3TMOA

The catalytic domain of human deubiquitinase duba
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
141
Chain Sequence
AARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Phosphorylation-dependent activity of the deubiquitinase DUBA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords OTU domain-containing protein 5
total genus 33
structure length 141
sequence length 158
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tmoA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tmoA01
3TMOA 3PFYA
chains in the Genus database with same CATH superfamily
1TT5B 3R0TA 4PV0A 2NRYA 4YBJA 4M3BA 2HELA 2J90A 4XG7A 4FI1A 5KBQA 2YISA 1DAWA 4WXCA 4U44A 5FP6A 4YC8A 4R79A 1G2HA 2E1CA 4ASDA 3IW7A 4MD9E 4RIOA 3SGCA 2KZVA 3FV8A 2ZDTA 4A3DJ 2DUVA 2PHKA 2K27A 2OZ6A 4NM0A 3C0GA 3PRIA 5A4CA 3VYUB 4CH7A 2VQHA 1XSDA 2YACA 4D5CA 4EQQA 4CYCB 4DEEA 3HJEA 1BR4A 2ZXIA 2DQ7X 2W5BA 2QNJA 1SVLA 3U9GA 3OXZA 1UMQA 3I4MJ 1A48A 1A6QA 5F1ZA 3MY5A 2RKUA 3JXWA 4ORKA 1HDPA 2IVVA 1JBPE 2G15A 1V54H 3A8WA 3GTLJ 3M1CA 5DT3A 5D4SA 3LSTA 3ZQCA 3CCYA 3DBFA 2WOTA 4KT5C 3FI4A 3R6SA 2P6SA 1KQ8A 3KP5A 2H9VA 4ID7A 1EH7A 2I0YA 1JHFA 3PWDA 4U0VA 3OYLA 3W10A 5FJ8J 1OKZA 5IEXA 2ELKA 2RAEA 1H00A 3LFSA 2CKQA 3UDZA 1FC3A 4QT1A 2BZTA 2IRFG 5FLVA 4DFBA 3L2UA 4NH1A 3AC8A 1R0PA 3BDDA 1R22A 4Y5QA 2FSLX 4BE2A 4GMYA 2OCEA 3GZNB 1W8CA 1OYYA 4BDKA 4GK4A 3GFEA 3TG1A 2DCEA 2CRGA 1HCRA 4L42A 1X1AA 1UV5A 3PJCA 2PUIA 2HDCA 4BC6A 3G0EA 2P3GX 3BZ6A 1RKWA 3J81K 2R5YA 3S15J 2PL0A 3DAEA 3QP5A 1KU3A 3M2WA 1HW1A 5ILUA 2BDJA 3GU7A 5EK7A 5IQDA 2UZUE 4NUBA 1OIQA 1NHAA 3HGKA 4RIXA 4BJJB 4OT5A 3SD0A 5GAGJ 1URWA 2PX9A 5FG8A 5CEOA 2P7CB 1PUEE 2WQEA 4C3PA 2WELA 1O6KA 1XBBA 1MJ9A 2VTHA 3GFMA 4DT8A 2VD5A 3LFFA 4O7NA 1CKPA 5GP9A 4G12A 3RQ4A 1J2XA 4A5MA 5D5VB 4YLLA 3E6DA 3P4KA 3E88A 3QU6A 2UV1A 3IS5A 4HV6A 1WBPA 3F5UA 4G7OF 4G3EA 2DFFA 1MMDA 2XVDA 1B9NA 2NYXA 1OITA 4L9IA 5D5XB 2G2IA 1WGXA 2HIWA 1ETOA 4JDKA 1I39A 2F4IA 1X4OA 3A0BC 1UU3A 5KK1A 3VNTA 2XANA 5IQCA 3V5PA 3HEFA 3FL5A 2QKLB 5EZHA 4BDDA 3BWGA 4B09A 2BZKB 5DWRA 5AA8A 2W48A 4IOCF 1WJAA 2W5AA 4APCA 3Q60A 2OZOA 3UC4A 4NSTA 4IDTA 4IHPA 3ZQIA 3K2ZA 2XB0X 3V5QA 1VR2A 4IH8A 2C5OA 1W4MA 3CUOA 3H3UA 5TRDA 4E4HA 3ZONA 4QMXA 4NU1A 1H8AC 3OWKA 1WZ2A 3ZDUA 1F4KA 5KAFC 3HUBA 4CCUA 1Z7UA 4L67A 3U4UA 1RKTA 3R30A 4LGWA 3A60A 2XKDA 3OR2C 5C01A 2FRHA 3I7CA 1OGYA 4RIYB 2VJIA 2HOSA 2QO7A 2X8EA 4WNKA 1OPKA 3BHTA 4MKCA 1YRNA 1TFFA 4U43A 4U7DA 3QZHA 3VUDA 1K3AA 1VQ7I 3E97A 2ITYA 3FK6A 2R3NA 4DDIA 1ZOGA 3DWLE 3RINA 1S7OA 3FZVA 4RJ8A 3U87A 2IS6A 3OS3A 1JUSA 4ZTFA 4FKRA 3ABUA 5DA3A 4BGGA 2PSQA 3OTVA 2F4OB 4C62A 1A6IA 4WG3A 2XALA 1G59A 1H89C 3CUQC 4GT5A 2JRMA 4XRMA 1MSFC 1A36A 3UYSA 4EM1A 5CEMA 4E7LA 4DF3A 4F63A 1ZQ3P 4XH6A 1Q5KA 4TL0A 4KD1A 3B2WA 3Q4CA 5J3LA 2E5ZA 4KB8A 4N9HA 3L8PA 2FA2A 3LLTA 1OUKA 4CZZA 1PHKA 4NM3A 1UZCA 4GGGA 4CV9A 4ZYHA 4QTAA 3IO7A 4ENMA 2A68F 2YZLA 4BHBA 2PMNX 3QYBA 2GQRA 3ERMA 2V1XA 5JGAA 3HSFA 3OYBA 3BYMA 5LCJA 3U6JA 2W06A 1J7LA 3K3JA 4Y4RA 4YC3A 2GQGA 3D0EA 4P7EA 4X2FA 2E7XA 1KV1A 3PSIA 3KRRA 4R1HA 3EUAA 3WF5A 5JLWA 3CCRI 3REPA 1XBCA 4F70A 1S7AA 3M11A 1XGNA 5FGMA 4CYDA 3CCQI 3SYTA 2VBYA 2CNVA 3JR1A 2EXCX 3NUXA 1OCZH 3FIWA 3CJQB 1ZMUA 3HPHA 1ETKA 2EWNA 3CO6C 2NVXJ 2W1ZA 3LXLA 2DYRH 5EI2A 4LITA 4PGGA 3UDTA 5ETIA 3GC7A 4DLJA 4YLJA 1GDTA 2EB3A 4ALVA 3ZRGA 3R9OA 1Z3XA 4EC9A 2B9JA 3K5UA 2HENA 2DOEA 4S04A 2DPDA 2JDVA 4LOQA 3B6CA 4UWBA 1KQ9A 3LQRA 2CPKE 1BX6A 1OIUA 4F93B 4D1QA 4G34A 4FTKA 2WAFA 5DCMB 4C2VA 3M4OJ 3H9GA 4F78A 4AAYA 2OFUA 4HZSA 4UUSA 1TQIA 1IG7A 2XGXA 4EM2A 1OQYA 4G6DA 4E4MA 2B9IA 3KF7A 1YS6A 3VOEA 2IVMA 3DPKA 3GCPA 5M55A 3LQ8A 2HZDA 3SEZA 4Y85A 4Z9LA 4XG6A 5FB2A 4EJUA 3F88A 2CW8A 1LE8B 3PJRA 1ZXEA 1NVSA 3TO7A 3M07A 5LWNA 3IPHA 4C4FA 4DFLA 2J50A 2BW3B 3ZXTA 5F04A 3R7YA 4X3FB 1XC5A 3AG2H 3P86A 1ZGAA 3HRTA 4BCNA 2VKDA 4QO9A 1SVMA 5E3MA 1XX5A 3R63A 1GV5A 2BMCA 4IMYA 3ZSHA 5K3YA 3HG9A 3DB8A 4ZS4A 4E5WA 4M6VA 3W3CA 3OOUA 4EOMA 4FG7A 2C6LA 1UCRA 4MXOA 4ACMA 1IN5A 1WBWA 1U46A 3UODA 4W8DA 3LJ2A 5AUTA 1DP7P 1QPEA 2CFOA 3N9XA 2F5VA 3PNVA 2GOXB 4LMNA 2M2EA 1NG7A 2ZSIB 4ITHA 1ITYA 4LB5A 2A5WA 3OF0A 1IAHA 3P79A 4M0ZA 3CQWA 3ATTA 3SQNA 4CXAA 3KZIC 2HEOA 4MCVA 5KMNA 4PX6A 2R3SA 1Z1DA 4D5FA 2XRLA 3HIFA 2P6TA 4HNFA 4OAYA 4FZFB 4M69B 4XLHA 1XPXA 5J47A 2P5VA 1ZRZA 3CP9A 1QU3A 2EWAA 5FLMJ 3AL0B 3TW6A 1Z0XA 4P5OA 3G0FA 3IW4A 2OW3A 4GVAA 1JVPP 3T8OA 2CV1A 4R7BA 2YX7A 4L5IA 4LUEA 4L44A 4RGRA 4Y15A 2IVSA 1JJ8C 4QMSA 4Y8DA 4JYKA 4DHJA 2L9VA 3M8FA 1MRVA 3OIQA 2R3MA 4I4EA 2OJED 3K4NA 5E4HA 2B54A 3FLSA 1YHSA 2RG5A 2D45A 2X0LA 4CCKA 2C3JA 4RQKA 2QLUA 1R1WA 3AC1A 2E9PA 5AAEA 3T9TA 2V1NA 4R7HA 4B3XA 3G1OA 2A2AA 3RKWA 2YSRA 4RFZA 3HTSB 2Z7QA 3PZHA 1KE7A 3EN4A 5LMAA 5E20A 4KDPA 3Q6WA 5FXRA 1EA3A 2WXVA 3LSGA 3BQYA 1J91A 5ED4A 4BZNA 3K4JA 1X4PA 4XN0A 2VKEA 3Q3BA 2KT0A 5FLFA 4AM3A 1W7HA 3NW5A 3SFIA 5DUKA 3W6VA 3M7GA 2UZLA 2Z2SB 4PMMA 3MFKA 4O7LA 5DYMA 3OIPA 5J1VA 2R64A 2R3LA 1Y6AA 4BCOA 2NNYA 1UU7A 3PPJA 3HRBA 4P5ZA 5AP2A 2FEZA 1JSVA 3M3YJ 2YDJA 4IAZA 3CMAI 3W0QA 4D0WA 2L7FP 