3TMOA

The catalytic domain of human deubiquitinase duba
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
141
Chain Sequence
AARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTU domain-containing protein 5
publication title Phosphorylation-dependent activity of the deubiquitinase DUBA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 33
structure length 141
sequence length 158
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tmoA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tmoA01
3PFYA 3TMOA
chains in the Genus database with same CATH superfamily
4FKWA 3CMAI 3VJNA 2YCQA 2PN6A 5KCVA 2RC4A 4KFCA 2FSLX 4CKJA 2WMXA 3QQKA 3ML6A 1UA2A 4U7ZA 4GK2A 1OQYA 2DN0A 5HLWA 3KYDB 4JBVA 4RMNA 4MQ1A 3DBQA 1X1DA 4R7HA 5KK1A 3C5IA 2YSRA 5L2TA 3PG1A 3VBTA 4YSJA 3R0AA 2Z2WA 4WF2A 1B4AA 3G1OA 2WTIA 3CO6C 2L4MA 1JGGA 3KN5A 3KRWA 2R0QC 4JQEA 1MSFC 4LV8A 5FEQA 2P0CA 2RFSA 3ZO2A 4L3JA 4LMUA 2C3KA 2VN2A 4PDYA 3ODYX 1GIHA 4O21A 4TYIA 1WJ5A 3HTUA 4P5ZA 1PXKA 2DI3A 3TOAA 2Y4IC 1VQ5I 1X3WB 2M3AA 1YWNA 2E9OA 4M72A 5ANDA 2Y4IB 3KXHA 4IVBA 2G0EA 3V8WA 1EH6A 4DYCA 4U6RA 3Q4UA 2PPQA 4O7WA 3NEWA 4CYCB 1Z91A 2IA0A 4DFYA 4BJ5C 3RPYA 3F72A 2R5YA 3MPMA 4E7IA 3CEKA 1IEPA 4ZEGA 2P7VB 3ZM4A 3GI3A 3Q96A 1E2XA 4LFIA 4MVFA 3UQFA 3MPAA 2Y9ZA 5BYZA 4IAKA 4HA8A 1L8TA 3HGKA 4QP1A 2HZ0A 2MG4A 1FBQA 2K86A 4FSYA 4M3EA 4DYQA 4YLKA 3P1AA 4A69C 4I76A 4G3DA 1FSHA 4HX7A 5LCJA 3FMHA 3GC9A 3PVUA 2NVUB 4GEOA 5AP1A 1VQLI 4QMNA 4QMVA 1ZKGA 3RKYA 1H25A 4ZZNA 4O81A 4KIBA 2VT3A 3POZA 3ITZA 2RFNA 4YJOA 5C9CA 4BGDA 1TWGJ 5EM5A 5KNLA 1FJLA 3CE3A 1T6SA 3LPBA 4IWQA 1SEUA 5DEQA 1U8RA 1XCBA 1AA7A 2YACA 2UXNA 1FOTA 5B2MA 3LA7A 2WZJA 3BRBA 1Z9XA 3FC1X 3GU6A 1RW8A 4E5AX 2XANA 3K4KA 4DA5A 2BMCA 3C7JA 4PSXA 3R8MA 1H88C 3ZBXA 2J5PA 5BPDA 1O57A 4FVPA 4BR3A 4ASZA 4FTIA 1BI0A 1A6IA 3ISPA 3Q60A 3HA8A 1OCPA 2BVAA 2F5DA 4U41A 3EQHA 2V9VA 1FMWA 4IHXA 3QCQA 1XH4A 5CYVA 3FPMA 4E26A 3OCTA 4TXCA 1ZRCA 3LLTA 2VT2A 2QLUA 5HG8A 2XAJA 4CO8A 1H1QA 2VX0A 4A9TA 4DZPA 4X2GA 4BDFA 2H8RA 5KCMA 5CSHA 3ZLSA 3DQWA 1YHQI 4TRLA 3UR3C 4QP3A 2EUFB 3P5KA 4G6QA 4IRIA 1X8BA 3CUQC 5CU4A 2QC6A 5T6KA 4ANSA 2P3GX 5HE3A 3CUQB 4BN1A 4DFNA 3TIZA 4AQCA 4W4VA 2GHMA 2PVRA 4EBVA 2XB7A 2CLQA 2PMHA 4ESFA 4X2KA 2WC2A 1S8NA 5DGZA 5JZNA 4UEUA 3IH3A 2WMWA 4BH9A 2E9UA 1YO5C 1MJAA 4DFZE 4C58A 4AXCA 4ASEA 3HRUA 5KMKA 3C9WA 4GFOA 3R7VA 2KIQA 3CLOA 2QVSE 4KIFA 4EJTA 4II3A 3JR9A 3OS3A 4FZ7A 3FK6A 3JXWA 4PDKA 1P2AA 4YJVA 4YFKF 3ULZA 3HMOA 2DA5A 4FGBA 4AA5A 3DU6A 3CP2A 1GOLA 4ZTLA 4GT5A 3WU0A 3O51A 3PJRA 2O8XA 2YCSA 1WJBA 4Y72A 2A61A 1ZYSA 1OKRA 2ZB9A 3O6BB 5CT0A 2YIWA 1R58A 4BQNA 1IXCA 4D2SA 4HEA2 3QD3A 4XV2A 3TEIA 3GMEA 3MVMA 2B7EA 3ZQFA 1YYVA 2WMSA 4E6AA 3GLXA 2G2HA 1GZ8A 4FA2A 4FKJA 3VS0A 2R0IA 1Y0NA 3H4JA 4H36A 2M0CA 3DPUA 1OIUA 4YJNA 1SVGA 5ERIA 2Z7RA 4Y85A 2O63A 3JRAA 3F22A 2R9SA 1K6OA 2QUFA 4USDA 3FKLA 4ZZMA 2ZMCA 2VWUA 2FA2A 1O3TA 3A7HA 4PDPA 5CQEA 3BCAA 4RPVA 1B8IA 2BR1A 3K69A 4XG2A 5J4YA 4G7HF 3DQVC 4ZJJA 1T0FA 4CFXA 3PUFA 3IW4A 1VQOI 2P33A 1QCFA 1LKXA 2RF9A 4S04A 3A7JA 3Q9XA 2WPAA 2O9LA 2NOJB 2NO3A 4DF3A 2E2IJ 5M06A 3I6UA 4UVAA 2A05A 3LJ2A 3KREA 4YELA 3D2IA 2CNQA 4UUSA 3KMWA 4NJDA 2X39A 4EHVA 1J1CA 3OYFA 2R7RA 3V6RA 2GOXB 2LKSA 2B9IA 1MQ4A 1VI0A 1MBFA 3FBIB 3VNTA 4IRHA 4CFWA 2R3JA 1LUFA 2XNGA 4K2EA 2KIMA 2J90A 1SD7A 3ZHPC 2ELKA 4D9TA 3RKBA 4UZHA 4WG5A 2HKXA 1HKQA 4O2ZA 3J81K 3OTVA 4TNBA 1ZR4A 5DWRA 1YDTE 3U51A 4BHNA 1TQPA 3S2WA 2FOWA 5FXQA 4QLCU 3TNPC 4NKSA 1U54B 1WBSA 3HVCA 1LJ9A 3NFFB 3HDDA 1VJYA 5AV4A 1ZY4A 4O0SA 4KD1A 5L6PA 4K18A 4RB0A 3FKNA 4DC2A 3OIQA 2VN9A 2ZNZA 1H08A 4F63A 5DBXA 3QA8A 4FR4A 5IISA 3HKZA 2E7WA 3ERMA 3U55A 4J71A 4R1HA 4DZJA 5I9ZA 2OQRA 1R49A 4XP3A 2NRAC 4EOOA 5CVUA 4ZYGA 4M69B 2HXOA 2FX0A 4QQCA 5L3CA 1HBXG 4YIFA 3SHEA 2QOHA 2YITA 4BY7J 1WCMJ 1ZHFA 2IS6A 3BY6A 2DA7A 1PUEE 3CQEA 4E7SA 3QYZA 3IW5A 1JKSA 4U97A 2WA0A 2CUZA 3QBNA 2XKPA 4G5PA 2DO7A 2B52A 1BC7C 1DM2A 2JD5A 3HAMA 1U5TC 3ID6C 1G8JA 3AD4A 2K85A 2G1TA 3BJ6A 1U5TB 3R2BA 1R7JA 4F9BA 2F9GA 4XX9A 1VFCA 1GVJA 4PJLA 4WXCA 3WF9A 1VQ9I 1S7OA 3Q2MA 5BMMA 1K9AA 3GCVA 1E0EA 3LQ3A 4PMMA 2W5AA 4UALA 2Z02A 4CRLA 3A4PA 4M3QA 3EPZA 4OAZA 3ZMUA 4AUXA 1N78A 1PXMA 1RETA 1R4NB 3GNIB 4QO9A 2IPXA 2E71A 5FB2A 3E93A 3CPBA 3CMEI 1A6QA 4I5HA 5IF1A 5HLNA 1M17A 1Q62A 2FNPA 1FSEA 1RZ4A 2I5UA 1ZYJA 2Q83A 3WIGA 1PXPA 3ZUTA 5I4NA 2UV2A 1BN5A 5FEDA 1XGSA 3NRMA 3DBCA 4LD5A 4RDUA 3DBLB 3D94A 2YM5A 1HC8A 4I02A 3AAFA 4GU9A 3HRCA 4Q2AA 1XDUA 4KRDA 4LM5A 4ZSJA 1ON1A 1K78B 4DHFA 5AIKA 4KMUX 2M87A 3UQGA 4ZS4A 2GIZA 4AW1A 4MD7E 1HOWA 2HOGA 4AWXB 4BCNA 4QYEA 2WFYA 3H36A 3SFIA 1WGXA 2XA4A 2FO0A 4O7TA 3TEDA 4F3QA 3OWLA 2E9NA 4LMYA 3AOXA 2OIBA 4ESBA 2ZC2A 4GRIA 4ANMA 4XLAA 4LG0A 5CU0A 4YC3A 2NVQJ 1W0UA 1DU6A 5HEZA 3FZ1A 3CO7C 2PUUA 2W05A 2W1IA 2W0JA 2PVNA 4ZTFA 3RAIA 5FM2A 1PVEA 2E34A 4L52A 3MN2A 3C18A 1L3LA 1OVEA 2C6LA 1OLTA 4LL0A 1FBUA 2LF8A 5KKRC 2PX9A 4TYJA 4LLGF 1QNTA 4FC0A 2GHGA 4QP9A 5BNGA 3ZLYA 2W57A 4ZZDA 3R71A 1JKRC 3I4BA 5IOZA 4RJ3A 4AA4A 3QQAA 2R3RA 3P78A 2LTPA 4XRMA 1FEXA 4NC8A 4H1JA 