3TMOA

The catalytic domain of human deubiquitinase duba
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
141
Chain Sequence
AARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Phosphorylation-dependent activity of the deubiquitinase DUBA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords OTU domain-containing protein 5
total genus 33
structure length 141
sequence length 158
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tmoA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tmoA01
3PFYA 3TMOA
chains in the Genus database with same CATH superfamily
3IPHA 2GLOA 3I4MJ 3F21A 4L46A 1WCCA 4TKSA 1UAAA 2F7ZE 2X4HA 4WKQA 3P9KA 5CVIA 2BFYA 2CHLA 3PFYA 1OYIA 4WXHA 2VJ5A 4GK2A 3L8XA 2QQBA 3KMUA 2HAKA 1YRNB 3WHCA 2DMNA 3L2QA 4HPQA 4QMPA 4I23A 1V1KA 4ZJZA 2R3SA 2BIKB 2IW8A 4HF1A 2ZYBA 2O5KA 4C0TA 4H1MA 3G2BA 5CXZA 5H8EA 4XKVA 3DU6A 2QWWA 3KIOA 5C4JJ 4RT7A 3MFKA 3NPCA 4Y5HA 1ZRDA 1YOLA 1TWFJ 4R3PA 4ZDPA 1D1CA 3DBCA 3KREA 1SM2A 4LLLA 4DBNA 1RR8C 2EBIA 1ZY4A 3TI1A 4G9RA 3PVBA 4HZSA 3G73A 3I4NJ 5FTGA 5BX0A 2QO2A 4DHJA 2WPAA 3ETAA 1ND4A 3REPA 4ALUA 1AOYA 1BL7A 1XN7A 3R63A 2CN8A 4AX8A 3J81K 3K2ZA 2J0IA 4UZHA 5A3XA 2YM3A 2VNYA 4X1EA 3VS5A 2VWBA 4OMZA 4O0YA 4I76A 1HW2A 3UQGA 3FIWA 4RWKA 4PCQA 3EFKA 5EJCA 4YBJA 1L3RE 1PRYA 5IEXA 3R0JA 5IA1A 3MVMA 2O63A 3C4WA 4JXFA 2H8WA 1Y8RB 3AG9A 5IT9Z 3BG3A 4ETSA 4TW9A 2XBAA 3OL4A 5HD4A 2DA7A 3V04A 1TWAJ 4KIOA 4YTFA 2F5EA 3R0AA 3MPAA 3W0RA 5FGKA 2QSGX 2I8DA 2VN9A 2RF9A 3CO6C 2W9FB 5AP2A 4E26A 3KL8A 4TPTA 5CJ9A 3Q9ZA 3F3XA 4CTCA 2O7OA 3LMGA 1E0EA 4M67A 5E20A 5DR2A 3HA6A 1WBPA 2W1DA 3OWPA 4MD9E 4YHJA 4DYQA 3F3TA 1AA7A 3HJEA 2Z3YA 4XN0A 2VODA 4AQKA 4NJ3A 5AX9A 2PMLX 2CGXA 4E1ZA 2WD1A 1T56A 5DYMA 1ONVA 2C0OA 1SNUA 2ZB1A 3OTUA 5HO8A 2P3GX 4FTQA 3K1PA 2WB1N 4R5SA 3GCUA 4FKVA 4I6BA 4F6UA 5ICPA 2BRHA 4QWQA 1LFUP 4FI1A 4YTIA 3H3ZA 5M08A 4BHNA 4UXLA 3CCLI 3QUPA 2MFZA 3ISPA 3LA3A 2CJJA 3QHWA 4FNWA 3ZC6A 2E9NA 3L2RA 1W5SA 2P5KA 3CCVI 2EPFA 3MKLA 3QP6A 3ROYA 2E71A 4XSXF 2YWPA 2JA5J 2OF4A 3K4BA 4K18A 4QMWA 2EFPA 4JDJA 3P9JA 1BIAA 4UB8C 1O3SA 5AADA 2XK9A 2Z8CA 2XYUA 1OB3A 3EQLF 4IVNA 4LOPA 3CMMA 4E93A 4F6WA 3LFKA 4LUEA 4EVIA 5CXHA 4X7QA 2XJ2A 4UYNA 3BWGA 4I5PA 3NS9A 4M9SA 3GW2A 2C1AA 4XP2A 3A01B 