5H8GA 3QYFA 1P5EA 1MJAA 4M9SA 1R71A 1XHAA 4LOPA 4NCTC 5AX3A 4EK5A 1XGSA 5TKDA 2W4OA 2JA5J 4M9XA 2WGJA 2BY0A 2GQSA 3UQFA 2BCJA 3GU6A 3H5AA 3RZOJ 1WJDA 5C44J 1JAMA 3MH0A 1ZRDA 4XOTA 2UVXA 4EOIA 1GZNA 2JUCA 3R73A 3MIAA 3ESWB 3E92A 4YELA 2KIQA 3RI4A 3PSCA 4UVCA 2XA4A 1UAAA 2OQRA 3W2OA 3KZYA 4XRSA 1UHWA 1Z21A 1X1DA 3R22A 4XLFA 4YPSA 5BMSA 2DFEA 2P0WA 2FQ3A 1R1TA 2JN6A 1SVHA 3Q4ZA 5DD4A 4BS9A 3IW8A 4D9JA 4TNBA 2VQCA 3KEXA 3MVHA 1D0ZA 2WY7Q 2BYVE 4IF4A 2C6KA 3LOKA 4TKSA 5CSPA 5HI2A 4PL5A 2GTNA 2ELJA 3OYGA 4XSXF 3OYEA 3LA2A 4F1OA 3L9PA 1C0WA 4LV8A 2YIRA 4IL6C 3FMHA 3VBWA 3DJ7A 4YNEA 3PLAE 1EKEA 2CMPA 3IHUA 3BEGA 4DCEA 2PVJA 5ICFA 5DFPA 2ITQA 3PPZA 4ZIMA 3DDPA 3Q53A 2PE2A 3BG9A 5A46A 1IZ1A 1OCPA 4CMOA 4LQMA 2P2HA 2WAJA 5LXMA 1MBFA 3COAC 4BDYA 5HICA 5EM5A 4XYFA 4KT6A 3AG3H 4DH8A 1ZGJA 4DEGA 1Q1VA 5D11A 3EN9A 3CKXA 1FOKA 4ZSGA 5IH5A 2OG8A 4PUZA 4RMNA 4IB1A 2PY3A 3P5JA 3IUOA 3TDZC 3O51A 3NUUA 4NYEA 2CYYA 3WTTC 1EH4A 5GNKA 2C6YA 3DEWA 2BIKB 1XH6A 3AC5A 4CG9A 5KMMA 2VGPA 5HDKA 2RDPA 3R0JA 5CWZA 5H8EA 4ZZLA 3IW6A 4UBAA 5IQBA 3UVPA 4AX8A 5CEIA 4XS2A 2J4ZA 4BGQA 1LPUA 3B8QA 4CHUA 3OY3A 2CGPA 3GCSA 3RYPA 2WAEA 5CPRB 2X1NA 2Y31A 1UNHA 3QAHA 1OR7A 3E5QA 3MCZA 2JUGA 1IAWA 1GZ8A 5EI8A 1BW5A 1H27A 4AGDA 2HS5A 3MSSA 3O2PE 3IAS2 2DA6A 4DJAA 3LSPA 2X9FA 5HG7A 1CGPA 3IW5A 2LR8A 3EQCA 4G3DA 4AP7A 3EDPA 1Q97A 1XKKA 4PJJA 2YCFA 3IOKA 3KKVA 2V79A 1D5VA 1BR2A 5HBEA 4CGZA 3TDWA 4FETA 5EG3A 2WU6A 1LPQA 1U3EM 4FTUA 5EZGA 4AG8A 3PIPF 4QP4A 2J5OA 4HNIA 4U0IA 3V01A 2ZM1A 4KIOA 3BROA 2BY1A 1MQ4A 2JVHA 3CJFA 4ZDLA 1RUOA 2HZ4A 1Q8ZA 2HYYA 4EH3A 5C3EJ 3DTKA 3LFKA 3MH1A 4D58A 3BOQA 5EFQA 2BKKA 1OM1A 5F6FA 3BZCA 4IRIA 2I0EA 2GS2A 2JPBA 1QVTA 3ZM9A 4M67A 3FXUA 2OPTA 4QYEA 3O8UA 4O7YA 3ETAA 4CFFA 4E8AA 3OVVA 4A7CA 2CU7A 5JN2A 1PY5A 1S9HA 3QZIA 5AFVA 3QWJA 4AT5A 1I1SA 2JKQA 3VS4A 1MQBA 3IWFA 5IDPA 3CEKA 2JVGA 3VUHA 3S2WA 4M15A 2X1DA 2Y0AA 4EV0A 3DBHB 5DV5A 2KHMA 3QOEA 3OWPA 4A3KJ 1HKTA 3EQPA 3BE2A 1XBAA 3U51A 5CYVA 3G9LX 3TQNA 1PKDA 2BRHA 4EJWA 5B5EC 3QWLA 3R7EA 1X2MA 5M5XJ 4C30A 2QU5A 4ANJA 4CLIA 2ZMEC 2DWBA 1B8IB 4ABZA 4L3LA 3VN9A 3CBLA 1U6GA 2G1TA 5GINE 2Q0NA 4NTTA 5DHJA 2W9FB 2NO3A 4LOCA 3EHAA 3ZOSA 2ACJA 4JP0A 3MEXA 3C4EA 4XX9A 2RGVA 3PSDA 3TIZA 4ZJVA 1W7PA 4FSTA 4O7VA 4C4JA 4XG3A 3CKWA 1LQ1A 1O3TA 2BEOA 3V8WA 3TV4A 1VQOI 1UU9A 3FQSA 5H2FC 3VW8A 2L0KA 3QQFA 3EUHC 1GLNA 4JBAA 2HOEA 4BB4A 4J1RA 4D9UA 2W4KA 4G6NA 4O0UA 2R2PA 3T1BA 4GYGA 1RE8A 3HOYJ 2I5UA 3CCVI 1YXSA 5J7HA 3E8EA 3E6CC 4IZYA 3BLHA 5HLNA 1G6NA 4EK8A 4HW7A 2M7AA 3KYLA 2EVAA 3HKZN 3EQHA 2PVRA 1ZZ2A 1H25A 2UW8A 4Y52J 4X3FC 1MW7A 1R3CA 1R4NB 3F6XA 2F2UA 2VTJA 3AT4A 4H1JA 2H1KA 1WBVA 3Q04A 3D14A 3QZGA 1Q4LA 2VUWA 2MW8A 3S3IA 4FTHA 4AOJA 3DBLB 1QRYA 2XKEA 1OKWA 4X0GA 2QQBA 2H96A 3D5XA 2GFSA 3OUNB 5IQGA 4FT3A 2DO7A 4G5PA 4X6AJ 2V4JC 5CSXA 3ATSA 3NUSA 3MB7A 2UW4A 1W83A 3ZUTA 3NNVA 2CNQA 2OJGA 5BYZA 4XR6A 5F95A 1W7PD 3TP3A 3V5TA 4RB3C 3TZ8A 3QRFF 5M56A 4F1MA 3V7SA 3HXLA 3NCGA 2YCQA 3Q5IA 2IXSA 5IYBJ 1UHMA 3COKA 4YSMA 4FX4A 2EILH 4TYIA 3CQEA 2W24A 4BCIA 3M1SA 4PUSA 3W6KB 2VPRA 3J80K 3VUMA 4GKIA 3DBRB 4TYGA 2BRBA 5IU2A 3J7ZI 5HS9A 4A3CJ 4UNOA 4XRSG 1VQ6I 2RGPA 2JITA 3F7WA 1H88C 2JWTA 3HP2A 5DR2A 5CXZA 4I22A 3MKLA 2OA4A 2QBYB 5DNRA 5TJJA 1LFBA 3ZMTA 2E2JJ 2EA4A 5L2IA 4OU0A 2KQRA 3LQQA 4N9IA 2VWIA 3PXKA 4FX3A 5FD5A 2ECBA 3ZZWA 2V7OA 4ANLA 3A1YA 3D5VA 4I1ZA 1GOLA 4CCNA 3IECA 4ZMEA 4MD7E 3NLBA 3TI1A 2BV6A 4XLPF 1OBGA 4JS8A 3BCEA 3FBNB 1KYWA 2PMOX 4IAIA 4A4OA 2DFHA 2P55A 5HX6A 4ACCA 2XNEA 5M4UA 3HYHA 2K3FA 1YQAA 3F5GA 2F5EA 1MRYA 3IGGA 4HLYA 3ZC6A 3QCSA 3O3KA 3OL4A 4CD0A 2MC3A 2X2MA 2ID6A 3K54A 2ZB0A 4G17A 3HOZJ 4D1XA 5AADA 1YW8A 5CVUA 2ZCWA 4KMUX 3OS0A 4ERKA 5KCVA 3FEGA 2LFBA 5AAGA 1UG0A 5LRRA 3FKJA 4C3FA 4HX7A 4EJ7A 4A5NA 2ZJQF 4XSZF 1JKPC 4I23A 4CV8A 2VX1A 1DP3A 4AZSA 2R93J 3RQIA 3QRTA 2FMYA 4AACA 3OOMA 4RX8A 3UP7A 1BI2A 1V0OA 4FASD 2QODA 3CC4I 2UZBA 3OYAA 4GG5A 2FNPA 1H0WA 4RM2A 2V6EA 1X3UA 1B72A 1FMVA 4C36A 2CUJA 3ZO4A 3AXWA 4A3MJ 3P08A 2WO6A 4FG9A 3WF7A 2VO6A 2HCKA 3UZPA 2CV2A 1MMNA 5D9HA 2JA6J 1BM9A 1ZLTA 1TT0A 1HQCA 2Z1DA 4R78A 2V55A 3WZUA 1FEXA 5D10A 2A05A 3I1AA 5JFSA 2F5DA 3FUPA 1FMWA 1BUHA 4Y3OA 3BTLA 2A69F 2ZMEA 3PVWA 3TO9A 5I9YA 2GNLA 2YEXA 2X6WA 4I02A 1SFEA 3BP8A 2ESHA 5CYIA 4IW0A 4TRLA 1PUFB 1IR3A 4JRNA 3A03A 4F7ZA 5IEYA 4YFKF 4IAYA 3RPSA 4RM3A 1BR1A 2WC2A 3GC9A 3C4FA 3WBLA 1P7JA 2PN6A 2OF4A 3KP3A 4HQEA 3ZSGA 3PXYA 3E5AA 4ETSA 1UU8A 5KNJA 3RNIA 4MBIA 4DEHA 3EN6A 3RTRA 3CC2I 3VW6A 4RGUA 1BYGA 3FHNA 1Q99A 2QYOA 4X0MA 2PULA 1CDKA 3JPVA 1W5TA 4HPUE 5IA4A 2YIXA 1BL7A 4CSVA 3D5WA 4FK6A 4QQTA 5CZIA 4HVIA 3VS0A 3R71A 2RVCA 4AXDA 5BQ0A 2AYPA 4YJVA 5CQGA 2VWVA 4I0SA 2XPWA 3R7UA 1XMMA 2V26A 4HNVA 4CCBA 1OL5A 4X3FA 3KU2A 4CFUA 5B3SH 2WMSA 2XVCA 3POZA 4AU7A 3PUFA 4C38A 3HKOA 3D2KA 4L5JA 3TV6A 4MBLA 1LDDA 1YTYA 1J9IA 3V5LA 4FE4A 1IUFA 4WKQA 3WGIA 2O63A 2J6MA 2R7RA 1HXDA 2GA1A 4EH9A 1ZH5A 5CX9A 2BOLA 5KO1A 3TTIA 2YS9A 4AQCA 3P5KA 4WRGA 1WPKA 2Y2ZA 1B39A 3QOPA 3LE6A 3AMBA 3F3ZA 4OBOA 4QPOA 2E34A 1QCFA 1O57A 3QZFA 3JRGA 4L68A 2R3RA 