1S5LC 4UB8C 5HNHA 5LFAA 3KK9A 2DMQA 2M8GX 4UB7A 2VTIA 4EOKA 3DLAA 4WHZA 4B3XA 3PIXA 1PP7U 5EDRA 3PPZA 2TCTA 1CF7A 1RI7A 5D6FA 4C02A 2G9WA 5F95A 3L00A 3RPRA 4L9NA 3IS5A 4X21A 3WF6A 2OFUA 2Y0SA 4IWOA 3K2AA 3MKLA 3IDCA 1HOMA 1ZYDA 2VO6A 5EEGA 3QWLA 1TKIA 2M4GA 4LGHA 5KBRA 4MGRA 1J7UA 1ND4A 3A2CA 2ZV7A 5DR6A 1P4WA 1WBNA 2ME6A 2M1BA 3N4TA 3R2YA 5KZIA 1WBWA 2CCIA 3MY1A 4S0HB 2HZTA 3DKGA 1PXLA 4O22A 4DHIB 4JQ7A 4YTFA 3R8LA 3OY1A 3D7TA 4TYEA 2HK5A 2XPVA 4FV2A 2YIYA 2UZOA 1K4SA 4AA0A 2QSHX 1IG7A 3RK5A 4XG8A 4RX8A 1M2RA 3UOJA 2OFVA 1X2NA 1W83A 2XF0A 3P9IA 3AXWA 3PIPF 2M9HA 3W0MA 4I6FA 1I3QJ 1XH6A 2GCDA 1BX6A 4XHKB 3GUDA 3GU8A 4FK6A 1E1VA 4EC9A 3BJOA 2VBXA 3WU2C 4AOJA 3HOTA 3D83A 4GL9A 3R00A 4AACA 3TNIA 1QL6A 2WQMA 5BV3A 2FUG2 4CT2A 2HTSA 1Z7LA 3GC8A 3W33A 3GENA 3K1PA 4J7BA 2VODA 4JG7A 3SD0A 3MZ8A 3FHZA 4I5PA 1WFCA 2MC3A 3VWBA 1JOWB 4M71A 4ASNA 3CY2A 3TO9A 3GTKJ 4GYIA 5IA3A 4XG4A 2WTJA 4ZIMA 2DAOA 3LSGA 2W9ZB 3DV8A 1IRZA 3ZQGA 4HNVA 4NUSA 1G3SA 1T95A 3VYUB 4CSVA 5DPVA 3UG1A 4BCOA 5IU2A 3H10A 3BLRA 1Q1VA 3LFDA 1H4LA 3TDZC 4YJPA 4CG9A 4MXAA 4N0SA 1XWSA 2C5YA 4G9RA 2YWPA 1JKPC 3ZN0A 2O5KA 2Y9QA 1G8XA 3SZGA 3QFVA 4JK1X 2UZBA 1ST4A 1UU7A 1D0YA 3RAHA 1RUNA 2OW3A 4XEYA 4ZY5A 1SFXA 1UHSA 1XBBA 1Z67A 4P2KA 2EFPA 3EQCA 3LCDA 3ZQHA 3KXNA 1A04A 1U0JA 3BHUA 3SQQA 4ACMA 3K4MA 2WB1A 4M9XA 1G8AA 4J1RA 2LY9A 5HTBA 2HKOA 4QQ5A 3ZQLA 2RKHA 2VTTA 3VO3A 1OYYA 3I4PA 2BY0A 1R00A 1IAHA 4YC6A 2FA5A 2HW7A 2A0CX 1Q5KA 2XIXA 5E3MA 2RKUA 4XLIA 4Y4RA 3ZQIA 2V5QA 3ANRA 3DFGA 2BFXA 1X3ZB 4FCYA 3CCEI 3GYHX 2H27A 3O7LB 2ITOA 3DY7A 3FISA 3I79A 4UHTA 1SAXA 1R1UA 2Z33A 3UC4A 4ETSA 2F57A 4FASD 4C37A 3I0QA 3AC5A 4A9SA 1R71A 3NYVA 3IW8A 4BCFA 3UP7A 4EH2A 2HYFA 5IMEA 2K9LA 4RIXA 2G9XA 3L8PA 1NHAA 3K5VA 4FEVA 4UVCA 3VS1A 5K1YA 1F5TA 2HXLA 3F9NA 1TVOA 3MH1A 2E5ZA 1Z6RA 4QOXA 4F9WA 1VEBA 2K02A 2IO6A 3VHKA 2OCEA 4GGGA 2ZSHB 2QKMB 4YHJA 1Q99A 2OK1A 1P6RA 1ZRZA 4FHTA 2ELJA 1FINA 4LGGA 2PK9A 3F88A 3KL8A 2AO9A 4O7ZA 3LSTA 2N8GA 3L7WA 4B3AA 2RNJA 3TP3A 1IN4A 3IWZA 4U88A 5LEJA 2HI3A 2Y8OA 5HBJA 4TWNA 2WNTA 2R5YB 4O5VA 1Q1HA 3G9LX 1FP1D 1VF9A 2CWEA 3S16J 3QF9A 2WV0A 3RJCA 2X7FA 5LMKA 1LVAA 1BIBA 4I6HA 4A3BJ 2QZ8A 1LPQA 5AP3A 1HW5A 3EN6A 3T9IA 2UW4A 4EJOA 4ORKA 3GWZA 2XH5A 3MA3A 3UOLA 1XS9A 1U5RA 4J8NA 4I0BA 3M2WA 5CI6A 4FUXA 3P0MA 3VONA 2LC2A 3HUGA 5J8FA 3HRTA 5E3LA 4R7IA 5CEQA 4GV1A 2V1NA 4F7SA 3EWHA 4ZJZA 4KBCA 4EJUA 2Z7QA 4NT4A 1B6CB 3FMJA 3F5PA 4ZK5A 2QQ7A 1LVKA 2I10A 2BUJA 5J9LA 3RP9A 4I0RA 1JVPP 2JAVA 2FUMA 3BLHA 4AGCA 4FKPA 2CSOA 4EM0B 4FJVA 3W2AA 2XRWA 1G3TA 4BCQA 5B1AH 3OT8A 2KRCA 3DAJA 5TRDA 2C68A 5FGMA 2PZ5A 2RAEA 3OCBA 3QTRA 5EKOA 4W97A 2QQAA 4LIUA 4MQVA 3WHCA 1Y1VJ 2IWIA 4XP2A 2K5CA 2JTVA 4OTGA 4FVQA 3CJFA 4ZY6A 2EIMH 1PP8F 2JSCA 3FYKX 3RINA 4ZDOA 3T8OA 3BG5A 2NP8A 2XASA 3FYJX 3BR5A 3TO7A 1X1AA 2XRLA 3E3BX 4II5A 2VJIA 1KYZA 2WQBA 3KRXA 2J0IA 2RFDA 4YPDA 5AM6A 2IGKA 5K4IA 2CN8A 3C4EA 3T3UA 3QYWA 4OW8A 1OL6A 3FI3A 2E1OA 1IGNA 1TNSA 5H20A 4EOLA 2OTJI 2GTNA 4M67A 3NZ0A 3DCFA 3L2UA 4BDJA 4CCLA 2GAUA 2EZHA 2WHBA 1ZN2A 2DT5A 3G51A 4WWCA 4WXDA 4HYSA 2Q2EB 3RDIA 3GEQA 2QQ8A 2VUMJ 2B55A 2DCEA 4OINF 1ZMWA 3NIEA 4BBMA 2K7LA 4QDVA 4AW5A 2GLOA 3DXJF 4DBNA 3I71A 1K79A 5LVOA 4KSQA 4CT1A 4KT5C 3V7CA 3CCUI 2BFYA 4DYMA 3GO5A 3QOEA 2WB1N 2LVSA 3PRFA 3NARA 2KPMA 5LRSA 4C33A 4M0ZA 3I64A 1LFBA 2Y0AA 3AD6A 2H1LA 3F8BA 3S0OA 3COIA 3W0QA 4O91A 4MFDA 2VX3A 3R9RA 3K1NA 1R22A 2EWNA 4PMTA 1XG1A 2DQ7X 3GC0A 4OLIA 3ZGKA 3SFZA 3PY1A 3QD0A 1P4OA 2CMWA 1T45A 3VW8A 2EB2A 2BIKB 5EHLA 3TUBA 3FLSA 4E93A 2BILB 2BAQA 4O0VA 4B7TA 3LCOA 2LYCA 4GU6A 3W2OA 4IAIA 2M30A 3FMKA 1UELB 3BE9A 3BWJA 3T8RA 3OZ6A 1POGA 4U43A 2AUHA 5FTGA 2ZM4A 3QA0A 4DGWB 3PA3A 4UY9A 1SVMA 3Q9SA 4IEBA 1GY3A 4K8AA 1YWVA 2MW8A 4XBUA 3WE2A 2B9HA 4C62A 3V01A 5C4KA 4QYYA 2F5FA 4V2GA 3GZ6A 4O82A 3ROYA 3BZ6A 2ACJA 4KRCA 3KXZA 3II5A 3NUAA 3HRFA 2JDVA 3Q0WA 2AQFA 3SDGA 3ZC5A 3FE3A 1GV5A 2DK8A 4OIPF 5KMLA 3RTRA 4HNIA 2WGJA 4U0VA 3TT0A 2UZLA 5IQBA 3B6CA 2OXXA 2QSGX 3P7BA 3ZM9A 3RTPA 3M8FA 3V8KA 1W7PB 3NAYA 4E7JA 3PIOF 1J59A 1T0FC 4CGZA 4I5MA 4A5MA 4IX4A 1B8IB 2RGVA 3PUFC 1O6LA 4AXFA 1APME 3ECHA 2Z9OA 3F2AA 3TNWA 4AGDA 4CFUA 1ETVA 1KE5A 4D55A 1XSXA 4G8XA 1GVDA 3DLSA 2HXQA 4PK4A 4EJNA 3EFLA 1SVLA 5HKMA 2ITXA 4C59A 3CF2A 1MBGA 4M6XA 3FV8A 3GT8A 4MIMA 5LD2C 3VS5A 4FTRA 3LA3A 5K5NA 4D7NA 4UUSB 3QYEA 5GIOE 3WYXA 3D5RC 4J01A 3FDNA 4JIAA 3QRFF 1H9TA 3U8WA 1DU0A 4D4YA 3AC2A 2IA1A 4CKIA 4A3LJ 3QRIA 5EG3A 5EK7A 2FOKA 5FKLA 3SZTA 5EM8A 1BMKA 2ISYA 4RX9A 1OITA 2KKOA 1STZA 2IS4A 1JJ6C 2C30A 1ORKA 4B6LA 2PE0A 3S2HJ 2B54A 1TW3A 3UOKA 3ZUUA 3HYHA 2JVHA 4FKRA 4MXZA 3ROUA 3LQ8A 3DB6A 5F0CA 5EF6A 1GHCA 2W99B 4IM2A 2WTCA 2DDAA 1S29A 1H9GA 4PFPA 4U5JA 2NNYA 4L67A 1YTYA 4U81A 5A2QZ 1JTXA 1DPRA 4BGQA 4FT3A 3K10A 4GSBA 5KAIC 3HZTA 2EWAA 5L3FA 2YHVA 3HEFA 5AJQA 5ANGA 1KE9A 4DITA 2VUWA 3VOEA 5IQAA 2A6TA 1OKZA 4RQKA 3VUMA 1XSDA 2LF7A 1MBEA 4JBQA 1I6XA 5FG8A 4GW8A 3PXKA 1TP4A 4FSNA 4BCIA 2EQRA 3D0EA 2LGCA 3DXPA 3ANQA 5K9IA 3BZCA 2WY8Q 2EV5A 5HLGA 3DLZA 5CAPA 2XAFA 3GCPA 4BTFA 1GV2A 2BHZA 1IRXA 