4ZT6A 3RIGA 3FHLA 5TF0A 2QR5A 2AH5A 4D3SA 3UMBA 1K7SN 1Z2CA 3EAQA 4PO1A 1ESEA 1C9MA 3IDAA 3T1NA 5BUQA 1IB0A 8AT1A 1LVGA 1EEHA 1QGYA 2RHBA 3I83A 1L8LA 3KHUA 1G0NA 2X41A 2YWDA 4QO7A 2A1UA 2OBFA 3AUSA 3QW4B 3CGGA 2C2WA 2AR7A 2B98A 1CUVA 2Y1XA 3IB6A 1ISHA 1UFRA 2ZBDA 1JA9A 3FIJA 4NP6A 1DAEA 4TX1A 3EVTA 4X90A 1KJQA 4MP3A 2FR8A 2M1ZA 3DLAA 2DECA 1RMYA 3OLZA 3SC3A 5JD5A 3T3GA 1P9RA 1AKEA 1OI3A 3IALA 4FKBA 4Z8YA 5HQTA 1IHPA 2JLAA 1E89A 2IEYA 1MN6A 4TT8A 4AN4A 4C0AC 2R86A 1NJ8A 3CR7A 3W9UA 2W2PA 5I7FA 1XDGA 1F7VA 4LF8B 1RI3A 4DM7A 1T1EA 1H1TA 2QD4A 3UCFA 3FHJA 5LWHA 2P9ZA 3K53A 5DWDA 5ADUS 3FHTA 4XIIA 2C00A 4LCEA 4IJWA 3MQ2A 1UT5A 4EGAA 3S8EA 2V8OA 4BNHA 1FNSA 1L9KA 1MG5A 2PSDA 1JFLA 1AHHA 1JPUA 2VRWA 4YMUA 3S2GA 5CYPA 4U8GA 4B4OA 4O5AA 4DSZA 4US0R 2VSNA 4RGVA 4KGDA 4W9YA 4J49A 4OGLA 5F78A 4ITRC 4WEOA 3JYNA 3TFOA 4QX6A 1G6OA 5GADl 1N36B 2EQAA 2EFYA 3B1XA 1G0OA 4KQ9A 4C4AA 1QRRA 1W49A 4M76B 4QAJA 3TZCA 3KU1A 1AUPA 3TRDA 4LZPA 4CT0A 4EJFA 3CMMA 3D7NA 4NU5A 4OREX 3HM2A 1ESNA 2G67A 1NUQA 4HEHA 2P91A 3ZYCA 1E1QA 2CCKA 1JSXA 3PDHA 2JEOA 2GK4A 2JGDA 4KAXA 4MCRA 3PQFA 2ZUTA 3BWDD 5JS2A 2ZVPX 3S28A 1EK2A 1XL1A 2WSBA 3NT4A 1D4ZA 4N5DA 2ABWA 2HEIA 2XIQA 4Y9UA 5SY6A 3EOAI 3DNPA 3FVRA 4LZZA 4UCWA 3MFQA 1EFUA 4X9XA 1GCGA 4MWGA 2OGTA 4DG8A 3FFTA 1OXXK 4L4SA 3ZHQA 4BEWA 1FSGA 1KI6B 1SB9A 3HQ4O 3LW8A 3CH5A 4ZI7A 3PDCA 4ZQGA 4Z54A 4LDRA 1C30A 4B8ZA 2ZWOA 1NRWA 4PAGA 2HWYA 4Z86A 5AVSA 5CURA 5DGXA 1RJEA 5LQRA 2RB5A 2HMYB 3CEJA 4UZEA 1M1XB 3FTPA 2EZ4A 1UDRA 2PZFA 4WNAB 1Y4ZA 1IN5A 3TRKA 4A0GA 2PVVA 2WVAA 2OCPA 4BNJA 4QRHA 2WM3A 1VKOA 1BMFA 1F6WA 3C3AA 3H87A 3L79A 3FDIA 1QX3A 4HZUA 4LG1A 4LVUA 3LGAA 3QVLA 2OHOA 2O50A 3GNQA 1DNPA 1F17A 2ZITA 1D2MA 3NVAA 4NNJA 5LQAA 1K3UB 3X2SA 3IIKA 3EVDA 4FFMA 3VR6H 4DCNA 1MHTA 1ZIOA 1WIWA 3HVRA 1TQ2A 2NADA 2AK3A 4DKJA 3K6KA 4DOMA 2KLHA 4QEKA 1SBCA 2QU7A 1RZ3A 3AX6A 2QL6A 1NUTA 3C3YA 3CS3A 3GP5A 4PX3A 4D8UA 2VIIA 3UENA 1QIKA 4LA4A 5DTJA 3RVQA 3WWEA 2CLHB 1R9JA 3GJXC 4QQ8A 5F1OA 5KMGA 1MOSA 2V6IA 3RIXA 4YBZA 4HLNA 2MSEB 1SUWA 2QQGA 1VBMA 3TJRA 4EHFA 1B8VA 1QIHA 4MS1B 1XQXA 1XYGA 1COWD 3ILYA 2J32A 3PR1A 3WNVA 3F1KA 1NBME 3ZD7A 2JASA 2OKCA 3OICA 1LDMA 2I03A 3KG2A 2X0IA 1OXTA 1EUDA 1SHKA 1RWVA 3NFRA 3IVGA 1Q1GA 1EX6A 1YB7A 2BM1A 4GMKA 3EPLA 5DP2A 1CF9A 2GS9A 4KNYA 1YR7A 2QHXA 4GP6A 4FR5A 3D3JA 1EGAA 1PWZA 2A14A 4FGZA 4DSTA 1BMDA 5F2OA 5IVKA 4HRYA 4DYDA 1PQPA 1E3WB 4Q05A 2IXBA 4LUCA 2G1PA 1BD4A 1QKIA 3R5SA 3FDZB 4LW8A 4PBSA 2VHZA 4B33A 4CI9A 1I10A 2QNRA 2WRZA 3PT9A 4N5NA 3NVKI 4L51A 4MUYA 1XTZA 2W6ZA 4AZ3B 1NP3A 4EB6A 4G1FA 5A6SB 2GPNA 1C1DB 3OHMA 1DBWA 5CIWA 5EPUA 4YMWA 3MVEA 3ZPXA 4BVBA 2QNBA 3D2AA 3EVCA 4DS3A 4PNEA 4TYQA 2AMFA 2QN6A 1JHXA 1PR3A 1VHWA 2WOJA 2IXTA 3AF2A 4JFRA 1GYPA 4MLPA 1QWSA 4EZBA 3GMSA 1OBVA 1MORA 5FUQA 5K3OA 1P4RA 3QXXA 2GYUA 1GKUB 1GPMA 1XCGB 2QY6A 4B31A 5CH5A 3PHIA 1IRIA 1Z4JA 3MINA 1Y5IA 3I1YA 1OB5A 4J9UE 1JU3A 4BU0A 1VLMA 2BGMA 2P30A 5DLEA 3ZHRA 1GXSB 3NHKA 5BQ5A 1KVUA 2ZRGA 1MMFB 2YHSA 3B1FA 4QPDA 1DX6A 1RXYA 3CZQA 3OF2A 4LDJA 1UC5B 1E79D 3G5MA 2H2FA 1U3VA 2R9VA 4JXZA 3VQTA 3IHLA 4QU8A 1R8YA 4HNUA 2GPSA 3EIOA 3T9BA 3TXAA 1UBLS 3A7DA 3H1AA 3VSCA 2DFDA 1T5LA 2XODA 5ED0A 4ZVQA 3SQDA 2CHGA 1S2MA 3B48A 3VC1A 2IS2A 3HJCA 4JENA 2VWPA 4II2A 1IXYA 2FW1A 1TYCA 4HXYA 3SJBA 5GY7A 1Y7LA 4Z9YA 3JQFA 3ASVA 5BNFA 2IH4A 2IELA 2NXNA 1TAGA 1U9IC 3ET5A 5AVJA 1DHTA 1KETA 1LXCA 1OY1A 2ALJA 2NM0A 2EZ9A 2Q50A 2WM2A 3HABA 1GFZA 3OCYA 4JJ8A 4REMA 5D3KA 1LPSA 4ZVMA 5P21A 3OU7A 1UXOA 1A3CA 2VTKA 2H31A 1D5CA 1KXZA 3QVGB 4RMNA 2GN8A 1RVV1 2OY0A 4Q47A 1P4GA 1GZ6A 4Q7LA 1B0PA 2QKYA 3DM9B 3L4BA 2SKDA 1L5YA 1ODJA 4GR4A 4WK0B 4PXAA 4W63A 4BO3A 4MRNA 4BAUA 5I4CA 3DH0A 4URHA 3WRWA 1GEGA 3UHOA 1IVSA 3FPSA 3OU2A 4GGMX 4WFKA 1SBTA 1EJ2A 1N2OA 1EWVA 1IVYA 1QSGA 4FTWA 1B6TA 1L7DA 2QN1A 4YEDA 3VVMA 4F84A 2HV8A 1V6AA 4TS1A 5IKMA 4ILKA 4NICA 4MW2A 1L4YA 2VG8A 4TSFA 3IQGX 5FO0A 1BIFA 2PGDA 4MAFA 1FPQA 4S1VA 2L17A 3B3GA 5B7PA 1XD9A 3EVNA 1EM8A 1RWQA 3BB4A 2O52A 2VPPA 2XUPA 2Y9MB 3K05A 4EX6A 2H1IA 4UPDA 3COYA 2GESA 3HUTA 1L3IA 3KWMA 3P27A 1XMSA 2Z43A 2K7ZA 4U2GA 4UASA 1FUEA 5EWLA 4J1TA 4UXIA 4WNYA 5FTKA 2EW2A 1JG2A 3LIPA 4MRAA 1M1YB 2GN4A 2Q9UA 3FYSA 4GGPA 3V2IA 1C30B 5BSTA 1LVUA 2ZXEA 3EXHB 4EF6A 1BW9B 3BIXA 5E9WA 5KQGA 2PXXA 5A0VA 1Y3AA 3A70A 2NUPA 3PE4A 1E8NA 2OAQ1 4Q7MB 5MN4A 1AOXA 2HDWA 2IEGA 2VZEA 2WZQA 2ZIWB 1N6PA 3O2QB 4QVKA 3U3JA 2CVFA 3VZRA 2LNDA 1ANKA 4FOSA 2X4GA 3LU1A 2WSSD 5AVTA 2CK3D 4YASA 3WI7A 2Q3FA 3LECA 3K0BA 2X3FA 3ZCQA 2ZPTX 1WZIA 1R8JA 4DPLA 1G3QA 3K1ZA 4U02A 5DK6A 1Q91A 4KYVA 5EZ6B 5HGXA 2DWUA 3OT1B 3KJFA 1CQJB 1TM3E 3OHSX 3ZXXA 5K7SA 4O3MA 3DP7A 1JP7A 4JS0A 4PHHA 3REGA 2ZWIA 4HDSA 2J0QA 3FCOA 4HEA1 1PKEA 4ZAVA 4LRSB 1S2IA 2WVJA 1K7CA 2NSLA 3KR2A 2V59A 