2X6YA 1APLC 3VS6A 1FTTA 2M34A 2PZYA 4DBQA 3R8LA 4E7WA 3PIYA 4L7SA 2TDXA 1Z7LA 2FUMA 4DBNA 1ZRCA 1VLRA 2R7TA 4RC4A 2OZAA 4GRBA 4E73A 3E7VA 2PMHA 5CU3A 1IASA 1LJ9A 2WIHA 1K4SA 3WE2A 2R4GA 1XR1A 4AZVA 1MZBA 2OC6A 4ENYA 3RSNA 1Z67A 3GENA 4E6QA 4FNYA 5AONA 3RCDA 2VTTA 3S3OA 2AC3A 4EL9A 3N97A 5LHIA 3A7JA 1D1BA 4ASEA 3EKKA 4IVNA 3AKKA 4G9RA 4MXCA 4EQCA 4A6EA 4PJMA 2Q0BA 2L4AA 2XRWA 1MH4A 2WQMA 3MS9A 5IISA 2BY3A 1VQ5I 5CSWA 5CEPA 3OL3A 4L46A 2YCSA 3N4TA 4G6QA 5K1YA 4NJDA 1D8KA 3ROCA 2H34A 2FSMX 4WF2A 3HOXJ 3AKJA 4BCQA 2BDFA 2C5XA 1GVDA 2EFWA 4OIQF 3VONA 1G5SA 4EEVA 5K7ZA 4OT6A 4H4KC 3GYHX 1J7UA 3SEQA 1VQNI 5IP9J 2ISZA 1TWFJ 4QP2A 3R8PA 4UY8I 2HOGA 2W25A 2KJCA 4FIEA 4EH4A 4D0PA 2UZNA 1FWZA 2LLKA 5AIKA 4RA2A 3C2GA 4HGLA 1Q8UA 4RWJA 1J3HA 4FEVA 4PDOA 2C6DA 3C9WA 2YCRA 4FISA 1LDJA 3CJNA 3S0OA 3FY2A 3SVVA 4BKJA 4UZDA 3GGFA 3ML1A 2ELHA 1PDNC 4WHZA 3G90X 3KX2A 1Q24A 5K4IA 3BQRA 3FM3A 2B9HA 2X81A 4BCKA 1J75A 4UB8C 3LFUA 2UZWE 2LOOA 3U2RA 1B38A 2HYJA 3F8NA 4DTBA 5A2QK 5AP7A 3E7OA 1S29A 1JKSA 1XN7A 4O84A 3PG1A 4AFJA 3KB7A 3QKLA 4H3PA 2KKOA 3O17A 3LCTA 3IK3A 5KHWA 3M1EA 1E9HA 4I7HA 1DI9A 5GJDA 3SZGA 4DNCA 3QQGA 2HZIA 2VL8A 4C3JJ 3HOUJ 5K5RA 1G3NA 4IQ6A 1TLHB 3A8XA 1DPRA 3OYJA 4EC8A 2IEKA 1SAXA 2VAGA 4XKWA 3IC7A 2L54A 1PMNA 2Y0SN 5L6WL 2DMQA 4B44A 4F0FA 4HAMA 2XEYA 4FSUA 1V0PA 3MDYA 1DU0A 4I92A 1E17A 3B6AA 5HVKA 2VO3A 1YS7A 3R9RA 2K5CA 5CVRA 2LVSA 5E8VA 4B43A 2P4IA 3R02A 4YPDA 2ZJ2A 3F21A 5EYKA 4G3FA 4Q5HA 2XKOA 3QKKA 5EGOA 4OTWA 3CESA 3CCEI 1J1BA 4FZ7A 4M12A 4HGEA 4IWPA 1IXRC 1Q8WA 1YWNA 1T2KA 1HCLA 2ONLC 3NNXA 3HBLA 4O38A 4AVPA 2XCKA 4ON0A 4JAJA 4XNFA 1Y6IA 3TV7A 1OZ1A 5BYYA 2UUZA 3ORMA 3LCOA 2ZOQA 5CVGA 3HNGA 1KE9A 4AAAA 3MTFA 4IX3A 3HOTA 2DK8A 2H27A 3JYAA 3F3XA 1H24A 4N4OB 4WO5A 5DPVA 2BAQA 2HK5A 3COHA 2WQOA 2VODA 1P4XA 4OMZA 5LQFA 3E6BA 2C68A 4M14A 1ZG5A 1KE8A 3RCOA 4ACGA 4ZTQA 4BQQA 3ASNH 3DKXA 3VS1A 2KIMA 1XJDA 1BIBA 2ICWG 4NL0A 2GU8A 4MXAA 2I0HA 2JK3A 4FOCA 2VWYA 3OOPA 2PPQA 4BJTA 2EK5A 5I9UA 4AIJA 3WG9A 3U54A 1ZYRF 4Z55A 4DGWB 2WTWA 4I99C 2X1CA 3VUGA 4MF1A 3LLAA 4L9JA 4Y33A 4JLCA 2DU9A 4RA5A 5CQEA 3ODYX 2X6OA 2ESMA 3CCLI 1KOBA 2E9NA 2V22A 4BGHA 1EH6A 4DEDA 2MLKA 2HZ0A 4CCLA 3TM0A 3HDDA 1G8AA 1RNLA 2A6EF 3WYYA 3L2VA 3PFIA 1YX5A 1F43A 4E7IA 3JRIA 4NJ3A 3RDIA 4NCTA 3EKNA 5EKOA 4A6DA 4ZY5A 4HZFA 1TP4A 4EHEA 4ESJA 5IA3A 4HOBA 2Z16A 4BDCA 3PWYA 3A7IA 4ALWA 5DR9A 2PFBA 3TZ9A 3HLLA 4Q9SA 4B6LA 5H8BA 2W5HA 5HCYA 3RAWA 3IKVA 3BG7A 1T6SA 5C8NA 2YIYA 4EOPA 4YTFA 1H28A 3OYDA 4FEXA 4ANMA 2QQ7A 3P23A 2VBZA 3QCXA 4UUSB 2J2IB 1ZGWA 1G3TA 3V8TA 3S2DJ 3BC8A 3KN5A 5JMSA 5JK3A 2WKMA 4GYIA 4JNWA 4CKIA 2WWYA 1LNWA 4YC6A 3D0SA 4FIFA 2K9SA 4XNEA 4NKAA 4YTCA 3DTIA 1R0EA 4XLAA 1DGRM 2VU3A 5HLHA 1WCMJ 1WFXA 1K79A 3PY1A 2UWMA 3OSGA 3PPKA 2K9MA 3F8CA 4QWQA 3BELA 1FIAA 4CA0A 1PRYA 2XNOA 3QUPA 2YU3A 1U5TB 4O0TA 1VJYA 4EQMA 3JY0A 3GCQA 1YOLA 3KXNA 2NRUA 4GG7A 2XRUA 3DU5A 3WE4A 3KMMA 5TR6A 2ITUA 3GEZA 2GIVA 2BXYA 5GJGA 3EZRA 1SMHA 4DE4A 4E4LA 1SMTA 3EYIA 2M30A 2OZAB 3LSJA 5IEVA 4USFA 2XRNA 4NW5A 2OU2A 3IAM2 4PDSA 5FO5A 4AN9A 4LFIA 3VEPA 1CMKE 3RPYA 3DLLF 2WMWA 4N4SA 4JQEA 3UIBA 3QRKA 1D0YA 4RZWA 1OKVA 3OR1C 3KY2A 1OGUA 3CS9A 1VQLI 4J95A 3S1HA 3VQHA 4U45A 3K4KA 1AKHA 4Y46A 1RR8C 3KN6A 2YU9J 3DLSA 4E20A 3H1CA 1K61A 4FA2A 4M3EA 1R6RA 2QEXI 3V5JA 5LWMA 4I93A 5ICGA 2UV2A 2VOPA 3M42A 3BCBA 4D1ZA 2QSFX 3H0GJ 2DA2A 2M0CA 3GW2A 2J5PA 3EMGA 1S9IA 1U5TA 2ZSHB 5DCFA 1BBYA 1FYLA 1PW2A 2WTDA 3W0SA 3RKXA 4R1VA 4KS8A 4AUAA 1QPIA 4C33A 4ZS0A 2WMTA 4RBOA 3B2TA 4IZ5A 4MXYA 2IW6A 2KL4A 3SA0A 4BDBA 3DFGA 3AGLA 4HF1A 1ONVA 2ETKA 1ENHA 2GNIA 3FE3A 3QD0A 4PRJA 3J7AO 4HDVA 3H10A 4HVGA 3TJDA 3FMNA 4NWMA 5M44A 4OOIA 3H0DA 3VS7A 3C3WA 2J0MB 2OD5A 1FYMA 2R7WA 1B4AA 3G73A 3FPMA 4AW2A 4QPSA 2E71A 1ZYCA 4O91A 2XIXA 3IQ7A 4H39A 4QPQA 4I6FA 3EUHA 2BALA 4QMVA 1PUFA 5E9EA 3MW1A 1TC3C 3ZXSA 2VWXA 3R1YA 3QQKA 2FBIA 4JJRA 4HW0A 3AG1H 2CO5A 3CJRB 3HZTA 2QENA 2HDDA 4U88A 3S2HJ 3U8WA 3UNGC 2Q2EB 3I0OA 1N25A 1QL6A 3GC8A 3F5XA 3DTCA 4GCJA 1QPCA 4HGSA 5M53A 4USDA 5DS9A 4QTDA 4BTKA 3ZC5A 5G1XA 4KNYA 1YITI 3AD4A 3CPCA 4Z16A 3R00A 2F57A 1LVAA 3RYRA 4HDUA 4GUBA 4ZYEA 5FRIA 2NNWB 4XLNF 3ZH8A 4JOAA 4YEJA 2FGIA 2WBMA 5EJCA 3O0GA 5A14A 4ZTHA 3EYGA 2FXAA 4GVJA 1Q3WA 4EH8A 4IHTA 5E3OA 1NK3P 4CQEA 3FXOA 5TISC 5E8UA 4FKOA 3UOHA 1KE5A 4L8MA 1SFXA 3K9TA 2Y30A 4KS7A 4TYEA 3KCCA 4LB6B 4FE2A 2BVMA 1POGA 3WTXC 4KYWA 2R3HA 4XLVA 5FBOA 5B2MA 3V5WA 3ABLH 3FHZA 3VUKA 4XP0A 2BFYA 4FTLA 4A3FJ 3DQVC 1X8BA 4RVMA 3AC2A 3EB0A 5J9ZA 3RPUD 5IP7J 2A5YB 1B72B 4G7HF 5DUIA 5DG5A 2H8RA 4OBPA 4XICA 4BACA 4EK6A 2ZV2A 4K0YA 4RLFA 3NUNA 2WNTA 3ALOA 1H1WA 5TT7A 5B66C 2XCHA 3QCQA 2OCCH 2NRAC 3OBGA 5JT2A 3W2RA 1A35A 4FKIA 4LL0A 2XJ0A 5CSHA 1IO2A 3ZRLA 4ANQA 2X51A 2H6BA 3O96A 4FK3A 1KSWA 4JI9A 4B9DA 2HVSA 1XB4A 3TEIA 4PTEA 2OH0E 3PNYA 9ANTA 4A9UA 4FJVA 1ST4A 2FBKA 3OG7A 4DYQA 1YW7A 4GV1A 3I5NA 2RL5A 4X2NA 1K7AA 4H36A 2RQPA 4HCTA 4XP3A 5E17F 1Y0NA 3DEEA 3LMHA 2UZOA 4OBQA 4BAYA 2OV7A 3W2SA 3ABKH 3LOCA 4O7ZA 2LREA 2M4KA 4F4PA 1F1ZA 2I1MA 1UHSA 2XSJC 4OR5A 2PG4A 2ZXWH 