2F4MB 3E5XA 3WGIA 3KC3A 2C6MA 3CC6A 1QPCA 5ICFA 5F4NA 1R0PA 4DTBA 3SAYA 4RVKA 3BYMA 5K3YA 4WUAA 2LMDA 3KA0A 1UHMA 2R7WA 4WBBB 4M6VA 4X6QC 4JMQA 4JX3A 1VQ7I 4DEBA 2R5ZB 2KLOA 1MDMA 3OYKA 2CQ7A 1X2MA 3DK7A 5IA1A 2OXDA 2EH3A 1QPMA 3W6JB 3W10A 2W1EA 2GSFA 2WV1A 3C1XA 3EQFA 4FNYA 1Q3WA 4QQTA 3TIYA 2UUZA 2C5NA 1W98A 3H3ZA 2YM3A 4OIOF 2V26A 2X6EA 4V0GA 4O0XA 5BYLA 3PFIA 4ZSEA 1K83J 2W24A 2W1ZA 2ELHA 5EM7A 3H9RA 2JMWA 4AYBN 3UIUA 5HDNA 5M3MJ 1V5FA 4ANLA 1JKKA 3BTIA 3T0YA 4QP8A 4F65A 1R1WA 3BJAA 3MFUA 3Q5FA 1A06A 2JUGA 3Q0VA 4MK0A 4O0UA 4I0SA 3U87A 4KA4A 2VWBA 1WZ2A 4KB8A 4AU7A 3G1MA 4F99A 1R1VA 4NKAA 5JN2A 3ZC6A 1WPKA 3G1LA 3O5AA 2K4JA 3NIZA 4DFUA 3E97A 3EZVA 4LLLA 1CGPA 2EJRA 1KQ8A 2BV6A 2VO0A 3W8QA 5TISC 3O8TA 2VB6A 2MC4A 4EONA 1WZYA 3V6SA 1ZARA 3SXFA 4F4PA 5F20A 2BGCA 3V4GA 1XMLA 3NUYA 3I59A 2C0IA 2ONLA 1ENHA 3HECA 2Y75A 5A46A 3A4CA 2VQCA 3TG1A 2G7HA 4HLYA 5B2LA 5IMXA 3ZMTA 4BQQA 4BDKA 4C3HJ 2ITPA 3E1SA 3RK7A 3UDZA 5FLVA 2V7AA 3OV8A 3C4ZA 4H58A 4ITHA 1FT9A 1OJLA 4OR5A 3TBIA 2R7FA 3R6XA 3ZFXA 3V8JA 4I01A 4EOSA 4HV6A 1XX5A 2I40A 3OCGA 5CQWA 3WTSC 1JSTA 1XN7A 3HRSA 2PZIA 4RWKA 3QTQA 5EDPA 4IH8A 3LM5A 1CF7B 4IFGA 2Z16A 4CCJA 3TJCA 2FBIA 3K9TA 1R5GA 2DLLA 3ZFYA 4LB5A 2L0KA 3KP4A 1ZOHA 4YR8A 3KP3A 3SG9A 2HU9A 4MAOA 2A4LA 1FPUA 4H39A 4HBLA 3JYAA 4PY1A 4O6JA 4FGRA 3D4QA 2FSWA 2F7EE 1SMTA 2WMQA 2PJRB 3OW4A 4F64A 3L8VA 2JRTA 4XRFA 5HIDA 4IIRA 3REOA 1FMOE 1AHDP 4M68A 2CDZA 3Q4CA 1FY7A 5HDKA 3S17J 4IADA 3E8CA 2DU9A 1HF0A 4XKWA 4OBOA 1Z3YA 1AKHB 4GIIA 3D7TB 5ILUA 3KP7A 4RM3A 1PYEA 4PJ0C 4FIIA 3AT2A 3L2WA 4RWJA 4IJPA 4GIHA 4JG8A 4NM0A 1YFHA 3C50A 4K2RA 4CCUA 5JQ5A 4S34A 4BIEA 4XRSG 3A01A 3GTMJ 3FY0A 1FYKA 2HQ5A 1OBDA 3S2DJ 4M0YA 4KKGA 2LG4A 2AXTC 4FIEA 3FZSA 4APCA 3HGYA 4XSZF 2NS7A 5A4CA 4KT6A 5IOYA 2WQEA 4G9YA 4A3KJ 4CTCA 4M12A 3OS0A 5HVJA 2WADA 4XRJA 4B48A 4XS2A 2PG4A 1WSUA 2UVYA 4C4FA 2EA2A 4A3CJ 1KE8A 1BW6A 1WVWA 3WE3A 4U7DA 1U46A 4RJ8A 4E4XA 2O0UA 4BRXA 1G2HA 2PMUA 3FEGA 4YO6A 2HCKA 2ZOQA 2OV7A 3R0TA 2IJMA 5F0HA 3GU4A 3F7WA 5I9VA 2VAGA 4L01A 3DB8A 3FKIJ 3R6SA 1CKPA 2ZV2A 4AWIA 3CD3A 1U4DA 4YNEA 4A12A 3MEXA 5CVIA 4OMYA 2GFCA 3TI1A 2DOEA 4ENJA 1OUYA 3BU5A 2XEYA 3Q5IA 3IECA 3LHJA 1ONVA 3HOYJ 4GKIA 1OMIA 3BZ3A 5CVFA 1YI4A 1A36A 2L9RA 3QP5A 5KMNA 4YJRA 4X0MA 2UZNA 1M52A 3P08A 3FDYA 5LRRA 5EW3A 3F0CA 2VTMA 4EYMA 3BT9A 1YW9A 2LKXA 3VIDA 2QYOA 2GQQA 5ANIA 4ZLOA 4LOQA 1YQJA 4CZTA 4BZOA 2XEZA 2X2KA 2EIJH 1M7QA 2CKPA 3KN6A 4A6DA 5M3FJ 5KAFC 4YFNF 3BC8A 1ZGWA 2XB5A 3AC3A 3AKKA 4BY9E 1ZRDA 2ITZA 5JFXA 2E2HJ 3EL8A 3R02A 2VE8A 4RIXB 1IDYA 4I4EA 2DFFA 3ZMZA 4NTTA 3PSCA 4FNWA 1PDNC 1OCTC 3E3VA 4M3BA 2BRBA 3ATTA 2OUMA 3F8MA 4O83A 2XV4S 4QNYA 3ZP5A 3RPSA 4H3BA 2EIKH 2JSPA 2E5NA 5F04A 4AVZA 4I99C 3CJGA 4LV7A 5CQUA 5HNGA 3QQLA 1U2WA 3F5GA 3KIOC 2IPQX 2XSJC 4LB6B 4CMOA 1H24A 1RR7A 4AT5A 3LZBA 3F61A 1SNUA 3S3IA 1YX5A 2PE1A 5BX0A 1RC9A 4XONA 4E7HA 4J97A 4RVLA 3WZKA 4BNCA 3NRVA 4YP8A 4L00A 3GVAA 4DQ2A 5LMKC 2QU5A 5AEPA 4QTDA 3BR0A 3OMVA 3W6VA 1NK3P 3U1DA 3ZZWA 4BICA 5D10A 1WMKA 5CAVA 2YJSA 5G6VA 4LITA 3F66A 2HR3A 2RFEA 5GP9A 1SFUA 2JQ7A 3CJQB 4L9JA 1ATPE 3GCMA 4IVAA 2WAQN 4FSQA 2PVHA 4D1SA 5DR9A 2ZDTA 3F9KA 2KIFA 4XM3A 3JRIA 3HUGB 3AD5A 4GS6A 4Z7GA 3ZRKA 4KIOA 3CP8A 3BDDA 4NIFB 3P5JA 4FKUA 4MF1A 2XAHA 4I41A 5DT3A 3ERED 3CR0A 2OTLI 3LOKA 3DV3A 5FJ8J 4O0TA 3I56I 4R5SA 3TO6A 1FNNA 3RI4A 3DJ5A 2DA4A 3F3TA 2GXBA 1U9OA 3S3OA 4QMQA 2RG6A 5D7AA 3E5UA 4W4XA 3CKXA 1Y39A 3RZOJ 2SRCA 4O86A 4GCVA 2W1OA 3ZXSA 3RVGA 4FKLA 5LJJA 5F08A 4K6ZA 5H3QA 4B09A 4BEHA 5E92A 3V5WA 1JLUE 4XOPA 1OUKA 3QRUA 4TN6A 4ZTSA 4RA4A 1QU3A 4I09A 3SQNA 1XBAA 1OBGA 3OBJA 1UU9A 2IZRA 3SA0A 3FLYA 1XGNA 4MXOA 2WTVA 2WB8A 3G6HA 4WIHA 2QGUA 2XARA 2ZM3A 4TY1A 4DEDA 5AUTA 2P5LC 3PP1A 4WG3A 4FG9A 4HF2A 2DYRH 2ZAZA 2PMOX 5ICPA 5JGBA 3R0JA 4OMZA 4DGLC 1JI8A 3NUNA 3LMIA 4LDTA 5EYMA 1HQCA 4EOMA 4HQEA 4FV4A 1YHSA 2QCSA 3V8SA 2I0YA 2HPMA 5DM7F 3KVXA 1URCA 2AQEA 3VS7A 5E79C 5CSVA 4PCQA 3W0RA 4CCMA 3HOZJ 4QMLA 3O3KA 4N4SA 3MFTA 3H5RA 5LLQA 2HYGD 1PMEA 4XLNF 4BCKA 5HS7A 2LDUA 2XPWA 3JRGA 3BR2A 5CZHA 2QEXI 2X7GA 2FBKA 5E8WA 5L2SA 1R3CA 5FBNC 3PDTA 4QPSA 3T8TA 1H8FA 4L42A 1ERDA 4ASDA 2ZJ2A 3CC7I 1PY5A 4AZVA 4E8AA 2FBHA 4BDEA 3UDSA 3M8JA 5DT4A 4QRCA 3DU5A 2HPIA 4EHEA 4F9CA 5KMOA 1UWHA 1MMAA 2QKLB 4DH1A 4XNFA 2PU8A 5FRMA 1KU9A 3GVUA 1Y91A 2XZSA 4KABA 4LRMA 3ZCLA 2HQNA 4XKBA 2HDDA 3MVLA 5CSWA 1K3AA 1ZYCA 1SVOA 3DEUA 3NAUA 2CUJA 3QAME 4FKIA 3S1HA 2ZVAA 4QMWA 1U9NA 1U6GA 3QXOA 4U80A 1O7FA 1SYKA 2IGNA 5IQCA 1BR2A 1JHHA 3OYCA 3PLSA 2R3PA 5BPIA 2P5KA 1V5EA 2W85A 2WKMA 2IT0A 3F3XA 5KZ0A 1KE6A 5CEKA 4IAFA 3DF8A 5LGNA 2R7DA 3F2RA 4OTDA 3HJEA 3NWSA 4IWDA 4A6EA 2BBYA 2B9SA 1TQMA 3HV3A 5CT7A 4G3EA 4RC4A 3RZBA 3BQYA 3QRJA 2IW8A 4BQAA 4ZYAA 1RJBA 5HG5A 4CRSA 1OPJA 3KY2A 2PTKA 5FLXZ 3GFMA 4G94A 3MW1A 4CCBA 2OU2A 2LH9A 4EUTA 3OY3A 3HM5A 4WG4A 3I81A 2GHLA 3Q5ZA 3AC8A 5GAEJ 3OEFX 2CU7A 4HVIA 3ATSA 5FD6A 1WI3A 3P9CA 3E6DA 5TO8A 3WARA 5M4FA 2H8WA 3DTCA 3P7CA 4JS8A 1KYWA 3BGQA 5HHWA 4HOBA 1FYLA 5LARA 2HOTA 4A3MJ 4IXAA 2E1NA 2DODA 4D7MA 4BDDA 4GT4A 5IUIA 