3DOIA 4PSDA 4TYNA 2PWPA 4WBNA 2XDQB 4ZDJA 1YK0A 3GZTB 3KTAA 5DX8A 3JASB 2NV2B 1ABFA 4RGYA 1NN0A 4IIJA 3WKDA 4NENA 4ND8B 1GTG1 4G4SO 4CV3A 3L8GA 1I2BA 4ZI3A 2I9KA 1LY1A 5CDFA 5GTDA 2GKGA 4AROA 4CKEB 1ZC3A 2PDAA 4MV4A 1MKYA 5HKAA 4H59A 2JJQA 2YXDA 3LVBA 1IBCA 1S02A 5LKAA 1Z6AA 3HFSA 1E9VA 1XZDA 3F47A 5TS3A 1ZM2A 2Z4TA 3VDXA 1NIPA 5TR9A 3VOTA 3ZXUB 4MGIR 5FLEX 2ZJAA 1GDTA 1ZRNA 1F20A 2J0UA 5ESWA 3COJA 4W5NA 1M10A 1TA9A 1WXDA 4BV3A 2VTEA 1K7XB 5F21A 3OMWA 3HCCA 1XFAA 3PQEA 1P3Y1 2IDJA 3RS9A 4RPLA 3VPSA 3GU3A 3JWJA 2O8VA 3MRSA 1I0IA 1XLVA 3QVXA 4NHEA 2M32A 3BERA 2EZAA 4ZZ2A 1EFCA 1R6UA 5FFNA 1D07A 4EAQA 1Q2UA 2OBXA 2ZYWX 4UULA 4EJMA 5HTOA 2RE8A 2CW5A 2PUJA 2FVXA 3I64A 1WDMA 4COKA 5KBYA 1Z4OA 2OV6A 2VRCA 4JZ0A 3QFSA 4BC1A 1O77A 3I32A 2JGLA 4BO0A 3H2GA 1GQOA 3FJYA 3P2OA 4W1PA 3WLEA 1CUJA 2BIFA 4ZU1X 5AUNB 1X80A 1T2EA 2LW7A 4CQMA 3O83A 4W9NA 2AL7A 2CLKB 2BKEA 2JIMA 2EP7A 2QYSA 1GUFA 3DD1A 1FJ2A 4R0MA 1P44A 2PK3A 5L9AA 2ZBRA 3HVJA 1C8BA 3S70A 1CETA 1F2TB 1KKUA 1UANA 1WB5A 2RHJA 2XECA 4KIFA 2GQ0A 3N2ZB 5JAIA 5EJFA 3VTKA 4I50F 3P7MA 3HKEB 2Q29A 4P7BA 3F1LA 2Q5IA 3RWMB 4J6EA 5JAZA 1H5UA 1FP1D 2YWFA 4OC2A 1WUKS 3RRBA 4CMGA 2XEDA 1HTTA 1U8EA 1CJVC 2X1VA 2WW8A 1VLHA 1H85A 1M0TA 4TMYA 4UBKA 4GPBA 1JEYA 4GP9A 2WKSA 5F1KA 1WMEA 4YJ3F 1I6LA 3N1UA 3R7FA 3SEAA 1D2EA 2QTCA 1P33A 3AP1A 3F3KA 2IW1A 4RHXA 2D1YA 1S3IA 4B74A 3OU6A 1A8UA 1OBOA 3IUYA 1ZPDA 5EPOA 3PENA 3CFYA 2IXGA 4ROTA 5JANA 1K2WA 2BUAA 4PZPA 1ODSA 2RAPA 4O4HF 4PSCA 4NE2A 2D00A 3ZQKA 2CNDA 1C3JA 5JE8A 4KNGE 2EBFX 1JDVA 5GIPE 1MAWA 4BXOB 1RMTA 1OFUX 2HWXA 3I2HA 4PG4A 4ZQEA 1GYQA 2PRJA 5LVAA 3SVTA 3KETA 5JMWA 3I04M 1KK2A 3KFLA 1BTOA 3QUBA 4QFCA 4HQNA 3CXUA 3MCTA 4Y6QA 3MHTA 3PJRA 3OO0A 5TGDA 1B14A 4HWKA 4L5AA 1ZSNA 2CEAA 3A10A 4MB0A 3AOEC 3C8MA 3NIDB 4UTXA 4Q4CA 5C9ZA 3O8RA 3AHEA 4ZRNA 2C7GA 1QIGA 2CLMB 2GRUA 3HS3A 5AO9A 1JGTA 1QE5A 3GMTA 4A6PA 1JWLA 4CETA 4PSUA 1OZ0A 4GYJA 1T10A 3WKAA 2F3SA 3MJHA 4Q82A 4BKMA 1XWFA 1L5ZA 2ZU0C 3UJDA 1AD2A 1AUQA 3WIBA 5LLTA 4JB3A 2DFPA 1NBMA 2ZB2A 3PDUA 4DGSA 2UYYA 3N39C 2LGJA 3I3SR 3EY9A 4NAVA 4IJVA 4I5FA 4Y2QA 3JWEA 4TSKA 4G37A 4COOA 1XEXA 5AKYA 1V4VA 3CLTC 4TYMA 3ZVRA 1Y1RA 1SUPA 1PV4A 4GEKA 3E18A 3ZDFA 3FWHA 4PZEA 5DX0A 3SXUA 1Z35A 1NAHA 1L6RA 2I2FA 4TRMA 3W06A 4BY9E 1XTQA 1F4LA 3WNDA 4C1BA 3GJQA 2Q0HA 3ZCRA 1AQLA 4GHWA 4BO8A 2ATEA 2CVPA 3L5OA 1DDOA 3CNBA 3ZZTA 4HAZA 1JE1A 5ENVA 2Y6UA 4RPJA 2Y9PB 2QENA 1I7PA 4ZI7B 3E5RA 2ZI4A 5TT0A 2EIXA 4RE5A 3RD5A 4EHNA 1BQEA 4QG7A 5D2CA 1KKMA 3PP8A 3UW1A 4S0XA 1V96A 3L8ZA 2G76A 4NMMA 4Q3KA 1CJUC 3LI2A 2D54A 1SU4A 2E87A 3CN7A 1E2DA 1FFHA 2Y1LA 3R5FA 5CVUA 2P67A 3TNYA 3ZYZA 3S6JA 4OLJA 2XITA 2J5BA 4ZEVA 4P4IA 2PYIA 1L4UA 3R6WA 2GCIA 3ZNQA 4HVCA 4K6MA 1RPTA 1WDWB 2C82A 2HUNA 4F56A 3GN1A 2D2XA 1EP9A 5DPMA 2CK3A 4WZAB 3K4IA 1VC2A 4DB4A 1U1CA 4OH7A 3TMYA 3DMNA 3B1ZA 5I4KA 3WNCA 3I2KA 4O0LA 3TAUA 3AF0A 5HFAA 1D2CA 2QOEA 2H1VA 3K2BA 2QTFA 3FPGA 2IZ6A 4KOAA 1ZCFA 3MRVA 1EB8A 2JGEA 4Q9DA 3QXSA 3UPTA 1K8ZB 1NW8A 3MUNA 3PPVA 2VPTA 5K99A 4QOIA 4LOIA 1PK9A 1RWPA 4TLAA 2WTNA 1J97A 4LJ9A 4RFSB 5KQPA 1U7HA 4D43A 3HN6A 1ULBA 1A71A 1O3YA 4ENQA 4I19A 3D3NA 4ZAWA 4CG0A 1OI4A 4OJMX 1A4UA 3LYAA 3U62A 1T9HA 3K8OE 3PUHA 4UUQA 1KDZA 4HXFB 3FSEA 4CLEA 2P3OA 3A2KA 4X3RA 2DFKB 1ISMA 3MFYA 1ZN7A 3RBXA 2W71A 3JVVA 3QF4B 2OCDA 3TNDA 2XSZD 2ZULA 1AKNA 2DQSA 4HG2A 3GLRA 1GQYA 2B78A 2D5LA 3ESRA 2YY5A 3ZS8A 1A2OA 3IJPA 1AUXA 2YJNA 3BMNB 3CGWA 1ZVVA 3U0VA 5A5VA 1E98A 3BQ9A 4PIMA 2GP4A 1UT8A 2VN8A 3NAZA 3WV4A 1EWYA 1BE1A 2JANA 3TZQA 5CCXA 1RBQA 5F7JA 2O2GA 4U7HA 3PWSA 1X87A 4PZCA 4C86A 3BD8A 3OHPA 3SX0A 4WACA 1KDRA 4FYJA 3BL8A 2YUIA 2XI4A 4HNAB 4YACA 3ROFA 1PNVA 3C24A 3CBGA 3K0FA 4Y8VA 3O03A 4MKZA 1I80A 1PEAA 5JZSA 1AQNA 3Q8XB 5KTYA 1P4SA 1P18A 2X0FA 3INTA 4R71A 3KDSE 4EZIA 2YVAA 4RK4A 3MTGA 4HDRA 1HF3A 5EJ8A 3T7EA 2O2DA 1ZWKA 4HDSB 5HJ7A 3NDBB 4HK4A 3FYTA 2QZJA 1YJBA 3PNBA 5ITSA 5KU7A 4QDJA 1HETA 1T6NA 3DVRX 4H18A 1G5QA 4IHQA 4PS0A 1DWOA 5ECWA 3BK2A 2OWDA 3ZJUA 5AESA 4F97A 3KQUA 5FWXA 1WABA 2HL6A 5BSMA 2OZKA 1SJ9A 5FEUA 1CNEA 4CYMA 2HQBA 3LGSA 1H8EA 2H5JA 2YRWA 2YFYA 4GZ5A 1GRCA 2WU4A 2W0MA 2ZRKA 1I1NA 1DJMA 1JQBA 2ZJYA 3QVOA 4WK4B 1A9TA 2QAJA 1G64A 2GEBA 3A6KA 4C8CA 1L5HB 5T3UA 1BWPA 3CLUC 1XMOB 4DR6B 2B1RA 3KYDA 2R62A 3L6CA 4FCVA 4IMJB 5CVJA 4KQIA 4YUZA 3JYQA 5HKKD 2BGTA 3WG9A 2WU3A 2JIQA 2VJOA 5DRTA 4DL9A 1T9GS 2YHIA 1GPDG 2YZMA 2Y92A 2GPBA 3OT5A 2OLJA 2PQ6A 4QU9A 3M0EA 3CUWA 621PA 3U16A 3DEZA 2QZZA 3O0TA 3OX3A 4INOA 1ZC4A 1JJVA 4LKOA 2EEPA 4MR9A 2GF9A 3H05A 3JRXA 4WECA 5E38A 4BP3A 1FZTA 1QHEA 5E2IA 4D26A 4V0QA 3G2LA 4ZYUA 1ESCA 2RKWA 2XCIA 5EZSA 3GLSA 3P2IA 3TQFA 2EWMA 2H7YA 4CU2A 3BRSA 2QBYB 3KQOA 2PCLA 3LYLA 2HCBA 1LPPA 3G2QA 3KJGA 3OECA 1IJKA 2JJ2D 1SCBA 4LHZA 4PZ0A 