3TLZA

Microcin c7 self immunity protein mccf mutant w186f in complex with adenosine monophosphate
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
335
structure length
335
Chain Sequence
b'PLLAAPLAVGDTIGFFSSSAPATVTAKNRFFRGVEFLQRKGFKLVSGKLTGKTDFYRSGTIKERAQEFNELVYNPDITCIMSTIGGDNSNSLLPFLDYDAIIANPKIIIGYSDTTALLAGIYAKTGLITFYGPALIPSFGEHPPLVDITYESFIKILTRKQSGIYTYTLPEKWSDESINFNENKILRPKKLYKNNCAFYGSGKVEGRVIGGNLNTLTGIWGSEWMPEIRNGDILFIEDSRKSIATVERLFSMLKLNRVFDKVSAIILGKHELFDCAGSKRRPYEVLTEVLDGKQIPVLDGFDCSHTHPMLTLPLGVKLAIDFDNKNISITEQYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccF
publication title Structure and function of a serine carboxypeptidase adapted for degradation of the protein synthesis antibiotic microcin C7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 118
structure length 335
sequence length 335
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02016 Peptidase_S66 LD-carboxypeptidase N-terminal domain
A PF17676 Peptidase_S66C LD-carboxypeptidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Class I glutamine amidotransferase-like 3tlzA01
3.50.30.60 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 LD-carboxypeptidase A C-terminal domain-like 3tlzA02
5F5XA 3TLZA 3TLGB 4H1HA 4E94A 3TLYA 4MI1A 4MJXA 3TLGA 4E5SA 4INJA 3TLEA 3TLAA 4IIYA 2AUNA 4EYSA 2AUMA 4IIXA 1ZL0A 4JVOA 3SR3A 3TYXA 5FD8A 5F9MA 5K99A 3TLBA 3T5MA 1ZRSA 3GJZA 5F1YA 5JYBA 3G23A 3TLCA 3U1BA
chains in the Genus database with same CATH superfamily
1Z13A 3H6HA 4HQLA 3MTEA 5F2KA 4C78A 2NU8A 1MB0A 3Q4GA 1JIIA 4X41A 2FPMA 3B1YA 1A77A 1TF2A 1QFXA 4GOND 4P4LA 4GXQA 3SX0A 4Q34A 3AFGA 2GVNA 2LW7A 2Z4SA 3UUFA 4X7MA 5FWYA 4EY8A 3QOFA 2J3JA 1Z6YA 2QTCA 3H05A 2XRZA 1P4GA 1TFUA 2I4OA 1XT6A 1Q92A 3EEIA 4DM7A 4TL9A 2UVPB 4BEVA 1PNRA 3I12A 1L5HB 1IHPA 4YQEA 4HVCA 1EVJA 1WZNA 3CR3C 3CUEF 1E3WB 3UMSA 4P3OA 3I76A 2Q6IA 5EGNA 3Q8MA 4XWGA 2RAFA 3KX2A 3K73O 1DEXA 4NR0A 2JI8A 3BS4A 3PJDA 3C74A 2H5LA 1T8TA 4HNGA 2GLTA 1P5FA 3NCHA 1Q0RA 4LHYA 3UHPA 3I6IA 3LPMA 1KC7A 5DF1A 1G17A 4G1CA 4MWSA 2WA1A 1DOAA 4HEHA 3QENA 4IDAA 3ZK9A 5LXTB 1XL1A 2PRYA 3NRBA 2DQKA 2WIKA 2UZ0A 3WGNA 1NW3A 2YRWA 3AYXB 3LL4A 3NHWA 4WOKA 5IN5A 1F6BA 3W6PA 4AF6A 1OZHA 3F9RA 4PLPA 5FX2A 2QRVA 3WRYC 5DTJA 3QU9A 1ZJ6A 1TYCA 2F9MA 2HHCA 4KOAA 3IVMA 2PKQP 4EDHA 1ITZA 2WB4A 3OCZA 4QBIA 5KNDA 4EA9A 3DBHA 3PEYA 4RHTA 4CMEC 1IRXA 1K8RA 5B58C 2V96A 4NPAA 2C97A 4IF4A 2WYWA 1PNOA 3IDQA 1PG0A 1A8UA 5B2EA 1O94A 1O6CA 4BNLA 2W43A 3W4JA 1RQ7A 1AUXA 3RB8A 4CLRB 2YWDA 1V7PC 4EKDA 2OBNA 3H0CA 2X3YA 5CLGA 1YT5A 5E2IA 5F5NA 1GDHA 3UNXA 3HXPA 4N5MA 1JI0A 3WGUA 2RGNC 4F5WA 3PXAA 3CPSA 1EHYA 4OHUA 2XECA 1H8HD 1NMSA 3AIKA 3HDVA 3LQKA 1DBWA 1IDOA 1S9DA 2GAOA 4U2CA 3VPCA 1KPHA 4MMZB 5IAGA 4TVSA 4A0SA 1EAYA 5HE8A 1DEHA 1SB9A 3QYJA 2BYTA 3PL1A 4IXDA 3WLEA 1JQAA 1S2GA 1E4YA 4LGCA 3AJDA 4BMNA 3N74A 1W34A 3PENA 5IYZB 2DR3A 1T8PA 1KDPA 3D6FA 1CY2A 3HU1A 4DV3B 1A5TA 2C78A 4WCFC 1YNSA 5A06A 1PR1A 3PUIA 3PQ7A 1SBCA 1YBVA 1XKXA 3AWDA 2D7CA 5DDIP 1YDMA 3RAJA 3GCWA 1Z6ZA 4V0SA 2BBWA 1P6UA 1F60A 1KOLA 1G42A 4YR7A 3NOJA 3CWQA 5DX8A 1U8CB 3MIZA 3GDFA 4AROA 1L2TA 3BH6A 3HYNA 2PGLA 2Z30A 3KQOA 3OUTA 5C8YA 1O6GA 4ZAYA 2LUOA 3R6WA 4WY2A 1WCV1 3T1OA 1BHSA 4NYJR 3FDJA 4G25A 4P92A 2WB2A 1EFUA 1NQTA 1RBQA 1ZZGA 2F00A 3HNRA 3JQBC 3PD0A 3PPXA 4IHJB 5EKSA 1ZD2P 3HPQA 3O1IC 4CYMA 1KSJA 4IX9A 2EZBA 1BWPA 2CDCA 4FFBA 4MARA 4P83A 4QOHA 4B46A 2FUEA 4X6UA 4BNVA 3KTFA 5LYYA 2FSSA 5JXIA 2JCGA 1XBTA 3RS5A 1JDZA 3ILXA 2R79A 1ZD3A 4G84A 4JLAA 5DLQC 3QFCA 3TXXA 2L42A 3G8DA 3BHJA 3LNTA 5KSWB 3CR8A 2H0RA 2RI1A 1BCSB 2YHIB 2A3NA 3P5BA 4ME6A 5JNLA 3L0IB 3P4YA 3JQGA 1BE8A 5EA2A 1X8LA 5EIXA 1UMCA 1ADCA 4P5DA 3FY4A 3HLTA 2NZWA 3R6GA 2JIZD 1KKUA 3OLVA 1FFEA 5EOVA 1LQUA 4RD0A 1G9SA 3ENNA 2IV3A 3FCXA 4R0NA 1P2TA 3NBKA 1SVMA 2QP9X 2JH9A 4PU0A 5DBEX 2UYHA 2XRYA 5LQMA 4YUZA 4MKFA 4NC9A 5AVYA 4LF6B 1B1AA 2P9QA 4Q82A 3RSZA 4AYXA 3PQ4A 1PKXA 3O3OB 4N8DA 4INPA 1EB8A 5EJ9A 2GGSA 3QFHA 4Y2RA 4GM0A 3L4EA 2OM2A 1ESMA 2OYSA 1W36C 2BGGA 4QLAA 4NESA 1PFUA 8GPBA 1F0KA 1TZ2A 5FLXA 1ZOOA 2R9VA 4H3SA 1R5JA 5K6AA 1XEWX 3JD2A 4AIIA 4YB8A 2CK3D 1KC3A 1OHHD 1LBTA 1YZFA 3FFTA 1L5WA 3BJZA 1EJ2A 5DBFA 4WOBA 1O4VA 2OXRA 1RC1A 3N8HA 2ZETA 1FSFA 3O9MA 1FFCA 3VYRB 1NF8A 1P39A 3GF4A 2ZAGA 3GVPA 3IURA 2WMDA 4IQ4A 4HQNA 1QH0A 4AJOA 1CJCA 2VF5X 3AUUA 4U7TB 1FTNA 3F3YA 4L3VA 3T1VA 3TD9A 4HOYA 3VYSB 3N2KB 3ZU4A 4TMYA 2DEUA 4JC4A 4EMSA 3W2TA 2V7UA 3WK7A 2I1VB 5CNJA 4LFCB 1H22A 4WBNF 1KZ1A 3U3OA 2R751 1YK0A 1ZSVA 3E7PA 4EX7A 5C1PA 1OLUB 1LK0A 1P33A 3QHAA 5KAPA 5BV8A 1ZD1A 3EJ6A 1FUEA 4RCVA 3C1TA 2APJA 2XCUA 3F6RA 4ZMRA 1FLAA 4M88A 4O1IA 5FAKA 3FFXA 5FO0A 2RH4A 4MUFA 1H0RA 2P0EA 4HNVA 1KJNA 3JCZA 1U2TA 4JVMA 1Z8HA 4NV1A 1VA5A 4GX2A 4S1NA 4KCGA 1JFRA 1F5SA 1I8TA 2E1PA 5DTEA 4IF6A 1X42A 2JFYA 4DIOA 1C9KA 2Q9AA 1A9XB 4EKEA 4C3UA 1W36D 1NBOA 2QQ0A 1U0SY 2TMDA 5AJUA 4PO3X 4ZVNA 5CP8A 3WGQA 3K9FC 1G0OA 1KI3A 1XG5A 3DDSA 3FTQA 3NOXA 2Q1SA 2AB0A 2B99A 2B5OA 3B36A 4UDYX 521PA 1Y1QA 3KJEA 2ZJ0A 5IM4F 1UMDA 3K8OE 1MB4A 4G4GA 4QPDA 1J4AA 4L4YA 3QKSA 5JMWA 4H0CA 2VTBA 1KJ8A 4OMCA 2EX1A 3AZPA 5JI3E 