1SNXA 1KOAA 3UYTA 2J0JA 1F0QA 1JT6A 4B9DA 9ANTA 5B3SH 2V7FA 2CGVA 2QBYB 2R7UA 3DGKA 1TL8A 4XMOA 3HOWJ 3Q32A 2I7QA 2PZPA 5D8LB 3E5AA 4I23A 3EMGA 4CFNA 1P9QC 5LEKA 5BVEA 1JPAA 3IKTA 3UIBA 1PUFA 4RA5A 2HYYA 3K5UA 2REIA 3UO4A 4X3FC 3KCKA 2XB0X 2RQPA 4JOAA 4G7OF 4I98B 4JBPA 4IHWA 1D0ZA 4IOCF 2ME0A 5AUYA 2QLQA 3BBTB 4X3FB 4WXHA 3ZONA 4ZTRA 2JBPA 1OZ1A 1XH7A 4DBQA 2OICA 5EDNA 2K3PA 5J1VA 3F6VA 4CZCA 3Q6WA 4A93J 2VTLA 2W1GA 3NUUA 5H2UA 4MYGA 3REPA 3QQGA 2J0KA 3H9FA 4C3FA 3FXJA 3DK3A 1HXDA 4XH6A 3LSMA 3LAUA 4JT3A 2CW7A 2C4GA 3R9NA 3UO6A 2L2OA 2XUUA 3UNKA 1XC5A 3EJ1A 3SZPA 3K6GA 4OBPA 3TV7A 4F52A 1HKSA 4FTNA 3UPXA 1HSTA 2IW5A 4C3JJ 2STTA 3LXPA 1ZLTA 2IW9A 5DV5A 2XKEA 2XNBA 1S7AA 2EVAA 3FM3A 4U42A 4PDSA 4KYWA 4BF2A 3V51A 5GJDA 5BUIA 2EXCX 4B1RA 4BBEA 4FKTA 2IZSA 2UVZA 1OGYA 2WMUA 3I54A 3IGOA 5JLWA 1WJEA 4Y5HA 1TT5B 2P5VA 5M53A 4ZY4A 4Q5SF 4FETA 3JSOA 1E3HA 4TL0A 1IAWA 2MSYA 3EUHC 1YG2A 1MDMB 4NHJA 4IJ9A 2J5OA 4EK3A 4KBKA 5ICCA 3OD6X 2H1KA 2CKOA 1O3SA 1JJ8C 2ESHA 2XAMA 4XL9A 4EK8A 2KDOA 2KDZA 2E2JJ 2XAQA 2XNMA 1LEWA 3UO5A 5BOXA 3GTGJ 4RG0A 5CZIA 5C26A 5T3QA 2JDTA 4FL1A 4O6EA 4GK4A 4BCPA 4Q5HA 3IAS2 4V0GB 5GHVA 4N4NB 1IN8A 4MQ2A 2X8EA 3AT4A 2V7OA 3HXLA 4FKQA 4S30A 3MJ1A 3UZPA 4NYEA 4O7NA 5A4LA 5JHUA 1X58A 4FE4A 3PP0A 2ZFWA 4E4HA 4XUFA 1JT0A 4Q5EA 3CCQI 4U9AA 2QNJA 4RVMA 3CDHA 3UMXA 3OR2C 2WAEA 4YJTA 2X6WA 2P81A 1XBCA 3CUOA 3JRHA 2I0HA 4RAGA 1B39A 2YZLA 3F8FA 1GLNA 1LEZA 2VI6A 4CCNA 5D6EA 4NFNA 2HY0A 1UG0A 1P92A 2OQGA 1ERKA 4AD9A 4F9AA 3OFMA 4PX6A 4ACGA 3V7RA 3MFKA 5HNBA 3HA6A 3I59B 2CJMA 3LFNA 3RKXA 4YNOA 2UW5A 5C4LA 3SDJA 5ETFA 5AUZA 5CALA 4E6QA 4F91B 4ZSAA 4BUPA 2OJIA 5GTHC 3KYLA 3A7FA 2QHNA 2NRYA 4DH3A 3VBYA 4O96A 4NW6A 4E4NA 1TFFA 4N9IA 4JBOA 1X1BA 3VYTB 5D5WB 1WKMA 4RA2A 3ALNA 4IZAA 3Q0UA 4C9YA 1K7AA 2BY3A 3GX4X 4PL5A 3EIDA 4OTWA 4EQMA 3MI9A 5GJFA 2ZO4A 4IF4A 2WTEA 2VBYA 1OCRH 3OYEA 4Y95A 5HI2A 3HSEA 5BVDA 4FEWA 3ALOA 3RK9A 3LXNA 5I9WA 2IRFG 4Z16A 2MH2A 3O7LD 3E7OA 2C1AA 4PUSA 2PVJA 4TW9A 1YOMA 1IV6A 3GCQA 3EKKA 5DRDA 3PA5A 2I0VA 4CCOA 3PWYA 3RALA 1R39A 3K3JA 2EFQA 2BVMA 2R3LA 4PTGA 4B8MA 3FBNB 4S2ZA 3N97A 1ETWA 1Z6TA 4EC8A 3OYNA 2OC6A 1U8BA 3KULB 4XR6A 1W82A 2JFLA 4D9JA 3VUIA 3R04A 4LMNA 2IVSA 3AKZA 1H0WA 4HZRA 2VGPA 3VVHA 2OD5A 3ZCOA 4II2A 3BL9A 5IP9J 2CRGA 4EQCA 4BDZA 1M7NA 4DEHA 1UG2A 3KMMA 1I27A 1MSEC 1QPJA 2FQ3A 1OPCA 3NUPA 3UBDA 4XRLA 3GZNB 5M5YJ 5DCMA 3VYSB 5C4JJ 3D2KA 4XP0A 2ZV9A 3A01B 3HUCA 2FE3A 3KEQA 2ZKZA 1IF1A 4FIHA 2VWYA 3VYRB 4PDOA 2YN8A 4FSZA 3LSPA 1JXSA 4DBRA 2IJLA 3DKOA 3W1FA 3LFFA 2ETMA 2B53A 5IYCJ 3D9VA 5JZJA 1P14A 4YC8A 1EKEA 4UUVA 5CXZA 2FH9A 4ZOGA 3A7IA 3BG7A 4OT6A 1KZHA 4HVHA 3BV2A 3U21A 5A6OA 3EQBA 4TWOA 3UDTA 3CF5F 2H34A 2DWBA 4C30A 4YTCA 2WBMA 4RGXA 3JCUC 3QUEA 3R01A 4XMYA 2X0LA 1HW1A 4EZ3A 2KRFA 3B6AA 2HEOA 2M4KA 3HHHA 2JZYA 2HYJA 4D4RA 4MTEA 2JT1A 1VQ8I 3F23A 1JUPA 2VWIA 3MH0A 2IA2A 5A4QA 3FY2A 3CXWA 2HVQA 2YFXA 5A6NA 3D5XA 3M8EA 5EQPA 3LXLA 1Q3DA 4YTHA 2OZAA 4I6QA 4B99A 1X1PA 4M15A 2Z1DA 3I3LA 4FTAA 5HG9A 4LQMA 2XBJA 4FX0A 3H35A 4XLFA 2DJIA 2RQQA 5HTCA 5JMSA 4UUTA 5B0XA 5EJCA 3R9HA 4EKKA 4EORA 2QI8A 2VOPA 1NTCA 2VU3A 2TDXA 2V9PA 2C0OA 3DKCA 4UXLA 4FSUA 1YXTA 3G73A 5M44A 3W16A 3EQRA 4BHBA 4QTEA 4YTIA 3DNDA 1WBOA 4EH5A 3AC1A 1YI2I 3EN9A 3EQDA 2QHMA 3WG9A 1NW1A 3HGGA 3F21A 3GTQJ 2M5WA 4GK3A 4MH7A 3QQFA 5CXHA 2EFNA 5HD4A 1YXVA 2QOCA 2AC3A 4Y8DA 2DMNA 4RAZA 3TOBA 1T38A 1PYVA 2JC6A 2L02A 4QMPA 2W06A 2XJ1A 3V5QA 2A3SA 5BQTA 1V0OA 1PF8A 3BX5A 1U78A 3VS3A 2C1BA 2QVOA 3CLYA 2R0UA 4F7NA 1MJBA 2QG7A 3RM7A 4RZWA 4L5IA 4R3CA 1SMHA 4CXAA 3SV0A 3ECOA 4M97A 5DHJA 3K4CA 3TGNA 2XKCA 3IDBA 3O2MA 2XRNA 2XIKA 3PY0A 2IVTA 4QP6A 3QRKA 5AX3A 5ANOA 2PVKA 2EZKA 2ZYBA 2ICWG 2C6IA 3TTIA 1H1WA 3L8XA 5C8MA 5L3EA 2VOOA 2R7QA 3LQQA 1FWZA 2XRUA 3HV6A 4DEGA 1S9HA 3CMMA 1ETKA 4Q9SA 3FSKA 4DH8A 4IQ6A 1YOVB 5CI7A 4FV3A 1MNEA 1SANA 3BZKA 3CGOA 1I50J 2B1PA 2HGCA 5E90A 4BZNA 1REPC 2DBBA 2G01A 2OG8A 1ODDA 4A4OA 2OCCH 4NW5A 2KQRA 5BUJA 2UW3A 2A07F 2C47A 4ENMA 3P5JC 5TT7A 4F09A 1WCCA 2ZM1A 3MV5A 1YW7A 2PMZA 1Q4LA 2J6MA 2Q0NA 3QU6A 2E2BA 4ENNA 4EYJA 3JRBA 1LQ1A 2EZIA 2BYVE 3MKYB 2FSMX 3O71A 3AGLA 3NNUA 3UJGA 4DBXA 1QPDA 4IB5A 4DNCA 4CICA 3JUHA 1VQNI 1B9NA 4DGOA 3WTTC 3IW6A 2P55A 4FV9A 4JX6A 5EKNA 3OF0A 3ZEPA 3TACA 3U6JA 3TTJA 1HA8A 3FI8A 1ZY5A 3UVPA 3HHGA 4BEHB 4IDTA 2CGPA 4KIGA 2H09A 1IA8A 3HZJA 5FKMA 5A2QK 5IG1A 3V5LA 3IUOA 2CCHA 4Z6YA 4MO7A 2FSTX 3IAM2 1JKLA 4GDFA 3C4WA 5JQ8A 4HG2A 1JKQC 4UV0A 5CU2A 2MYSA 3DQXA 4P4CA 2PVFA 2PULA 4EJWA 2X9FA 3FMSA 3W2QA 2CO5A 5J4VA 1RUOA 3RWPA 3AG1H 1DPUA 3P7AA 3ZXTA 3GBGA 1NXKA 4R8HA 4MD8E 2F6CA 4WRGA 3UC3A 3WTVC 3GFEA 5D8KB 4BIDA 3CCNA 3QUPA 3HPHA 3R7UA 4GVJA 1XTAA 2F2CB 1OYWA 3VBVA 1B1BA 3M1CA 5E1WA 4GUEA 3JRCA 3I4MJ 3WGGA 4CH7A 4BE2A 2W7NA 1YRNB 2JKMA 5M4IA 3TXOA 5ACKA 3R60A 1S6LA 5AV1A 1P4XA 5I9UA 2F7XE 4LIVA 4GT3A 5ICEA 3OIPA 1Z21A 3LE6A 3OSFA 3QQJA 1OIRA 3JVRA 5HCYA 1F4KA 3HP5A 4IVCA 3IV5A 4CV8A 4F6WA 2KISA 4FKVA 3QALE 1SC7A 3KRLA 3QUDA 2XYNA 2CW8A 2XF7A 2O6GE 2YDIA 2XHKA 2GDOA 1W36C 3RMFA 2PHKA 2NYXA 2QOLA 3GEZA 