1E94E 2PQMA 3LUCA 3UVEA 4ZREA 4J0GA 1FFDA 3GB9A 3KYDB 4K5QA 3WWYA 4OBXA 2FN3A 4I46A 1D1TA 3WGQA 2NLOA 3C6YA 1IULA 1HFKA 4ZOEA 4CFZA 1XVLA 3M6LA 2D1RA 4REOA 2DBZA 3E70C 4RSGA 5DHFA 2EJUA 5DTQA 1WXQA 5D8DA 4M1MA 5ELMA 2VDWA 3RK0A 4BL5A 4EPVA 5EWJA 1FLVA 1J8YF 2NZUG 2QAGB 1PNOA 1N5DA 1TX4B 2D4HA 2I4TA 5ALEA 1JIVA 3VX4A 5C7LO 5ADVA 3GDWA 4I3HA 4EB0A 3B1JA 3PRKE 4GPAA 1FFXB 1PR5A 4B6PA 1EXVA 1RRCA 3G89A 2SCUA 3NU1A 4HQ6A 1KRXA 2OORC 1D9ZA 1VRCA 2PEZA 5KJFA 4FDTA 3K3PA 4DA6A 3M8KA 3NATA 4PFQA 2R85A 2GXUA 1ONSA 2UZ3A 3FOAA 2VYQA 3GZ4A 5ETJA 3DLPX 4YN3A 1NN5A 3KOUA 4MKRA 3ONWA 4RA9A 5BN4B 1YZ3A 1CUSA 3WV5A 2B4YA 2GLXA 1HFEL 4A1OA 4B3SB 3VPXA 1EU1A 1RQRA 3M2PA 4CMJA 2C31A 1PKXA 4KXLA 4DC1A 3R6DA 1NQAO 1PQYA 1YL5A 4LE1A 1ZNXA 5TQJA 4DMKA 1E9FA 2FRXA 3KQVA 3MJEA 3L0DA 4JLVA 3TGPA 4PLCA 2PTHA 4CLOA 4TYWA 3AFHA 4NABA 4CDMA 5JHHB 1NJGA 3RVRA 3HV0A 3WLFA 3WSVA 3L7KA 1TL7C 3B7WA 4NARA 1W6RA 1WXGA 3C7DB 4UPVA 3UJHA 4Z4IA 3QVVA 2H4JA 3T1VA 1FW8A 1FFGA 1KI4A 2L2QA 3QBVA 6AT1A 5J4VA 3HCAA 2PZJA 4B6SA 3G3EA 4TV8A 1PFKA 1QK4A 2VUIB 4QNNA 1D8TA 3L04A 3RTCA 3I6IA 1KOJA 3GUZA 1WMBA 3KVNA 5LBTA 1CEQA 2QSYA 3WK5A 5HZHA 1O9BA 1MPTA 2WA2A 2O48X 4EUSA 2PA3A 4G65A 4FDLA 4L07A 2CDNA 3VA7A 4LJLA 3LPNA 4WY8A 2P90A 3KEGA 3IUPA 2XHEA 4KLZA 4D6YA 1DJLA 1PJSA 3SKXA 4RNCA 4F2GA 3AZOA 4QPPA 1Y63A 4GI1A 3FWNA 4Z8XA 2VKQA 2EATA 4W8GA 2OXTA 4LVCA 1NQTA 3EB9A 4QJBA 3FKSD 4HDMB 4MVCA 3A2LA 3RBUA 1Y4DE 3DDOA 4JQCA 4DR4B 4YRNA 1XLTC 4OHFA 1CEEA 4XCXA 5HPYB 1OT3A 3K0EA 5ITWA 4QQFA 4FFBB 2N42A 5A4DA 5KVVA 2I4RA 1YE8A 2N75A 2Z08A 3F96A 4WRRA 4BNWA 4JJKA 4ZK2A 5BNWA 2IPXA 2AEEA 2VLBA 1H2WA 1DXYA 1E3DA 3F9RA 2ZI7A 3H0CA 2ZJ2A 1H6BA 3FFWA 3HKDB 4ZO4A 3JRNA 1II8B 2PRZA 4RY2A 4DR1B 2W2QA 3CRRA 4LS3A 3W4KA 1GN8A 3FNIA 2HIMA 3LPCA 4KLRA 4Y6RA 4D92A 1GTVA 3NMUF 4P38A 4K87A 3SEZA 1AK1A 2L18A 4AP5A 2W6PA 3AFNA 4QE3A 1LI7A 5IABA 1Z0KA 3ANMA 5A5DA 3CW8X 2FWMX 1FFEA 3U3KA 4M1OA 3NH6A 1BXGA 2HBRA 2K4MA 2BPOA 2XMCA 3PA6A 3LDGA 1Y3BE 4C7XA 2X8LA 2JRCA 5GONA 1QGZA 3REOA 2P5YA 2R751 2NU8A 2D0OB 1KY3A 1V3QE 3CEPB 2DSNA 3CISA 1G5TA 4GOMD 5ALYA 1XMJA 4LXYA 4BFWA 5IX8A 3B6ZA 4JUFA 5JYEA 1KF0A 3PUJA 1P60A 3DTTA 1SC1A 3MAGA 3ELYA 4CIVA 4LGYA 3EXIB 1WPQA 2WFAA 1AUOA 3EXIA 2D59A 1B3RA 4G1EB 1S96A 2COEA 5EIEA 2WSIA 1MVNA 4S3MA 4HLDA 1JEDA 2P9GA 5U9CA 1E3EA 2PRKA 3AVYA 2BCEA 2CLSA 1R88A 1XNQB 4N12A 3DVSX 2F3UA 3AR4A 1O95D 3K09C 3WLIA 1NSTA 1Z68A 3K96A 1U8FO 1N5RA 3JYPA 3L7LA 4J0FA 3EXEB 5SV2A 4YRIA 4QELA 1SXIA 4Z2AA 1I6KA 3GGSA 4JUIA 3SDBA 2ZE6A 3VHLB 1YTLA 1O97D 3KQPA 4HYQA 5HDQA 3WQHA 3MMZA 3E53A 2BEVB 2IYEA 3QPWA 2X9NA 2YBDA 3OPVA 5J4LA 4OXXA 5CB4B 4MRSA 3PQ4A 5I6DA 5G4KA 4KSCA 3R7BA 1SUBA 4Z1OA 4E88A 3JTMA 4KMSA 1VL2A 3W3AH 1NDUA 4KYIB 1UBRS 4BN5A 4CEIB 2J5XA 2BFFB 2GJ8A 2O0KA 3G0DA 3WK6A 3E22B 3GEGA 3PQ2A 5A02A 1T0UA 1WLSA 4OI4A 4P6VF 1ISPA 1F3OA 2A0WA 2JGIA 1E60A 1YB1A 4JQOA 3O3NB 3HUFA 3CNHA 1JEOA 1YI0A 5H80A 1WUTA 1NWCA 3IX7A 3SJ7A 1FJHA 1D2GA 3M9WA 1ZR4A 1JB9A 1E6CA 5JYCA 1TD9A 4FX2A 1VIVA 2ZB7A 3GPDG 3L06A 1QH1B 1W59A 3E9RA 1I9GA 1EK6A 4FKZA 4TMVA 1ITZA 4YAFA 4Q6WA 1S8OA 3ANNA 1UMDB 3ITNA 1DBRA 1QK3A 4JVNA 3O84A 1BX1A 2D7CA 4D5GA 4XH9B 3A3NA 4X1OA 4HXEB 3NYRA 2NQ2C 3M81A 3B7GA 2VDVE 1I2ZA 3V2GA 2OCBA 1KGSA 5HF8A 1TI7A 5IVDA 3TD6A 3KSMA 2O59A 5EC8A 1E1NA 2GM4A 2HJWA 2JIRA 3W9BA 4CFYA 4BMYA 3L1IA 4DWJA 2FFBA 2QS9A 1E6MA 1J06A 5AKIA 1GG8A 1JEEA 4KE7A 4IJUA 3E5MA 1QG6A 1JWBB 4Q6BA 5JS1A 3PCTA 1LTKA 1T36A 2EFHB 2AR9A 4R4JA 4DRXA 1VIAA 3I12A 4MDEA 3HYLA 1EDEA 4JKYA 2CMGA 2F3RA 4LXGA 2GYYA 4M1KA 2OZLA 1BWRA 4JEUA 1K1EA 5JT1A 5KU1A 3SYRA 2B30A 1H2XA 1XWWA 4C9EA 2V7WA 1I7QB 5ALFA 1HE1C 3Q15C 3PD7A 2FUG6 2O4CA 2NU7B 4GPD1 2CUNA 4O4LB 5L3QA 4LOKA 2JBHA 2VP9A 4GF5A 3GNSA 4G4SP 4FVTA 1QXSA 5T8KA 3SN6A 1T9AA 2BI4A 2DWPA 1ADJA 1A7KA 3EQ7A 1E2EA 3NHJA 2SCUB 3KOMA 4FHZA 3C16C 1Z6GA 1QC5A 2FMXA 3C3JA 5IM4F 3PC2A 1IIRA 3OZAA 3PF8A 3L2OB 4C6TB 4PLYA 2BHTA 1UWKA 3WNZA 1Z28A 3TBKA 1V95A 2QLBA 2DYKA 1DTSA 1R6TA 3TLXA 1T2VA 1BROA 1URPA 3CF2A 1C7QA 2OZPA 3D64A 4F7DA 2XTMA 2C2XA 3FF3A 5BV0A 3A4LA 1G20B 1UOOA 1AG9A 1XCPA 1HOXA 3AHDA 3JQDA 4JBIA 4TLLB 5J5CA 2H6EA 5DDIP 3SVZA 2ZBGA 4IIJB 4QGSA 2X0JA 3R3HA 2OGWA 2GEVA 1WVGA 2GOYA 4MWEA 2PKQP 1F6DA 4Y2VA 2OUIA 1T91A 3GFGA 1VPWA 4ZAFA 4EG0A 1QJ4A 4ND2A 1KKLA 3B5IA 5JMPA 3SZ3A 2EJTA 1W8IA 5K2OA 4MUJA 3Q3GE 1E0JA 2H07A 4M21A 4MGEA 5LP6F 2R00C 1X1DA 4FHEA 1N2GA 5FAKA 5JAHA 1NLZA 2COUA 2WWXA 4J07A 4QYTA 1XAIA 2ZBVA 1U9IA 2JFWA 3HGTA 4GX1A 5AVVA 2I1WA 2QX9A 3AL3A 1WV0A 5LB4A 1BS2A 2B2XA 3TFQA 2ZAYA 4KIGA 1E62A 4MQLA 1Y8QA 1V2GA 1FXWA 2BMWA 1VHQA 4XR4A 3M6VA 3TAHA 4EJ2A 2IY9A 4AKGA 2G72A 2R6FA 5FT9A 4ITUA 1NM5A 1RHJA 2QPOA 5EI5A 3SZUA 2JLBA 4AKTA 3D3WB 4PY2A 1JLRA 1K4MA 3K1AA 4L2IA 1HNXB 3LCJA 3ITDA 4JH0A 