4II2A 3RCJA 4FYNA 1XD7A 4RS8A 4YO6A 1LUFA 4RWIA 5HU3A 4FV0A 4M0YA 2QONA 3F6OA 4U7ZA 5KKRC 2IN6A 4QTEA 3C4CA 4ZDOA 3ZEPA 2BHYA 1ZLJA 4K33A 4RX5A 1U0JA 3WZEA 4PJ0C 4ITVA 4JVGA 3QBNA 4N0BA 1Z6RA 4XG4A 2C4GA 3RPUA 3KRXA 1JKKA 4ZSEA 3BKBA 1IN6A 4YZ9A 5EYMA 1XMXA 4TN6A 2PK9A 4YBKA 3DK7A 2D2WA 3D94A 4A4LA 1P92A 5LVOA 1AOYA 2K02A 2AQEA 3H9QA 3IRQA 3FZOA 3RAKA 4YJOA 3S3MA 5AP6A 5EDRA 2K9NA 2R7XA 2IGKA 3TOAA 4AIDA 1YIJI 2CLQA 1H9TA 1Q3DA 5AEPA 1YOMA 2EIJH 4I6ZA 4FV6A 4IAKA 3OYCA 1BOBA 3RK9A 2PVHA 1U9OA 4A4XA 2XROA 2C0OA 1IXCA 2HYGD 4PQNA 4KBAA 3DS6A 1L8TA 5AUUA 4HG2A 3PIXA 2HGCA 2DT7B 5HG5A 1WI9A 4FTCA 4AS0A 5LGTA 5A4TA 1ORKA 2C6EA 1VQKI 3ZM4A 1H8FA 2PMUA 3MWMA 1W98A 2CGUA 3ZFYA 4ALUA 3EPZA 3AGMA 2BE5F 3C7JA 4DZPA 3UC3A 4EUTA 3HL2A 2UVYA 2RFSA 3DBQA 4LLNA 4I41A 3DV8A 2WMBA 5FEEA 4RAYA 1J5YA 3KXZA 4Y7NJ 4F08A 2W1DA 1QZYA 4FSYA 3RMFA 4RZVA 2LH9A 4DFNA 4F09A 4APPA 4N70A 2DA5A 3VWBA 3CIKA 4BTMA 5JR3A 4TWOA 1MBJA 3CDHA 1L3RE 5AP5A 3DGKA 3DCFA 4HYUA 4QQJA 4AZTA 4V0GA 3MV5A 3FI3A 4R8HA 2R7SA 3Q2JA 3QHRA 4UXNA 4U79A 2IAIA 2HZNA 3RKBA 1NW1A 5FEDA 3BJ6A 5D6FA 4ZJJA 2BAKA 3AG4H 4HOKA 2LD5A 1BJZA 1Y91A 3ORPA 4BEHB 4BE0A 2O65A 4JQ7A 1IAJA 2P81A 4F55A 4FODA 1NY3A 2JLDA 2XS0A 3O8HA 1STZA 3GMEA 3CO7C 3FQEA 4JL9A 4ZYGA 3NIZA 1IRFA 3HPGA 3ONQA 1WVRA 2DDBA 4F52A 1ZHFA 2DI3A 4CMTA 2CUFA 3HHHA 2OWBA 3ZLWA 1FINA 3MN3A 4C58A 2R3GA 3V51A 4KIPA 3MKZA 4QMQA 3MFUA 3TT0A 5AUWA 2W7XA 4FV3A 2WFYA 3HV6A 1XCVA 2WQNA 3ELJA 3AD6A 2LYCA 2JKOA 1MIJA 2K85A 1U8BA 2C5NA 1H1QA 3GUBA 5A2QZ 1F9NA 4L3PA 1XGOA 2FYSA 3CTQA 2LMDA 4FSRA 4NUSA 3WI6A 3PQKA 3BL7A 2B9FA 5LGUA 3FLQA 4IRGA 2ETHA 1G8JA 3S17J 2OICA 5D4RA 3A99A 4NB5A 4L18B 2JDTA 3R83A 4NZWB 2Y48A 4E26A 3WTZA 4C4HA 4BXUA 2Z3YA 4LJZF 2EFPA 2VTRA 4UN0C 4FV2A 4NFNA 1ZYDA 2GNGA 3VQUA 2VTSA 3GF2A 3PA5A 5CU4A 4ASXA 5F1RA 3D2IA 4U6RA 5E8WA 5AV3A 3RNYA 4M3DA 3FF5A 3LFAA 1X58A 1KV2A 3IH2A 2KDZA 4PMPA 3LAUA 1ZY5A 3I71A 1JJ6C 4M97A 2G0EA 1SVGA 3ZCOA 3RHKA 5KMIA 4MEDA 4GFOA 3O71A 1GT0C 4YJUA 1P4AA 3FK7A 3O23A 1VQ4I 3DY7A 2QOIA 5CEKA 2R7QA 4PFOA 3QX2A 4G5JA 1R23A 3GOPA 4S0HB 2JD5A 2M8EA 2ZM3A 1K4TA 2YM5A 5BQTA 3D15A 1DPUA 4CT2A 1MJBA 3JY9A 5H20A 4A3GJ 3KC3A 3KA0A 2GFCA 3W0MA 4OINF 5B7VA 2W1FA 3EWHA 3G15A 5E18F 3DKCA 2FSOX 2QR7A 3I0QA 1FVTA 3BY6A 1RR7A 4EJVA 5DEYA 2JDOA 4RLLA 3O8PA 3IDBA 4F65A 4C61A 4J8NA 4EOJA 4EKLA 5CS6A 2V9KA 1Y1VJ 4EH7A 2DS1A 3TYKA 5HQ0A 3GO5A 2JA8J 3TWJA 3CXWA 3BYUA 2IW8A 3DV3A 4V19K 3QU0A 1JQHA 2HTJA 2E2IJ 5HDGA 3CSVA 3LM0A 1IV8A 4NC6A 3MWUA 5FGKA 5KHXA 4QPAA 3ZR8X 3QRJA 3KGAA 3TGNA 1YI4A 1JOWB 2CNUA 2EJRA 2BHEA 1FPUA 2MBFA 1ST0A 1GNGA 3U21A 2X7FA 3MYGA 1E2XA 1HCKA 2XAJA 5D8KB 4MEXF 3GTOJ 4AT4A 1KOAA 3BT9A 3Q96A 2PZIA 4IHYA 1MSEC 3QTRA 4Z2YA 2EINH 2E9OA 4MXXA 4RX9A 3EUKL 2GHGA 4EBWA 3OXTA 3DF8A 3DNEA 4CKRA 4PFPA 3JAMK 2OSCA 3QLGA 5GIPE 3HOWJ 5L6OA 4KBKA 1MNEA 2MD0A 4FKTA 2XSDC 1W84A 3S00A 2GXAA 3BU6A 1XMAA 4C7TA 2BBYA 3LXNA 4CUGA 3ASOH 2BVLA 4RBLA 2EZKA 3HTUA 1FZPB 1BL0A 4ACHA 3ZQHA 3F3WA 3LXPA 3LSKA 2CQKA 5HO8A 4LMYA 4DOZA 1IN7A 3GOKA 3GVUA 5JRSA 4AIKA 4M3GA 2DN0A 3VULA 3X2QH 4D55A 1JT0A 5DVRA 1SFKA 2G9WA 1QMZA 4FT5A 2HQ5A 3VBQA 3EJ1A 5JZNA 5L6PA 4JG8A 3V8SA 4FV7A 2OTLI 4JIKA 4K2RA 3FMKA 1RQQA 3PLSA 2O9LA 3EIDA 2A19B 2DQRA 5A6NA 2DOFA 2CFXA 2Y69H 1BI8A 4J53A 3OP5A 5FUTA 5CENA 1USTA 3ITZA 5FM2A 4K18A 4HX4A 4MTDA 1D1CA 3TO6A 3E87A 4RSSA 2YJRA 1DM2A 2NS8A 4O0VA 2XJ1A 3AAFA 4DGOA 1T46A 2CN5A 4EZ5A 3VPRA 4NTSA 4RIYA 2ZFUA 3NYOA 3CJTB 2ZB9A 4C34A 2R7ZJ 4FKSA 1XH8A 1FT9A 5EEHA 4NHJA 2WD1A 4OTGA 2STTA 4JR7A 3TCPA 3UIXA 3ACJA 5CF8A 5AUVA 3ENHA 3R7OA 5AMNA 3KULB 4BBRJ 3R61A 4ASNA 4RLQA 3UNZA 4JDIA 2RREA 3L1SA 1YJ9I 2OUMA 1VF9A 5KUPA 4GS6A 4BHZA 2CH0A 1CKJA 5L8LA 4I76A 4EJNA 3LAPA 4AE9A 1U5RA 5E8XA 1HOMA 1NTCA 4KKEA 4F9CA 2EV0A 3JRHA 2LK2A 5B1AH 1R1UA 4O0SA 4PL4A 3FLWA 2DMPA 4Y5HA 3I55I 3MD2A 3UTOA 3U6IA 3NVKI 3FZSA 1PMVA 3I53A 4BGDA 2O0YA 4G31A 5LBQA 4QNAA 3UMXA 4RT7A 4YJQA 5CU0A 4O7RA 3UE4A 4JX5A 2WMVA 4IFCA 3TUDA 4H3QA 1TBXA 4B47A 5IT3A 1OYWA 2N8GA 2VTIA 1WWXA 4ACDA 2MG4A 3JSOA 4GU9A 3KRJA 1VZOA 5TO8A 3V42A 1B59A 4MO7A 3BX5A 2PZPA 2EZLA 1KGSA 1MDMB 1UA2A 4U3ZA 3BBWA 3ALNA 3QXOA 5ANEA 4G1WA 2BHZA 5JH6A 2PUNA 3R04A 1GY3A 2VWUA 1SVEA 1FX7A 3R60A 1Y8GA 5HZNA 3KETA 5CAQA 5L3FA 1OIRA 3I79A 3BHVA 4FOBA 3U1DA 1JT6A 3RAIA 3EOCA 3L7WA 4Q4ZF 4EZ7A 3GQIA 1KUTA 3ERED 4O7TA 2JRTA 4B48A 2P2IA 3E8NA 2HOTA 4ERWA 4C0TA 2UW0A 4KSQA 5E8YA 4I21A 2R5ZA 4XEYA 1RC9A 1MMSA 3QA0A 4FCYA 1BW6A 1N75A 3C50A 3LMGA 2H6DA 5K5NA 1E3HA 4G8XA 1H9GA 3OYNA 4D4YA 1YHWA 1R49A 4CO8A 5L2WA 1QVUA 3MTLA 5AX9A 1ZARA 3A02A 3ZHPC 3JRDA 1E3OC 4O2ZA 2UXNA 4EGYA 4I94A 4M8TA 3JTHA 5BPDA 4ZOGA 2GXBA 2KTYA 3TOBA 4GJ3A 4F0GA 2YDIA 4FKLA 5D5UB 4MFEA 4GSBA 2QQ8A 4HYSA 2FSTX 3FM5A 2WEIA 2PEXA 4MLOA 5B2KA 4MH7A 5C9CA 1YE9A 2OXXA 2W1EA 3AC4A 3MKWB 4I0TA 4MBJA 3H9JA 2Y0MA 5J8CA 3FXLA 2CWEA 2XYNA 3KXMA 3BL9A 4XBFA 4JG7A 2P0CA 4QP8A 2XK6A 4L0YB 1BC8C 3D7TA 2YWPA 3LFCA 2QSHX 1LE8A 5E3NA 2MA3A 2CSNA 2O64A 4NM5A 3M8EA 3OD6X 4CG8A 3VS2A 3ZO1A 2VONA 3MMYB 1HW2A 4C2TA 1ZR4A 2F4MB 4WSYA 2FX0A 3SZTA 