2LY1A 4PJNA 3G90X 4RBOA 4PUZA 4I4FA 3D15A 4WNMA 3J81Z 1BC8C 2KIUA 3BYSA 5FXRA 2WQNA 2E9VA 3ZLWA 3U6IA 4PMPA 3OEZA 4HOKA 3ZO3A 2XS0A 1B38A 3I5NA 5HE0A 5FLFA 2W00A 3RQIA 4L0YB 5F1ZA 4X6RA 2JKQA 1YOLA 5CEOA 3TYKA 2DK5A 5A4EA 4FV6A 4AZTA 1BR1A 4HW7A 4F0IA 3PJ2A 2R7VA 3UPZA 3ZH8A 3OS1A 3P7NA 4C3IJ 1IC8A 3QXPA 4AP7A 1IAJA 5FDPA 3VEPA 4EV0A 2YA9A 2JK3A 2L7ZA 4CEGA 5DT0A 4L9VA 2A68F 5IQEA 1SMYF 4IWPA 5J1RA 2P2IA 3IL2A 2CKEA 4FEUA 1BI7A 3NW5A 5D41A 4IX5A 4B47A 4B4LA 4R3RA 3PZEA 2XJ0A 2C0TA 4YO4A 2I6LA 4P9UA 4YIRX 4L3PA 1BLXA 1IA9A 1ZZLA 3QPLA 3BTJA 2VTRA 4QMUA 3IDPA 4A4LA 3KQ7A 3NW7A 4XORA 1DI8A 2FEZA 3FMLA 1REKA 2XCKA 2R7IA 1UVRA 2YJRA 4YBJA 4BZDA 2ERZE 2VPLA 5E8UA 3THBA 3OYBA 4JDHA 3E3PA 2VLAA 5AAEA 2EU9A 1J1BA 1MUOA 3ORZA 2C6TA 2KULA 4D5HA 4MTDA 3KCCA 2ZJRF 3WIKA 5E20A 4EHGA 5ACBC 3CQWA 4PP9A 4E5WA 1WH7A 4MBJA 1T56A 3RIRA 2ISZA 2CQXA 1RDQE 3AMYA 3KFAA 3PVWA 1B72A 4L8MA 5L2IA 4YFXF 1UHWA 4XN3A 5ITAA 3TKIA 3OL3A 4KDPA 2BZHB 1VQMI 3NPCA 1MQBA 4ANJA 2BCJA 3SHFA 1PUFB 5D5XB 4J96A 4BHZA 3X2QH 2YR2A 4A2UA 5EOLA 5CANA 3VQUA 4AN2A 1ITYA 3IH2A 2R2PA 3BR1A 2PVLA 5GPAA 3KMUA 2GXAA 2L7FP 2VWWA 3NGAA 4RLFA 3J7AY 4O0RA 1QPEA 4AIKA 4BCGA 3UTOA 2IS2A 3L2QA 5JVGF 3TZ8A 4KMFA 2VTAA 3E92A 4I20A 3QTUA 3QOPA 1NG6A 2UVXA 5FM3A 2O5RA 3JREA 1IDZA 3QU0A 4AGUA 4EK6A 1GZOA 2WMTA 3RI1A 4ZJIA 2WAJA 2XGXA 2ITTA 2Z60A 3SC1A 3PSFA 3G15A 1YXUA 2RL5A 2Z2SB 5IH4A 2YCRA 4BS9A 4BHPA 5FP5A 5JRSA 2VXDA 3HSRA 2W1HA 4FYOA 2QO9A 3HDNA 4ALWA 5KE0A 4CTBA 4YU2A 4U3ZA 4K33A 4X0GA 2BKKA 5EYKA 2ZXJA 3OOUA 2Y0MA 1FLIA 5TR6A 3K3IA 3MFSA 3Q3SA 5IT9Z 3BTCA 3GGFA 4I92A 3RAWA 4ZZLA 1NVQA 2QODA 3TUCA 5JI6A 4LI5A 3K1MA 4AIDA 5HIBA 4QTCA 4ITVA 4HF1A 5EG0B 2ITUA 2X51A 2E1CA 1UKIA 1AU7A 3H5AA 4ERWA 2GM4A 3K2LA 3V5TA 2X6YA 5J8CA 4CYCA 3D5VA 5K7FA 3R1SA 4NWMA 1KA8A 1N75A 4G6TB 4C2MJ 1U3EM 4DHJA 5HODA 1S9IA 1TC3C 2J5EA 2FMYA 4OTFA 1OIYA 1RKTA 2M2EA 4J00A 3ACKA 4IM0A 2VWVA 2JA7J 1GDTA 4BTMA 3U1KA 3SX9A 4APPA 1OISA 4E6CA 2B63J 1O6YA 4YUQA 3CQZJ 1JQHA 4MX9A 5AP7A 1FX7A 4FEXA 2F5VA 4EWQA 2DMUA 1ZTRA 1Q41A 4MXXA 4DAWA 5IPJA 3EUAA 2UUEA 3VUDA 2K27A 1P4FA 3BQZA 4KNBA 3LFKA 2EV6A 2UW9A 4AM3A 4WRSA 3CD6I 5D9HA 4EH6A 3R7IA 4H0EA 2V62A 2IZTA 4W8DA 4D0WA 1SAUA 3TJDA 3ZO4A 2K9NA 2B7AA 3ORXA 4WT6A 3IKAA 3M11A 1J2XA 1VQ4I 1SVHA 5AUVA 2BRHA 3LCTA 1F9NA 1EH7A 3BEAA 1Y8QB 2QR7A 3VS6A 1DI9A 4E4LA 3I7CA 4RIOA 1YS7A 3RSNA 4U87A 4P55A 3A2KA 5E1EA 3CBLA 3QTIA 4ZH4F 1A5JA 4QEBA 1LR4A 4U8ZA 5HESA 1VZ0A 4FEQA 5HU3A 4Q4ZF 1ZGJA 4LRKA 2R3HA 5A4TA 3FMQA 3R7YA 1GNGA 5HLTA 1N25A 2OKRA 2RV8A 3MTFA 3AKLA 3BHTA 1A9UA 2VPRA 2NVXJ 1PXIA 3F6XA 3W0PA 4Y5QA 2NVYJ 5JEBA 4P90A 4ESJA 3NYOA 3UVRA 3S14J 4FTOA 2NRUA 2DW4A 4BYIA 3AG3H 4L7SA 2OU7A 2W7XA 3IK3A 4IHTA 5IZFA 1YW8A 2PUNA 1PMNA 3QODA 2WMAA 3K4LA 2BDWA 2V1XA 3KX2A 4FV0A 2X4FA 4IJAA 3BIZA 4D4VA 4PTEA 3TV4A 2BZIB 1S72I 1Z9CA 3KETA 1YIJI 2MGQA 1J5YA 3PQJA 2HQRA 5I5ZA 3BELA 1OR7A 3LXKA 4WOVA 1QHGA 2MBFA 3R22A 3UE4A 1V54H 1KUTA 4DG2E 3O17A 2F4JA 1Z77A 1XO2B 2CH0A 3R8VA 3DBRB 2P8TA 3VSKA 2W4OA 5DCMB 4EM1A 4RB3C 2R7ZJ 3G0EA 4G6NA 4MD9E 1T8IA 2UZWE 2WQOA 3WZUA 1FBNA 3ZN1A 4JQ8A 4OIQF 3PFQA 4AOTA 1XKKA 4HYHA 4USEA 3GLLA 3W8LA 1T33A 4AZWA 3RJPA 2YISA 4BDYA 5CU6A 3GCSA 2O0YA 3R9DA 3HOSA 4O7RA 4F7LA 1UNLA 1BI1A 1K2PA 3JRFA 3S8PA 4ZDLA 1IUFA 4JAIA 2BZTA 4IC7A 2BHHA 1WI9A 2R64A 3NMUF 2EA4A 5E8XA 3HB9A 2JRMA 4N6ZA 1EV7A 4PF4A 1V55H 3U54A 3HUBA 1HKTA 4DH7A 4R78A 3PO2J 4Y3OA 5G1XA 3BWFA 2YPRA 3PXZA 4AS0A 4EL9A 2GS6A 3VODA 1ZXEA 1IN6A 3L8SA 1GZKA 4O38A 5BMSA 4RIYA 1FOWA 2YCFA 2KZVA 4RGSA 2DFIA 3J7YJ 2BALA 3PIYA 3I1AA 2OZAB 1XHAA 5E8ZA 2QM3A 2JN6A 3OYAA 4RGRA 2QOIA 3S3NA 3WILA 3Q52A 1ULYA 5E8YA 3DKXA 1WVXA 5KKRB 1SD5A 1BYGA 2YAKA 2RIOA 5J1WA 1ETOA 2CW0F 4DEIA 1ON2A 3VBWA 2L7MP 2ZB0A 4QQJA 4WX9A 2FVDA 3OOMA 3JR1A 4Q48A 4G3GA 1ACIA 2I0EA 2YM6A 1R36A 5IQGA 4CYDA 3TUDA 4X6AJ 4QPAA 2AYPA 2Z3YA 3ZDIA 1F36A 3BQRA 5AV2A 4UXNA 3KEXA 4KA3A 5H6RA 2XAUA 2GZWA 4UV9A 3AGMA 2AHQA 3LQRA 4J53A 3FMRA 4M7IA 2PMLX 2K3FA 4M9SA 4AW2A 4OT5A 5AWMA 3A99A 2GNGA 3S93A 1QMZA 1MGTA 3MD2A 3BU3A 3M9AA 5FLMJ 2X9DA 1H01A 4QYFA 2R3SA 3F6OA 3EN5A 3PYYA 4AAAA 1BUHA 1ETQA 4XNEA 3T9TA 4JNWA 4GJ3A 1JHFA 4MXCA 3U6HA 1Y8GA 4LK0F 3KCFA 5IEXA 4A3JJ 4QPQA 5IP7J 3ZQCA 4KSPA 2CUEA 4EBWA 4QMTA 5IUGA 3C13A 5K5QA 4UZDA 2NPQA 5FLXK 3EN4A 1SFOJ 3MTLA 3BYUA 3C1DA 3GF2A 4O0WA 3HKZN 3UZRA 4E20A 4RFMA 2QENA 4L6QA 4G6OA 4XICA 4JAJA 1QRYA 1Z05A 5GPCA 4WNPA 1NK2P 4FODA 1FMKA 4F9YA 4JXFA 3C2GA 1LFPA 5HZNA 3QRTA 4FYNA 3U4WA 3TZ7A 1ZG1A 2PL0A 2VGOA 3MZHA 3PG3A 3OMYA 3ZOSA 2A1AB 3E88A 3EN7A 3BU6A 1FVRA 2O64A 4IBMA 2F5CA 2F4IA 5BMZA 4GUBA 3BHYA 2RREA 3ELKA 2HTJA 4N0BA 3MKZA 2BXZA 1YJ9I 3BV3A 3L2RA 1IZ1A 5HO7A 1FMVA 4EEFG 4MNEA 3FHNA 3H92A 2HXIA 1R6RA 1PJKA 4X1EA 2CS3A 3QZIA 4O7SA 3HOUJ 3OXIA 3L2VA 3WG7H 3SJMA 4TT7A 3CJTB 2MLKA 4ZDPA 4EZ5A 4KIPA 4XIDA 2ETRA 4JJRA 4AU8A 5E8GA 2F48A 3CCJI 3N05A 4BIBA 4QMXA 4DINA 4ZSLA 4R3PA 2IZUA 3F3UA 2WOUA 5JGDA 3EDPA 2GTMA 3OIOA 4K9YA 2UZTA 3RKWA 2DYSH 2CV2A 4UWBA 4E7LA 1XGOA 1FTTA 4JX7A 1KU3A 5M5WJ 4CKRA 2HOAA 3D1NI 3KK8A 3CSVA 