5BUZA 3C5HA 4L9SA 2H4HA 3E23A 3QBDA 2IYFA 3L07A 3RABA 1XN1A 5BRJA 2C0QA 2JBKA 1MJGM 3UMVA 1XDSA 2RBEA 4EG5A 5FOTA 1N2JA 2B4QA 4K9KA 4XZ3A 2OQ2A 2F55A 4IZOA 1M75A 1Z74A 3VR4A 4UDOA 2VK4A 1OIWA 2XQIA 4Z4CA 2YOGA 5BRAA 2YN2A 3I30X 4NBNA 5H4GA 3H5OA 5B64A 1EM8B 4F3YA 4F4JA 3L9XA 4M86A 2DBRA 3EZLA 4MR8A 2CV2A 3L46A 4HAIA 5ILGA 1Z3CA 4B9EA 1X74A 3ZCPA 2DY1A 3LX4A 2VTVA 3IBTA 1DIAA 3QE3A 2EXXA 4RESA 1FYVA 3ZX5A 4MKXA 2DT5A 2OBNA 5IN4A 3SF8B 1RJDA 5E1OA 2RG7A 1PVOA 1EAMA 1TCVA 4FMDB 4ZC1A 4C2TA 4YPOA 1LLCA 1ZSYA 4HQOA 3STYA 5C53B 2NOAA 3PUZA 4D45A 3LBHA 4RK5A 1NVEA 4XEHA 3WYBA 4E46A 1RVDA 2J0EA 4K6OA 3WGLA 4YECA 3WRYC 3DHEA 4UU7A 4U9UA 4CMEC 4BNIA 2PUFA 1SOAA 3QVGA 4TXJA 2Q99A 3IXMA 4OGFA 4OMCA 4RM3A 5KHAA 3FGOA 3I01A 4AY3A 4NOKA 3EHEA 4UHCA 3DCNA 1P6UA 3A1NA 3KKOA 1ZXLA 2RH4A 4AY5A 1M8KA 1VPDA 2ATCA 2XCQA 1SNYA 3M6WA 1G60A 2ZYSA 3OZRA 4JLDA 4K9SA 4EPYA 5K20A 3Q7SA 2BVNA 2MDTA 5C4GB 3WNBA 4G0WA 1K0UA 3F5SA 1VSBA 3DAHA 4ETMA 3N8HA 4DLSA 1YZFA 5AK0A 1W30A 4L76A 3C6XA 5TE9A 3LK7A 5B57C 4XRRA 1E1CB 2V6GA 3ACCA 4LMAA 1YR9A 3ZU5A 4F2HA 3DAGA 5DO9A 1UODA 4HGQA 4AQYB 2OAGA 3EMBA 2IPLA 3GLFB 1EVKA 2JLRA 4IDEA 2EW8A 2H11A 2GZ2A 5HK8A 2I67A 5FPTA 3WL5A 2BZSA 2OR3A 2R79A 3IH5A 5HILA 3TUIC 1CEXA 2XT6A 2Q5EA 3LFTA 4XDGA 3VZQA 5KSOA 2JIPA 1KK0A 3R0XA 4LHYA 3ANXA 2YS6A 1M6VB 1YZQA 2WIDA 4YT5A 5EYPA 2B9EA 2DQYA 1IN6A 1BS9A 5KYGA 4X7PA 1KEEA 1YZHA 4X62B 4P2BA 1TTTA 2P68A 2XUIA 3UWKA 1V71A 1NDHA 3K32A 2NPFA 4BAZA 2O5VA 4NATA 1R4NB 4HNHA 1Z5WA 5C8DA 1O8BA 5HIIA 2W11A 4R6XA 2Z1DA 3RTBA 1YUMA 1QQTA 4MJXA 3SJCA 1B74A 5KWJA 2F7SA 3B78A 3S8YA 3CONA 2CLEB 4KCGA 5BSFA 4QUAA 3I9FA 4UTVA 2BTQA 5KPDA 2JFQA 5DNDA 2W2VA 1SEVA 1OX4A 4NMWA 3TL2A 1U1IA 3MWDA 4MR7B 4MA0A 1N7HA 4KWTA 4Z1MA 3KOXA 4F4FA 4YCAA 1OFGA 3DR3A 2VQFB 1LQUA 4IG4A 4URYR 1I7SB 2A30A 1YUNA 3GP8A 4N41A 5C1OA 1QVRA 2AN4A 4A0FA 4IBOA 1NA5A 4Z0NA 3AY3A 1X7ZB 2BISA 3DAYA 2CVQA 2J9GA 3ML1A 3QYAA 1TO1E 1VZ3A 5DLYA 4DY4A 4EIWA 3QUCA 4XUGB 3ZH9B 3WS7A 5KTNA 4URXR 2QAGA 3DKPA 5CJPA 1WETA 4BUCA 5MF6A 3BT7A 4PVCA 3MWGA 1ZAYA 1N9GA 3GWZA 4CM4B 4ZC8A 2C97A 4QGFA 5FHRA 1JLKA 4MOWA 5JALA 1NFFA 2F1IA 4H3VA 4UDNA 5IXYA 2H1CA 2ZR0A 1EFAA 1C7RA 1QIEA 1RM5A 1UBCA 2DTEA 2FQ1A 3MWLA 2ZAGA 3G2NA 2V4MA 3H9QA 5F2KA 2E5LB 4OCZA 4HUTA 4CXMA 3G0CA 2PSJA 4A8TA 3OCXA 4QDZA 4IDQA 2R11A 1KRHA 1DO8A 2ONCA 3PUKA 5K4AA 1CZNA 4FBMA 1GJRA 5L7YA 3V3KA 2IHNA 3IV6A 4QNMA 4JEHA 2J4CA 4BNLA 1OHHA 1TMYA 1FXWF 2VK2A 1HQKA 1XZMA 3E9CA 5DEOA 3W5UA 3HPQA 3MTQA 3KTOA 4GWKA 4MCPA 1QAMA 5JASA 1U8CB 1DRKA 1M2WA 2Q3MA 3O5AA 4PQFA 4QSMA 5FA8A 2JVJA 4WUTA 5EWMB 3REFA 4X8HA 2RHGB 4BNMA 3FROA 4HX5A 4NPCA 1CS4C 1G8SA 2XF2A 1GGNA 2FEXA 2OHIA 2PPLA 3EZ9A 3MLAA 2CHVA 1Z0JA 3L0YA 5JH7B 1WQ1R 2A9PA 3IULA 3SVLA 3F67A 5DW0A 5IRCD 3WBJA 4E7OA 2ZYUX 1QP8A 1YRAA 1ZOOA 2GBPA 2GAIA 2FZLA 2OHJA 2YHIB 2GI4A 3Q7QA 4CIWA 2NZ8A 2Y1KA 3ZGZA 5CP8A 2H3EA 3OQNA 3LUAA 3I9JA 3GXOA 4M9ZA 4F2WA 4QU5A 1PL8A 3EX7C 2PWZA 2YZGA 2BMJA 4RK0A 4ATNA 4XJTA 2HLPA 2AQ8A 3PWKA 1EUYA 5CW2A 2UXDB 4ESHA 4Y3UA 1RFLA 4MQMA 1M2KA 3PR2B 4RD4A 1KO4A 4BKQA 3ESYA 2R7AA 2RHDA 1IJEA 4OBEA 3T9FA 3R3YA 4D97A 1QU3A 1GQFA 2BHLA 1S2DA 1BU8A 5BSGA 3ORHA 5BWLA 3HKEA 2HAEA 3FE2A 4ZVLA 5D3QA 5FWXB 2VPWA 3N2LA 1F2TA 3MSXA 4KZKA 3ZW9A 4TT3A 2EAUA 4DG5A 1PK8A 1U31A 4KRFA 4D1YA 3QPDA 5BW8A 3QWHA 4ZV7A 4B0OA 1YQ9A 5K0BA 1LH0A 4XDZA 4RKFA 2ZRNA 5EQTA 2YINC 5LD2C 3OTHA 2ZCVA 4JQYA 4D02A 1USWA 5JRZA 1OE0A 1JBKA 3JARB 4HCJA 1TUEA 3BEDA 4L3VA 3UWDA 4B73A 4EHKA 2YV1A 4MQEB 4P7GA 4E6EA 3TQOA 4EO4A 1M5RA 1RCTE 3F7MA 1EP2B 4Z4EA 2YQ4A 1RPZA 5J1TB 3B3JA 4KWEA 1P4AA 2ARKA 3D4PA 2O4UX 1U0FA 2V96A 3II6X 4LXXA 2QUJA 4MIYA 1II9A 4MO2A 2B4AA 3I2IA 4KZPA 4D99A 3O1IC 4FYKA 4J0KA 1U3CA 2ID4A 3L7MA 1GL6A 4DRXB 2XTZA 4TKUB 5K3EA 3BD7A 2REQB 3O94A 1P9WA 2LIVA 2IK8A 3DZ8A 5KSZA 2PZ8A 4CKYA 2VTBA 4EHHA 2RD2A 4N5HX 3UUGA 4PC2A 3P9XA 3FRHA 4FDAA 4PSAA 2QT0A 2I34A 2VNKA 4KTVE 3H9CA 3FCYA 5HM6A 2D0IA 4PW0A 2JBWA 4PHGA 4YUWA 3NKFA 4IIHA 2PX8A 1I3KA 1PQ4A 2C2KA 1NKSA 3FLEA 2RBKA 3FNHA 5BV1A 2FSHA 2ZWAA 2VPZA 3FUUA 2OO5C 2FWPA 4KTTE 3CH6A 3OLYA 5AKHA 1Q3KA 4PC1A 4P82A 2ZIXA 5KNBA 2A1TR 1EBBA 2O2ZA 3LXXA 3F9IA 3OPMA 4UEJA 4F9GA 3ZZ0A 4RULA 2R66A 3AZPA 3GBPA 5JXWA 3UXHA 1SQSA 1SY7A 2GTIA 2IXAA 4URUR 3T1HB 1WB4A 3QPVA 4IQ4A 1H22A 3FMOB 5IZCC 3QBEA 5KTMA 2YWBA 4R05A 5COBA 4ENTA 1R10A 1PF7E 3ZHTA 1VIYA 4HQFA 4MS4B 4DLLA 4U7JA 1WS6A 3WL4A 3E7WA 3REQB 5IAOA 3I39X 4B7ZA 3E22A 1FDRA 2WIBA 5K8VA 1L7NA 1LPOA 2PKRA 4BKOA 1SXPA 2C07A 1KJWA 3HUUA 4DMMA 4YMLA 4CO9A 4M99A 3HEMA 2DR0A 1ODTC 4RKEA 1SGWA 1U8AA 5CG1A 4LJRA 4BNYA 5F7OA 4HJRA 2GT1A 4YMSA 2AOUB 4JI2B 4E2WA 4NGSA 1HDYA 3KZCA 4MI6A 1MNAA 1V9SA 1EPUA 3EMKA 4UU1A 4BAGA 1Q77A 3W6PA 3VVCA 1BNCA 2VJNA 5H02A 2WMDA 3F2VA 5JWHA 2IH2A 