3AD5A 2PMZN 1IUYA 2O7OA 5L3DA 3MY1A 4K8AA 1Y8YA 4JQ8A 3AMAA 5ITAA 4M84A 4FKUA 2GZWA 3DFCB 3SZPA 1XDSA 4RDUA 3ZBFA 2HZTA 3HV7A 5LVLA 4RVLA 4TYJA 4GK2A 4LG0B 2JBOA 4ANSA 1HKSA 4QP1A 1DGWY 2E35A 3MFTA 4TY1A 5EYDA 3GTJJ 4TYHA 5ANOA 3PXZA 4FICA 2V62A 4NNJA 3UJGA 1FSEA 3DLAA 3ZMZA 3UBDA 3KVXA 3LZBA 4U81A 3W33A 1MKMA 1FOXA 3Q9WA 2XAOA 2DMNA 4QEBA 3JVRA 5EYRA 3QRIA 3BYSA 4AYBA 5H3QA 4XUFA 5GIOE 2YR2A 4I3ZA 1P9QC 4GRIA 2GA2A 4G9CA 3ZP5A 3BWFA 3A61A 2W05A 3S1NJ 4F9YA 2HOAA 3H5RA 3V6SA 2RQQA 4WOVA 2KULA 2PMIA 4E7ZA 4G16A 4UV8A 4PDKA 4ZDPA 4C4EA 3OYKA 3PDTA 3QTQA 4YZNA 3Q9XA 3T0YA 5B1BH 5J87A 4DGNA 4MYGA 5FXSA 3DCVA 2V9VA 5J4YA 4A9TA 2H1LA 3BZKA 2XIYA 4AFEA 4JT3A 3ANRA 4TPTA 4WXHA 2CQNA 2QKRA 2UZVA 3ZU7A 1PXOA 4IVBA 1HBXG 1M1EB 4DDGA 2IGOA 4HSTA 5ACBC 1SM2A 1IN8A 2JDSA 1OL1A 4IADA 3JAMZ 5BVEA 5HIBA 1GV2A 4B8MA 3PVGA 4BY9E 4BCGA 1USSA 3GFWA 4XJ0A 5CI7A 3O7LD 3OZ6A 2R7VA 3MA3A 1PMEA 5HVQC 3IOPA 2IG7A 2WMXA 4UYAA 3VWAA 2QWWA 5CANA 3CLOA 3OYIA 3MH3A 3OT3A 4IKFA 5EGOB 1ZG3A 1AKHB 1WVWA 3WU0A 1FOWA 2W82A 4BICA 4EJTA 2ZV9A 5K7FA 2BZIB 3TZ7A 1YW9A 2GM4A 3R9HA 5KKRB 2C30A 5CI6A 3ECHA 4UWYA 1XCBA 3DXNA 1LEAA 5IQIA 2XM8A 4YSJA 3OFMA 4AZEA 1OCRH 3CD3A 3EYHA 3IKAA 2E9VA 3RALA 3DA6A 3I81A 3EQGA 1MGTA 2R7IA 1G3SA 1ETVA 2VLAA 5CLPA 3P7NA 4RIWA 5AP3A 3U9CA 1B6CB 1MDMA 4L45A 2HY81 2R3PA 5IT9K 3THBA 2A1AB 5HU9A 3Q9ZA 5L3AA 4J97A 1FGKA 4K77A 4I0AA 2W85A 4ZZDA 4QMLA 2UZDA 3DK3A 3D83A 5CLSA 3HUCA 5ANDA 4BDGA 5FRNA 4I5HA 4D2SA 3R4KA 4Q48A 4ZYAA 2HQNA 1FSHA 3L2CA 4FSZA 4BJ5C 1YXUA 3KLNA 1WVXA 1Z05A 1J59A 3GU8A 3PY0A 4JMQA 3REOA 4AWXB 4RPVA 5LMKC 3GNIB 5I9ZA 2OJJA 5DM6F 1MBGA 1UKHA 3GCUA 5FTGA 2EU9A 4UV0A 3ZSIA 2B7AA 4B1RA 1ZYJA 1ZYLA 4BVUA 1NA7A 2ZMCA 1J7IA 1W0TA 1ZELA 4FTAA 1PYVA 5A3XA 3BG3A 4BBEA 1FVVA 4DGGA 3R2YA 3WTSC 1O7LA 1DI8A 3E5UA 3CY3A 4PZJA 4BYYA 3HSRA 2QR8A 4XKVA 2CKPA 3FXZA 3KEOA 1KU2A 2RF9A 1JUMA 2AEGA 4GT4A 3UYTA 5EG0A 3OY1A 2FB8A 3VJOA 2YA9A 4QYYA 2PBIA 3VS5A 1RIOH 3C1DA 2H94A 3DZQA 4M73A 4Y95A 4N57A 2UVZA 3K4BA 3SXRA 4IQJA 1KE6A 4O6EA 4AOTA 5EM8A 3ZQLA 2P7VB 2KJBA 4PJNA 2Z2WA 4JDHA 2ACXA 2K4BA 3T3UA 3N4UA 3ZLXA 3FZTA 4HQMA 1R58A 1X19A 2LC2A 3SW7A 3HAMA 2JFMA 2GHMA 4IPAA 3R21A 2RFEA 4D4VA 2HXIA 5GTHC 4QMWA 4FQGA 1ODDA 2ZKZA 4NC8A 5ILSA 4HA8A 4HYEA 5DI1A 1OFCX 5I9VA 4BYJA 2OBPA 3RIRA 4OW8A 5HCZA 1F0QA 3LFBA 5L3BA 2DTRA 5EQEA 3S14J 4EKKA 4BEHA 2ISYA 4ZJIA 2CUZA 2EZHA 4H0EA 2UW9A 3BG5A 1UVRA 4FNZA 1T39A 4AZWA 4B7TA 2NYAA 3CTHA 4IDVA 3SG9A 3KLOA 5HTCA 1JLUE 4B4LA 1KWPA 1TKIA 2XJ2A 2PVNA 4M3FA 2PTKA 1MRUA 3UP2A 1ZAOA 1RESA 3C4WA 1XQZA 1MBHA 3HMOA 1QPMA 4QYFA 3OIOA 5F0CA 4FGBA 1ETXA 3TL8A 3PRFA 1VQ9I 2M5WA 4EK3A 4RC2A 3FLYA 4WXDA 2R7DA 2A3SA 4NFMA 5JZJA 3C18A 3WILA 3S93A 2ZFWA 1P4WA 2R7BA 3W2VA 3W0PA 3GXLA 2D1HA 4KSPA 3T8TA 1LB2A 5BVOA 2P5LC 3F8BA 1E1VA 3FXRA 4AF3A 4FZDB 5CT7A 2EQRA 3MFSA 3PVBA 4YZCA 3UO4A 5ETFA 3W8LA 3UOJA 3GFIA 1DUXC 4BDHA 4RMZA 3I7BA 5D12A 2LF8A 4YTHA 3DOGA 4C4GA 3A4CA 4DC2A 2IA0A 2TCTA 1ZN2A 5AV0A 3NWTA 4V2FA 4JK1X 4YJTA 3D5RC 5DBXA 2VE8A 2P4WA 4XK4A 3CQZJ 3ZCLA 4KIQA 4F9AA 2JSPA 2BFXA 4O86A 1JWHA 2NXNB 2OIBA 3EQBA 4CICA 2AUHA 4QMUA 2X85A 4IAAA 2ZXJA 3L2QA 1WBSA 2XKFA 2W4SA 5BMZA 2ERKA 3KFAA 5C8KA 4UVAA 2PJPA 2M9HA 1W0UA 4QTCA 2GTMA 3SFZA 5DIAA 4GFGA 5EM7A 3NSZA 3CDLA 2W1OA 1QNTA 3E93A 2JTVA 4E70A 4DTAA 1UB9A 2WADA 3EL8A 3PIZA 1MNMC 5F4NA 5D41A 4DFUA 2EA2A 2QOOA 4DH3A 3GB2A 4J01A 5AWMA 2I7QA 1L3LA 1I09A 5J40A 5E3LA 4KIBA 5LRSA 5DT4A 4A3IJ 2CW7A 3MN2A 2BGCA 2VOOA 4IEJA 3FXWA 3E3BX 4FKVA 1OL6A 1Y1WJ 3Q9YA 4BIDA 4KIGA 4ZTRA 3QUEA 3BU3A 2UW6A 5CU6A 3KPHA 4RLKA 4ANBA 1O3QA 2YM4A 2HKXA 2HWPA 3IH4A 2HPIA 3VVHA 3F2RA 4IE9A 5JGBA 3I54A 3Q0WA 4L3JA 3SW4A 3GXOA 4DH7A 3MH2A 4OTIA 2VO0A 3OWJA 1WAKA 4RQVA 3F61A 2VKHA 2DK5A 3VRZA 5F27A 4ZJZA 2FBHA 3OXIA 3I64A 4IX5A 4AZFA 1U5QA 1WFCA 3K10A 4EHVA 2NAZA 4E7JA 3Q32A 1CSNA 5IUHA 1OKRA 2GBYA 3BZ3A 1P4FA 2JJ7A 3ORKA 3DBDA 2JAMA 2IW5A 3PJ8A 2GS6A 2VJJA 2XAGA 3HOSA 3OV8A 2E9UA 3DK6A 2IA2A 4UEUA 4DFXE 3ZQQA 2VWBA 4I5PA 5DR6A 3ZRKA 5J8IA 3UNKA 2NOJB 1JTXA 3K70C 4ZTMA 4DBXA 3DTEA 1XTAA 1PF8A 3KZZA 2O3PA 3JUHA 3W2QA 3DQXA 2JQ7A 2JMWA 3WIGA 3SV0A 2YAAA 2JAVA 4QSHA 1ZOEA 1AD5A 2DBBA 4GDFA 4MX9A 1Z9CA 3BTIA 3UVQA 3RM6A 3QTSA 2B1PA 2O3FA 3PP1A 3NYVA 4FIJA 5HG8A 1W36D 4G6OA 1V55H 4J7BA 4HF0A 2BDWA 4LDTA 2WU7A 4O81A 3W0RA 4IJPA 3DKYA 3DKGA 1HA8A 4G7ZF 3SDGA 3PJ2A 1ERKA 4D5KA 1OI9A 3CD8A 5IA2A 4P9UA 3IP4B 4DA5A 2XB7A 3V3VA 4C02A 4RGJA 3PO2J 3BRBA 3QAME 3QWKA 1X1BA 2CS3A 4ZEGA 1FPQA 3K4MA 4O21A 1TVOA 1ETYA 1FMKA 2XNGA 3W8QA 3P9IA 3GTKJ 2OKRA 4KBCA 5CVJA 4IZ7A 3LHJA 3FYJX 3OCGA 3BGPA 1APME 4O27B 4O0RA 2DMTA 3COIA 2VPLA 2B0LA 1K83J 3RHXA 3OBJA 1Q8YA 1Q8TA 5K7HA 1J09A 4RVKA 5DGZA 2VTQA 2OJ9A 2Z02A 4FG8A 3CY2A 5AV4A 3FZPA 4MK0A 4U9AA 3ZFMA 2WMAA 2Z33A 4IC8A 4BU2A 3S2PA 2GXGA 3HECA 3FXQA 4TNDA 3QQJA 4U3YA 4I2OA 1FQ1B 2X7OA 4D28A 1G3WA 4HBLA 4DHIB 2BVAA 4DEAA 4EZ3A 4J00A 2QOKA 3NMUF 3DFAA 4D5HA 2OIQA 3U4WA 2VN2A 1K78B 2PU8A 3PO3J 3BR6A 2OO8X 2VX0A 4A0XA 4FR4A 4F9BA 3WIKA 4WG5A 4GW8A 3SX9A 1QHGA 2WTKC 5HNFA 3A2KA 1YXVA 3BLQA 2YPRA 