3RPUA 2J50A 3QHWA 4ASXA 1F5QA 3DTKA 2GIVA 1SD4A 3S1MJ 2OJFE 5F27A 5KBQA 4QTRA 5EH0A 1SVEA 4DFBA 4LV5A 1PRYA 1WJAA 4CG8A 2VJJA 3CCLI 3QC9A 4KN7X 2GWRA 3QPHA 3RPQA 1UU8A 2BTSA 4MXYA 1JTYA 1X19A 1LB2A 4ON0A 1BOAA 4PWNA 4CGAA 2QOQA 5M4UA 3FKJA 4K1BA 4HYIA 4HDUA 3OVVA 1Z7UA 5EQEA 2JJ7A 5AA9A 2UWMA 1X4OA 5FGKA 1BR4A 1Z5MA 1BJAA 3C4XA 3EETA 4WO5A 3NWWA 3ZEWA 3KF4A 4ZYDA 1XSVA 4NC6A 3CC2I 5L8JA 5E17F 3TDVA 4AXAA 3CDLA 1C0WA 3CP9A 3PFYA 4FISA 3OUKA 3KP5A 3CJRB 1KWPA 2QR8A 2YWVA 5LGTA 1WFXA 3POOA 3LAJA 3ULIA 2Y9YA 1DAYA 2XNOA 4NM5A 4E7ZA 1FC3A 2DT6A 4F55A 3UYSA 5D5VB 3ELJA 3NYNA 2R7SA 4A07A 3VRYA 5DI1A 1UWJA 3R83A 1J7IA 1RRJA 3F2NA 1OCZH 4QP4A 2NNNA 2WMVA 1NH3A 3NAXA 5I0BA 5FFZA 3CIKA 5IY5H 3CCRI 3UIXA 3H3UA 4L45A 2DA6A 3HV7A 4FV7A 2Y2ZA 1STCE 3PVBA 4DDIA 4IC8A 5CAQA 2VC0A 1I1GA 5BVFA 2Y0SN 3G5DA 2RNGA 4M3FA 4JL9A 5HNFA 3KP6A 1O3RA 1EH4A 4G17A 3PQKA 2X4HA 4XG3A 3RQ4A 2X81A 3NFGB 2JITA 2R3KA 3FI4A 3H3CA 2V6EA 4PJJA 5D4SA 5HICA 2DQRA 4I0AA 3ZFMA 4U45A 4V04A 3Q9YA 4ALVA 2J51A 4BJJA 3PL8A 2XSDC 2HFHA 4LRJA 1D5YA 2ETHA 2LNBA 2D1VA 4DTAA 3DZOA 1QZEA 2TRTA 3MDYA 5AIQA 3GBZA 3C0HA 4FSMA 4S32A 1GUUA 1NVSA 5DVRA 2VTQA 4IX6A 3VF8A 3ET7A 2C69A 3LQ5A 1JKTA 4HGEA 5H8EA 3L09A 1I1SA 2PZRA 2E1MC 5HX8A 3IHUA 3DFAA 4YEJA 3DKFA 4LOOA 2E1MB 5M09A 5K7ZA 3MWUA 3IKVA 1CDKA 3VC4A 3VF9A 2CV1A 2J0MB 5LHGA 3PSIA 3ZS5A 1ETXA 5TKDA 4LOCA 5AP4A 2XKOA 3ESWB 2NAZA 4QMZA 4C2TA 3PJ3A 4CZZA 3MA6A 1B72B 3CGFA 3CCVI 2HZ4A 3SGCA 5JFWA 5DH3A 3I60A 4XQFA 2QOBA 4AT3A 4BKXA 4FT8A 2QOOA 5AIRA 4RT7A 4I24A 5IDNA 4MCVA 4X2FA 4V05A 1FQ1B 3TN8A 2K9QA 3E5QA 4F78A 3I58A 3HL7A 2F2EA 3UNGC 4ZTJA 5EEAA 2VO3A 3MPTA 4NM3A 4ENXA 5HU9A 5IUHA 3MH2A 4FKOA 4QMMA 4AN9A 5L8KA 3CTJA 2GQGA 4BXUA 1BM9A 4M6YA 4U0YA 4TPTA 4DDGA 5B1BH 4O3MA 3FMEA 1OB3A 3MGYA 2HDCA 3JTHA 1XMXA 3LNQA 2UW7A 3NLBA 2Y30A 5IQFA 3OOPA 2QONA 4F93B 3OYHA 3C4CA 4N70A 4RB2C 3NQOA 4FT9A 5EI2A 3HBLA 2XAOA 2HWVA 4HX4A 4JI9A 4C3RA 3C0GA 3LSKA 4BQOA 5LVPA 2J7TA 4FTMA 2JKKA 2YZAA 4YRVA 4BU2A 5EEHA 4IE9A 4A9YA 5CAUA 4JDKA 1IRGA 3VFZA 5BS6A 4IAZA 2ZMEA 2PWLA 3E64A 3S2PA 1OL7A 3LL7A 1YLFA 2ZFYA 3TNHA 2C6OA 4GVAA 3R1YA 4FG8A 1PYXA 2W82A 4LOPA 4IHVA 1XJDA 3OC1A 4TWPA 2I8DA 1UNHA 2E19A 5B7VA 3TP0A 2MH9A 2JA5J 3JSPA 4GRBA 4HW0A 2IXSA 1Q8UA 1QVUA 4NQWA 2LLKA 4C2VA 5LCKA 2HZNA 4QIWN 2K4BA 1HSJA 1JUSA 2G15A 4J98A 2XNEA 4F1OA 1TTYA 5E18F 2AEGA 3QGYA 4ID7A 1MH4A 2YEXA 2ADUA 4NU1A 1VQKI 1A31A 5J40A 3S00A 3CKWA 3MYGA 5E8SA 5GJGA 3G0FA 3EZRA 4GFBA 4AQKA 1W84A 4RC2A 1PKDA 4BJ6C 5IYBJ 3UVQA 1Y6IA 3B2WA 5ANJA 5M56A 3VULA 4Z3VA 3QX2A 4ABZA 3IOPA 5CPRB 4RFYA 4M84A 5EI8A 4G31A 3TDUC 3LWFA 4Y7NJ 3HL2A 1UB9A 4RX7A 4RZVA 3KF7A 4U0IA 2GS7A 4HGSA 3ULQB 2STWA 3IQ7A 3PXFA 2V9KA 3EYIA 5BNJA 1UKHA 2Z8CA 2GNLA 4RAYA 4JX4A 3WGHA 4JBAA 5CF5A 4R1VA 4HJOA 2VC1A 2P7CB 2ITVA 2H9VA 4G6DA 3MVJA 3TZMA 4B8XA 4IL6C 2W5BA 3FZTA 3PRIA 5JLXA 2IS1A 4C35A 2VIXA 4C0TA 5KNJA 1D5VA 4BB4A 1FIPA 3ORMA 4BBSJ 4O7YA 2ESMA 4FUYA 4OIRF 1J91A 3ML1A 3QPSA 1DGWY 1HW2A 5CSXA 4XK4A 2DXIA 5CX9A 1LEBA 2QSFX 1Y6AA 3OR1C 3AG9A 3J7AO 4DG3E 4I21A 4FVRA 5HG7A 3LLAA 5JRQA 3L9NA 3GOKA 4EOQA 1R4MB 3E87A 1XQZA 3FQEA 2HELA 2JEDA 4FX4A 1REJA 3SYTA 4YPSA 3E7LA 3DTIA 2OH0E 5HLPA 3WF8A 4BCMA 4AIJA 3AC4A 5LQFA 4JDIA 5CENA 3PNYA 3QCYA 3J80Z 4E73A 3DPKA 4O7LA 5F64A 5HVYA 3O8PA 3AKJA 4L5JA 3CESA 1DAWA 4DHZA 3DBEA 4QDEA 2XM8A 3OTUA 2Q2EA 1ZLJA 4P9FA 4FX3A 5FTQA 3QLGA 4RSSA 4RGJA 3R30A 4HAMA 3KE2A 3QWKA 4KNYA 5CY3A 3QQHA 3VPRA 2HOSA 1KQ9A 1BKXA 3R4KA 3O2PE 2P2HA 5J9YA 2Y6OA 2VBZA 5JKGA 4RC3A 4FK3A 1OR7C 3SRVA 2LREA 1WHUA 1JUMA 4ZC3A 4DGGA 5M5XJ 4EZ7A 2V6CA 2OZOA 4KUMA 1WVRA 3DPLC 2XJ2A 2VO7A 1L3RE 2VTNA 4JG6A 1Y57A 3UNJA 5LHIA 1ZH5A 3VBXA 2DT7B 4G3CA 5CEPA 5DM6F 1MP8A 3NUXA 1I6HJ 5M57A 3QP6A 3VSLA 5DR2A 3MFRA 4CHUA 4AZEA 3TWJA 4I5CA 5F1RA 1Q61A 2VZ6A 5JHFA 4PZJA 1MBHA 3D5LA 4I6BA 4ZLZA 3RZDJ 5AP2A 4BY1J 4ZTQA 3COKA 1MBJA 4HQMA 2CLXA 3FXKA 4HNFA 2CN5A 1BBYA 3GP0A 3DXNA 2JKOA 5CJ9A 2EB7A 3EYGA 5HO8A 3D5UA 1JSVA 4CFFA 3C0IA 4USFA 2O3FA 3WZJA 3FC2A 4FTKA 1WJCA 1JWHA 5BVKA 4JRVA 3OYGA 3A0HC 3HIFA 1I39A 1IO2A 2XF5A 2DTZA 4YZDA 3MVHA 3QWJA 3BKBA 2IVUA 4IHPA 5DLSA 4E1ZA 4CVAA 4HNTA 4L46A 1TQIA 4ERKA 1GIJA 3VUGA 3CY3A 4LG0B 2X2LA 1W7PA 5HVKA 2IGOA 2UW6A 2MLGA 5ED4A 3V8TA 2W48A 3OWKA 4F6UA 5IEYA 3HMPA 2FXAA 2Z7LA 2GXGA 5IQHA 4PMSA 5K4JA 3KKVA 4RIYB 4EH8A 4I0TA 5E8IA 4F6SA 4G1WA 5CLSA 5ETIA 3EYYA 4KS8A 1WBVA 1I5ZA 1JKOC 4EEVA 3QZHA 4FT5A 4FMQA 3PJ8A 2IG7A 1G8KA 5ILVA 4RFZA 2A19B 4MBLA 3R8UA 3HDMA 2DPDA 5E7RA 4UX9A 3BGZA 1H1RA 4I94A 3UKGA 3WE4A 4FBXA 3GFJA 4CZUA 5ANEA 5FXSA 4CUGA 5E1XA 3K4BA 5HIEA 2W9FB 3A03A 3PO3J 4R77A 2YM7A 4AZSA 2UZVA 2BHYA 3GCUA 2MABA 3DTEA 3RKQA 3VHEA 4LFUA 3KU2A 4F1TA 3NWTA 2X48A 2Y31A 3TDWA 3O23A 4L0ZB 4H1MA 2YAAA 3R8PA 3VUHA 1MRYA 2XK4A 3MY5A 3L9FA 2JA6J 1VYZA 1URWA 4FTUA 1V3FA 4MWIA 1AQ1A 3SVVA 2YABA 2E35A 1E3OC 1IXRC 4RQVA 3H1CA 3GTOJ 3R73A 4LL5A 3KRJA 3OY9A 4P96A 4ITJA 5DE2A 5FROA 2HS5A 1H26A 3KB7A 3PY3A 2X85A 3BLYA 4PGGA 4UVBA 3JTGA 2OZUA 3GB2A 4QP2A 2YIXA 4RJ5A 4BYJA 1AGWA 3FXUA 3A8XA 5A14A 1W5CC 3BCEA 3W0OA 