4Y9DA 1G0NA 1OXMA 3BC1A 3PNLA 4K6HA 2F3TA 4X9XA 1KXJA 4INOA 2J46A 4J8PA 3H16A 3HDTA 4OA5A 2C2OA 5AI5A 3AZOA 4A8JA 1A5BB 4BIIA 4DEYA 4F86A 3EG9B 1CUSA 2BEWA 3F46A 3UH0A 4R71A 5A0TA 1E61A 5KNLA 1EFPB 2ZRLA 3EK2A 5I9NA 1CE8B 1OMOA 3C8MA 3AR5A 3GFGA 4TV9A 2O8FA 2ZTSA 4PX2A 3MRSA 4KITB 3QXSA 121PA 1Z5WA 4L51A 1DKQA 4PIMA 4DR3B 2R8PA 1GAQA 2C5AA 4R51A 2CL7X 5AHXA 5ALEA 5EHQA 3SJCA 2VHZA 3TOZA 2QTVB 2HLPA 4ALNA 1A0OA 1UZLA 2Q0QA 3Q0EA 4YO7A 4DWJA 5HNKA 1MORA 3NYWA 1RYZA 2W8ZA 1UJ6A 2GPYA 3ORHA 4L7QA 4ENUA 4ZRMA 4QAQA 3DHNA 1R4NB 1SEPA 4IHAA 2XZOA 4RYLA 3CRW1 3IAFA 3PFBA 2BMFA 2O23A 1E9AA 5KYNA 3AF6A 1Z37A 2FG6C 3PS9A 1J2EA 1EFHA 2XUAA 3I8SA 4UPDA 1E0KA 1TJ4A 2Y0PA 3PZRA 3RE1A 2TYSB 2QAIA 3NW9A 3SBEA 4R3WA 4Z51A 4M9RA 3OU6A 3DZ8A 5DM0A 2HSEA 2QVCA 3N8GA 4E2YA 4RYDA 1RRFA 3QNWA 5D3ZA 1DX4A 5D6NA 3D3KA 3T5GA 4LMBA 1A8SA 3LUDA 4EY3A 2A59A 3QPDA 5KYVA 2N75A 2MU1A 3ND9A 1TYBE 2QP3A 5LUAA 1F3LA 2IYWA 4TZTA 4D6XA 4X1YB 3GK3A 4UVDA 4Y98A 1H3EA 4RF5A 4MK4A 1IC6A 1CZNA 2H1LA 2QVGA 1X0XA 4K81B 4EY6A 2RGRA 3CVWA 3I4FA 5D7NA 2TSYB 3AK4A 4OJTA 1WVMA 5H8WA 3F2VA 1X15A 3R7LA 1XTUA 2YJ4A 2HRDA 4L57A 5LJLA 3P0EA 3A7DA 3RR2A 1KYWA 3TQSA 3QHPA 3W3AA 4F4UA 3QJGA 2GP4A 2CLHB 4PG7A 1WZEA 5LQCA 3KQNA 3NANA 1XLTA 3OOJA 2BGUA 3CLHA 4UULA 5ELMA 1UOPA 3GR6A 1Z7WA 4FMCB 1PK9A 2R8EA 5JS7A 4OI1A 3LPCA 1KBLA 1T9GR 4Q3CA 4KV9A 4WLFA 1J0BA 1QH9A 4XGKA 3T3EA 4HNSA 3QW4B 4Y6GB 4I66A 3EX7C 1XV5A 3CEPB 1CVRA 2LD4A 4MRNA 4LFAB 4F3YA 4TL6A 3VC2A 2A7XA 4J1QA 3NHBA 4RSGA 4DLKA 1NV8A 2ZM5A 1WSAA 5KNCD 4DQ0A 4NV3A 4CEJA 1RWMA 3WGIA 4YV0A 1H2AS 2YC2C 2X9VA 5BWNA 4IOKA 4MWDA 1JHDA 2W6ZA 2V7XA 1D1QA 5IJ9A 4UXIA 3NEYA 2NYVA 3GEHA 5DV9A 4NU0A 4IWYA 1UPAA 4CI0B 4ZT2A 4EVQA 3EGDB 2Z1DA 4OAQA 4XJXA 1U3VA 4INAA 2DC1A 1Y0BA 3R7NA 4C03A 1AUVA 1C9YA 3KOZA 1NONA 4MLCA 5JDCA 3QFTA 2BFOA 2IH4A 1Y8RB 5KTTA 2IRWA 3RLIA 2PR2A 2QA5A 3G5AA 1EQUA 2Q4EA 3RJTA 4ZALA 4AUMA 1OWMA 3UAGA 4UJ3A 3RG2A 2I6GA 3CUVA 2HK6A 4WQMA 3V80A 4J90A 1YR7A 3I5YA 2FPLA 1ZONA 3L6CA 3EE6A 1E96A 2DUNA 2YHAA 5DGHA 5JISA 2JGRA 4OA8A 5FPSA 3PDUA 1SBQA 4RK1A 3EA4A 5F7ZA 1RJ9B 3LZCA 1TM7E 3EULA 3GAFA 4PQYA 4U2EA 4R9VA 1I4EB 1NPDA 1Z26A 2WABA 4A6DA 5TJHA 3MWYW 1T6XA 4YUYA 3DFKA 1VKRA 1MQAA 5KOJB 1E3QA 2XEJA 5JIBA 4N40A 1KDRA 2HNAA 4TMWA 2WJIA 2J9RA 1PL6A 3W6UA 3JTEA 4GSYA 3NP9A 3O8QB 4N0EA 1DPGA 1ECCA 1HMYA 2CXTA 3M3PA 2B8JA 3P19A 4A0RA 1E9VA 3OESA 1W76A 3PICA 5HIKA 4JYAB 3GLFB 5GJVC 2AJTA 4L78A 3E9NA 3OHMA 4B75A 1N3LA 1SFRA 3DB1A 1A9SA 3PEVA 4RJIA 3QG5A 4MKXA 3TTXA 3OZBA 3H7AA 2IEDA 3ZIUA 5I7OA 4R84A 5IZCC 3QVOA 4HRAA 5DP2A 3KJHA 3WK5A 4POAA 1ISHA 1YZQA 4BWFB 3IUNA 3O3CA 1BMQA 3MWEA 3IP5A 4BNMA 1RWNA 1IL0A 2VDKB 3ROQA 1AIPA 1WXHA 3U16A 5IVKA 4C88A 3L6EA 3NVMB 3ZD9A 4MH0R 2XA2A 4LHEA 3IKLA 1Y1PA 3ROPA 1ORHA 3OZFA 1KKLA 4J0IA 3ST7A 1P1BA 5DVZA 1E5QA 4LS3A 1KR5A 1EXWA 2IZ0A 3MMSA 4ZKEA 4CMBA 5EJ5A 5JBNA 4RTRA 1BRMA 3IB6A 3KALA 1N75A 4FFOA 3R8CA 3RRZA 3E5NA 4B83A 1KA9H 2C7VA 2VYFA 4ILKA 5F2OA 1CHDA 4CDKA 1D5CA 3JWJA 1QXSA 3I09A 1ZAKA 1NBMA 3LU1A 3ZI4A 4GM4A 4DMMA 1F0PA 2B5VA 3DE1X 1U0BB 4DMHA 3GX1A 4P45A 3LT4A 4EG6A 4RA6B 3RJMA 3U60B 1RXUA 2FETA 4RK6A 5CHYA 2IH5A 3DAHA 4NARA 4D9FA 2XCQA 4AMUA 4ZTZB 5JC1A 3TUZC 1QE3A 5HKBA 2WA2A 2LR0A 2N47A 2QXYA 5HKAA 2RHOA 3FLAA 3KU1A 4GOJA 5EIFA 4K2AA 1U9YA 2OZPA 3CSSA 4WZAA 2E82A 1L8AA 1JJAA 2BMJA 4Y7CA 2HJSA 1ZISA 4OHVA 4XLTA 3KD3A 2P6RA 3U6BA 1UQTA 4MLDA 4HPXB 4R1OA 5JH7F 2XH8A 3WWEA 1NRXA 2BTQA 3A9TA 3WXBA 4TZ6A 3HRHA 5EJGA 3ZPXA 1E0JA 3O75A 4Q9JA 3UVEA 4M8SA 5CJ2A 1GGOA 3I1JA 4TSFA 3PWTA 5G4KB 1ADBA 4C5CA 1HWYA 4TYPA 3R3ZA 3SQOA 1U28A 2ZBQA 3BAFA 3GPIA 3M8KA 4KTTE 3WK9A 2SHKA 2P2LA 4ZZIA 3HCAA 2FPRA 4TWAA 1ABBA 3F9IA 4AO8A 4QX6A 2YN4A 4L0MA 3B52X 5CFLA 4D0SA 5LOVA 3E7WA 3CNOA 1A5ZA 3DL0A 3EEYA 3MRXA 4LK2A 3D0RA 2DJIA 5ALIA 4QGSA 4V0MA 3K70D 3DP9A 1S0UA 2BFCB 1Q1ZA 4KK3A 5I8WA 4FMPA 3ETCA 4B84A 5EJ8A 3BI0A 3RUCA 4YRMA 4UVGA 3S1LA 1IOLA 1QGUB 1R64A 1S2MA 3BFVA 3MS4A 4QOIA 2WEKA 2WIAA 1X2EA 1E63A 1Q7TA 1ULUA 1WUTA 3O91A 4EPXA 3KR2A 2NPFA 5GY7A 3VKGA 2VZLA 4FCCA 1N2BA 4RGVA 3OJWA 1VJ5A 1EAMA 1D8TA 3EGXA 5AHWA 3HI4A 4RK7A 2X77A 5AOVA 1REQA 5EJFA 4EIWA 3LBYA 5IDVA 1MOPA 1VKZA 2PFSA 3BCSA 1NN1A 2N1MA 4NS4A 3T5BA 2Y1EA 1QHNA 2BEVB 3A3NA 4RH1A 4WN3A 4HNTA 2DH5A 3JYHA 2P41A 3K0FB 2JZOA 4NCIA 3TRHA 5JBIA 2ZWPA 2B4RO 4FXOA 4KHZA 3BMCB 1QE0A 4HJXA 5KOHA 2YV5A 1NVAA 1Z4OA 3ENKA 2J6BA 2DH6A 2HSDA 4ZV9A 2PM8A 3R40A 2F1HA 4QYIA 4AJ9A 1SCUA 2OOTA 1XQ1A 1EK1A 1K8ZB 2E21A 3M6FA 4V0OA 1XHFA 5DSZA 2EYQA 2EZ9A 5WRFA 3WNVA 3LY5A 5FBKA 2W6QA 1PWEA 3QXXA 4W1QA 2YNMC 4JQSA 3ZE8A 2PZMA 3VBEA 3N0RA 4CQLB 3D3QA 4Z4FA 4RE6A 1DO0A 1I6KA 1RPNA 4BKPA 5BMOA 1R61A 3P1JA 2BBOA 4FHGA 3VVBA 1NAHA 5EJ2A 3OJLA 1HLFA 3LSTA 1IWOA 3ZWVA 4LKRA 5CXSA 4A6XA 5JZ9A 5A9TA 2MSWA 1PCXA 4AJKA 1WXGA 1RWOA 3SZ3A 2YN0A 1YBHA 4UU8A 2FOLA 2HXSA 3RTDA 1KFKB 1V6CA 2PL3A 4G3XA 3G0IA 3FUUA 2VP2A 3GUVA 4ZPXA 2NGRA 2O05A 3GNLA 5C0OE 3ZQ4A 3MS2A 5AMXA 1EX6A 2A8YA 1ZVMA 3W5VA 3BGIA 5JAMA 4TQ9A 2XUPA 4ZEMA 4PHCA 1WB9A 1R8YA 4KQ6A 2JGFA 1U8FO 2HSZA 3K0AA 2FR8A 1CJUC 1HT0A 4EVIA 3LUBA 4KUHA 5D3MA 4K6CA 4BX0A 2FUCA 3HO6A 4RMJA 3RWMB 1YQGA 