3BYOA 4TWNA 5LGNA 1ZRFA 4IHWA 1FBNA 3E0JB 1M7QA 5ANKA 2DT5A 2QLZA 3RPOA 2PJRA 1ZYSA 3AT3A 5A9UA 4EM0B 4HCUA 2X6EA 1IXSB 3FISA 1M2QA 3A7GA 2COMA 3DBCA 3TKIA 4E7KA 2B7EA 2IS1A 2VRXA 2HNHA 4ZAUA 5A4EA 5CT0A 4QMOA 4M13A 4PWNA 2WTCA 3RJCA 4DGMA 2KPMA 3BCAA 4WK8F 3QP6A 2LSOA 2X9DA 4BIEA 2UW5A 1PJRA 2EFQA 4H3BA 1FJLA 2XV4S 3QPLA 5BVFA 1NVRA 2ADUA 3GTGJ 2X6XA 2JPCA 4AD9A 3MZYA 3E8DA 1I3AA 3UO5A 5HHWA 1QBJA 2XARA 1YI6A 1OECA 1YW2A 4XONA 3LSHA 5ANIA 2AXTC 4E7SA 2ITTA 3H5NA 1LKXA 2L7KA 1YG2A 3CLYA 5M4CA 2BILB 3G5DA 4N6YA 2IA1A 1BC7C 4S30A 3NARA 1D8JA 1UJ8A 3PTGA 4Q5EA 3TNQB 4UB7A 3Q4UA 3BPXA 3MVJA 3W0NA 1X2NA 4XBUA 1WJBA 3F3VA 1YVJA 3RPVA 5HE2A 3ZMDA 3QHWA 2VWZA 3IGOA 3CP2A 5CVIA 4L00A 3C51A 3R01A 1YXXA 3NW6A 2MD5A 3ID6C 2JA2A 2XM9A 2OQGA 1WMKA 4S2ZA 1PVEA 4XG8A 2OK1A 2FNAA 1LVKA 1CKIA 3Q0UA 5IG1A 1E0EA 1HKQA 1JGSA 1U4DA 3SG8A 1XGMA 4Q47A 5E1SA 2OXDA 4I20A 1BL6A 2L01A 4BDIA 2VIXA 3PNTA 2DFIA 2CKOA 2OF2A 2VC0A 3J7AY 4CFXA 4RAZA 3K4CA 4XV2A 3JS2A 5HGIA 2DA4A 4AXCA 4J8MA 3SLSA 1T0FC 4ZSJA 3OCBA 1YO5C 2XAUA 1I27A 2IGMA 5M06A 3IONA 1OIYA 4I6HA 1WH5A 3NQOA 2K40A 1KA8A 3FKLA 4RIXB 4BJJA 4QLCU 5HNHA 4X6RA 3G33A 3CCNA 1U54A 2F4JA 2ITZA 2RN7A 4LV7A 2X1EA 1FYKA 4JX7A 4A3JJ 3GP0A 4XRLA 1OYIA 2AQFA 2GLOA 2HKOA 2VBWA 5HS7A 1Z91A 1TTYA 2E1NA 5BX0A 5AP0A 3MGYA 1RPWA 3ZRMA 3N05A 4U0WA 3C13A 4CRLA 2C3IB 5D7AA 5AV1A 2HR3A 4C2WA 3D7ZA 2XIZA 3ORNA 1LEZA 3WE3A 5GADJ 2NS7A 1GVJA 4ZTJA 4BI0A 3FMMA 3WTWC 4ITJA 4EORA 3W16A 4B8LA 3H9FA 3VO3A 1HSJA 2Y9QA 1ZKGA 4RB1A 1Z57A 4OMYA 3Q2MA 3DTWA 4EOOA 5L3EA 1LP4A 4CGAA 3NFFB 2FO0A 3KK9A 4R6VA 1XWSA 4M6YA 2VXZA 2X7GA 2W99B 2GDOA 3E7LA 3K1NA 3FMLA 5AV2A 3ERKA 4HPTE 2REIA 3SC1A 3EN5A 1H1RA 3KXGA 2ITPA 1WJFA 4JG6A 5KMLA 1MBKA 3PE2A 3C0IA 4L43A 3FL4A 4GCVA 2OXYA 5GJFA 3HRSA 4PDYA 4TWCA 4DEBA 3F23A 5CTPA 1R78A 3ACKA 1X3WB 4MNEB 2Z99A 5BVNA 3P7AA 3L9MA 4HVHA 5IY5H 3PUBA 1K2PA 1EV7A 3HGYA 4DTKA 3SHEA 2L2OA 2KRFA 3TKHA 4LYNA 4CFNA 3LMIA 2KRHA 5EHYA 4AWIA 3PA3A 3NAUA 5L2SA 5HE0A 4HSRA 4BKXA 5J1WA 4XV1A 2WV1A 4I0BA 3E3PA 4EH5A 1YRNB 2XASA 1HOWA 3FY0A 4I6BA 4YUQA 4IVDA 5LCKA 2M8GX 4A3EJ 1S7EA 2Y9YA 4UYNA 3FHRA 4AT3A 4ZYDA 4RGSA 4BHCA 1AU7A 2BZJA 1R5HA 1NH3A 1FP2A 1I6HJ 3F3TA 3RPQA 4X7QA 3ECOA 4FTRA 3O8GA 3HA6A 2PVLA 4DG3E 3WZJA 3FMRA 1P7IA 4XL9A 1YWVA 3K1PA 4EJOA 2CN8A 1O3SA 3CF2A 1RETA 3Q6UA 2VO7A 4DZJA 3LXKA 4HCVA 3HOVJ 5CKTA 1RRJA 2Q0OA 5J9YA 1AGWA 4JBQA 4F7JA 2FQ4A 4O0WA 1EH8A 1LEWA 1OMIA 3EETA 3G1MA 2CQ7A 4UVBA 1H1SA 3CUQB 4U42A 5BNGA 4DH1A 2V7FA 1K6YA 4W4XA 5F9EA 2W0JA 2YHVA 3NUPA 1PJKA 3NW7A 2BAJA 3F0CA 3U9NA 2HAKA 1Q62A 2XAFA 4J71A 2R9SA 4KITB 1CQTA 3EYYA 2HVQA 3R2BA 4D7MA 1E1XA 5ILVA 3O7LB 1ETQA 2XNNA 4C35A 3RZBA 4GIHA 4XRJA 5KMJA 4PMSA 1FOYA 3LFQA 3PG3A 2XIRA 1OBDA 4OTDA 2I40A 3SQQA 3FYKX 4KNBA 1FBSA 4FE7A 5BPIA 1WSUA 4GXOA 3LQ3A 3UVRA 3CCSI 4OIOF 3N4MA 3NDMA 5M3MJ 2BROA 2KIUA 5ACKA 5IPAA 2LGCA 2GIZA 4O82A 5JFVA 3A2CA 4YFXF 3IH3A 3KP6A 3W6JB 2VX3A 1XH5A 4DLIA 3UZTA 1UWJA 4R3PA 3B8RA 3E63A 4GIIA 1JKTA 4NDLA 3EFLA 2B4SB 1U2WA 5C4KA 3U6HA 4HVDA 1GZKA 2YM8A 2QHNA 2WAQN 2E1MB 4G9YA 3E1SA 3LFDA 3C0HA 1B6AA 3ORIA 4RJ6A 4GFMA 5E1EA 2JFLA 1SNXA 4KWPA 2GAUA 2B0QA 5IOYA 4U8ZA 3KCFA 3NEUA 4CSWA 3GUDA 5HLIA 1CTPE 1UFMA 4MNFA 5E8ZA 3E62A 5BS6A 3HRMA 1T45A 2FD5A 1LUJB 3H9RA 3OYHA 2ITNA 4BL0B 4KICA 4V04A 1NK2P 3ZQFA 2DT6A 3UR3C 4L01A 3V6RA 5IH4A 1JNKA 3FKOA 1VYZA 3UQGA 1H01A 3ULZA 5IPJA 2XAHA 4BTFA 3U1KA 4JBVA 3ANQA 3G2BA 2QQ9A 3VS3A 1TZLA 2Z7RA 3BR5A 1SZMA 4BCJA 4R7IA 1M52A 3ZOBA 4I5CA 1REKA 2FOKA 3K5VA 1PXPA 1H0VA 3SOAA 3K4LA 5HORA 5GHVA 3AKZA 4RWKA 5J9LA 2Z5UA 3HUGA 1OCOH 3ORTA 3OMYA 4UALA 2BR1A 2Y8OA 4BZDA 1O6LA 2EXMA 4IXAA 2IWIA 3LA3A 5FXQA 4BH9A 1PXNA 5CSVA 2VI6A 1KZHA 5HBHA 4CTBA 3LL7A 4CCMA 2LP0A 4ENJA 4UUVA 5CAVA 2LRDA 4P1WA 3UO6A 2WTEA 4JDJA 3BWJA 3CF5F 2RKHA 2ZJWA 5FTOA 4XIDA 1GIHA 3QTWA 4Y13A 4P55A 3KYDB 4PTCA 5CAUA 1QZEA 2YIQA 2QLQA 2PZRA 1XSVA 2MGQA 1IDZA 2MH9A 3VF9A 3BJOA 2F7ZE 1WCCA 4JX4A 5BVKA 3H0ZA 2JDRA 3H0YA 1XDUA 4CLJA 4UY9A 2E5NA 2CCHA 3VHKA 3BPRA 3CDIA 2XAMA 5HKMA 1XMLA 4M74A 4PMTA 3PA4A 1F36A 2XGCA 5DRBA 3SOCA 2FSWA 2F2CB 1TW2A 3BTCA 4CYCA 2XK3A 1YIOA 4MUQA 3S8PA 4CZTA 2DJIA 1QQIA 3PFYA 2W4JA 4LG3A 3FAAA 2X9EA 2XUUA 3Q0VA 2J0JA 5HLTA 2ZC2A 4FUYA 2CW0F 3MAJA 3FC2A 4E7HA 2LY1A 5C4JJ 4MNEA 2YM6A 5CVHA 5EOLA 2GNJA 2QBYA 3MIYA 2DXIA 2KIFA 5IMXA 5JRQA 3IV5A 2XUBA 2DA1A 4A06A 5J1RA 4K6ZA 1QA6A 2VJ5A 4IEBA 4O22A 4TZRA 4X21A 4EQUA 2QCOA 4EH2A 3VBXA 3E5XA 3L1PA 4F7NA 5BUEA 2A0CX 3JRFA 2NVUB 5A4QA 4EK4A 3L9LA 3BLAA 4BBFA 3EFKA 2DLLA 3RK7A 1DQUA 3GVAA 1YHVA 3P0MA 4DG2E 5M4IA 4W4VA 5EI6A 3CZ6A 3VIDA 4DYCA 1FNNA 1JKRC 3G9NA 3S4QA 5I9XA 3BHUA 2L5QA 4H58A 3PJ1A 5KE0A 5K5QA 2Z7SA 2H8HA 3ZDIA 3HRUA 4NT4A 5J5SA 4JQFA 2R3KA 1M17A 5F08A 1I5ZA 2UZKA 1K78A 2A27A 3VB2A 3WG7H 3UKGA 3WOWA 4F6WA 2JIIA 2EB2A 2CQQA 3FMSA 4LM5A 4U41A 2EUFB 3TMOA 4V2GA 2MABA 3R1QA 5EKNA 5CQUA 1TQPA 4DFYA 5FRMA 4L6QA 3WGHA 2FUG2 3PIOF 3ZLSA 3R8ZA 2QQAA 3DU8A 3POOA 3W18A 3BR3A 4WCGA 3T9IA 4O5VA 3SDJA 4BCHA 3ZN0A 5JFXA 5KZ0A 3UG1A 4MQ2A 5M57A 3TXOA 2XKPA 2ZJRF 5LVPA 