4AXEA 4MUQA 2X1CA 5M07A 3O8GA 3N4MA 1L0OC 5E4HA 4AXDA 4A3DJ 4G2FA 4R79A 4BVUA 4A3FJ 1W36D 3CS9A 4CXFA 4Y52J 3WYYA 3HRMA 4C3PA 2C5XA 4RJ4A 3BG6A 5K5RA 4HPTE 4HYUA 3GFIA 3F3WA 4JRNA 5HD7A 3HMNA 4EOJA 3J7ZI 1FTZA 2L7KA 2CKQA 1GIIA 5CKTA 3EOCA 4TKSA 3W2VA 2P0WA 3FWEA 1ZOGA 2R5ZA 2PUIA 2QO2A 3RHKA 1R9TJ 3HMIA 2VKDA 5CEIA 2HIWA 5ANKA 3ENMA 2DDBA 3CCMI 1T46A 3R21A 2GMXA 1MNMC 3K0LA 4ZXTA 3HOVJ 3IW7A 3OSGA 5C1QB 4GCJA 4TZRA 4BAYA 3G33A 3PA4A 3MBLA 5AP0A 4G16A 5DDGA 3A62A 4OAYA 1MRUA 1E17A 3WU1B 3QZGA 4MNEB 2BDFA 4IB0A 4MTAA 3PXRA 4O2PA 1DDNA 4YZBA 3ENHA 4QMSA 5LMBA 5DA3A 4BE0A 2C3IB 4CFVA 3R28A 1KU2A 3QQUA 5HE1A 5AADA 2OJ9A 1QA6A 2OBPA 2W4KA 3EFJA 4NSTA 4NZWB 2OH4A 1RESA 3ERKA 1D1CA 4PJMA 4AVPA 4EVIA 3G4SI 4N9HA 4R7BA 2R3NA 3KZZA 4KBAA 1O4XA 3I55I 5EI6A 2X1DA 3LSJA 1Y8YA 4BE1A 5L6WL 5LVNA 4IM3A 3MQ0A 2VONA 3DT1A 5IA0A 2M45A 5IQIA 4PFOA 4L68A 2QLZA 3KZYA 4UB6C 4H3QA 1DS5A 3R9OA 2QURA 4BGHA 3EH9A 3CZ6A 3OROA 3AFHA 3OWPA 4XJ0A 3KZIC 4PTCA 1OIQA 2C6KA 2ACXA 1TZLA 5BQ0A 3PUPA 1OCOH 3ZOBA 3L1PA 1NT2A 4AE9A 3GTLJ 4GKHA 1KOBA 1K61A 1XMAA 4AAYA 5M51A 3KEOA 5FD2A 4GH2A 3OYLA 3HPGA 1Y0UA 3ASOH 4X3JA 5HS8A 5IT9K 1JAMA 2WOTA 4ZZOA 2H6BA 4NCTA 3PPJA 1YITI 1O7LA 2O8KA 5L3DA 2JDRA 2ZB1A 3Q04A 2J2IB 2FYSA 3KGAA 3CLQA 3TCPA 5HDGA 4WNKA 3DJ6A 4PSWA 2YIRA 4IX3A 3UDBA 1E1XA 4OUCA 5LBQA 3FI2A 3BYVA 2DQLA 3ORPA 3TNQB 3GXLA 3MJ2A 3Q2JA 2EV0A 2Q8KA 5BVWA 4DTKA 2WELA 2X6XA 4HX8A 3A60A 2LY2A 2L9SA 3H9GA 3PM1A 2R3MA 1TLHB 2YUSA 3BTLA 1YKRA 1CMKE 4FE2A 2BEOA 1Q24A 3C2BA 2CFXA 3V04A 4G7ZF 2PJRA 1H8AC 4P7EA 3DLLF 4F0FA 3PE2A 4EOPA 3H30A 2L3DA 3DEWA 2DOAA 1Z0XA 1LUJB 2O3PA 1W0XC 2CNVA 5DNRA 3OG7A 3BPXA 2YU9J 5J87A 3WTUC 1FBSA 1AKHA 2OZ6A 4TYHA 2G7UA 5GINE 4DEEA 2LD5A 4ANQA 3RYRA 3LFSA 3WTYC 2BVLA 4QTAA 2DOFA 2IP2A 3FK7A 2ECCA 4ZTNA 1K6YA 3VAPA 5CAOA 1KE7A 3ZUVA 2ITYA 2D2WA 1KGSA 1FGIA 3W2RA 5CF8A 4FOCA 4K11A 4BJJB 2ECBA 1H0VA 2OJJA 2VKEA 1SM2A 3BBWA 2COMA 2A27A 5AAFA 3BQCA 1Z1DA 4MNFA 3EKNA 4RM2A 2AC5A 3L2CA 3NNXA 4NH1A 2QQBA 4BJTA 4WKQA 2WU7A 5L8LA 4EQQA 1XH8A 4YZ9A 3QYBA 2J4ZA 4IEJA 4XKVA 4H4KC 1FZPB 1OI9A 5EYDA 3WTXC 2WEVA 2IVVA 1F3MC 1XH5A 5A9UA 3LMHA 4U44A 4WSYA 2VE9A 5TOZA 2JVGA 4X2JA 4I6ZA 3P23A 5JT2A 1T2KA 5ICGA 5JK3A 2UZDA 5BVOA 3RCJA 2QKRA 4RMZA 4ZSGA 1ZYLA 4FSTA 3H9JA 3KYCB 4JQFA 5T68A 3E6MA 4NJ3A 3PXQA 3FX3A 3K4JA 1G59A 2XPUA 1NA7A 3QGWA 4XV3A 3LFBA 2HENA 1LE8A 3K54A 1W0TA 1W5TA 3NVKI 3FQSA 3QZFA 1PXNA 3RPVA 4DFLA 2R4GA 2EINH 3AMBA 4HSTA 1FOYA 5DIAA 2LOOA 5C3EJ 3IG7A 1GAGA 2GFSA 2HY81 2E9PA 2XVCA 5ETCA 3FHRA 5FQDC 5HLHA 2BY2A 4IPAA 2IGMA 4IKFA 3FWQA 5DEYA 5J6XA 1RQQA 2JA8J 3IH4A 4C4HA 3OXZA 2XYUA 5HE2A 1UJ8A 3G6EI 4QYGA 3K70C 4BACA 2CSNA 2GNJA 3NNWA 4W4WA 2OF7A 4Y33A 5TJJA 3QTXA 4HGLA 1QZZA 4X7QA 5CNNA 3VS4A 3UZTA 1M1EB 4B8LA 1K4TA 1YJWI 2G2IA 3GU5A 4I22A 5CSPA 1MMNA 5AAGA 5L6OA 4DOZA 4I6LA 3P4KA 2CJJA 2PUPA 2ZMEC 2Q1ZB 2NS8A 3LIJA 5HVQC 4YHFA 2FRHA 3QKKA 3LSIA 5F6FA 1FPQA 2ZMEB 2OWBA 3LM0A 5AUUA 3P9KA 1RPWA 4RBLA 2CNUA 1R5HA 4UWYA 5DEWA 2KJCA 2WTKC 3LKMA 4PQNA 4AGWA 2Z7SA 3KIOA 5J5SA 3H0DA 2L54A 5DUIA 2WTKB 4RWIA 4E7KA 3T1BA 2W84A 4GYGA 1ZWSA 2KZGA 1IR3A 4M73A 4OOIA 1WH5A 4XOTA 2WIPA 1ZZ2A 4HV5A 4ZJVA 3BHVA 3DAKA 2FQ4A 3HC7A 4NQWB 3L9LA 3V3VA 4JLCA 3HYIA 3TW6A 4UV8A 4QTBA 1Q8YA 4C4EA 4O84A 3HTSB 3QAHA 3VRZA 5FEEA 2PYWA 2LAVA 2F49A 2GA1A 4WCGA 3TW7A 3F5UA 3FBVA 3GFLA 4L44A 4KICA 3WI6A 4RX5A 1VZOA 1BL7A 1XD7A 4RVTA 3CPCA 2KP6A 4HRIA 2WTWA 5FRIA 5JGAA 4W4YA 2JGZA 4D2RA 3SW7A 2LRDA 3ORLA 5EGOA 2DA3A 2FSOX 3OCSA 3IWFA 3VN9A 4BGGA 5H8GA 3E6BA 2R7BA 5DTDA 1SZMA 3HLLA 3Q53A 5EQYA 4C4JA 5FKNA 2C6EA 4AIHA 5L3BA 5HBHA 3ZQ7A 4N6YA 1V0BA 2M7BA 1EJ9A 1TT0A 1VYWA 2QD9A 3QTSA 3FKOA 3IPHA 2D1HA 3QX4A 1RKWA 3SEQA 2XUBA 4MLOA 2VL8A 4CMTA 2KJBA 2CUFA 3W3CA 2GQRA 3IO7A 5CF4A 1ZREA 1OM1A 4AW0A 1YI6A 3IRRA 4IAYA 2A2AA 4H3PA 3PJCA 2WIHA 2GA2A 4JOMA 2X2MA 4V2FA 2IEKA 4NC7A 3CC4I 1H89C 3BI6A 5BVNA 3MB6A 3OYJA 1G5SA 2V1UA 4IDVA 1PKGA 4BTJA 3JAMZ 3SOCA 1B59A 4L9IA 2NVTJ 4HLXA 2R7XA 4FTLA 3MB7A 1CM8A 5BYYA 5CYIA 3CTHA 3FL5A 1JSUA 1VQ6I 4E70A 3FXZA 1P2FA 3E8DA 4YZCA 3ETAA 2BROA 5DOSA 3DDPA 4OBQA 1J3HA 3NNVA 1OPLA 1ZR2A 4WK8F 2VTPA 4J99A 5AV0A 1UV5A 3QU3A 4Z2YA 3EL7A 3S1RJ 2O03A 1MBKA 2X1EA 3R8ZA 4TNDA 3DKYA 3F82A 2XGCA 5IQDA 4K77A 3Q3BA 4FZFB 1GT0C 5AUWA 4BXXJ 4CSWA 2YX4A 1OMWA 2Y48A 4Q47A 3LMMA 3OP5A 2XK6A 2J5FA 4YLLA 4ZP5A 3JW4A 5CVHA 3VBQA 1FGKA 5AIPA 3SRVB 3RCDA 4DG0E 4A4XA 4KUJA 3WZEA 2VWXA 4X2NA 3P9JA 4MHGA 4LGWA 4DT8A 3SLSA 2ETKA 3OS2A 5HCZA 1S7EA 3SDBA 1H27A 4NB5A 2HQAA 1QO0D 3BROA 2VJ4A 4AYBA 1YX3A 2XK3A 3WTZA 5FBOA 1PMUA 5EZGA 1MRVA 1O3QA 3JS2A 5KUPA 4CCKA 4A5NA 3FZVA 1YOJA 4V01A 4RS8A 2EZLA 3IONA 4Z55A 3FLZA 4NDLA 3P86A 3QKMA 4CMUA 3DXQA 2K40A 3ZPLA 4I3ZA 2OF4A 3FXXA 3H9OA 3UIMA 4FIFA 2VKVA 2V0DA 4YIIA 3EFKA 1H0MA 4XLHA 2AS5F 3ZSHA 5FKOA 2YIQA 2VD5A 3R1NA 4MQ9F 5ILSA 1HCLA 4EH9A 1AD5A 5EDQA 2OO8X 5FDXA 4R1YA 2G2FA 3MIAA 1ZAOA 1G8SA 2NYAA 2ZJWA 3E62A 1J9IA 3OUNB 5KMJA 2R3FA 4ZYEA 4P1WA 4CLJA 4DEAA 5EYRA 1OECA 3CCYA 4F0GA 4AC0A 2ONLC 4ZMFA 1ZYRF 3A4OX 3ZYAA 3FUPA 3ABUA 2QCOA 5J1UA 