3VKUA 4OFZA 2AG6A 3A3OA 1O6FA 3KEQA 3LHDA 1PJTA 4X1KA 5EIFA 5JCJA 5E8RA 4PQGA 1AKTA 1SKQA 3G2MA 1E5QA 2R4UA 3IP1A 1PWEA 2QP4A 3PICA 4J8PA 1P80A 1E6KA 1A0OA 4F9EA 1D09A 5CA0B 1YFKA 2Q8QA 2V03A 3I1IA 2RJOA 1VLZA 5AH0A 4BQPA 1XNHA 3Q1KA 4JOQA 4II7A 3MAJA 2QP3A 5AOVA 2F00A 4YI3A 4R9RA 4ZIRA 4CUJA 2Z2IA 3E9YA 1ZU4A 3SMQA 1YL7A 4JBXA 4MV9A 1RJFA 2XYPA 3ETLA 4R8SA 5HDBB 4CG2A 4UD6A 2CBZA 3HB9A 3L7OA 4G0PA 1RBYA 2P9JA 4AJ9A 2CMDA 1JTEA 4G5OA 3X1MA 5I8WA 2VSXA 1DPGA 3DONA 2O8EA 2BCJQ 1JJBA 1HH4A 2IZ1A 2F1JA 2WHPA 4L02A 4CL3A 1QBKC 1JT2A 4QO8A 4CKCA 4R9SA 2GEFA 5HQ3B 2QX7A 3C6QA 3NONA 5C5EA 1FSZA 4L7VA 4RVGA 1XUOA 3TVYA 2KW5A 1EFDN 2AC2A 5AI0A 3HV2A 1W36C 1NMQA 1RWKA 1PVDA 3RSQA 3VO8A 1M74A 3I0MA 3OZSA 1OLUA 3KQQA 2NZ2A 2A4KA 1OHHD 1TRKA 2ZUVA 1B8NA 3X44A 4LOLA 4YMGA 3VV2A 4MNTA 3ZJ4A 1NYRA 2M98A 2IYQA 3A3KA 1U5BB 2WTBA 3GCXA 4HPJB 4M4SA 4QXPA 3I58A 5ES3A 2PPVA 2PL5A 3FSRA 3N70A 1Z06A 4M7RA 3ZV4A 2GZ1A 2YVLA 3C3BA 1V9CA 2XUJA 1DRUA 3IBFA 4IQGA 4MVJH 3FAKA 3GVHA 3TN7A 3FUWA 3USZA 4QUKA 3U6BA 4FFSA 3H0KA 1N5JA 1NBOA 2ZXUA 1SKYB 1WNTA 4HATA 4C21A 1Z7GA 4K1LA 1T2DA 3I5XA 1CUIA 4ZHSA 3OCJA 3G7NA 4DADA 4JJGA 1G2IA 1X2BA 3K6JA 2EHDA 1OTHA 3E3LA 3I5AA 2O14A 4HAOA 1MA3A 1QO0A 3UA4A 1JU4A 4GBMA 4K6HA 4QEDA 4TPKA 3ZY3A 1TGVA 4M8IA 4WNCA 2WMOB 2VQ3A 3AB8A 5JNSA 3SBDA 3U7EB 4UHJA 1PGPA 4QXQA 2PGAA 1M2VB 2CD9A 4U2BA 4DLNA 2EKQA 2IPOA 3FOBA 4P81A 4E12A 4IHKA 4DDVA 4GPZA 2PKCA 2RGNA 2IU4A 4ZCTA 5IXJA 1E9CA 3ACBA 2HU5A 1QF9A 3HJRA 3MS4A 2G5GX 1FRNA 1UFOA 3K1YA 1MXHA 4JVLA 1GPUA 4L22A 1CYDA 1NYLA 2A2ZA 4UHBA 2GJAA 5KX5A 1BEZA 1RM3A 4EQ6A 1M1ZA 1CUZA 1YHYA 4IYJA 4UZFA 3Q8WA 4AK9A 3WYGA 3DEJA 4IDNA 4R2XA 3BXPA 1EX1A 1VL8A 5KNLA 2ZG6A 3QH4A 2XNKA 3AVWA 4OXIA 1Q14A 3TVDA 4GD3Q 3FPCA 3HG7A 3WLQA 1KORA 3OE5A 1RADA 1GTJ1 5FQOA 3KAJA 2NTNA 1SA0B 3A1WA 2C83A 4W5RA 2YCLA 2WILA 1LVHA 4FZJA 3EZAA 1N8NA 5IJAA 2E5WA 1CS0B 1G21A 5BSKA 5JH7F 3S9MA 1EWKA 5A3SA 4X6XA 4B81A 3H04A 4G1UC 4Q9KA 3VDNB 5FUWA 4Q9IA 1IONA 1TCBA 4O2AA 1CQZA 1Z82A 2ON6A 5K2MA 3ZV5A 4UNIA 3PEWA 5E95A 2C57A 4YRJA 2FPXA 2WSSA 2JCVA 1GZ4A 3EE6A 3KHTA 3WHPA 3ZEIA 1JYFA 1PNRA 4CF4A 4YRGA 1RLMA 2ZW9A 3UFXA 1C5KA 1L4FA 1QLHA 2QXYA 4MW4A 1UZLA 3DQPA 5ICEA 4Y1RB 3TPZA 1XA4A 1Z38A 3TRIA 1A5BB 2VATA 1N0VC 1S2GA 1NFRA 2VWQA 4DMFA 4HAWA 1T5SA 4E5YA 4ZT5A 2FZCA 1ZOIA 3BI1A 1JKXA 1AKVA 1EG2A 4PO8A 3UM9A 3V1YA 1KJ9A 4DLBA 3MBKA 3PGJA 1B26A 3AO0B 2WTUA 4Q15A 2HHAA 4HFNA 4MCSA 4HWOA 4M1QA 2RGRA 1DXOA 3NTVA 4A2QA 3TK1A 1IATA 1PYDA 2C5LA 1GSAA 2JH9A 2J08A 4MDHA 1NATA 1P3DA 1C9EA 1WQ4A 2DUNA 1T9ZA 2GFIA 3EIXA 1JH8A 1JLMA 4MJ7A 3RCBA 2G63A 3GDGA 2YHBA 3BMCA 3ZOZA 1T1GA 4OC0A 3THWA 2X5JO 2QM7A 2E48A 2ZYAA 3KSRA 2I7DA 1RAEA 2GPYA 3MEQA 1B1CA 4ZYVA 4EHIA 4FIDA 3UKOA 2RBGA 4N9WA 3N59A 3SIWA 2DUWA 3EDMA 3OIYA 2E49A 3DEAA 3A1VA 4FM9A 2AE1A 3C3MA 1E3IA 3L8DA 5G3YA 3BBLA 1Q2XA 2QTMA 3BE5A 4WVFA 2R8YA 1TYZA 2C3OA 3IJ5A 4PN3A 1E4EB 1OWMA 2WTMA 4JJEA 5DYYA 2Z95A 3SBXA 1FVOA 4EMSA 4AUEA 1T4CB 3KPVA 3U7QB 3ZGYA 3C5EA 1W4LA 5FRDA 3UK1A 3WC4A 4WESB 2A9JA 4XAQA 1TU3A 4QBKA 5ALPA 3VAYA 5EGSA 1T25A 2IKQA 1K4KA 3DQQA 3QJYA 1E5DA 2PGIA 1QS0A 2FLVA 3NHMA 3O93A 4G9GA 5A3QA 5CRIA 1QF6A 3IEPA 1ZK3A 3L6OO 4OAOA 2Z83A 4IIJF 1GPKA 5I9BA 3V6LA 1XAHA 2XOKD 3K4PA 3QPCA 2VHEA 3AEXA 3NI2A 5HBRA 3DDHA 4ZN6A 5I7RA 1MB3A 1GOTA 3IBYA 4CT5A 1D6NA 1TFUA 4QXMA 1HT1E 1SULA 4DB2A 4RPIA 3DOFA 3HSYA 4BDSA 3I9KA 2FU5C 1JWAB 4OB7A 1PD1A 4D96A 2QG9A 4X3CA 5I51A 3EIUA 2BR5A 4AJKA 1QTQA 3SC6A 3VSDA 3NOQA 4IGEA 4AZWA 3OZXA 5D7NA 2ODEA 1MIHA 4KNWA 3GJ4A 4Z99A 3UK7A 1J0XO 1RAIA 1BCSB 4D4LA 1SCUB 3A6DA 5LXTF 1VL0A 2IYPA 3LSYA 5CJ2A 5EXSA 3SC4A 3W5IA 3ZBTA 2O9JA 2REXB 4HDCA 2DPLA 2OXCA 3IQZA 3TCKA 1KWGA 4MUHA 3GLGA 2IV2X 3NXKA 5A4JA 2GARA 1KBOA 2C59A 1M1NA 2ZUBA 3FYDA 5ALSA 3TKYA 3UC5A 4DQ0A 1PLJA 5EP1A 5HNKA 4DIFA 4DWVA 1CFJA 2ZM5A 2IYSA 2RGYA 1NOKA 3HJGA 4E2XA 1A82A 1WMAA 3O4GA 1HLDA 1QC5B 3JD3A 2IITA 3LQFA 3NHLA 4NQZA 1CRPA 2ZRBA 3GIDA 3QLUC 4X91A 2PLWA 3R8XA 4HH4A 1F9EA 3C3EA 4L3WA 4PTYA 4G07A 3OO1A 3DFMA 5HX7A 2VA9A 1JIIA 3AUFA 3BGWA 3ELUA 3HU3A 3QMWA 3QY9A 5FUYA 2AYZA 1EUQA 3D7DA 3N07A 5BXQC 3IUJA 3NHRA 1MG0A 4H27A 4CQJA 2H5EA 2DVMA 2OZLB 4TV8F 1BSVA 5EXTA 2I2WA 3V9AA 5HZMA 2HI0A 3FUXA 4R2MA 2UZ0A 2VHYA 1ODIA 3EPRA 3PFBA 2FZ4A 3IJEB 3ORRA 2ZE7A 1R6BX 5C8ZA 1NPDA 4RFSA 2FPUA 2NV6A 4BMCA 1EJ6A 1XX6A 5F4ZA 2VAXA 5EVCA 4NOJA 1RQ2A 3DFKA 2V0NA 3LG2A 3O31A 4TGLA 5GONF 4LY0A 4Z1MD 4DR3B 2ESRA 1DAPA 5C4IA 2C2BA 3HO8A 1IEVA 2V97A 3BWXA 3LHKA 3NORA 2Z5GA 5KWIA 1BHJA 4D8VA 3DTYA 5JI2E 1G6Q1 2J6IA 2G06A 2P6UA 5EE3A 3WGOA 1V16B 1W2HA 2VF8A 3Q6MA 5EFOA 7MDHA 4ESVA 5IR2A 4OD0A 1EK1A 5EG5A 1WU8A 3LHFA 2ADFA 2MU1A 3M6UA 3QKTA 4RJIA 4TL9A 3T61A 1DAFA 1DXQA 1OB2A 4EYOA 3OIVA 4FNOA 3TNFA 1J0AA 1NBMD 2FB9A 3H17A 