4CG2A 3PDIB 5K0CA 4NX2A 3C6QA 4GKBA 3GJXC 3B85A 2PYDA 1TQ2A 3CCCA 3OJFA 1JHXA 3AW8A 4YK7A 3GWGA 2VSFA 2NSJA 4MW4A 1D1SA 4H6WA 1LEHA 2REQA 1X1QA 3ASVA 4MV7A 4I1VA 2QZ9A 1ENZA 1NWHA 3AFOA 5ED4A 2H9YA 2Q4BA 4M46A 3QFSA 5FTJA 1RMQA 1V5GA 3PYMA 3IILA 3T5AA 1RLIA 2QK4A 2ZI7A 1XAJA 1BEZA 5DYGA 3RAPR 1NLYA 2XVYA 3ZTWA 3EDRA 2XF2A 1K68A 3AEQA 2C4MA 5JAZA 4K9KA 1JILA 5A6SB 2C95A 4H6VA 3OZRA 1X7XB 4KX5A 3MTIA 4KFTA 4TWBA 3QXHA 3NYRA 4JLBA 3SIXA 3JVDA 1PZGA 1BXRA 3BOSA 4MJLA 4QOSA 2FPUA 3KDPA 1LPBB 3KXKA 4K9NA 5CX1A 4ZPJA 5KKNB 3SJZA 2B82A 1P4JA 4Y1RA 4DCVA 4JC8A 4WLUA 1Z6QA 4PGAA 4FM9A 3THXB 3OP1A 1ZFNA 4KQ1A 3BRSA 4PXSA 3CO5A 4KI0A 2CNOA 2CJWB 5LBTA 1F2UB 3HKDA 1C30A 3L6RA 4CO9A 1CJBA 4W8OA 3HVKA 2IFTA 2HYDA 2J9ZB 3LDHA 3QUTA 2O8EB 2I2FA 3TE7A 3J81k 1JS1X 4M54A 2CXNA 3D02A 2AN4A 3BGSA 2XKBA 3MT0A 1LQTA 1IJBA 2SKCA 3ILYA 2D0OB 3O8LA 3WMWA 4BVEA 1R0YA 1IPFA 2FE1A 3VPGA 1N77A 3S8YA 5FUXA 4OP3A 1L5QA 4PWYA 3VISA 1PR9A 1HOXA 3I39X 3UANA 1NXQA 2ZK7A 3H0EA 5AXBA 1XRNA 2VYNA 1AGYA 1GQQA 1QRAA 3RS8A 3ZHXA 4ZZ3A 3PI7A 1SXJE 1X7WB 1FZTA 4MDEA 1PQWA 4RTNA 2B6HA 3A32A 5B4VA 1DXOA 2OVBA 4N03A 5M3BA 3K71B 2OG1A 1KETA 5IR2A 16PKA 4LDAA 2IYAA 1QCCA 2J4CA 4ZQHA 3R7FA 4DNQA 1AQ6A 4G5XA 1RAIA 3CXRA 3LRXA 4RPKA 4I9GA 1UBKS 4EUEA 2CMDA 3E6AA 3LCUA 3OIFA 5JCPA 3T0IA 4E2WA 1H1TA 1HY3A 5FO1A 1NRIA 2FB9A 4G8DA 1FRVA 1KK2A 3BXOA 1WPQA 2GN2A 1JHUA 2HDOA 3JD4A 3KBOA 4W8GA 2DGDA 3L92A 4RORA 4EMUA 5CB0A 2WPNA 3JY6A 3VU8A 2AEEA 3ULKA 2O2ZA 4OHKA 5EHNA 3AB8A 3ZWWA 1GTZA 1IHYA 2D5CA 1P4SA 2FEAA 3MQFA 4OXQA 1RZUA 4RMHA 3FCEA 2ZRMA 3ICOA 1AS2A 4XB2A 5HE9A 2QNBA 2Q9BA 4TMKA 1NDQA 4ZXFA 4TYWA 1EX1A 1K6JA 4JVLA 5EEGA 3KZXA 1NNSA 2H63A 5JS2A 3IAM6 4F11A 5TE9A 4KU4A 1JQEA 2GKOA 2ODNA 4EGQA 2NO5A 4NVRA 2ZIXB 1I3KA 4L73A 3R9IA 4MZDA 5BQ3A 2C3PA 3FCSB 4N3AA 3SVTA 3EUAA 5AW3A 3QNUA 4F2HA 2ERCA 3T12A 2GYWA 2XNHA 4HDSA 3WMRA 1X6VA 3CONA 4B4OA 1A88A 4Q7MB 3AONB 2BI4A 1CQIA 1LC3A 2P2NA 1YL6A 3NJRA 1YF3A 3QOWA 4F4JA 2Z2JA 2P65A 2HX1A 4L2IA 3IAXA 3LCRA 3AHDA 4AWAA 1AXEA 3COSA 3LC1O 4MYHA 1PSDA 1P6QA 2QLLA 4FYKA 3PHCA 4LBZA 5REQA 4JMLA 4DSTA 3DOCA 3ZJ4A 1V6AA 1UAAA 2WMOB 2XB2A 1ZK4A 2D5AA 2PS1A 2ZDQA 1E2DA 4FGSA 2R96A 3DOHA 3IIEA 3KB6A 1RI2A 4QWMA 1KEZA 4LW8A 3OQVA 2VK2A 1N1DA 3RTBA 2C1EA 3BMOA 3MLEA 4JODA 3W8NA 5IB9A 1W88A 5I9LA 5AKHA 3UT6A 4KQKA 2AZDA 5A5GA 1U9ZA 5AHKA 4ALMA 3SE7A 5EUQB 3KSAC 1AQJA 3B82A 4HXEB 4WOPA 2NUTA 9LDBA 4IKEA 3U13A 1QV6A 3USCS 5KNDD 1YNOA 4LJYA 3RBXA 4OHXA 4Q3AA 5A4MS 4U39A 3SKXA 1IM5A 3VU0A 3L7CA 2DFDA 3VUFA 5IXJA 3CGGA 1Z0JA 3ZTYA 4YQYA 4EFLA 3T7IA 1PTJC 3TZ6A 2Z5LA 1QG2A 5ES3A 4C87A 2XQKA 3E4DA 5TX7A 3AJ8A 2WHPB 1BXGA 3DQQA 4EKIA 2ORYA 3DGFC 5AM2A 3VJRA 3QPUA 1AKYA 1SC4A 2ENWA 3DZBA 1PT6A 4IM7A 4UXHA 2D4AA 3D7LA 3SX4A 4RFVA 1YULA 4PFQA 5LB4A 3BL8A 3S2FA 4LRQA 4H2DA 1CIVA 1KZGB 2FWAA 2XHZA 2AWOA 3BRWA 2OXFA 2CUTA 4LXYA 3L1UA 1KFCB 2ID4A 1C0KA 3KT0A 3RAGA 2R6AA 4IJWA 4OSOA 3DV2A 4X90A 5K01A 1DJOA 2XGGA 4R7GA 3PDCA 1ULAA 3CR7A 1U1GA 2YXBA 3COWA 5F1PA 2NO7A 3B1ZA 4QTTB 4NI5A 5JC8A 3FTCA 2BFFA 4KGZA 1LZKA 1Z07A 2DX7A 1PG2A 4ANFA 2E5WA 1DRKA 1G8PA 4DR5B 5FJJA 3LGXA 1E2PA 3G1WA 4FUQA 4G07A 2H92A 2QL9A 1FOEB 2AOWA 2PJZA 2MSNA 1BRTA 3A6JA 2HQBA 1ACLA 4B3SB 2XUGA 1I3LA 3QVMA 5ALPA 4RNDB 2PR7A 4JI3B 5LFAA 2IOYA 4YRRA 4AQYB 1V9CA 2OMEA 5EZ5A 4DA4A 2GB4A 3BXMA 4BNUA 2GCOA 1FUIA 3LX4A 1UK8A 5AI4A 1JIVA 4MB6A 5K3FA 2YR0A 3NUZA 3A1NA 1Z6XA 5ALNA 3EFHA 4LN1A 1HE4A 1JA1A 5CB4A 2ZAMA 4WK0B 3T3NA 3KKZA 2P1ZA 3DLCA 1Z5VA 2X0DA 3MIIA 2GBLA 3ZWPA 5B4TA 1TVMA 1F51E 1SWVA 4LMRA 2IL1A 1CUGA 2JK0A 3SXUB 4E5VA 3THOA 1P2SA 2L18A 2PZAA 3ETLA 3I23A 2YUTA 3NVAA 4QVIA 2GF0A 4DZTA 2HA4A 3GY0A 5CLLA 3ESRA 1N2EA 3C41J 1D2NA 2ISQA 5IKEA 1MQ9A 3K0KA 4QTXA 1VRVA 5SY4A 4DC9A 3WLNA 2E48A 1G2OA 2Y1OA 3Q8LA 3LSYA 1WDTA 2ZDGA 2X0JA 1XZDA 1Z6AA 2PAAA 2P3QA 1T5IA 3BL5A 4K6FA 4J2TA 3TI9A 4D9KA 2FG7C 3WDLA 3DAGA 3DYIA 9MHTA 2X23A 2BFBA 2ZVDA 1YFLA 3N5KA 2XIQA 4QDZA 5BYBA 5AJXA 4D44A 5LCXA 4M1ZA 1OLXA 5F1OA 2GCIA 4HDNA 2R1UA 5C8XA 1CUJA 2HD4A 5EJMA 3OZWA 2LTAA 4NZZA 1ZK0A 2V8OA 2XUZA 2GZDA 2UZ1B 3RODA 4ZDIA 2PRZA 2EXXA 2O1WA 2R6FA 2ONZA 4FLEA 1IUOA 1XWIA 4JUDX 4BP1A 5HF6A 2I2DA 3GJSA 4AKHA 2PKEA 1MVLA 3CH4B 2X4IA 1J20A 4XQGA 2E5FA 1NW9B 1PJSA 2DM6A 2Q41A 5C5IA 5JSHA 3X43A 1BJTA 2Q4RA 3WQBA 1HQYE 1DTSA 3JQDA 4NULA 1E66A 3IE1A 2QTLA 3FOEC 5CJPA 4D80A 2ILVA 2ZJ2A 4U2KA 3TQHA 3IMGA 3DGEC 4ND1A 4Z9FA 4NNOA 1Z5PA 4AN4A 3SLRA 2DT8A 4PO1A 1P18A 5HJ2A 1D7OA 2RJOA 4RPJA 4UAGA 5E6UA 3LUGA 2VL7A 3WB2A 1EG7A 4W7IA 3W3AH 2PCNA 3SGLA 1QWOA 2XQGA 2YZ2A 5E8JA 1LV8A 4B71A 1RAHA 2YBEA 5E6SB 5JYDA 1OJLA 4X3PA 4NFYA 1IZZA 4AURA 4NENA 4P6VF 1V8PA 5ERYA 4BV8A 4HKTA 4DA8A 1PJ4A 5LZ2A 1E2FA 3BTVA 1HEYA 4X1KA 3C15C 4TLDA 1G64A 2A67A 1A98A 1QHHB 2AG5A 4HP8A 3I34X 3TCKA 1JHRA 4GIBA 4M49A 3SJ7A 3DL2A 2GXAA 2O3JA 3MGBA 4WVLA 1V0JA 3K8ZA 4X6LA 3JR3A 2J9FB 3JQ7A 5CLHA 4CHGA 2CV0A 1SGWA 1WD7A 3C6ZA 1ZMOA 3NR2A 2G7ZA 4FT4A 4BNWA 1GUBA 4MDYA 1BEEA 3CF2A 3CZCA 3TIXB 5K8CA 3KB2A 3WWDA 5EHXA 2VDMB 2YN2A 5SZKB 4LX8A 1NBME 3PU6A 2ZSAA 4Y30A 4CXMA 4C9VA 2YXLA 4NZNA 1O5OA 4M0DA 4BJ1A 2QAGA 3AL2A 3TEMA 1C3JA 1JQ3A 2GBPA 