5EQPA 2PLYA 5EHOA 1FOTA 5BMMA 2YM3A 4MVFA 5FFXA 4AE6A 1REPC 1G8XA 4QNYA 3ZO2A 1H26A 4PSWA 2WTVA 3BHYA 3KQ7A 4ZSAA 3R1NA 3VBVA 3FBVA 1WBNA 4MTEA 4LLLA 3I3LA 4BQOA 5E1XA 2ERZE 2PE0A 4BTJA 2OH4A 4IC7A 3KMUA 1T56A 1VZ0A 3WGGA 3D4QA 5J4VA 1IDYA 2Z9OA 2PVKA 4MHGA 1SC7A 1JGGA 3Q3SA 3V8JA 1XS9A 3PXQA 2LG4A 3W2CA 4QP3A 3HV4A 4YZDA 4NC7A 4FSQA 1KONA 1JE8A 3HB9A 5IMEA 2A07F 2HI3A 3OWTA 2DYSH 3SXSA 4M71A 2EFOA 4X2KA 3NWSA 4JX3A 4YJPA 4XKCA 5E1WA 1IV6A 1B8IA 3RAHA 4AXEA 2O2UA 1MP8A 4EMSA 3BPVA 4WBOA 1V1KA 2C6MA 2ZV7A 2QVOA 2MFZA 1ATPE 4JBOA 2L7MP 4ESBA 4ZH4F 3DPLC 1BI0A 1FGIA 4C2UA 4X2GA 4DYRA 1O6YA 3GCVA 4FSMA 2VN9A 3LKMA 4V0GB 3WZKA 1XG1A 1DS5A 2SRCA 3WF8A 3KP7A 2XHKA 2G7UA 5LEKA 1WH7A 2YWVA 1OCCH 3OCTA 3WTUC 2CMWA 4L53A 4AIHA 3I4NJ 1P6RA 2J0KA 5JQ5A 2ETMA 2GNFA 4MQ1A 5FDXA 2WPAA 3GU5A 4QP7A 5E8GA 4ZY4A 3HKZA 3V7RA 2QF7A 5EEAA 1AWCA 4O7WA 2X39A 3UG2A 3W1FA 5ETAA 3VYTB 3DB6A 2O8YA 4BDAA 5T68A 2DTZA 2AHQA 1IGNA 5DCMA 3EQRA 2R3JA 4HX8A 5AUXA 2IS4A 4HYIA 4MWHA 2QU6A 3HX4A 5JHUA 2M1BA 3HVCA 2CG4A 5AP1A 1SAUA 3BJAA 4DFZE 4X6QC 4A2UA 2K86A 5JGDA 2WQBA 2VXDA 3G71I 4FT9A 4ZLOA 1ZLKA 4I5MA 4CT1A 2LKSA 2E1OA 4KINA 4LRJA 3S3NA 2NP8A 2XDVA 5CJ9A 1IG1A 3ZGKA 1X1CA 2CGXA 3TEDA 4AUXA 2IZRA 5HNGA 3Q52A 4XOYA 2UZTA 2Z8CA 4DITA 1IRKA 1TWGJ 3BTJA 2YITA 2C47A 1B1BA 1ZY4A 2ZB1A 4LV5A 3KYCB 4JIAA 4RC3A 1M2RA 3BV3A 4X2JA 3QA8A 4IACA 3GLLA 4JOMA 2K4JA 1PXKA 3GEQA 2O5RA 3CGOA 4Y17A 3TNWA 5FQDC 5HDNA 4WG4A 3KVWA 1U9NA 4XLEA 5D6EA 1L0OC 5BNJA 2E7WA 3O5AA 2VTPA 1OPCA 4BZOA 3IKTA 3OMVA 3FMDA 4C59A 5ERIA 4KIFA 4PY1A 2FVDA 2WMQA 5ICEA 3AMYA 4FKWA 3ORZA 4YTIA 3W32A 4YNOA 3QYWA 3ELKA 4NQWA 2Y4PA 3I60A 5EM6A 4RFMA 2HDWA 2F6CA 3FHIA 4Y83A 2ITXA 4F7LA 1G3YA 1R7JA 3FC1X 5IH6A 3H3ZA 5IT9Z 5HIDA 3H4JA 2GS7A 3AL0C 4Q5SF 3EFJA 2L9SA 4YR8A 3U55A 2L3DA 1PYXA 3R0AA 3I6UA 4FV1A 5HVYA 3ZPLA 4Z3VA 3VC4A 2BRGA 2IBDA 5C27A 3NEWA 2CQXA 2PMLX 5M51A 1I1GA 2PWLA 4LIVA 4LUDA 3HMMA 5JFWA 3DXQA 2OBJA 3FLZA 3JR9A 2GCDA 3P9KA 2CJJA 1ZR2A 4LFUA 5M08A 4FVRA 4EH6A 4GFBA 5IA1A 4ZC3A 5IUIA 2UXXA 3O50A 4CZUA 5H6QA 4JRVA 3NYXA 3R9NA 3QYEA 4FV9A 4D9TA 3GTMJ 2HU9A 4PL3A 1PXJA 4XRFA 4FGRA 2WMUA 2JKMA 3QL8A 5HVJA 2LKXA 2UZEA 3F69A 3KIOC 4O7SA 3A4PA 4LIUA 1OISA 2YN8A 2XNBA 4ASZA 4U97A 4EI4A 2Y0SA 2B9SA 1CF7A 4GUEA 4DHFA 4IVCA 4HNTA 1YQJA 3QCYA 3LMMA 4PK4A 4M6XA 4QMYA 3OW4A 1BI3A 2VQLA 2RFNA 4M72A 4I6QA 3LFNA 2R0UA 4EATA 3BBTB 5FKLA 4TXCA 4YG2F 4KRCA 3BIZA 4FIIA 3GFLA 3DAKA 3PUPA 2YAKA 6PAXA 4K11A 2C69A 2IPXA 4QQ5A 4RIWB 4XHKB 3FKNA 5CVVA 5JKGA 1H1PA 4JR3A 4HGTA 5JVTA 2IZUA 2YZAA 3UOLA 1WJEA 4FTIA 2QOFA 3ENMA 3AT2A 5JLXA 2RFDA 2W96B 4CXFA 3MY0A 3DPTA 4MD8E 3G6GA 2C0IA 3LVPA 5AUZA 1D0XA 1Z3YA 3LFEA 4DQ2A 2F49A 2P5KA 3F6VA 4AQKA 4YIFA 1STCE 3RWQA 3UPXA 4J52A 2E36A 4BIBA 1I50J 3Q9VA 4IJ9A 1SD5A 3AQVA 2DAOA 3RPRA 4YHTA 4BQNA 4HF2A 3GT8A 1QGPA 2DA3A 2QOCA 3TBIA 4IM3A 4WD5A 4XKBA 1YI2I 5IQEA 4C2MJ 1O9UA 3WF9A 3QXPA 5HOOA 1YOVB 3FX3A 4HPQA 2W57A 4S32A 4QOXA 4BE1A 4PCQA 3A4OX 3KEQA 2UW7A 3ZYAA 4XV3A 3LSIA 1A31A 1ULYA 5FROA 4RB2C 1LEBA 4RA4A 3ZFXA 3IG7A 4LLGF 2XF6A 3DXPA 2CGVA 3RTPA 4FKGA 2W17A 2FJ1A 4OTQA 5AIPA 4J19A 2X8DA 4FL2A 4CRSA 2WAQA 3MBLA 4TYHB 3E3VA 4XN3A 1V5FA 3BHHA 4UWCA 4E5BA 3AFHA 4G94A 4ZP5A 1CM8A 3L9NA 2R5TA 3IL2A 5CASA 3T5XA 1O7FA 3WARA 4FV8A 5H9BA 3A62A 1T0FA 3MESA 3L8VA 2EBIA 3DDQA 3MVMA 2PZ5A 3PFQA 3JCUC 3CQUA 3HC7A 4BBMA 1CF7B 2QURA 3JSPA 1S3JA 2B52A 4F3QA 3J80Z 5CEQA 1WHUA 4NK9A 5HLWA 2NPQA 1V5EA 3G51A 3WU1B 5C4XJ 1NXKA 1WQ2A 2R0QC 4RAGA 4CNHA 2B55A 4ZSLA 5DN3A 3CD6I 4GT3A 4AGCA 1W7PB 4WA9A 3DZOA 2JIUA 3T3VA 4E4NA 3WZDA 2AS5F 4XLIA 3BG6A 4KUMA 3V4GA 2ZDUA 3OCSA 2XEZA 3LCDA 2VQGA 5EDQA 3CMEI 4E93A 3HV3A 3BE9A 1MD0A 5D1JA 2MYSA 3V8LA 1YDTE 1HSTA 5IYCJ 3TW7A 4IX7A 3Q5FA 4ZXTA 1TNTA 1TWHJ 4YJSA 3G1LA 5TF9A 4BDZA 4GEOA 5KMKA 3BLYA 2GWRA 2H8WA 3FPQA 2LF7A 2O0UA 3HYIA 1IN4A 5IQFA 2BTRA 3FI2A 2IVTA 4FVPA 4ZLZA 2HQAA 5DRDA 4H05A 4DN5A 5I9WA 4EBVA 4QMTA 3UDSA 3JRCA 5CALA 3F22A 1ZOHA 4M7IA 1YI3A 2DYLA 4I09A 2LBFA 2CDZA 2WY8Q 3BU5A 2V9PA 2CJMA 2X8IA 2QD9A 1I3QJ 5IA0A 5AIQA 5H2UA 4PNKA 2W9ZB 2H6CA 4P9FA 2K9LA 4FEWA 4U87A 3ISPA 4I4FA 3TZMA 2CUEA 4O6LA 5K4JA 4R5YA 3RZDJ 2F2EA 2QSGX 2JC6A 3C1XA 5J8FA 3E6MA 4FEQA 1MUOA 3QTZA 4UB6C 5ANGA 4LD5A 4H1MA 1J1CA 1J0RA 2Q8KA 1Z6TA 4R3CA 2WHBA 2J7TA 4FTOA 1SD7A 3G4SI 2BY2A 3N51A 4KA3A 2DDAA 4XLCA 5HLPA 4S34A 3VFZA 2X4HA 3F7ZA 5CZHA 2JT1A 4F6SA 4OAZA 4BF2A 3PL8A 1U54B 3DAJA 5D7VA 4ENNA 2QC6A 5KMOA 3CMYA 2R5ZB 3QX4A 4L0ZB 3JW4A 1UELB 4W8EA 4XMYA 4HZRA 4IB0A 5M4FA 1OJLA 2OIDA 2FA5A 3QQAA 2DPUA 1ON2A 2KISA 1X1PA 2XF5A 1YYVA 2C5YA 4PF4A 1OR7C 2R5YB 3SAYA 1WZYA 4J98A 1T8IA 3MJ2A 2A61A 5G6VA 3I5UA 2X6DA 1LDKB 2I6LA 3FZRA 3G6HA 5JVGF 2X4ZA 4F64A 3L8XA 2V0DA 2XPUA 2C6TA 2IW9A 2YX4A 4F91B 4O6JA 1YHQI 3ZXZA 3ABTA 3SKCA 3Q9SA 5BPYA 3RVGA 4YIIA 3SRVA 4E6CA 5HE3A 2GSFA 4MWIA 2HVRA 4C4IA 3PUFC 4PP9A 4D4SA 2DW4A 1T33A 2H09A 5AA9A 3KULA 4QYHA 5IUGA 5C4LA 2OJIA 1LFUP 4D4RA 2RNJA 3ROUA 1Q61A 2R7FA 2PUUA 3WE8A 1DDNA 4O0YA 4XBRA 2M3AA 1AHDP 4OWRB 2WB1A 3CC7I 3E64A 3IDPA 1JPAA 4FKJA 1P2AA 5LVMA 2QA4I 