3SX4A 4UAVA 4A0QA 5FF9A 4DDUA 5B2FA 5BN3B 4LY9A 3P4XA 3M33A 2I8LA 2DFVA 3QSGA 2YYSA 4PIPA 1PN3A 3JVUA 3T7TA 3W3ZB 1U2GA 2QAGC 3BTUA 4L73A 2ZJ4A 3RYTC 3UN1A 3PZBA 1U65A 1NKVA 4P5EA 2XRZA 1QGUB 2O05A 3ST7A 1Z39A 1YZLA 3ZTTA 4L3OA 1EEXB 4KDRA 4AJNA 5BOSB 3DOUA 5D85A 3TG8A 5HFJA 3OURA 5K0LA 5DNYB 5IPFA 1EXDA 1XPUA 3G8YA 4TZ6A 3IERA 1RBMA 3PRYA 3AI7A 3QKRB 1BXRA 2DG2A 2IIPA 2PANA 1AT1A 5A9TA 3ZDRA 5LP6B 3PFWO 3GFTA 5LQUA 4TV9A 4IUCS 3RVSA 4D4MA 4AY2A 1U1EA 2MSNA 1JZQA 4I3GA 2G08A 3K6SA 5CX1A 3UXYA 1WBBA 4LV5B 5G4KB 4LE2A 4HAYA 4M7OA 2C7PA 1GPAA 3QA3E 3GRFA 3IR5A 2PSHA 5CB4A 5I7HA 2AXEA 3Q3HA 1MB9A 2LKDA 3DOOA 5D1HA 5JTUA 3HJNA 4TTQA 1GNSA 3LL7A 2CE2X 2QQFA 1HG0A 1R5OA 3FCXA 3NYQA 3ZHOA 4H3SA 3ZWYA 1G7SA 3DPIA 4JSYA 2W2KA 1N25A 1QANA 2P2DA 3QPBA 4C88A 5GZ3A 1EDDA 4J76A 1P0IA 4U2FA 1FLAA 3TJZA 5HUJA 4J0NA 1DKMA 1W4RA 4CV1A 4XA8A 2W22A 3JAKB 4XJXA 3VTAA 2FPPB 4UBIA 4M9XA 1C0LA 1YF3A 1DQPA 2VJDA 4FEGA 4HPXB 1KSHA 4Q4HA 5DLQC 3U1BA 1ADGA 1YS9A 1NNEA 4C84A 4G24A 4GSKA 4CF6A 3W5CA 3ZK8A 3V4OA 3EVZA 1H4VB 3PXAA 4HQLA 2VWHA 2WHYA 2Y93A 2WLSA 3ZZNA 5CFQA 3SZOA 3TZLA 1BS1A 1FVFA 1KXJA 4WE3A 5H70A 3DTVA 1I2MA 1NRXA 2JRLA 4WJZA 3COSA 1YJCA 4XUEA 4YT8A 1QO9A 4Q4DA 5A1JA 1QQ6A 4UHEA 1A2QA 3SYKA 4YV7A 1Q0HA 2C8VA 3L0BA 1U0SY 1Z22A 3IXLA 1FXUA 4BFUA 2UYCA 4XWKA 4HGZA 2C5EA 4M8SA 3L6BA 4I0WB 3WFIA 1H65A 3AKYA 1IL0A 4GI5A 2PIAA 1XTVA 1VJ5A 1UBHS 4F92B 3O8LA 1QOZA 5AVKA 3WGNA 2VBIA 2R8ZA 13PKA 4RKWA 5GPBA 5B37A 3ZZUA 1K86A 2Q27A 1CDDA 2VXCA 2ZSEA 5DU2A 3DGEC 2AJCA 1ZNQO 2P41A 2XMDA 3IEIA 3FPFA 5J40A 1PEYA 2N1MA 3EOZA 4D8TA 4MP6A 5IKPA 1QQBA 4NMHA 4M87A 5K01A 1HPLA 2O06A 3E4DA 4Q7EA 1M6WA 3R0VA 3EZ6A 5DM60 4E6PA 5KQMA 5A0TA 2C96A 3NBMA 4B4UA 1MGOA 1RRVA 3A04A 4CDGA 3CX7A 1Y4AE 5CPFA 1Z5VA 3T5MA 1A7UA 5DHSA 3JD2A 1QVWA 3U9TA 3VV3A 4RYDA 1YOVA 3AR8A 3B9RA 4M83A 5JROA 2RGDA 2P9CA 3SP1A 1HO3A 1SCAA 1N8TA 3BRWA 5CJJA 5DNVA 2HHCA 3Q5EA 1B8OA 1XRLA 1EBUA 3CJQA 4ZANA 3OF3A 2V1UA 3KEOA 2ZYHA 4X66B 1ZH6A 1EGQA 3LNCA 4EHLA 1SXJB 3QLJA 2Z98A 4XX0B 1QR2A 3BK7A 3KK0A 3O21A 5JAQA 4X95A 1SR8A 3GG9A 3QP9A 3UK0A 4DMUB 3AEUB 5ISMA 2JA2A 4ZVNA 3W5VA 4IF4A 5LZ8A 3TSZA 1YI8A 3M70A 4J9VA 3ZG6A 1T2FA 4AJ1A 4RDHA 3U48A 1PBNA 1J9GA 3RUFA 3KBBA 2H51A 1JZSA 2CUTA 3T3EA 1HV8A 1BGXT 4B83A 5GP1A 5ITZB 2E6UX 1X7ZA 2NUBA 4GBJA 1A77A 4YXFA 5KOHB 2AW5A 5FD8A 4I9UA 2ZRJA 2Q21A 4HYTA 3GRUA 4ZA2A 5CHEA 2BEWA 4BKPA 3B53X 3UB2A 4NK4A 2INGX 4BC0A 3JQ7B 1P0FA 4ESOA 4ND8A 2B5VA 1CQXA 3W5DA 3X1XA 3DOEA 4GUDA 4D9IA 3UPUA 1G5RA 1D7AA 1ZJ6A 1QHNA 2VAWA 3OCUA 2OMEA 3WQRA 1E1LA 2POCA 1UFVA 2A0YA 4LGVA 2OLKA 3DEYX 2B20A 2GZRA 2AK2A 1RYBA 2AFIB 1UIMA 4ZVKA 4BX2A 1E7QA 1OLSB 1QTRA 2PHZA 3PHBE 4EITA 1LK7A 3KDAA 4YDHB 3FRJA 1G4UR 2I4MA 2B25A 3RKSA 1QIMA 3KFVA 4E21A 5KYWA 1IBLB 2CSXA 5F3DA 1H2HA 2NAPA 4RHFA 2GUGA 4JI6B 1TYBE 3OZIA 3M4NA 2PH3A 5WRFA 3BQNB 2ZCUA 4AKEA 5AK4A 2H1HA 1U8YA 3N2NA 4RPKA 4QRDA 1HE3A 3BFKA 1Y1SA 2QRGA 3G88A 5ILQA 2FRDC 4ZQHA 5BQOA 1IIBA 2HSWA 1ZVKA 2IWRA 4AMUA 5EKDA 4B34A 4QNRA 4Q66C 1DP4A 3TIFA 1RYNA 1A95A 1BE0A 1YONA 3ESAA 2QSJA 2W9XA 3EGDA 5EE9A 4TTPA 2FPGA 4G0YA 5AUOB 2D2VA 3KKZA 3R3XA 3F90A 3MM4A 5IBPA 3F6YA 1XRMA 4L8GA 4M9CA 3Q3IA 2G9UA 3E05A 2C94A 4XFKA 3P1JA 1RQGA 3D6NB 4MQFA 3Q7TA 1TPZA 2RGWA 4Q4AB 1TTHA 4WD3A 4EF4A 6REQA 4GQIA 2P79A 4OB8A 1IBMB 5I9LA 2Q2NA 3U4MA 1E1QD 3RC3A 2Q6VA 1REQA 3BE6A 2Z6QA 1NT2A 4F86A 3IDFA 2IP4A 2UYGA 3DEKA 4KXXA 4TUYB 3KQYA 4EK9A 1JH9A 4GOXA 4Z3DA 1DRWA 4FNAA 5LPNA 2YVQA 3AZQA 1W94A 2GEUA 1Z17A 2RI6A 2QK4A 5FORA 3FCSB 4EPTA 2F3PA 4G0NA 3DZCA 1EVZA 3A4NA 4DMGA 1XT6A 4PZYA 4LZJA 1QV6A 4I1IA 2PZLA 1UBEA 2G77B 2ZSJA 2AD1A 1SWWA 2NUAB 5BR7A 2PX0A 3AIIA 5HSGA 2WU8A 4PG6A 3UANA 3B5EA 4V0NA 1IQPA 5BSRA 1EE1A 1A9XB 2VSFA 1YC5A 3QKSB 2JBAA 3GRVA 5AKGA 1HDRA 3F7TA 3T5DA 4J1NA 1M6NA 3U1TA 1U4NA 4RBNA 4CIXA 3VDMA 2XWQA 5FBQB 3BWCA 5IM4A 1J39A 1M34A 2BFNA 2Z8YA 1I01A 3NHSA 4LXHA 4LYDA 3R7WB 4D3FA 5CTJA 5CBPA 2V4ZA 2ACWA 5CH8A 2JI9A 2VF5X 3EWSA 1JVSA 3JZAA 2ZEJA 1HR0B 2QLNA 4AXXA 4AXBA 4E3ZA 1DINA 4IQFA 5DLPA 1E0AA 1A1SA 2JJ1A 1A5AB 4DR7B 5DT9A 1ZMXA 4NG5A 4LRXA 1RYDA 1L8QA 4MV6A 2KBEA 3SS7X 3NM6B 1JJ7A 1UBNA 3LBIA 3WMXA 4RJLA 3IO3A 3WTBA 2C9DA 3WIDA 5IFKA 1VKZA 3FBGA 3D3WA 4CM8A 3CM0A 2JCXA 4F4IA 3E03A 1CRZA 4RHCA 4IGKA 2BZ0A 3OPQA 3EUFA 2A67A 5AOBA 3AK4A 3BWMA 5EUBA 3RVPA 4ZGBA 4LF9B 4DBLE 1QCDA 5FI5A 2VUHB 2H54A 3JVIA 4QVIA 1WOMA 4OHBA 4ZVSA 3ZCUA 1T8RA 4XTCS 2XUDA 1PWYE 4R2HA 4DNFA 3D5EA 2B36A 4E7PA 4CTNA 1H0HA 1C7ZA 1AF7A 1UK6A 4INZA 3R75A 1BXZA 2VHTA 4H7DA 2UZIR 4XWWA 5PGMA 2PNJA 3WRXC 4G89A 1XTUA 1TCCA 2GN1A 2WKWA 4MPDA 1LBEA 4BJHB 3ELDA 1CEYA 3TTSA 4V0SA 5DYGA 2M9MA 3X3HA 4C06A 2ZE8A 3ZD8A 1TK9A 1QRAA 2ZJ1A 3FSJX 4FFVA 4PTLA 3DXZA 3WOHA 4ZARA 1SXQA 2W2NA 1SFRA 2OYRA 4B4DA 4LJ4A 