2KQUA 4PCLA 1Q1GA 4G97A 1E9EA 3GMTA 1GGJA 3RUPA 1KVRA 4BMCA 3ZD7A 1ZH4A 2QJTA 3M6IA 2FZCA 3O8BA 4I2NA 3F47A 5KQRA 4QRDA 2C2WA 4MW9A 3DVAB 2E6UX 2AL7A 5FPHA 5K6AC 2CB0A 4C85A 1Y4AE 1MN6A 3L8YA 3VVCA 3ZHSA 4CETA 4MPRA 4RWEA 1TGVA 3B7PA 1MIOB 4GBMA 5AVSA 3BEOA 1CWUA 3RTEA 4HDAA 1KH1A 3OC0A 2NYUA 4WZAE 5TVKA 2AOUA 3WXMA 4GMDA 1OLSB 2CVHA 1F8XA 2QXUA 3PLNA 4XYBA 4ZOAA 1E2UA 1MO2A 4BWVA 4Z7JA 4YY3B 4J4TA 4MSUA 3SIPA 1GUZA 5LNK6 4NONA 1H2HA 3UWPA 1FX0A 3QE3A 4GEGA 3OU2A 5LKRA 1XA3A 2JCBA 2C31A 4MRSA 2BONA 2FF5A 2HQOA 2J5QA 1QIHA 2HPZA 3AI2A 3FTNA 4IQGA 5F3RA 5B6IA 4E32A 4ARCA 3ZNPA 3AR2A 4DANA 1N1GA 1Q12A 3OY2A 4LWQA 5ICEA 5K8IA 2ILTA 2R4TA 4DM4A 2BKLA 3C16C 1SXJC 5EP1A 1S4MA 2C6GA 2X8BA 2BUBA 1NC1A 1RYYA 4R01A 3U7HB 4R2IA 1Y7TA 3AP2A 2X6TA 3VR3A 1VMDA 1QF6A 5IG2A 2PT7A 2V7VA 2DSNA 3OFVA 1V9LA 4V0ME 1N1EA 3GBPA 1IZ8A 1NUQA 2JAPA 3K1YA 2H1OA 2VJMA 2H07A 4EKYA 3IBFA 4V38A 3U3DA 1F0NA 2IYPA 1FBTA 2EV9A 1WVGA 1U3CA 3CKYA 3D6AA 3TAXA 4BMZA 4IIJA 3LWNA 4BVBA 4J7CA 3STVA 4DEXA 1EXVA 5JJIA 3IXMA 1IQ0A 2P90A 2PL5A 2QQGA 3RIYA 4B6SA 3GFTA 1MRNA 2BP7B 3M2PA 4WXPA 4Z4HA 4NGQA 4Q18A 1J56A 2WVGA 4GXNA 4OCZA 2C04A 3KEFA 4R41A 4UHKA 3DEHA 1R8XA 2CW5A 2J67A 4TL7A 3GFVA 1GZDA 4E08A 1JFVA 1VMEA 4HWRA 2AR7A 5EYPA 2HSWA 4FE4A 3S2EA 3RREA 4OK5A 3PFHA 4FE3A 4FNOA 5FXMA 4BDTA 1HT3A 4Q39A 2JFXA 3NRCA 3QKTA 3GLQA 5KYGA 1WQ3A 4P0QB 2YJGA 1GNSA 1RABA 1URPA 2OXEA 1SG6A 1UODA 2D1YA 3HHEA 1ZOSA 1KSHA 4GYWA 4NE7A 4PN3A 5JCZA 1EE2A 1VM6A 2QW8A 1TJ5A 2E55A 4LZPA 5ECGC 3D7GA 3EJWA 3TW6A 5JPCA 1XNRB 3ELBA 5C2JB 3IUBA 1SIUA 5EWLB 2WWGA 3FFAA 2ODAA 1RRGA 3I8OA 5JI2E 3E82A 3OFJA 4J1SA 1YK1A 2Z5FA 3PE6A 1HNWB 1FDTA 1RXWA 3NIFB 3QRWA 4OBBA 5CLQA 3Q6NA 4YJGB 1BVUA 1ZN2A 4CL2A 3I6BA 3G9ZA 5ADHA 3AY0A 2C2BA 2Z58A 1E1CA 2IYLD 3RFTA 4F91B 1S3GA 3ER8A 3SZLA 4YHHB 4LPKA 3C3PA 2E4ZA 3BFXA 4P7JA 3ZIDA 1GRVA 3DDHA 1V71A 2B1QA 4MB2A 5HKKA 4HN2A 1EUDA 3MAJA 5BNIA 3UMVA 3K16A 2K7FA 2AFHE 2RB5A 1IQRA 3GPBA 1O9GA 1HDEA 3OIDA 3PGVA 4QOFA 5H1YA 3H9JA 4OV6B 2PZBA 3LBNA 1VCIA 4IV5A 1IY8A 2IW3A 3Q72A 4EW3A 4ZAVA 5C4IA 1UAGA 2EZ8A 4R3NA 4YJFB 1DWUA 2RG7A 3CUWA 1Z06A 1VDZA 5DSXA 4F0JA 4HNUA 4LNUA 2YWFA 1NVEA 3TLCA 3JQCA 3IALA 2BCGY 3PUJA 1KFBB 3EF1A 3UV3A 2O19A 1GITA 2F4NA 3MGAA 5BXYA 2HA6A 3EPJA 4C7OA 5F23A 4IDQA 1SBNE 5DNYB 1CUVA 4S1PA 4AB1A 2MYPA 3N8IA 4ZP1A 4DSZA 5GV7A 4LMPA 4PLTA 1TUGA 2RAUA 3G1TA 3QIVA 2FA9A 4RX1A 4ZDJA 4TTTS 4TZKA 5HIAA 3PT5A 4RY8A 4HNAB 2DF8A 1CK4A 2WSSA 3M7IA 1AUQA 5KYYB 4QRIA 4DE5A 3SC4A 1NV9A 1UBGA 1AC5A 3ZJUA 2EYUA 4OXIA 4CKWA 1BA2A 5I7EA 4LTDA 4Q3LA 4MW7A 3PC2A 1IAVA 5JRJA 2O1SA 3OQ1A 1HFEL 1OE0A 2EJWA 1CW2B 1W2HA 2GR9A 4M8IA 1QQ7A 4IDFA 1JAZA 1SURA 2EFYA 2GPJA 4H17A 4BVAA 4F1JA 1FQJA 1IHXA 3E15A 3P9KA 3SHOA 3I74A 2I4RA 4N9QA 2YFQA 1KQOA 1WVIA 2AI3A 2FWJA 4PNZA 3HJHA 4DZRA 1P0QA 3RKUA 1P3Y1 2R87A 1ML4A 2DLDA 3JR7A 4TXNA 2J0EA 2LXNA 5L3QB 2PUGA 1QB7A 5F1KA 2Y1CA 3K0CC 1U04A 3RK0A 4D92A 4U9HS 4CQMD 4KNWA 5CFPA 1B15A 2FPXA 1JFSA 3WFIA 1S4QA 1T2NA 2O7RA 2V54A 4C3ZA 1KAEA 4CIWA 3PGMA 4OJQA 5EZYB 1KAGA 2ATCA 3DZJA 4E33A 5TB5A 3C3AA 2C8KA 2NTJA 5T4EA 1U6IA 3GPDG 4YLEA 2G1UA 4I1OA 2FWIA 3EBOA 5KX5F 1U90A 1GPKA 4BO7A 4DLVA 4KJZA 5IT0A 6CHYA 3GRFA 2Z56A 1JKXA 2ZS8A 2XB8A 3C3YA 3ZC3A 2ZUWA 1JXQA 1XZIA 1AZWA 5D7BA 1TCVA 1C3EA 1SPBS 4M36A 4RXTA 2FGKA 3WWYA 1WW8A 4Q1DA 5A2GA 1NSYA 1AKUA 4RW0A 3H4VA 1OFHA 1VSTA 2GM9A 2YMMA 3UBMA 3GRPA 1YTLA 4ZI3A 1NBMD 4EHBA 3PLAE 2FFJA 5DH9A 4GPZA 2I33A 2WHRA 3D8BA 1ZD4A 2DQYA 1YIDA 3G2QA 4LV8B 1NU8A 2ZBDA 2D0IA 2G17A 1YS2X 2IUSA 3EXEB 3H86A 4MWBA 2DVMA 2O4CA 2W48A 2OK8A 1GA4A 1VSBA 2EFJA 4WX2B 4DCPA 2IHKA 2XNCA 5BQXA 3RFVA 5HRCA 2OM6A 4Q3EA 1Z0SA 3I2IA 4XIIA 3VDMA 4AG3A 2PUCA 3V4ZA 3LUCA 2V6IA 5SYMA 4C6TA 1A3CA 2P40A 4QU9A 1N0WA 4W63A 1EDZA 1OFVA 1QIMA 2FUG1 1JPVA 3AL3A 5DU2A 3WK6A 4DWWA 4DLPA 1OIWA 4F2WA 4KR2A 3S1AB 2Z3VA 1Q5XA 1VLZA 3NXSA 5CJJA 4M86A 1KJ9A 3KLOA 2XOKA 3OJEA 4G5SA 3B3QA 4QNNA 4F7DA 1ESDA 1C2TA 2JDID 4Q6BA 1AO3A 4YCBA 3RAEC 5CPBA 5H0IA 2V6GA 3EFEA 1MABA 1KPGA 1RKUA 2I2XB 4CF5A 2Y0BA 4ZQCB 1UT8A 2FPOA 4ZI7B 4G0NA 1Q7RA 4FHCA 1WUYA 1H5UA 3FSGD 4JVNA 2W11A 3TQQA 4KRXA 2P3OA 4E3ZA 2HREA 2GXUA 1OTXA 3IJRA 3NYQA 2CZCA 3T99A 3QY0A 1RXVA 5AVVA 2PX2A 4KP7A 4G9EA 4OMFG 3O84A 4EWLA 1ZA2A 3DKVA 4BMPB 1JVNA 3PBKA 5T8KC 2Y77A 4JROA 4R0VA 2GOYA 3LVRE 4RVFA 3RS9A 4KNVA 2B2CA 3OF3A 4PX9A 3EMBA 3W79A 2G09A 3HV0A 3A14A 3O83A 2CLOB 1RWWA 2XTMA 1RQGA 3TN7A 2XX3A 3JWIA 1XRQA 3W0LB 3LP5A 2EDCA 2R25B 3E3MA 4X45A 4Y0NA 1XDSA 2ESRA 2R1TA 2CLMB 2LRHA 4LK3A 3IOMA 5HIIA 3MCAA 1IN4A 1ACJA 1JMVA 5H02A 1P9OA 5G2OA 1IBLB 4HWKA 3TNJA 4I1IA 3RYIB 3FMVA 3BQNB 1I32A 3IRVA 4GYYA 3S5JA 1EIZA 3NHUA 5A5FA 2JAUA 3CY6A 3I1IA 5KOIA 4QHTA 3IIBA 2PMBA 1PLJA 1SK9A 4JBXA 4ZEVA 2IS4A 3OMXA 4I50B 1VFPA 3KWLA 4KG7A 2IW1A 2P0AA 4JXKA 4TWJA 4BPRA 2AD5A 3SAJA 1MF7A 4WHMA 4XYMA 3QXJA 4Y9SA 4OAOA 2O8BA 3SSOA 5IAOA 3H5RA 1KJJA 4BLPA 4C0HA 2DFTA 1QK5A 3WB0A 4B9EA 3HCRA 5AVRA 3CN7A 1QONA 1QS0B 2FMKA 4RV5A 2H9AA 3C1OA 5AI8A 3DOEA 3WDMA 3TNDA 1NXOA 3DNMA 1U28C 3HP1A 4JQOA 2ZAOA 3D3WA 2DSTA 4M6WB 3TSOA 4E46A 4ZDKA 5A62A 4N41A 1G63A 4D9JA 1EEXB 3ADKA 1SR8A 1ZIPA 5LA6F 