4Z7HA 4FEUA 4W4YA 2XGEA 1URCA 3UDBA 3S1QJ 3OYFA 3KRWA 5KNLA 2YABA 4ENXA 4FHTA 1IEPA 4AXFA 4KJZA 1RDQE 3K6GA 2V6CA 2M87A 2XH5A 3VDXA 1IW7F 1SVOA 4I98B 4U0YA 4E4XA 3EQLF 4MNUA 2QGUA 5K5OA 4QTBA 3OWLA 3W55A 4DYMA 4AW5A 2F7EE 2PVFA 4EHZA 3I5ZA 4M9ZA 4C3HJ 1MH3A 1G8KA 5B0XA 4QDVA 5I5ZA 2YUSA 3VSLA 5DEWA 4L7FA 1B9MA 5A6OA 5EQYA 3PM1A 1MNDA 3BR0A 3HZJA 3KEYA 2OTJI 2G2FA 2HQRA 4ONAA 2XKCA 3RP9A 4ZLYA 4FKQA 3H9OA 5I4NA 4YURA 4E6DA 2W84A 1JSUA 3LJ0A 2COBA 1TWAJ 2ZNYA 2F9GA 2ETRA 1O4XA 1UWHA 4XMOA 5IQHA 1AA7A 4XCUA 4LK0F 2WIPA 4EUUA 1WI3A 2ZMDA 3GZ6A 4YFNF 3FSKA 3HA8A 2X0GA 3M9AA 3Q4TA 3SXYA 3DKOA 3PSBA 1K6OA 5BUJA 1Q1HA 2P33A 5DTDA 1JKLA 1WVYA 2XK4A 1MMAA 1W5CC 2QKMB 1M7NA 3TNHA 2R7OA 3NFGB 3W2PA 2XNMA 1UNGA 2ZAZA 4ZMFA 3W0OA 2R92J 3G6EI 3OC1A 1P14A 1Y56A 4QP6A 1VNDA 4UX9A 5L2TA 2G2HA 4KRDA 3IDCA 3ULQB 1IC8A 3O8TA 3DLZA 1R39A 1XMKA 4K9YA 4L9VA 5HCXA 2EV6A 3CTJA 4Y73A 4PSXA 2C6OA 3EQFA 1ZG1A 2Q1ZB 3WYXA 3AC3A 5HD4A 5GAHJ 5F0HA 3RJPA 2L02A 2QCSA 4AA4A 4F1TA 5JSMA 2F7XE 2Z7LA 2E19A 2VTMA 3QPHA 2C3LA 3BI6A 3J81Z 3NCZA 4FT7A 3KXHA 4CCJA 4BN1A 3LCKA 2M0MA 3K2AA 3O6BB 2YERA 2Q83A 2ZFYA 1LR4A 3KREA 1Q41A 2VZ6A 1F3MC 2CCIA 4WIHA 1WRJA 3LQ5A 2CV0A 3QFVA 3WHBA 4FZ6A 2F48A 3QTUA 4O96A 3NRMA 3HL7A 5IZFA 5AJQA 4KISA 3DEUA 1BA5A 1SYKA 4AGWA 1R00A 3K70D 5FM3A 5F20A 3FWEA 3F9NA 4BCPA 5LLQA 4CZCA 2O8XA 3HGGA 4EOQA 4A9SA 2KDOA 3F8MA 3SJMA 1H4LA 4MTAA 2BIYA 4PP7A 4HLXA 1IA9A 1ND4A 2IZSA 5EG0B 1GZOA 3UIUA 1BIAA 4BHNA 3LA7A 3UQCA 1KU9A 2A6HF 2CGWA 1T38A 2KP6A 4JXFA 3CCJI 4C37A 2JA7J 2WTJA 4AYBN 3F8FA 3PP0A 3QODA 1FBQA 3CGFA 1A04A 2C3KA 3GQLA 4BBSJ 4AU8A 3MPTA 2Y4IB 2ONLA 3EH9A 4FMQA 5LOHA 4KKGA 1SFOJ 3OTUA 5HE1A 4IWDA 1TL8A 4DCAA 4D0XA 4FUXA 2BW3A 5CXHA 4MQ9F 1XH7A 2OF7A 2VTOA 3A01B 3HDMA 3P7BA 1F5QA 4FX0A 1R5ID 3HV5A 1AQ1A 3QU3A 4FSWA 2KMUA 3NUYA 3KL8A 2DJNA 3JREA 3R6XA 1YX3A 4S31A 3S95A 4A3BJ 3I56I 2NOGA 4IWOA 2VUMJ 3UGCA 4RB0A 2DQLA 5F94A 4A9RA 5HBJA 2ZVAA 3NAYA 2QI8A 3PZEA 2QZ8A 2VJ4A 4II5A 2BZHB 2GMXA 2ITVA 4IB5A 2K7LA 5IDNA 3R7IA 5LMBA 4OTHA 5J95A 1N77A 3DU6A 2QOBA 4OTFA 2JKKA 2HFHA 3R1SA 1JTYA 1O3RA 3L8SA 5E8SA 1JHHA 2PVYA 1OL7A 2JEDA 1R1VA 3FWQA 3QD4A 3FMEA 3GU4A 3J7YJ 5EHLA 1PKGA 1UNLA 1PXLA 1SFUA 2ZYBA 3LJ1A 3DP7A 4I6LA 1BLXA 4A69C 1FBUA 3G3ZA 3PYYA 4JX6A 5KVRA 2BRMA 1VFCA 2Y75A 3DJ6A 2XP2A 4AXAA 1T95A 5EW3A 2PUPA 5F64A 1R36A 2JSCA 5FKKA 3FDNA 2NVTJ 3AG9A 3V04A 2Q2EA 4QTRA 2XMYA 3ZUVA 2EV5A 5CAPA 4MXZA 1PMUA 4CMUA 4ARKA 4A93J 1ERDA 2VTLA 1TWCJ 4EYMA 1U59A 1FVRA 2DODA 2XB5A 2ZMEB 2YJSA 3R9DA 4DT9A 4FV4A 5CY3A 3FXKA 5JFRA 4R1YA 4B4CA 2BHHA 4KAOA 4F0IA 4O0XA 1I44A 1Y6BA 2RC4A 4O83A 2LDUA 3I6WA 5KZIA 4U80A 4RG0A 1NG6A 3NZ0A 2XF7A 4W97A 3ORLA 4WNMA 3ORXA 4P90A 1Y8RB 2HWVA 1JXSA 3NWWA 2XK7A 2J9MA 3K69A 2VBXA 4AA5A 3S16J 1U5TC 3QD2B 1OPLA 4UXQA 5FDPA 2WZJA 5CNOA 3ZTXA 3TKYA 1X3ZB 2WEVA 4R77A 3NRVA 1ZK8A 2HXQA 5M5YJ 5E8TA 2OLCA 2I8DA 2OU7A 5CU2A 2R7UA 2QHMA 3D9VA 3L00A 1JKQC 1R4MB 4KUJA 1OCTC 5FBNC 3P9JA 4WBBB 3W2AA 1YLFA 3SDBA 2IT0A 2Y6OA 5HO7A 2LKPA 2IGNA 4USEA 5EW8A 4Y72A 3F72A 4B0GA 4BDJA 4YMJA 4IZAA 5CNNA 3I9V2 5EDPA 2PVMA 3ET7A 4ZZNA 4LOOA 4IHSA 3HUGB 3EL7A 3FXXA 1GXPA 3BV2A 4HEA2 4IX6A 1R9TJ 2W1HA 2L4MA 1HC8A 2OFVA 3BQZA 2IVUA 4UUTA 4B99A 2E2HJ 1KYZA 2XYUA 3MJ1A 2M45A 4TWPA 4KABA 2O6GE 4YJNA 5L8KA 2PE1A 1GXQA 5KBRA 2GQQA 3KMWA 4BXXJ 4BRXA 3LSMA 1BKXA 4KN7X 3WTVC 1D3YA 4LGGA 3D1NI 2WA0A 3F66A 2V7AA 4U7BA 4CEGA 4QMNA 5KHDA 1IRXA 2GOMA 4BDFA 3QQLA 4WUNA 1BI1A 3NYNA 5GPAA 4FTNA 3P78A 3LM5A 5LJJA 4GKHA 5I0BA 4WUAA 1R5GA 4IHVA 2W1GA 3P5JC 3MI9A 5BYLA 3V8KA 3GTQJ 1A5JA 3L2RA 4IWQA 3VYSB 3IWZA 1F5TA 3PQJA 5T3QA 2A6TA 2EIKH 3QTIA 4YU2A 2LY2A 3QRUA 2IS2A 2W1IA 3FBIB 5GPCA 5AAFA 3QYZA 2JBPA 4LI5A 3LPBA 4UZHA 2V1UA 1JUPA 2XAQA 2HW7A 4XOZA 4EGZA 3MFRA 2B53A 4NKSA 4FTMA 1E3PA 5E91A 4NIFB 1H0MA 5LVNA 3OY9A 2PYWA 3L9FA 3PSFA 4D7NA 3TL4X 1ON1A 4F92B 1Y39A 2Y4IC 5EH0A 3IRRA 4ZTSA 4YIRX 4DINA 3WU2C 1HF0A 3PXRA 3KRLA 5IOZA 1W36C 3LIJA 4GO1A 3A0HC 1YOJA 4V01A 2FU4A 4I0RA 4GL9A 4QRCA 3KXXA 1LFPA 3AKLA 2YFXA 3JVSA 4WT6A 3CJGA 4HRIA 2C1AA 5IA5A 4U40A 2BRNA 3VRYA 4BR3A 4OTRA 5L3CA 1G8SA 4EONA 5DD8A 3VJNA 1WJCA 3K0LA 3DQWA 2W00A 2KLOA 3HMPA 4LG4A 4YP8A 1SNUA 3BEAA 2W7NA 4G6TB 4A3LJ 3FJQE 2OAZA 1BI7A 3WHCA 3NVMB 4TW9A 5KAIC 2LNBA 1A9UA 1GIJA 2A4LA 2QO9A 4DW6A 5E1ZB 5HTBA 5TOZA 2EFNA 2PMZA 4EWHA 4P5QA 3VUIA 4XG9A 4F7SA 5EF6A 4KA4A 3KF4A 1RUNA 3HM5A 4QDEA 1GJOA 1GIIA 1GUUA 5A54A 1VQMI 4XORA 1QO0D 2XC7A 5BVWA 2EH3A 2YIWA 3HEGA 5JEBA 2GHLA 3VODA 3C5IA 1G4DA 2FE3A 2JIVA 2JZYA 5E7RA 3FMJA 5T6KA 5HNBA 3K2LA 3OT8A 3RKQA 5FLXZ 3TN8A 2V1DA 3NNWA 3VYRB 4II3A 2UW3A 1FP1D 1IA8A 5E92A 3CE3A 4PDPA 1JKOC 5HLGA 2EPFA 4J99A 1GAGA 3ZQ7A 2X4FA 4PGHA 4R3RA 3NUAA 4OIPF 3DPUA 3GBZA 1U78A 1ZZLA 4NW6A 4NQWB 5CF4A 5CF6A 3MA6A 5C8MA 3VSKA 3I59B 2RNGA 2NVYJ 3FLNC 3TJCA 3CTAA 1PP7U 4DIQA 2XK8A 5E8IA 3FMQA 1HDDC 2PJRB 4E6AA 2IPQX 1NVQA 4RVTA 3ZBXA 5FKMA 4CDGA 1I6XA 3LSRA 3QKMA 3S32A 4RJ3A 3KFWX 5C03A 1D1AA 2Y7JA 5DT0A 4RGXA 2J51A 1Z9XA 1P2FA 4IZZA 3MKYB 4S05A 3MB6A 4CFWA 2IJLA 3NAXA 4E1ZA 4XM3A 3CPBA 2ZBKA 3ZMVA