3UZUA 4DLXA 3OEEA 3AB7A 4JYPA 1V0JA 1A2KC 2Q5QA 4HN2A 3WLRA 4HWSA 4C2BA 1HDIA 1DQRA 2P5TB 5FL3A 3GVXA 3O4FA 5JMOA 4WJLA 4Z7JA 4LRYA 1L8AA 5AHKA 4G0MA 5DOZA 4R16A 4C0KA 2H2HA 1R37A 2QRQA 3B6KA 4KJZA 3IAAA 5JFOA 4MI1A 3PJFA 3AIMA 4HNVA 1KQGA 4G5RA 2EFEB 2QY9A 1BFUA 3NO4A 4ND1A 3IP8A 1PFUA 1VP9A 2CY0A 3D3QA 4EA6A 2BR4A 1MR3F 2QW8A 3R4CA 1FXSA 1JIXA 3LA8A 4H1WA 5L3QB 1ID1A 3HYNA 1A72A 3MT9A 3J7AC 3ZDDA 1XKXA 1DIOB 4CWAA 1NVDA 2GVDC 5G0VA 1R5NA 2Q4TA 4F5DA 1AZSC 1Y3DE 1M3SA 2WTAA 3DJFA 3ENZA 1ZJ5A 1PD0A 1UKYA 3NHWA 4LHEA 3S2SA 3FD8A 1YAHA 5A05A 5TVGA 2BFDB 2SHKA 1Y37A 2C4UA 3OQIB 4IDOA 3KFXA 4NMLA 1WHTB 3VGJA 2BLNA 4Q0MA 3COPA 3MCZA 3PGKA 5FL7D 3U3XA 3NOOA 4XWGA 5C5CA 1P5JA 4FHCA 4JEMA 3H8WA 3IPAA 3JSXA 5A7HA 3R7AA 4GZ6A 3O26A 4TJXA 2CXNA 1XHEA 4ZQCB 5CG2A 1X38A 4IXTA 1JBQA 4AKIA 2X3YA 3TSCA 4H77A 1B8UA 2QF7A 4OP1A 2D8AA 3NBKA 5BSUA 3A31A 4UCXA 2VF4X 2GEKA 5KREA 4CIBA 4J94A 3T7CA 1U1FA 4YMIA 1DFIA 4NU8X 3VSBA 3DLIA 4X0EA 4ZRDA 5T5QA 2AG1A 4JLWA 1RZRD 4BN0A 1Y1TA 5IMBA 1JQDA 3GYGA 1D2RA 2WIAA 3LCRA 1L5QA 2CDRA 4GM0A 3OCVA 1PT5A 3P0IA 3NP7A 3QF7A 4KOEC 3RFCA 2EG5A 4W5HA 5FR2A 1SBYA 1XXHE 1LPAB 1YS2X 4MAAA 4WHMA 3SQMA 4E15A 4DMRA 3ZU6A 2XDYA 1E5VA 5D5QA 4MGZR 3R7SA 2FR1A 1ADFA 4XGQA 4UE6A 5CW1A 2YR0A 2KLBA 2NZVG 2ORED 5EP3A 1XVTA 1H0RA 2Y0DA 3QU2A 3MS2A 5LYYA 1GTSA 2O8FA 4MLCA 2DJIA 3UBMA 3UJBA 4I4LA 3CHYA 4QOEA 5JPIA 3CUKA 5TARA 2FWNA 3EEBA 3CTPA 3OWOA 2TRSB 4S1NA 4GDFA 1BN6A 3EVAA 3T41A 3ZH2A 1GUAA 2JA1A 4QVGA 4ZAZA 1LEHA 3U3ZA 3AG5A 3U1VA 1DAOA 3WYCA 3CUTA 3CB4A 3UAYA 3K15A 4NGNA 4KDEA 1H3FA 3JQQA 4Y6SA 4LJ8A 3DKVA 3WAKA 3QTTA 1FZQA 1XGKA 3D6AA 3UATA 1AN0A 3EG9A 4GKAA 2AI2A 4MKIA 1UP4A 1QLWA 1UXIA 1Q92A 3TLJA 3W05A 1U0HC 3OZWA 5B7QA 4GXTA 1KQPA 3LUBA 1AV6A 4Q7KA 4O2BF 1LNSA 3K0AB 4EKDA 2ZREA 3R24A 1I3CA 4HMOA 4TMTA 5C8XA 4HMQA 3VR5D 3PQ3A 3BGIA 1AZWA 1JDBC 4RCVA 5D84A 2CJXA 1Z83A 2KX7A 3HY3A 4H17A 4K86A 5CLGA 4ND4A 3NS7A 5FLYA 3G79A 4PFSA 4EOGA 5KWSA 4BMDA 2FX3A 1P19A 1LNZA 2H2IA 1R7RA 2A88A 4HV4A 1GLVA 3WGUA 5JLJA 3O4HA 3RANA 5FUXA 5KAMA 1LQ2A 1P5ZB 1QZ3A 4ZVRA 1L7AA 1UBMS 1HUQA 3FCEA 5EINA 1ZHOA 1OSNA 1UDXA 2JFOA 3QHPA 3TB6A 4F8EA 3UMYA 1SQ5A 2FV8A 3GARA 3P9QA 2HMWA 3V80A 3WL8A 1O2DA 4ZI7F 5LR6A 3QEMA 1U3WA 1K66A 3CKMA 2QMHA 3FETA 2HN9A 4GZ3A 3RJMA 1JEQB 1L5MA 4DEVA 3CRQA 1RWXA 3C3KA 4ER6A 5FH9A 3ICVA 3H7IA 1XTPA 1IJBA 1THGA 2JGMA 3SSMA 2ZTMA 4LNHA 3BUSA 3AF3A 4KXWA 4IL5A 4ZEOA 1VA5A 4KACA 1ZU5A 2A5LA 4RA6B 4H3KB 2PH5A 3D4OA 3M83A 3AR2A 2KM1A 4GX2A 2G0AA 2ATXA 3H6GA 5KVCA 2ZJ8A 3FTCA 5BORA 1OOEA 2GFHA 3QEAZ 1PLKA 1T6XA 2AN5A 2N1BA 1E7RA 1H5QA 1JTVA 1Q95A 2W6ID 3EFHA 3ND9A 4JJ7A 4XVQA 4QDUA 3AFOA 5D6OA 3VOBA 1XN4A 2FEAA 5BN5A 1P75A 1TAQA 1XPOA 2I8AA 2E5FA 4A2PA 4AJJA 2QTNA 2QV0A 1HI9A 4YR9A 1YVUA 4M0UA 2O2CA 5LMNB 1XMIA 1QYRA 2A57A 2C4NA 3W5JA 5JDCA 2FUKA 1VL1A 5EKTA 3ZD9A 3R6TA 4DQUA 4F6LA 4PZUA 5A3RA 4JYMA 4KH1A 4G3XA 4JELA 1J22A 4Q1FA 4E32A 1I1HA 1UDCA 2V4UA 4DXAA 1G3RA 1VDZA 3B9BA 2ACKA 3U31A 4AZTA 4YAUA 4H3HB 3UGJA 1QYIA 3N8NA 3I5MA 1QFSA 2EK9A 1RR6A 4P31A 3OKAA 2DKNA 3QHAA 3G49A 4QHTA 3PUXA 1DIGA 4WXRA 3V34A 1O0SA 3EFEA 4LMRA 4EABA 5LXTB 4P4UA 3TGLA 4XUDA 1XQ6A 2RHRA 2VEDA 1P1IA 2F8SA 2Y71A 4KPFC 2DERA 3GLIE 3CO0S 2ENWA 2JAPA 4LFCB 3NHZA 3USCS 2Z2JA 3GX1A 5DGHA 3D8RA 4AX8A 6NULA 3K30A 3WJ1A 1O7JA 1VJCA 4L08A 1YGPA 4QPJC 5LA6A 5F09A 1TM4E 4H4DA 4RWEA 4DA0A 1AGRA 2WJ3A 4JYCA 3S68A 5LMZA 2PMCA 1QK5A 3IE1A 2JLWA 4M6WB 1DDGA 5JY1A 4NZNA 4XIFA 1DQYA 3HXPA 3VNQA 2IF2A 3H2HA 4A0SA 1LF5A 4X85A 2DPMA 1E4EA 4U4AA 2RAUA 1BOOA 4Q16A 1E3MA 4OLFA 1NR7A 3ZC3A 4W82A 4QYSA 2ZP1A 3R5XA 1RJ9A 1Y9ZA 3DO8A 3JWHA 3D2BA 3EDYA 1WY5A 5BR4A 3SYTA 4BZQA 2B4TO 1P7ZA 4L8LA 5HOQA 5J9FA 3H86A 4FNGA 1RWBA 1NJ2A 1LF0A 1WEHA 2XOEA 3EFOB 4C78A 4M54A 1H1LB 2CNKA 4Q7QA 4EB3A 4ZT2A 3BH7A 3ZWVA 2GGSA 2O2XA 5CT6A 1RI2A 1R3UA 2BFBA 5JDIA 2EKBA 1XQVA 3OG9A 1C4XA 3I01M 3V6MA 2EYUA 1P0CA 2PTGA 8ADHA 3I45A 4B3XA 1MW9X 4EWLA 3V4PB 2O3SA 4UFPA 1NLFA 3JQGA 1ADCA 4MINA 1LFDB 4N5IX 2JZNA 3G02A 5DV9A 4KVAA 3X0DA 4QSHA 1NF3A 4C7OA 3ESCA 4MLDA 1JQEA 1J56A 4NFSA 2IYAA 5E1DA 4AF7A 1TXGA 1V1MA 3FRIA 2CFTA 2VT3A 2XZTA 3QNMA 2CXRA 1WTAA 1C3OA 4ZP1A 1CUEA 1VKJA 3STTA 3IMGA 2BEUB 2PS0A 2QLJA 2XV1A 1VE1A 4FD3A 1C1HA 4UNNA 5SZKB 1AS0A 3ROXA 1TAUA 5LU9A 3HDJA 2DLDA 1HQDA 1XDWA 2JBJA 2ZDHA 2OAP1 2OFOA 4OHOA 4NBKA 3GXBA 3UEOA 3KOYA 3TMAA 1JHPA 3I9LA 5E4YA 3IUSA 4Q9AA 2ZANA 5J23A 2IOFK 4EGSA 1OAOC 2FHPA 2V7UA 2R6ZA 4UBMA 1KTIA 1W9MA 3ER6A 3R0JA 2C2GA 3V8QA 4RTRA 1GPH1 1PZXA 1VGVA 2JHGA 3IQEA 1JVBA 2QLMA 5IT4A 4HB0A 3LRXA 5F2EA 3ZHZA 3EGDB 4BMZA 4IDAA 1CS0A 1FFBA 1QPGA 2B1GA 3IOBA 1EBFA 3MSCA 2DBYA 5E3IA 4WLUA 5F35A 2FPIA 4RW0A 2WFLB 1Z2AA 4ARZA 2AUMA 1TZMA 5EQFA 3ZDBA 1I0ZA 5ILOA 1VGRA 2GZMA 3L7AA 5A62A 3P26A 