2BEJA 2P9FA 4WXEA 5EXDA 1GTG1 3RK1A 1I7PA 2VCEA 3SVLA 1R6BX 4AZ0A 1NN0A 3RT7A 4YALA 4JT9A 2CF5A 1U0GA 4HGYA 5F9MA 1U99A 3SXJA 1VC2A 5ESDA 4R1SA 1Q2UA 4L27A 5AVTA 1JE1A 3E22A 3I52A 3DOOA 4LOLA 4M76B 3S55A 1JB9A 3TCXB 1T8SA 3ADOA 4DA0A 2XGJA 1L8LA 1X38A 4WFJA 1LX7A 3A8TA 1UM9A 2V6MA 2CZGA 3K5HA 3KVVA 1BS2A 2ONKA 5BMVF 1XU9A 2XNDA 1U7DA 3QYAA 1Q19A 3IQXA 4BO6A 2R6JA 4Q7QA 1NXXA 4C30A 4C4ZA 1XMQB 3HY6A 1YMUA 4G2NA 5FOWA 2W5UA 1SZCA 1GOTA 1VIMA 3B7GA 3I9NA 1N6IA 1W9HA 3LGAA 1BH2A 1ZUD1 1KOGA 5FFMA 2G1KA 4FS8A 4YAEA 3BYZA 3Q1LA 5JNVA 3D8UA 3Q9LA 2QIPA 1J8FA 3R0XA 4JBWA 1F2DA 1GFSA 4NICA 4EEZA 5CLJA 4ILEA 5KYXB 5B64A 2PU5A 5K6RA 1OVGA 1A9QA 1EM8A 3H2GA 3IBTA 4LJSA 4ZVKA 5KJFA 1N0VC 3K5WA 3A9RA 1JDSA 3M9LA 2I03A 2AJLI 3WFZA 1USVA 1W5AA 4G56A 3VR6A 1CNMA 4B81A 1WU7A 4IQFA 1HE2A 1THZA 2JFHA 2OXCA 2GCGA 4LDNA 3NDJA 2IC5A 4PTZA 2NAFA 1YRAA 4EW2A 2WF6A 1YS6A 3SEQA 3W5SA 5JYEA 4M0UA 4MV3A 2QP4A 4RS3A 3U31A 1X9HA 1WZIA 3F7OA 4UUPA 4P3KA 4R0MA 5DHPA 2XIJA 1P81A 3WGTA 3S2GA 1BFKA 3L41A 3EARA 5JXGA 2FMIA 2DR2A 3R0JA 3R3XA 4GPD1 4NDAA 2JJMA 3NOOA 1F6WA 2F3RA 4X63A 4Z99A 5J63A 1TUEA 1KR2A 2RHCA 1XQVA 1T36B 2EEPA 3D6UA 1WETA 1NAIA 2BL4A 5HCIA 1RPJA 2A6PA 1GTVA 2I29A 3NAQA 4DGSA 3HU2A 3H87A 1HPLA 3HVRA 4FSXA 4EL5A 3KLMX 1Z0KA 3DKRA 1ZGGA 5AHOA 1W36B 2DWQA 1Q2XA 4DTCA 3FYDA 4RCYA 2OFOA 4MVJP 4XARA 5E2BA 1RMTA 4BTEA 1EGMB 3RUFA 3T4EA 3UK7A 2R00C 2ZYTX 3OTWA 3ZV5A 2HEIA 1KYXA 1JEYB 2VYND 1Y4UA 3E9ZA 5K0GA 1E2BA 2CNWD 1XZKA 3D5QA 1E4OA 2FLWA 1JHAA 3AF3A 3OQIA 3E3LA 5TARA 3B6KA 2AFIA 3OE1A 4Y6QA 2XEDA 4KEAA 4L5IA 2R1ZA 5DTIA 2FRXA 1F2TB 4NYMR 1P29A 4G23A 4FGZA 2G8NA 4U0JA 1IHDA 1U1IA 3G2NA 3I04M 2CWDA 4KXVA 2VUTA 5JXJA 4OFWA 4J0CA 1BJRE 2X1LA 1G16A 1XJ0A 4EPWA 3JRNA 4Y67A 4ZMBA 3GMSA 4IHKA 3H8VA 4D3ZA 3KXIA 2H31A 3DEJA 4G89A 1YV9A 4J03A 5TQ2A 4L4UA 4QOEA 5L4NA 4MQ6A 2COKA 2OUKA 1PP4A 2XMDA 1ZGHA 2AH5A 2IA5A 2R4QA 3KUKA 3VR4A 4X66B 1XJCA 4FKMA 2CYCA 5JD6A 2Q5CA 1CUCA 2B4YA 4KVZA 2YIJA 3VO8A 2WM9B 1W75A 2ACWA 3KUDA 2BFEA 2QZSA 3L0ZA 1L5OA 2GKSA 2W98A 3IT1A 4O4JF 4OGGA 1XN1A 4JJFA 7MHTA 2H59A 5CGQB 3BJMA 2ZYUX 1T3LA 1HYEA 1V47A 2ZT5A 4PZDA 3F0TA 2R11A 4Y2TA 3ECCA 4RELA 1KYVA 2KJQA 4GWGA 4J7UA 4OLFA 4JGBA 1OX5A 3HGTA 4XYGA 5THKA 2F6RA 4HEA1 3E1KA 1C9JA 1UXKA 3LQRA 2IV7A 2ONJA 4EENA 1JR3D 1ZCZA 2Z43A 5KWJA 4OGLA 3U5TA 4JBYA 2ASEA 2WYIA 4Q3KA 3AI7A 5IP5A 1G7TA 1XFAA 4C4SA 1TQHA 1J8MF 4NIMA 1SUBA 3L7IA 4CKEB 2CL6X 4OH7A 2QW1A 3GCDA 3KXPA 1VG9B 4A2QA 1BVRA 4L1KA 3U3MA 5DGIA 2WFMA 3RSHA 2QAJA 2AMJA 3QQ5A 2OFFA 4JYWA 1KYQA 1QYCA 3KFXA 4OUDB 5BOSA 4EA7A 3Q3VA 1H0KA 2WYUA 5BNZA 2EARA 4UTOA 2EQAA 1CVIA 3EEQA 4IDGA 5BWMA 3ISJA 4HI0E 2V4UA 4QEKA 4MEJA 1ZM7A 2SECE 3ZKWA 2GEVA 1PKEA 3FZNA 1PYOA 2ZJ8A 1R3DA 1Y9EA 2FFRA 3FVRA 3H83A 3X44A 5LKAA 1SCBA 1HFKA 2NTVA 3PQ3A 3D81A 1YZUA 3IXQA 1MJ5A 2FTKE 1VE6A 2IEZA 1Y9ZA 2K4MA 2WIDA 1MAWA 2FY8A 4HMQA 1O97D 1KDVA 1GU7A 3L7YA 1NP6A 1J9ZA 3RD5A 4UHHA 5HOQA 3NNNA 4YDSA 4ETMA 5J3JA 2H17A 1SUCA 4I5GA 3L2OB 3PTZA 3QBTA 4O4IF 1ZD8A 5IT9A 3KETA 3JAKB 1I6LA 1KP2A 1BKSB 2NXEA 1DJMA 3IE0A 4Q9LA 2X9LA 2QLNA 2C9BA 5B7NA 1AKWA 2XTZA 4F93B 3MTDA 2I2AA 4L15A 5L3QA 3QJ5A 4ZRDA 1FYDA 1TO2E 3KYDA 4HTAA 1U65A 4LVOA 3L46A 1Y1SA 3OMWA 1R37A 1OROA 1B2RA 3SNKA 5COAA 4YAUA 3FPAA 1SMKA 4UQOA 3T1HB 1IY2A 4JR0A 1THGA 3GP3A 3ID6C 3R09A 4TV8A 4LOJA 1ESZA 1X9IA 3AX6A 4S24A 4WPGA 5DO9A 1LBSA 5TQ0A 1WAMA 1NFQA 1LGYA 1GL3A 3KWJA 3RC9A 2FW7A 4MPTA 2HT1A 3EXHA 3JQ8B 4TS1A 4ZVMA 2E4AA 5HTKA 4LAFA 3AY6A 1HXHA 1QO0D 3QLVA 3KVNA 4D9MA 1G8GA 2E1RA 2VT7A 5GAJA 1Y8QB 5ICSA 2WP0A 4P1ZA 4U2BA 4DLNA 1E0SA 1SUPA 3MCZA 1SKUA 5FTNA 1T4CA 1QLWA 5AW9A 2I7XA 3IX7A 4BUCA 4CN8A 5LP6C 5TPWB 4GFDA 2E5LB 1AQUA 2DZDA 1JEAA 4PYJA 2WTAA 4B3DA 3NCTA 3QE2A 4IEFB 1OQAA 1ATZA 5HYVA 5F73A 4ZVOA 10MHA 4RQAA 3TXAA 5EUBA 3ZJTA 1E1DA 3L7LA 1W49A 1SXGA 3CRVA 3C7DB 5K7SA 4KE9A 3TZBA 2O57A 1T4MA 3JYNA 3IQIX 4LCBA 1Z7EA 5C51B 4LRWA 1BS1A 4YMUA 1THTA 3FNHA 1CYEA 4JFRA 5IYZF 5HRAA 1ZZEA 4CLXA 2HWUA 4LYYA 5EKDA 5HKLA 1SD2A 4PYKA 4JENA 4DCSA 1HNXB 1M1YE 1P1CA 2YZGA 5ICCA 3RABA 3FPGA 3Q98A 4HB2A 3KR0A 2MMCA 3R4VA 3QUCA 4LOAA 5K0LA 3ZIAD 2J31A 5EP4A 4YRGA 2BLNA 5FWXB 5AKGA 1IEVA 1QIGA 1C1XB 5EESA 3RYTC 1V96A 3NUQA 3UWSA 5C8DA 4WKNA 4WNIA 5BUQA 4M8KA 3LO8A 4TT3D 2NSLA 5DOZA 2WUWE 1Z5GA 3KQPA 3QXCA 3N1UA 2WV9A 3GHYA 1PFVA 4XFJA 4XFDA 1ODIA 4Q4LA 1UF9A 4WVFA 4MVJF 4GKJB 1NSTA 3I2HA 4IHJF 4MP8A 4FNMA 3X2SA 1XZQA 4JLNA 2EZAA 2GN6A 3O93A 1YTUA 1A4IA 2CDBA 3KVRA 2WKPA 4ZU3A 1HYQA 5TGDA 4U8HA 4CL0A 4C9BA 3I8XA 4PAGA 1PV1A 4F5YA 5B58T 1PBTA 1HLGA 1JDBB 5AKKA 4Q15A 3EPLA 3GZNA 1XELA 4H7EA 1G8SA 4OB7A 5EWJB 3IA7A 1VLVA 2FWBA 3WJ1A 5LP1A 2QX9A 2EL7A 3HK2A 4PPNA 4F3NA 4RMIA 2A1IA 3KHUA 1N6KA 3QBDA 2CFRA 1ZQ9A 4HH1A 4C2TA 1UR5A 5HEKA 5KI6A 3SEZA 3MSXA 3U09A 1N2IA 4HGZA 1KO5A 1JNXX 2X1MA 3HKBB 3QVVA 4RQBA 4B33A 3EGVA 4ZQFA 3H2JA 3CLRD 1XMVA 1BW9A 1C9NA 3N05A 5G0VA 2OEPA 3PF8A 2W70A 5KU7A 2OHIA 2R82A 4I6EA 3JQAA 5A3SA 1WCWA 5EC8A 3JRWA 3OZCA 2BWJA 2WV7A 2B92A 3W5UA 3AY3A 1PL8A 5FEUA 5KQMA 1RE0A 4RA9A 1NI3A 3G0HA 1EWTA 1UOEA 2GBCA 3QYFA 1N33B 2QTWB 2JATA 1IAQA 4KE8A 3QA3E 1XP5A 3DE0X 4BZWA 3QPVA 4AMYA 