3BCBA 3SXYA 3NEUA 4EK4A 3ZLXA 1XDSA 1J0RA 1YDRE 5LWNA 1MMDA 2ZMDA 3FSFA 2KT0A 2CGXA 4V19K 4FICA 5J7HA 1HCKA 4IVDA 4DCAA 5HQ0A 2QBYA 2VV9A 1H1SA 2R3OA 5AX9A 2JLDA 2EPFA 2BXYA 2C6DA 3FMDA 3UOHA 3M3YJ 1BIAA 3U9CA 2BZJA 2EILH 2BIYA 2RDPA 2WXVA 2DTRA 3MIYA 2X1NA 2MA3A 1SD6A 4YJUA 1Y1WJ 3F8NA 2QOFA 5J47A 5FUTA 2O61A 4D9UA 3CD8A 2OJGA 4X3FA 2FJ1A 1P5EA 2VNYA 1A35A 4YJQA 1RR8C 2FMLA 4Y15A 4MHAA 4CA0A 2XMYA 3SKCA 4ZAUA 3L9MA 1I44A 5E1SA 1XMMA 2UZEA 1VNDA 5M08A 2C3LA 5KX8A 1W4MA 5CVRA 1PW2A 1PHKA 2OXYA 1KU7A 3G6GA 4WUNA 3B8RA 1D0XA 3I6WA 2LBFA 3JY9A 3QKLA 1MH3A 2XNNA 1UU3A 2BRNA 4BI0A 5CASA 3B02A 3V8LA 3QC4A 4AF3A 4AG8A 2VRXA 3PLAE 5J8IA 1YS6A 1LP4A 1WJDA 5FRNA 1WQ2A 1B6AA 3G2FA 4Y46A 3MH3A 1T08B 5I9XA 3BHHA 3MVPA 3F5XA 3E8NA 2JIVA 2A6EF 1RE8A 4XG6A 2QU6A 2WY7Q 2DYLA 2MFZA 1FIAA 4EH7A 1BI3A 2ZXIA 3LA2A 2XK8A 3PSDA 4A3EJ 2ZXHA 2GPHA 4EMSA 3EUHA 2WMBA 1MD0A 4M3GA 5J1YA 4BXFA 2PFBA 3ROCA 3A61A 5JFRA 5AFVA 1E3PA 3FM5A 1PJRA 3COAC 3JPVA 4BDGA 5KHXA 1W7HA 4IZZA 3DEEA 1NG7A 4GO1A 3UNZA 2XIGA 4KJZA 3BLQA 3UGCA 3HAVA 5CLPA 4O27B 2XALA 4B44A 3P79A 3AT3A 4TYGA 1GZNA 2CQQA 1DUXC 3S3MA 1MIJA 4L43A 3OWTA 3F8CA 3CDIA 4MEXF 4NL0A 2O7OA 4XSXF 1R0EA 2ZFUA 2GU8A 4FTQA 2JPCA 3A0BC 2XIZA 1I3AA 4XV1A 1TWAJ 2ESNA 2KFDA 3L9PA 5GNKA 4HVGA 1IRFA 5CNOA 1OPKA 4FI1A 3ZTXA 2R3IA 5JFSA 2XF6A 4OGRA 4JX5A 2YX7A 5IA5A 2CHLA 5J3LA 3ZMVA 1HLVA 2NS0A 2QOKA 3H3VK 3WODF 2ZXWH 5E1ZB 3ZR8X 4XV9A 1YXSA 4QSHA 3WZDA 2WWYA 5HS9A 1TWFJ 2ZBKA 4D0XA 2VJ5A 2UXXA 2HWPA 3DOGA 4PNIA 3VDXA 2K9MA 4DW6A 4WA9A 2PJPA 4A7CA 2WU6A 3FMMA 3EQIA 2VTJA 2HAKA 3RAKA 4ARKA 2UZUE 4NCTC 2W1DA 1TWCJ 2DFEA 2XAGA 3A02A 3JRDA 3BYOA 5EHYA 3V5JA 4FTTA 4S33A 4IACA 1J75A 5GAHJ 1QBJA 1H07A 3KPHA 5F94A 3ZRMA 1MNDA 3M1SA 1F43A 2JWTA 3BOQA 3ABLH 1RIOH 2H6DA 5LWMA 4IX7A 2BW3A 3A7GA 5C8NA 4L18B 4NNJA 4RB1A 1EH8A 4G34A 2L4AA 2PE2A 2R7OA 4ZLYA 4YGAA 3AQVA 3HV5A 3ACJA 3LCSA 1X4PA 2LK2A 4C4GA 5KHWA 4XBFA 4IO9F 2V79A 3FXOA 2QWWA 3ZSGA 4BI2A 2DA2A 3QTZA 2CMPA 2HNHA 2OF2A 1P7JA 4E6KG 1P4AA 3KULA 2WAQA 4U79A 3ORKA 3MSSA 4KITB 1Q8ZA 3CQUA 1KV1A 5B66C 3O0GA 5HGIA 2X4ZA 3HSFA 4YG2F 4YSMA 4TYHB 1D8JA 3DA6A 2A6HF 1PMVA 2VQGA 3E6CC 5BUEA 4AX8A 3TKHA 1TWHJ 5IEVA 1QHHD 1YW2A 2DMTA 2DUVA 1MZBA 3HV4A 4L53A 3B73A 1YQAA 2VNWA 4UYAA 3OWJA 2YERA 4C2UA 3FLQA 4UN0C 4KWPA 2RGPA 1D1AA 2XCHA 4ZS0A 3DCVA 3R63A 4M14A 1OL1A 1ZG3A 5JSMA 1IN5A 2M0MA 3LSHA 2OSCA 3DWLE 1OCCH 4FTHA 3T3VA 4DGNA 4LYNA 5LVMA 2RN7A 2XP2A 3BGPA 4AOIA 4K0YA 4ACHA 3VJOA 3ORNA 4CNHA 1YDSE 1Y6BA 4M8TA 3BPRA 3TL8A 2M8EA 3LFQA 3BE2A 5BPYA 5M4CA 4MEYF 4RIWA 1FOXA 2F5EA 5GADJ 4HYEA 2GQSA 3EB0A 1YIOA 2MD5A 4RRVA 2YU3A 2V22A 2BTRA 2WAFA 3ZMSA 2XVDA 5IYDJ 4GMYA 4EOIA 5C4XJ 4GJ2A 4A9UA 4BKJA 4BC6A 3C7QA 3F7ZA 2DA1A 1UCRA 3NR9A 2ID3A 5KHDA 2W25A 1VTNC 3QD4A 4MBIA 2E7XA 5AM7A 3C2HA 2OBJA 4QYHA 4EATA 4IB3A 1JE8A 3U2RA 2QF7A 2C3JA 5D7VA 3GZ5A 3OXTA 5E8VA 5IA2A 3SW4A 2EB3A 1JBPE 3PNTA 3H0GJ 2PLYA 3BWGA 3A1YA 2PMNX 4FV1A 4RLLA 5GTIC 3CMYA 3IRQA 1H00A 2XROA 3J80K 1CKIA 2R4BA 3NDMA 2XC7A 4YHTA 2JPBA 1WWXA 3M07A 2R92J 3CJNA 3BR3A 4ACDA 1MMGA 3BEGA 1LE8B 4XKCA 3OW3A 1BI8A 1D8KA 3ZBFA 5DUKA 2ZNYA 2BRGA 2IBDA 3VUKA 3WF5A 3SEZA 2A5YB 3C3WA 3G71I 1XH9A 1EA3A 4CQEA 3NCZA 2X0GA 2GNHA 1OYIA 3EHAA 4FTCA 5IH5A 1BL6A 2W4JA 1J09A 4I1ZA 3MESA 4BHCA 1ZMUA 2EFWA 2BZKB 1WBTA 2Q0OA 4GFGA 3F3VA 4JYKA 3GXOA 5IP6A 3PUBA 4EJVA 4OTQA 4Y17A 3RYPA 4A3GJ 1IV8A 2DPUA 3ZQQA 1ZGAA 3MY0A 1PXOA 5L2WA 3OOGA 2BAJA 3SOAA 3KFWX 3OBGA 5L3GA 2OGVA 4YBKA 1ZMVA 3DKWA 5EFQA 1VR2A 3ZRLA 4FZAB 2FD5A 3M42A 4KKHA 5CWZA 1O9UA 3I5ZA 3OYMA 5CEMA 4BL0B 1W8CA 3AG2H 4G6LA 1BW5A 5EM6A 2IVMA 3H0ZA 3RHXA 4ALUA 3DS6A 3B2TA 4AE6A 5J9ZA 3RNYA 2B0LA 4PNKA 3RWQA 5EYCA 5HORA 5B5EC 4EH4A 2XK7A 4F70A 2KMUA 4CDGA 4G12A 3IOKA 3BLAA 4NBQA 4J95A 4FKSA 4BCJA 4A0XA 2QQ9A 1SFEA 4FL2A 3QHRA 4XG9A 1KONA 1T39A 4IOAF 2YM4A 3HP2A 1QQIA 1ETYA 2BDJA 4G9CA 4GG5A 1N77A 5LOHA 3VWAA 3U9GA 5JR3A 5JFVA 5CF6A 4MFEA 4BDCA 2UV1A 2BY1A 2EBIA 5K5OA 3TM0A 3R7OA 3U9NA 2XKFA 2VTHA 3DDQA 4A3IJ 2VQLA 3PVGA 1G4DA 3OYDA 4Z7HA 4OU0A 3PTGA 1W1WE 1JGSA 1I09A 2CQNA 1IJWC 5EGOB 2EK5A 2VWZA 1LPUA 2C5VA 5DS9A 2DS1A 1LDKB 3K4NA 2OLCA 3MKWB 1J7LA 1Q8WA 1G3YA 5D11A 3EYHA 2BOLA 5B2KA 3SG8A 2PMZN 3DAEA 2I1MA 2PI0A 2P4IA 1M2QA 3ABKH 4RLQA 2HWOA 2Q0BA 4KAOA 1ZG5A 1HDDC 3O8HA 5LGUA 3Q4ZA 4EK5A 3VB2A 4DGMA 5K7HA 1LDJA 3HX4A 3QCXA 3G9NA 2ZJQF 4EGYA 5E3OA 4HPUE 3B8QA 2CYYA 2NOGA 4GXOA 4CFMA 4JDJA 1KSWA 3RM6A 4DH5A 5J95A 1CQTA 4Y73A 2K9SA 4F08A 1U59A 1V5GA 2ITNA 5DRBA 2C5OA 4BYYA 4O0YA 4IZYA 3O96A 2WD1A 4IZ5A 4NFMA 4ZTHA 1OKWA 3GTJJ 4E4MA 1T98A 3LOCA 3M1EA 1OL5A 2R3QA 5AV3A 1YRNA 1USSA 4S05A 3DJ7A 2KRHA 3ZO1A 3FXRA 4OTIA 3FXMA 2CQKA 1WRJA 4KN4X 3HKOA 2W1CA 4DE4A 1UFMA 2VTSA 5A54A 3ORIA 5CS6A 5FTOA 3D14A 4HGTA 1H1PA 4FSRA 2HOEA 1HDPA 1Z3XA 4DCEA 4PRJA 4E6DA 2BAKA 3M7GA 2ERKA 5EOBA 4OWRB 2ID6A 1EF4A 3E8EA 2V1DA 4XG7A 3LFAA 5C03A 2H96A 2JA2A 4O7VA 4EI4A 4J52A 4FNXA 1BI2A 1UMQA 4C7TA 5KVRA 4DIQA 3LMGA 4QP7A 3DZQA 4L7FA 4AN3A 3W2CA 2RG5A 3FLNC 2O2UA 5CQGA 5DD8A 4IFCA 1YI3A 3JY0A 4W8EA 1R23A 1LDDA 4J19A 2H8HA 2E60