1N0HA 3ZNOA 4ZDIA 1N6LA 3R7LA 1X2EA 5THKA 4RHEA 4HUQA 4V1CA 3OSUA 1U9CA 1W88A 2IXDA 3PVCA 4XCVA 4PNHA 1XCBA 4F8YA 4DA7A 1TZCA 1JPNA 1W35A 1MO6A 3K09A 3U7IA 4QODA 3FSGD 3W04A 1UEIA 2CXTA 5ERYA 2QMYA 3ICCA 3LQKA 3QWBA 3UYKA 2V5VA 3HJHA 4P93A 1JG6A 1NJFA 3D0OA 4P0TA 4WH0A 4FJ1A 2YIMA 3SEQA 5FUVA 5B30A 2FQXA 3DFZA 7ADHA 4KIUA 3ICWA 2PKXA 2VQEB 4YQFA 3BL6A 1CP3A 4XKJA 4V0MA 3TLGB 2R1VB 3CWZA 4IIDA 5DBFA 5DNAA 5FA5A 2LKCA 2QD1A 1WW2A 1G59A 3RRXA 5H5JA 2IQIA 5CDGA 1T8UA 2B5OA 1IBKB 5J2UB 1UKCA 1SVOA 2C4MA 3Q6IA 4I1PA 4MPRA 2DEUA 3DKKA 4K9DA 5LL6P 3QE9Y 1LS1A 1ZI6A 1BXKA 2OB2A 8GPBA 5H9WA 3U4GA 4FCCA 1Z8NA 1XQ9A 1RRMA 2JARA 4NJMB 3EJWA 4O4HB 4KE6A 5AVRA 2W2XA 5TV2A 3L05A 1U7OA 2TSYB 4RF5A 1CZLA 4P3OA 5J5VA 3SHWA 2YWEA 4B3DA 1ZCJA 1KP2A 1XP5A 2NT3A 2V6FA 4XI9A 3RU2A 3ROMA 5CM9C 1JQ3A 1LKZA 4L15A 4Q3AA 1E3LA 2FDCA 4ZOLF 4AX4A 2NU6B 1B2RA 3GQVA 3HCPA 2CHQA 3DDCA 3C4VA 4MVXA 4BNTA 2I78A 3CX3A 1VSQA 3AXTA 3AU8A 1JXAA 1YV9A 1ZD3A 3H4MA 1CD5A 4NULA 2E18A 4BP1A 1IG0A 1WAMA 3OZCA 3T4XA 4EJSA 2RHCA 3T5PA 4M0DA 3HDQA 4AZ0A 1PGQA 1EWQA 3RAEC 5JZVA 2WPDD 4RJJA 3KQMA 3V1NA 4BNNA 1TJ5A 3IRVA 4ISBA 1QMGA 3I28A 1NI4B 1NW5A 4IS3A 5JO9A 4ZGGA 2XADA 3VM6A 4PAWA 1ZGJA 5E6UB 3BCUA 3LFUA 4C7BA 2BFOA 3HL0A 5K3DA 4L75A 1JDZA 4BMNA 1N6IA 1T3LA 2R68A 1P7PA 4GLBA 5IBCA 1GPNA 3WA7A 3QE2A 1V8ZA 1OWLA 4AF8A 2HK9A 4AJIA 5CA0A 1ZK4A 1Q0LA 2HF2A 2PL3A 3GZNB 3Q5GA 4KQKA 5EIXA 2ZBFA 1LSUA 2QTHA 4EPWA 1X1CA 2HPVA 2W4IA 3VO1A 3J81k 4MV1A 3OEED 2ZI6A 2POQX 4FQ5A 3QVKA 1Z13A 2HIAA 3FWPA 2C4HA 3GBSA 5I5EA 1V5FA 3NQ41 4WOBA 1YU9A 5FJIA 3T3NA 1GA1A 3KEMA 1J5EB 3PC8C 4LBWA 3HXOA 5H0IA 4NXNB 1CDOA 4F5YA 1XQWA 1ZUIA 3Q3VA 3TIXB 3EXFA 5IDXA 1O96A 1S0UA 4YNBA 5BURA 3CNNA 1X8JA 3HFGA 4YAIA 3ENNA 3OD5A 1KP9A 4JXKA 5TY0A 3RJ9A 2OGZA 5JARA 1J0DA 1GGMA 3L77A 1Q1AA 2EP5A 1NVGA 3H5IA 3NANA 4KHZA 1CULC 1JQLB 2XOXA 5TMPA 3WAGA 4Q4HB 2O3TA 1MZPA 4ACAA 1N0UA 5MDHA 3GJYA 4HD8A 3VZDA 3BPSA 2HWWA 3A9RA 1FL9A 2Q4OA 3P2EA 3UQZA 3GQBA 3RQSA 5LIRA 4L0CA 1Q7GA 2O8FB 4EKEA 7REQA 1P31A 1TM5E 1ZM3A 2PSFA 4J7XA 4N9QA 4KAJA 4B4KA 3RWBA 1Z0IA 1DAMA 1L4MA 3SI7A 2OZVA 1YCFA 4X1IB 1L9XA 4F2PA 5FBRB 3WYAA 5LYJF 3RFXA 1MF7A 3NB0A 2J48A 2IUYA 1P2UA 3TLCA 1DC5A 1I4TD 5JMTA 3O9VA 1DB3A 5AJTA 1XIVA 3AR9A 4D8WA 2C9ZA 4X92A 1IN8A 1VJTA 1T9CA 1JNXX 2C7BA 1EFRD 2F17A 2AOTB 1G3IA 5JLAA 4BJ5A 1L8XA 4ZYLA 2GEJA 2VDNB 3WLNA 1C3LA 1OZGA 1JXQA 2XMPA 1DWQA 4OM8A 2IV3A 3WIVA 4EL5A 1JIJA 1XP8A 2C6GA 5AJUA 3RU9A 5HRUA 1NYTA 4Q00A 3SD7A 2IVFA 2E1RA 1E99A 3E2MA 4EA8A 2IEBA 2ZJZA 3COVA 2WZCA 1MENA 1VG9B 1VCIA 3GLHA 4V03A 3T54A 4ROSA 5C7OO 2A9FA 1M2NA 2D8MA 2HMSA 2OV8A 3ZXSA 1KWKA 1I51A 4KPYA 1V7PC 2P5SA 4OFWA 1YOBA 4AP6A 1G63A 3A6PC 4KNVA 4DTIA 3DF9A 1FYEA 4K6FA 3OE7A 4JL8A 3Q12A 2VF7A 2FG5A 1EWRA 4X60A 2XVXA 1IMOA 1W8DA 2D5IA 4FHGA 4CMKA 5IF9A 5JBIA 3NOVA 1JFFA 1KAOA 3BH6A 4D2IA 1FP4B 5CBKA 4JC8A 3LWZA 2Q6LA 2JFVA 2YXBA 2X23A 4IMIB 4DRZA 4K9LA 2QRVB 4XVHA 4L9RA 1Z63A 2B0CA 2Y1WA 1IAQA 2JLZA 2LE0A 4PO3X 3MZ0A 3QMPA 1T8SA 3IPXA 4Q48A 4FDMA 4JX8A 1HURA 3RFUA 5AW7A 2CWWA 3UBTA 2DHEA 2OB1A 3AF6A 2XTJA 2KHZA 4EGQA 5TQ2B 1YVPA 5JD4A 3N0VA 2VTBB 5K0EA 2LDXA 5KNCA 2GBLC 1PJ8A 2HBQA 5K3SA 4HRXA 3DYVA 2WHQA 1X8XA 3KD3A 2JI7A 1N2CB 2OG1A 3ILXA 4R81A 2QM8A 4C9AA 1PFVA 3SG0A 3AUUA 4JLMA 2W5UA 1Z7BA 5DNWA 1HT0A 1Q0PA 2F6RA 2NVBA 3DCYA 5AIBA 4CNQA 2A0UA 3ANYB 1N8SA 4RTKA 1GTL1 4JP5A 5K0GA 2JG3A 4GR5A 1XROA 1Z4LA 3EK2A 4EKNB 3SMVA 3CLRD 4PXSA 1E96A 3Q4GA 2B82A 2O1EA 1N2SA 2ZYRA 2ZTLA 1NNSA 4L5JA 1ACLA 2JJYA 3FKSA 2RKBA 3KVYA 5FPKA 2YUTA 4B3BA 1R27A 4G9EA 4GECA 1M2HA 1OVGA 1X7YB 3F73A 1JA1A 2AWOA 1A9QA 2OCLA 3KKNA 1V2HE 4ZTBA 3VYWA 4WPGA 9GPBA 1B7GO 1FBTA 3M4ZA 1AGPA 2AMYA 1NBHA 3DHYA 5CFMA 1PJZA 1C7JA 2MINA 3T34A 3K5IA 4I8IA 2GPAA 2HMAA 1L8OA 3MMSA 2BGWA 2WJHA 1BDIA 3MWJA 4X20B 4E2FA 3WLMA 4NBLA 2FR8C 4BBZA 2XBLA 2H7CA 2OGUA 4OHMA 2F3TA 1V43A 3F6EX 1NN1A 2PNFA 3P4YA 1Q5XA 3IHKA 2ASVA 4MITA 4DSOA 1JSLA 2DQZA 2PVPA 1LC0A 1JQJC 3PHLA 5BNZA 5K4HA 3EYWA 3A1DA 1KC1A 3KZVA 4BE4A 3RGWS 2EKLA 3K0HA 2HI6A 3PSAA 4J16C 4WN3A 1PGNA 4JBGA 1N3BA 3TZHA 3X1ZA 1SU8A 2OEPA 4H2DA 5D5PA 3MF4A 2BFBB 3QU5A 4Z7OB 2BRUA 5DCWA 1NUAA 1YS1X 2WNSA 3EIEA 4I3FA 2DMRA 4H0FA 3AVXA 3FNQA 3CKLA 1SD2A 3WMRA 5C34B 2I6QA 3K20A 5K03A 2QTVB 4Y6LA 1JDEA 1YJQA 2Z09A 1EUCB 2PM8A 4DKXA 2CIJA 1NIJA 2H4WA 4N8EA 4FYIA 1X1SA 2E2WA 3PLRA 4P86A 4LYHA 2ZAOA 3EDRA 4EG7A 2BTEA 3NCTA 1HQYE 3TZBA 1Y1PA 3OWXA 3NBXX 2F3QA 1E6EA 3HDYA 2HGSA 3OM8A 3ESXA 4KO3S 4PVDA 1FVHA 4S2UA 5JSQA 4CKXA 1C9DB 2CYBA 1KVRA 1RTTA 3K0CC 4MCIA 4UDXX 5JCOA 2HDHA 1UPAA 2X13A 3QVUA 3HO6A 3OQ6A 1UPCA 1F0PA 3UKJA 4HKTA 2ORIA 1O5TA 3AHHA 5AKXA 5FTWA 4O1MA 1M0EA 4C9RA 3H4IA 4YX9A 2R6DA 3K9GA 5EWLB 1RP7A 4BVHA 1G38A 4MUNA 5JVDB 4TUYA 3QE0A 5EJ9A 1O95A 2VYCA