1I4OA 1ECLA 1HDYA 2ADFA 2ZKIA 1GVNB 4BASA 2X7JA 2Z2KA 5AOCA 3K1AA 4Z3OA 2IOHA 3REQA 2X0FA 3EVGA 3R74A 2JD1A 1C7JA 4FEYA 4LHVA 3C7CB 4EPTA 2VJPA 1GL6A 1M76A 3OE5A 3UGQA 2BSXA 1KO7A 2RCYA 4J1TC 4DJAA 1RVV1 2PSEA 3SF8B 2R1VB 3DEKA 1EWRA 3QK7A 4HEQA 2V7QA 1NXWA 1TKAA 1ZRNA 2AHRA 4HR7A 1UDXA 3CNBA 1ETHA 1WHSB 5H81A 1KEEA 4XWKA 3AUXA 5CA0A 2XDWA 2NQ2C 1DV2A 1EFKA 5AJYA 2M6LA 2VQ3A 3T0GA 2H4XA 1O9BA 1SWWA 2IYSA 5ADVA 1HTBA 1NJGA 1EM6A 4TS3A 1BCRB 3S2ZA 1AZLA 4JHXA 3M6XA 2OC4A 1AKTA 4ND4A 4RPIA 4ADSG 1SVLA 2QMZA 4BVJA 4BRZA 3H5TA 5JVDB 2V9CA 2VHJA 3LDAA 1RYFA 4BQEA 4RIEA 5I8PA 2D0PA 1T1SA 1ZCAA 3WLLA 4MDHA 3CPHA 5EKUA 3IVGA 1DV1A 4BFWA 4BRWA 1AKQA 1EDEA 3P2YA 1E5TA 4MVJA 4UEQA 3VZDA 3RO7A 3Q9NA 4U5QA 1ZC3A 1NR5A 2QUJA 1TLLA 3FIUA 2MR6A 2QEQA 1ZY2A 2J0UA 3TIGA 4E12A 2FEWB 5IVPA 2YRXA 3HV2A 3JYPA 4FTWA 4OQXA 1TRKA 3W8EA 1Q57A 2LIPA 4P5EA 4HDMA 1XZGA 1ND5A 3LVQE 2ERYA 1WCXA 3WS7A 1GLNA 1MA3A 3OOSA 5IAJA 4ZVLA 1N8SA 5HUQA 4DQLA 3D5TA 3TLJA 1IUPA 3IPYA 3Q3EA 1TUBA 4OKIA 3VOAA 1K1EA 1UBOS 4NNPA 4PHHA 4YJHA 1D1PA 5EE1A 3U7IA 1H1LA 4NJEA 4QULA 4K28A 5C37A 5I4CA 3RWBA 1DC3A 3LFTA 3K4QA 2HAEA 2GFQA 4CDNA 3UAYA 5JS8A 1K88A 4MQUA 3TPCA 2W58A 5E6RA 2ZBPA 3JSAA 5TR9A 4PAOA 2JGIA 4LOHA 3N8NA 1JBEA 1KH2A 3BMNB 1SCKA 3NORA 3L8GA 3ZXUB 3EZ2A 1BYIA 4D99A 5F2NA 4I6JA 3NNDA 5H70A 2PUWA 2C20A 1KFJB 3FSEA 3VH2A 3ZDZB 3ZHQA 3KRTA 1QAMA 3D6NB 3MYYA 5AKYA 1ZL0A 3VVLA 4XX0B 5A5EA 2YJVA 4ER0A 2ZJ7A 4NGNA 3BA1A 4DCGA 1IZ9A 2QRKA 2V7BA 4YN3A 3THYA 1ZJWA 2RHHA 2C6CA 2RJNA 2IU0A 4U7HA 1RPTA 4OQPA 1MHPA 1S8OA 1J0AA 2CVOA 3BORA 5EHGA 2PRKA 3T5TA 4B7ZA 4LSZA 5IUNC 4JI8B 4Q48A 3MJEA 2FNAA 3MCVA 1G20A 2DFKB 4FPXA 3KYCB 5GOZA 3SYNA 3J7AC 3E9DA 1G9XA 2BGKA 1VHQA 1KI9A 3EGIA 3MJVA 3TLYA 1MKYA 5FBRB 1ZC4A 2CSUA 3AR8A 2H2HA 3N86A 4ZIRB 3K8YA 4OIFA 3HJFA 4LF4B 3AUTA 4MA0A 1KEVA 2V55B 4BJ6A 1Z4KA 3VU3A 1KU6A 2CLIB 1DRVA 2GJ8A 5EZQA 2VRCD 3EIUA 5CMLA 3KFLA 3MCUA 2HBYA 5HS4A 4URZR 3TL2A 2CHQA 5EY5B 1D2RA 1M2VB 4MV9A 3TZEA 5JADA 5HQTA 1EVQA 5EJAA 4C6HA 5BN5A 1Y9DA 2GNOA 2RGGA 4P4EA 1QWSA 2Y0EA 2PXXA 2VATA 5SYNA 3ZHTA 4QGAA 5GJCA 4FWTA 1XA0A 1CPYA 3DD1A 2ZUBA 3TLGB 1FP4B 4LNHA 2H18A 2R44A 2DKOA 4HH4A 3BGWA 3FCOA 3PP8A 3OAAA 2WLSA 4NP6A 2I8LA 5AICA 5NLLA 2VTDA 4W4TA 4TTJA 3V1KA 3VRHA 2FK8A 5L3SA 5JNSA 1ZR4A 3CW8X 3LLMA 2FN8A 2HHAA 4MHTA 4FONA 4V3CA 2CHGA 2EWMA 1EQ2A 2YVLA 4P7BA 1CBUA 1V37A 2ZRDA 4FVTA 1E3EA 1T4DA 2Q3MA 2QN9A 1IJFA 4OHFA 4E11A 1BWSA 1WWKA 3MA0A 4KLCA 2XKKA 2HGZA 3VX3A 4C2AA 2G83A 1L7PA 2GBFA 1JIJA 2D5LA 2QTTA 4HRXA 2BM8A 3PPIA 4NU6A 4N47A 1XA4A 2BMWA 1TIKA 1H1DA 3MFQA 4NQRA 5BN1A 4UUAA 4Q19A 1M67A 4WZZA 4AP9A 3LG2A 1U7HA 1NKSA 1TIPA 3LPLA 2OP0A 2FSFA 1IG3A 2QR2A 2ZR0A 3H5IA 2AQHA 5FNVF 4X24A 1TYDE 4D3DA 1ZEMA 2P8SA 3OQ6A 4AG5A 4P34A 1JQ5A 2B20A 2WVAA 1CZKA 1XRMA 5AT1A 2P2GA 3DR3A 3ZHVA 3M5WA 4MVXA 5B3JA 4HMPA 4R16A 4X92A 3SHFA 3UGKA 1RBMA 4YQFA 3KJNA 4A8PA 2IS2A 4DCMA 4KIFA 4R6WA 4QT0A 1SU7A 5JZOA 1Y7LA 2GM5A 1MO4A 3G17A 4JZ0A 4ND3A 2OL4A 5ALOA 1UEXC 3UMRA 3ORYA 4RJJA 2VQDA 2ZRCA 3RPEA 4AZWA 5CCXA 5FI1B 1O77A 4YJ3B 2MOKA 1USWA 3BRCA 3CN9A 5CEFA 1PEKE 3TGPA 1Y80A 1DIHA 1SZDA 2JJ2A 3FE2A 3PIIA 4QJ5A 2ZT8A 5LC1A 1KQNA 2NU8B 3FTEA 3BG5A 5LDGA 1VSUA 2C4KA 2J3HA 2C2MA 2O2GA 3ETHA 3L1IA 3O90A 3HJTA 3ZHRA 1IIRA 1FXWA 4AECA 2AFIE 4Y1GA 2IHJA 2J59A 2R7KA 5FFFA 5GJWC 5JSQA 1FDWA 2A58A 4Z5XA 3UOGA 4ZYLA 1JAXA 2WSLA 1JU9A 1DO8A 3M1LA 3DSRA 3SNHA 3GEGA 4QG3A 2P3SA 3ZV7A 3IEVA 4I19A 5E9QA 3QLTA 1JDBC 4BY9E 4RJTA 2Y93A 2XGOA 3R9KA 2WHEA 4R83A 4C9EA 3TKYA 4HLCA 1GRQA 2NZ8A 2WKRA 3L8HA 3C24A 3G5MA 1FW8A 1X1BA 4RKWA 3ADCA 4JT2A 3QBEA 1CB0A 1ODJA 1JWLA 4H27A 4Y9RA 1PR2A 2YJ3A 3DS8A 2X8JA 2CLDX 4B6OA 3T1QA 3PJEA 2HJGA 2BOVA 1C3XA 4UCWA 2Q7OE 3RS4A 3U7EB 3DEIA 1YAHA 1C8BA 3DAOA 2AN1A 3H11A 3IAS6 4GOLD 2Q2NA 3QVGB 2BBTA 2QTGA 1R9JA 5E9AA 3D8RA 3REFA 4I5DA 2A9JA 2AG0A 3QX9A 1RD4A 2HMWA 3RYHA 3UICA 2C83A 3SXPA 2O52A 1GTL1 3G85A 2CXRA 3K4HA 4O59O 4MYRA 3BQMB 2FJUA 1UK7A 4NZOA 3HM9A 4Z49A 1XKQA 1UEJA 2A9QA 3K0EA 4BZXA 4BYMA 3A0UA 5AESA 2RHGB 4JR2A 4PZYA 4OI0A 3TXYA 1J99A 1SC3A 3OEHD 1MR3F 1X1EA 4N0PA 4C6RA 4R1TA 1P5JA 4PAWA 5CIYA 4AS2A 4UHDA 4YJDA 4WGFA 2CFIA 3A36A 2AZTA 3DWIA 1TW3A 4W82A 4YRNA 3N9IA 3UXYA 3F3SA 3VR6H 5IBCA 2FHSA 3R3HA 4LSGA 2GK3A 1E9DA 3JATB 4UOQA 3AVXA 4JT8A 1JHYA 2OT3B 1P73A 4W1SA 3LP8A 4OQZA 3DD5A 4BCDA 5ECDA 4K1XA 1CEYA 1XEFA 1UOOA 2CBZA 2GKGA 3KCNA 4ARAA 4UZSA 2Y0CA 3K70C 1R0BA 5KVQA 3R1IA 2AQIA 1HQCA 4C9RA 4XJTA 5C8ZA 3HXQA 3BIOA 1RM0A 5J2TB 3UK2A 3KKEA 1E18A 4DZZA 4JZKA 4EO7A 4ZCIA 5HCNA 4J0NA 1JFFA 4YECA 3CO0S 3ETGA 1I13A 1PK8A 4HADA 3LHFA 5ALKA 4EDFA 1JIKA 3LQ4A 2JJQA 4L16A 1RJDA 4PANA 2KB0A 4TVOA 2OUIA 5LQAA 4MQMA 2O7VA 1NMQA 5C1OA 4AQDA 2V6BA 4LFBB 3ZW9A 1T0UA 1EFTA 1EZAA 1COZA 4XWOA 2G0TA 5FTKA 3I9MA 1F1BA 4V2UA 3BK2A 3RS2A 5GP1A 4KDCA 3FFBA 2I7CA 2PUVA 4HBZA 3CNEA 2AF4C 4DLXA 4BXOB 3OQMA 1OT3A 3ES9A 3VNVA 3OM1A 5FWDA 1LRKA 2B8EA 4P58A 4D9NA 4QASA 3D3JA 4BTLA 1LKZA 4BATA 4BN4A 5A1TA 4Y2VA 5HIJA 5J9FA 3IPRA 3MERA 3IC5A 1PS0A 4IXMA 1VJDA 3WWOA 5KTNA 5M29A 2ECFA 4J43A 3I28A 2MYTA 2RK3A 4RGYA 4WZBA 5CDYA 4HB0A 1ZLXA 2ZSDA 4H4DA 1Z5OA 1NP7A 4FFBB 3FEEA 1O1YA 2M9MA 4HLDA 2FR0A 3OY7A 4JS0A 2JI6A 3K92A 3B5JA 4RZ2A 5TV2A 3UXMA 1T9GS 3FYUA 3IHWA 2I7VA 2OY0A 4V0RA 5EMLA 1N6RA 1MDFA 2CDRA 4BQIA 4XIJA 2I34A 4D9EA 4F3CA 2ON6A 5BR8B 1NW4A 1US8A 3MWGA 3A7EA 3WB9A 3JQGB 2Q1XA 1RJGA 2A57A 2Y66A 1UMCB 1TCAA 3OOEA 1LPAB 1K7EB 1QX3A 4P3YA 3IDFA 5SICE 2M6KA 5AW1A 4EABA 5IXYA 1G3UA 1PYDA 3FAZA 1L4YA 1UBJS 5K4GA 4RHEA 1M8FA 4ZZ0A 3ZDDA 5DNDA 2XE6A 4M1MA 3WX0A 1PZMA 3TI7A 2FSUA 3UUWA 3EA0A 5IAAA 5KWVA 4CGZA 3LT1A 4IJMA 1N8NA 3WWCA 4L4ZA 2FDXA 4ZICA 1LI5A 1W85A 4WDQA 3AVPA 4R6XA 3RV4A 3W4IA 5CDHA 4L6AA 1GAWA 2H2DA 1GDTA 2P9YA 1T3ZA 3I2GA 4IGIA 3AF0A 4KIUA 5A4KA 1NLUA 2POQX 2WF5A 2Z1MA 3ETEA 2IVZA 1WXFA 3KKOA 3CMCO 1H2BA 1C0IA 3VU1A 1NP3A 3S40A 1W35A 2EBFX 2JRLA 3DMRA 4CV2A 3VR2A 2JD2A 1CUZA 1UH5A 1DJQA 3GJZA 2EW8A 4BO5A 2IXBA 4E51A 1DTEA 5JASA 4MRAA 4MDFA 3PC3A 3F7NA 4B3JA 4AD8A 1FQWA 2K5UA 1P5RA 2HLDA 3OTQA 1LLCA 2HK9A 1CEQA 3LTEA 1PVDA 4Q9NA 3VSEA 1OI7A 1PR5A 2ICAA 1KQ3A 2QBYA 4E3WA 4QPPA 1U9CA 5T5QA 3S3TA 4QJ3A 1K89A 4MW2A 4BB6A 1JT2A 1MOZA 1WHTA 2P11A 2WZQA 3GMDA 2EBWA 3HBJA 3KLBA 1JLMA 1U2SA 2GZSA 2LZ0A 1SHLA 4HDCA 4WBXC 2DBQA 5AJHA 3CLVA 4GXTA 3F5DA 4A1OA 1ULSA 4MXDA 2XCSB 3FOAA 1J9GA 3CCFA 3KYBA 4JB2A 3I92A 5AVWA 4RPGA 3KSMA 2F3PA 2CCGA 4RQTA 4Z9BA 3ZHYA 1UZUA 13PKA 1II8A 4ZDWA 4CZ2A 4Y8VA 3NVKI 4N5HX 4JQYA 1C0EA 2ZYDA 2HXYA 1FFBA 3H3XA 3S7TA 2RHWA 1U3FA 3AVWA 4MS1B 2P78A 4AN0A 3K2QA 5B37A 3EWSA 4ITVA 5TQVA 2NU6B 1L4KA 1MENA 4Y0VA 2IYRA 3P9PA 3WHIA 3ZU3A 1MO6A 5IBQA 1UJ2A 1UPUA 1UMDB 5J4VA 1IUKA 1E3IA 2R66A 2QLMA 1L3CA 1PNVA 2GRUA 3R7AA 1L4BA 2VTBB 2CNBA 3CINA 2I1LA 2ZYWX 1IN1A 2X15A 3FWPA 4PLGA 1JLHA 5CNKA 2C77A 4MIOA 1YJBA 4E7OA 5KNBA 1QRSA 2VK1A 3BB1A 4PX5A 4A8JB 4E5UA 1O54A 5KMGB 1CRZA 4WUVA 3BWEA 1V9SA 1DIGA 1GQFA 1QC5A 3OPYA 2FSIA 5C9ZA 3SC2B 1IEWA 1AUOA 1XDBA 2BRUA 2B2XA 2H7YA 1DKPA 1H6CA 1XEAA 1B16A 1XX6A 2QVLA 3NBQA 4MULA 3EH1A 4EQ6B 1M75A 1J2RA 1W0KD 2A5GA 3ACCA 3GVXA 1W25A 1Y4SA 3MT7A 4GW3A 3O03A 4RO0A 4TV9B 1VJCA 3IJEB 2OG2A 4EI9A 1R3UA 4JQCA 1M2OA 2NP7A 2XYVA 5AVUA 3VR4D 5B7QA 4UAJA 3LT2A 3PNSA 1HE8B 1IWBB 2XHEA 3LX8A 1KWGA 1XVTA 1XQ9A 5C5DA 1ADFA 2H7VA 3INTA 1GUYA 2YFKA 3OQJA 3QE0A 4IR7A 5I6DA 1HETA 2OV3A 4TPKA 4CG3A 1NVVQ 4XQ9A 3AF4A 3UAOA 3HB1A 5TEWA 3HUUA 3SOZA 3C39A 1XEXA 4FDUA 4I7EA 4L8WB 1VBFA 2G5GX 4MVYA 4CEIA 1IWPB 2J0VA 3DCIA 3FI9A 4NFHA 4Y18A 1HL7A 1KYYA 1K0FA 1PJ8A 2HDHA 3HRIA 3QWIA 3RUIA 5B1EA 3HXOA 2I78A 1X7YA 2DWUA 3C1UA 1J39A 3DTYA 4IUDS 4QDOA 4QUJA 5IK2A 5JCJA 1U0RA 3EZXA 2H5EA 3FCUB 4L9WA 3TOXA 3DHEA 1JKJA 1BMTA 1YRYE 3PEEA 3ZBQA 5DIFA 2AMYA 3BERA 3F4LA 1OLOA 3DUFA 2GAIA 3TZKA 4YJKA 4ETNA 4N3GA 4NRDA 1DKMA 1G8FA 1C1HA 1TLFA 4IGAA 3D4LA 4TXHA 1ZGCA 4XVCA 4V1CA 2Z6QA 4K46A 4MVJE 3S8EA 2JLZA 2HDNB 3ZQUA 1RTTA 4KB5A 4BU0A 3HN6A 3SJEA 2FRDA 4HHEA 1N25A 2IZ7A 3OT5A 3ZE9A 1VKNA 4IIFA 5C4GB 5TF0A 2JG3A 4RTMA 4LDQA 2XE7A 2ZQZA 3E9CA 4HCJA 4E1VA 2W2PA 3H42B 1FMLA 3LT0A 2VCYA 1RRMA 1W6RA 1PZEA 4JUCA 4ZVPA 4OQLA 1QZZA 2C59A 1IN8A 2A86A 4BNDA 1JH9A 3RBVA 2FN9A 4G0ZA 4B0PA 5F7OA 5KTKA 2D59A 2G08A 4IGKA 3WRXC 4CM8A 2JGAA 1KPIA 1KI2A 1H2FA 2YMQA 5FV4A 4XYLA 4PO9A 1OJ7A 1YGPA 3L93A 3OSZA 4N7BA 3OQBA 1QYRA 3X2FA 2Q7DA 5CD9A 1Z88A 1J0CA 3KPWA 4GRDA 3PZBA 1N6HA 5EMKA 4PF1A 2BZGA 1EVIA 4CEJB 3TTTA 1GL9B 3UZUA 5ADWA 3ABOB 1ZHOA 4IRMA 2IXTA 3G1UA 2M1ZA 3RHTA 3ZHZA 1I10A 1JGTA 2CXPA 3LWBA 2GZAA 2HOQA 3A9WA 2P3LA 1L7OA 3HADA 1KK0A 2HLHA 3CBGA 3F71A 2X42A 1G20E 2ZAYA 5IWCA 3KR1A 4CCYA 3IPXA 5K3SA 1E3TA 1UJ5A 2PMKA 1P0FA 2XT6A 2B9VA 4CIXA 4DREA 2RHLA 3TIFA 4F92B 3GFQA 1G4HA 2QT0A 1GUFA 5JS1A 2UVDA 3BBLA 2YY6A 3PC8A 1V5WA 4HGQA 4JC0A 5LLSA 5TQJA 4S1TA 5IJAA 3VFDA 3M81A 4C7KA 4HDQB 2R60A 4ZO6A 4Q1FA 4HGPA 3KKNA 2J85A 2NZVG 2V7WA 4AICA 4CFYA 1Q6YA 2EFGA 2QUIA 2W8BB 5L4SA 4PFSA 4UEKA 3AEZA 3GGDA 4EUNA 1XCLA 3LXMA 3C8OA 2NX2A 1JXMA 2X2PA 4EVSA 1YS1X 4M0FA 4HH3C 4WCVA 4R81A 3S68A 3ONVA 3A6PC 3R3WA 1F5NA 4UAVA 3KBBA 4UHFA 2Q1UA 5AW6A 4IUBS 2N0SA 3M49A 3OURA 5HA5A 1U1DA 1V1MA 2NSHA 4LOKA 3STUA 1QBKC 4YAKA 3ER6A 1KI7A 2OO5A 1NZDA 1U3UA 3K6KA 3W2EA 1L5FA 2VYVD 3G2KA 3K2BA 5HBRA 4ZOQI 5JLJA 2KHZA 3KHSA 3LO5A 3A4NA 4IJ5A 5A4DA 1J8QA 4FYYA 4LDZA 4JP5A 1QAOA 4AY3A 3I6ZA 3JARA 1EMDA 2D8AA 5LQJA 3EZ9A 3OPMA 4D02A 4QPNA 3RGGA 5SV2A 2QR5A 3KLPX 1KARA 4FYIA 4GX0A 5HJ5A 1SHKA 3ITDA 3NH9A 1U3GA 2HHLA 3H1PA 3KG2A 4UMFA 5DLDA 5AXDA 1UT6A 4C8UA 1S8NA 4C9UA 5EXSA 3O4IA 1PDVA 1Q0ZA 2B4KA 1IQPA 2VCHA 3Q88A 4JT4A 1P0MA 2Y9PB 3MWEB 4OK3A 4YGYA 4X8MA 2Z1NA 3MM4A 2JFUA 4WOJA 4DJ5X 4RULA 1U7UA 4E30A 1VCOA 1VZ2A 3T7TA 1QOPB 4XIFA 1Y3IA 4AO6A 1N92A 1UKZA 3C4VA 3ROEA 3N2YA 2ZULA 2H1CA 5CDSA 4J1NA 4MGEA 2EOAA 4PTYA 5EINA 1H9AA 2G3YA 1DOZA 3OC6A 3ZLVA 4OHYA 1LBEA 1RHQA 1WLSA 1MG5A 1T1JA 2V9ZA 2NV0A 3GCZA 3R0IA 2EC5A 3JZAA 1XOIA 1FY2A 1S2LA 2HUPA 4NFSA 5EIBD 3VYUB 3J80A 1A50B 3FEDA 3ELWA 4MYTA 5J4LA 2YQ5A 3AJEA 3L1HA 5B1YA 3K6SA 3L1VA 2B6NA 4HC4A 1J09A 2ZEJA 5ILGA 1Z83A 1ECGA 1Z9BA 2B94A 1WU8A 5KYTA 4N7MA 1D9XA 4E7PA 1JQJC 1CEXA 2ODPA 2OOKA 2G63A 3NHFA 3P0RA 3TMAA 3ZW7A 3U62A 4DV5B 3Q1KA 1RZ3A 3JQAD 1KQGA 2PJDA 3ZGLA 4UJ5A 4E88A 2I4IA 1HV8A 3C70A 3MYRA 2PLNA 4B85A 4AP6A 3PRJA 4RH0A 2X58A 3QPCA 2PFGA 3AOEA 1XDZA 3BHNA 2QYOA 3CBQA 1IE3A 3CT6A 5JVLA 1QGYA 1UJNA 2FFHA 1YZ3A 2HMAA 1CVLA 1MDBA 2QTBA 3PPVA 3GH1A 2CVFA 2VRNA 3A1CA 2YYZA 4ZYZA 1XAHA 4KUGA 1NX9A 5ELYA 1JFTA 1CQXA 3EF3A 4BFLA 1ZJZA 2G5PA 2NVOA 2OK7A 2X5XA 3NONA 3Q8XB 4ER3A 3IT0A 4EYQA 2G28A 4PO8A 5E9WA 4MWEA 1UUFA 2OO7A 5IKPA 3ZI0A 5HRUA 3PPWA 1N3BA 1YL5A 4Q24A 3N28A 4JLKA 2VOJA 4YYEA 3G8CA 4QXMA 4I55F 1NC3A 2PUDA 5FUWA 3UYKA 2Z2XA 4L5CA 4L07A 1Y8ZA 5DTQA 3GFRA 1DG1G 3FUXA 3PQ8A 3FKSA 3PXEA 3EQZA 2J3KA 3U9TA 4IIBA 4J9VA 1LBIA 2XYRA 1JA0A 2W37A 4K8OA 2O48X 2QTMA 1LRJA 1MC4A 3P9ZA 3LKVA 2OV8A 4JMPA 1DL5A 3ONDA 3OVMA 1JEJA 2Y92A 5CVVA 2R6R1 1HT1E 3GUHA 4WMLA 4AXBA 3GLHB 3LF2A 5TMPA 2OHJA 3NALA 5BRAA 2M1XA 3EGXB 5CH5A 2X76A 5IF3A 5K0JA 3EEOA 3UB2A 1REQB 4A1FA 1GO2A 1I2DA 3AHIA 3E9EA 5AR1A 2P2ZA 4Q6WA 2PY6A 1Y6ZA 2ZI5A 5JSKA 3F8TA 3ZGVA 1U2ZA 2ZTLA 3LQFA 4MVJD 1XDWA 5CD1A 3IWWA 2PZGA 2QSZA 4OL0A 2QRLA 1LU9A 2FFAA 1O9HA 4ZCMA 5KOHB 2EZCA 2P67A 4C08A 4QFMA 3EZAA 3B78A 1MMFB 1S8FA 4YMSA 1SCUB 3OF5A 4TUYF 1NXPA 2BEUA 4MUNA 2E2WA 1QHYA 5GONF 4KDFA 1TTPB 2X6QA 3BXFA 4J0JA 4P4UA 2OHFA 3TQCA 3LPDA 2IYFA 2QT9A 4RUKA 2W6OA 5IJWA 3A1UA 4M3NA 4J4BA 1A5SB 3R5HA 4DLLA 3EGCA 3IP6A 1KORA 1QOZA 3TEJA 3V8PA 5DM70 1KJQA 2XCLA 4G5HA 4RVUA 4Y2GA 2A1TS 3G2OA 2CT8A 1JQKA 1QTQA 4I3HA 1XO1A 2X0KA 1U1FA 5CFNA 2W90A 3HUTA 3WHLA 4S04A 1QTIA 3BD6A 4JXZA 1SM4A 3LY7A 5AM5A 5JT1A 1JYFA 3KAPA 2EJUA 4JJKA 3V42A 3WIUA 1T2DA 4I3GA 1JRLA 1RAFA 3O0TA 3ILVA 3H9BA 4B4DA 1ZBQA 5ELLA 1MNQA 1LSOA 2VHXA 4I4CA 4QLBA 2AN9A 1DZ3A 2O3SA 2F17A 3MLAA 1UXOA 2OCGA 1AY0A 4WZBE 3ZH9B 4DXHA 1KP9A 3Q3IA 3DOJA 1F9EA 3ROZA 1EPUA 2G7MC 2PX5A 2W2TA 3K0AB 1D0IA 2O2SA 2G9ZA 2Q2VA 1Z0DA 4P2BA 5I9MA 5BV7A 4JUIA 5JPIA 4LJRA 5D3MB 2BIFA 3FZYA 1L9KA 3DFUA 1XUOA 1B3RA 1POWA 3IHKA 2OAEA 1KMMA 5FYDA 1N5KA 2VP9A 5JTTA 2J3LA 3IV7A 2ASVA 3D31A 3SE0A 1RRVA 2J4DA 2QE7A 1RRPA 3TSAA 1EA5A 5CGZA 5ALZA 5FAXA 1MLDA 2ZIEA 1COWA 1ZAYA 2REQB 4QRHA 1TPYA 2RH5A 3AP1A 4I55A 4CMCA 1K0UA 3K2IA 2B36A 2OGTA 3V8BA 4KRGA 2BZ1A 3ANXA 3IMEA 1DB3A 4MVCA 4Y6SA 2BM0A 3IAEA 3DP7A 4WJZA 4E07A 3M4NA 4CTMA 1QRRA 1R5OA 5J2UA 1O2DA 3AEQB 4BVLA 2Y1KA 3I4CA 1DAKA 2H00A 5DNEA 5E95A 3F4BA 3L6OO 5CT5A 4YJ2A 1RT9A 4GECA 4NMXB 1DGQA 1P1JA 1XK6A 3BL6A 5JQGF 1Q7GA 4DJJA 3G5TA 1R27A 3PKJA 3EYAA 5CFMA 1BXRB 2A5YB 3LKDA 1NUHA 5CX1B 5JO0A 3P97A 1ONOA 4Y1RB 4LDPA 1FVOA 4DIFA 1C7FA 3ZDFA 1M1NA 4F06A 4OHZA 4B8ZA 3RRMA 4BC0A 3C8ZA 4I4TF 5ARBA 1C30B 1SA0A 2OORA 2HF2A 2Q8PA 2RDMA 2WPDA 4EHDA 2Z9BA 4BWYA 3HWRA 1R8JA 3MW8A 4RZXA 1J25A 3BEDA 3QITA 1XP8A 1UBRS 1Y81A 3G6WA 3QE4A 1VI5A 3DVLA 4I8XA 4QDTA 3GGCA 4EB6A 5HZGA 4C21A 1MT0A 1QF7A 4GKAA 1CUYA 5IJXA 1YZGA 3HKEA 2UZ4A 1BKYA 4BO3A 5A6VA 3DM9B 3SQDA 2XAAA 3KO8A 1UKCA 4O5OA 1LPOA 4D0NA 4URYR 2FZ5A 4BGEA 4D26A 2YZMA 2QWXA 4NJMA 2WF9A 2WP8J 4JDUA 3FOZA 3QOYA 1Z62A 5H4HA 2PLAA 1SUFA 2PAFA 3V7FA 1T1IA 3KTOA 3AVUA 4DOMA 3EVFA 3O74A 3FIJA 4S05A 3EOBI 4LE2A 1QLJA 1LVUA 4WFKA 2J7PA 1RPZA 5CXUA 3GGJA 4B87A 1B41A 1FU7A 2HZ7A 4OYHA 5KSYA 4YXFA 2VNSA 4GEKA 5EP2A 1CSEE 2FP4A 4ZCQA 3SYRA 1Y5RA 4BLWA 2FPSA 1BE1A 3CZ4A 1Y48E 3G9UA 4GZLA 3PHIA 2P5UA 3BWMA 1FB5A 2QPOA 4JR1A 4OH1A 5DMXA 4B1FA 1BIFA 3ZDRA 1SG0A 3HJUA 4DKJA 5KYUA 3FRJA 1O95C 2RHRA 3QI2A 1JBKA 4ZV4A 2JJ2D 1ZSYA 4WKBA 1U7TA 3ZDEA 2H11A 1S7CA 1PYGA 4PQGA 3AC0A 2QIOA 1X39A 5AI9A 3ROXA 1EUQA 5A0VA 3L6DA 1FPQA 1QTNA 1SCJA 1T0PA 2WTNA 3AM4A 3K9GA 4Q47A 3O3NB 5H5JA 3ZWDA 1SBZA 4ESHA 5C52B 4BLTA 3ETNA 5DTRA 4W5QA 4I9UA 4Z2YA 2NTNA 3FM9A 5FV7A 3H3JA 1ZR2A 1NUAA 4ENWA 1PWXA 2QRGA 3FLMA 3PVCA 2XMSA 3CX3A 4TT8A 4EEKA 4CUZA 4MO2A 5LQUA 1U8UA 3CSDA 1YZHA 2DBZA 3I0MA 4FFLA 1TVCA 1U3DA 2Z3ZA 2GZ1A 4HDSB 4PRKA 4UUMA 3BH7A 1SG9A 1CQIB 4JELA 4BQSA 4A8TA 1VKHA 4KL8S 5ICGA 4O4LA 4DG5A 4M55A 4F6CA 4H6PA 1RLJA 4L2IB 4U0KA 5JQGA 5L3ZA 1A7KA 2ZSJA 2O20A 4G0XA 5REQB 5KU1A 3UCXA 4IDDA 5LZ5A 1R5NA 3PHJA 1TKRA 1RAGA 1RR6A 2EKDA 4YC7A 4B80A 1Y5IA 2SBTA 3RYFB 1LNQA 1Y6QA 3HN7A 3UT5B 5JFTA 3TYXA 6ABPA 5AJZA 2IPXA 2JKVA 5EZYF 1N4AA 4F9FA 1MX3A 3AUSA 4LYJA 4XJSA 4I4TA 5G53C 3TW0A 3QLUC 4U6NA 3WY9A 3BMOB 5L51A 2XA1A 2IHNA 2QM8A 1UBSB 1MV5A 1MUUA 3MD0A 2DHEA 4HLNA 4Y6PA 5P8WA 1JH8A 2NUTB 3IE2A 2IU6A 2RB4A 3FMPB 2AI2A 6ADHA 1ZYMA 4GPAA 4WV3A 3H04A 4AY6A 1GP2A 4J0FA 4PYMA 3W77A 5FNZA 1N5IA 2CFTA 3IIJA 4FUTA 1JEQB 4NMHA 4PLFA 4KSCA 5A02A 3S28A 1ZWLA 2VDVE 2I65A 1ECFA 1JYEA 3DKIA 4TRRA 3NXKA 1EWYA 3FH0A 3U9LA 2DY1A 2NZ2A 2BISA 4ECEA 1MB2A 2V7GA 1UZMA 3JQ6A 1ZM4A 4N1AA 4C5AA 1MQSA 2ABWA 1Y98A 1BXGB 1TZCA 3W78A 4GNKA 1XCPA 4OOEA 2WD7A 3ZTTA 3T8YA 1FU4A 1DX9A 4ZRNA 4C22A 2AA3A 3JAWB 1TAUA 1YRQA 3OZXA 3C6KA 4FFSA 2ATEA 5JDIC 2P77A 3PNMA 2FAXA 2GTPA 2A92A 1NVUQ 1DMRA 3I0NA 1WQ4A 3ANTA 4DXDA 3IIKA 4ECAA 3UJPA 3OOHA 4ZEWA 1NIJA 1WCIA 3GO4A 4PV7A 4WLEA 3T7EA 4B79A 2Y05A 1ECPA 1ORIA 4KPUB 1CJMA 2GA9A 3UHOA 2BFFB 2P4HX 1WMFA 1DBSA 1BXKA 4JEHA 3ZWYA 5A04A 3C7AA 2QD3A 4OHMA 5DWQA 3FPHA 4TKVA 4ZJUA 1Y5MA 5EIEA 3KPYA 4G5RA 4JLJA 5DJ5A 2FHPA 1XZEA 4PBSA 3VSDA 1Z7GA 1M1XB 1XDDA 3TG8A 3V46A 1X8KA 3GOQA 4XOUA 4LSWA 1LS6A 3K09C 4FYMA 4BV2A 1J1ZA 4US0R 1P6XA 5JAIA 4MAMA 2Z2ZA 4JU8A 3B3GA 3IHLA 3Q7RA 4FOSA 4QFDA 4DBVO 3A1SA