3N4UA 5IA2A 3CQUA 3EUHC 5CQUA 5HVKA 3F61A 2M1BA 1QPDA 3C0HA 4TXCA 4FX3A 1J7LA 3FI8A 4IEBA 4FODA 1B72B 3DZOA 1OPLA 2OPTA 1FC3A 1W0UA 3OOUA 3TZ9A 3QTUA 3QCQA 4FNXA 4XLFA 4MX9A 3UVPA 5J9ZA 2OIDA 1I1GA 2A68F 1KQ0A 4M84A 1JWHA 4X3FB 2FE3A 1ODDA 4B8LA 2NRUA 4U5JA 4L18B 3TN8A 2IAIA 2IVSA 5M4UA 3BR6A 4IM2A 4CQEA 2VD5A 1OL7A 2JRTA 2NVUB 5CEKA 4LLNA 1MQ4A 4BHBA 4MEXF 3VBXA 4Q5SF 2HKXA 4YIRX 3WF7A 3ZZWA 1JHFA 3A01A 1QO0D 4MLOA 2A3SA 3PP1A 3WIGA 3KK8A 2CGWA 2C1BA 3E5QA 4DA5A 1A48A 1CSNA 1LEAA 3JAMZ 4FZDB 2YN8A 3LXPA 4I5CA 3QRIA 5DBXA 3KA0A 3ZMZA 2J5FA 2WMQA 2NVXJ 4W8EA 2BY3A 2L9NA 5H6QA 1QPJA 1PUEE 3GC7A 4IJ9A 3A99A 2BHHA 4ITVA 5FFZA 2V5QA 3O7LB 3EZVA 1WJ5A 2UVZA 3PXZA 1UFMA 4F55A 4FT3A 2KQRA 2XB7A 4YZCA 2DOFA 3ZLYA 4GVJA 3RTRA 5K4IA 1TWCJ 3RKWA 2R64A 3PG1A 2VQHA 4Z7GA 3UNKA 4H3PA 4C4GA 2O0UA 3UJGA 3UOLA 4GYIA 4ZTLA 3PA5A 4RJ6A 3GOKA 1LDKB 4XG9A 2HS5A 5BYLA 1O3TA 4LK1F 3AMYA 3FJQE 5DPVA 4TWCA 1SVOA 5D5UB 4IKFA 1JJ8C 4ZZLA 3O3KA 2F4MB 2E1MB 1AHDP 3NUNA 4FT8A 2UZUE 3CJQB 4MBJA 2V4JC 4TY1A 3DNDA 2I0EA 2VBXA 2JVHA 5CAQA 3VONA 3ERMA 2C6EA 4EGZA 2JMWA 3DDPA 3UP7A 1JNKA 5E8ZA 5IH5A 5DVRA 4EC9A 1ETVA 2H1KA 3EYYA 2ZXIA 1Q5KA 1I3AA 1YIJI 4B4LA 3B02A 1P7IA 2RGPA 4FK3A 4XLCA 5D7VA 3KP2A 1EH6A 1E1VA 3O7LD 4QTEA 4FISA 4DC2A 2BHYA 4OIQF 5ILVA 5F0CA 5FEDA 1ZYDA 2CLQA 1U5TC 3ENHA 5CVGA 2F5DA 3FXOA 3FKOA 3BTLA 4Z6YA 2WIHA 4PTGA 3SG8A 4C2WA 5KMOA 2XP2A 1UV5A 2JRMA 4LV8A 5EEHA 5F20A 4WXDA 4ZS4A 5LQFA 5J1WA 4ARKA 4OLIA 2C0IA 4U7DA 1JT6A 2VNWA 4HW0A 1Y0UA 1OGUA 4FETA 1V5FA 1O4XA 2G9XA 3KCFA 1KGSA 1JTXA 4IFCA 3FZRA 3Q0WA 2DTZA 3CUOA 1GUUA 4ESJA 1FOTA 4R1VA 5LMKA 3SZTA 2YM5A 2JN6A 5HTBA 2CUJA 2K27A 4A3KJ 1Y6AA 1RI7A 4G34A 2ZB9A 3M4OJ 4L7FA 6PAXA 5HZNA 5KHWA 5J8CA 4U7BA 1BC8C 3OCTA 1OKZA 3EIDA 5E91A 4FKTA 5I9XA 2XM9A 4MIMA 4CXAA 1ZQ3P 3NYOA 1UU8A 1IG1A 2ZFWA 1OLTA 1S7OA 4G6LA 4UALA 3PJRA 5CVRA 3DTIA 1XSDA 2KIFA 4UBAA 1ZZLA 2WU6A 1XB4A 3FDYA 2R7IA 2Q8KA 5A6OA 4NW5A 1Y0NA 3DQWA 4EH7A 5AMNA 3FL5A 1P2FA 4D5FA 2WBMA 2C68A 2RFNA 3R1SA 2E9OA 4JAJA 1X1PA 2BCJA 2OH4A 3ZQLA 3UODA 1PW2A 5CAOA 1X3ZB 2XIRA 5JH6A 2A61A 4HYUA 3QHRA 2CQQA 4U8ZA 2PULA 4FL1A 1GVJA 3LVPA 3OWTA 4O7YA 3RPYA 3E0JB 3L8VA 2HCKA 5IQEA 3HYIA 1FQ1B 4BBFA 2YSRA 5JLXA 4TNDA 5LMKC 4DE4A 3WU2C 4YLKA 3FMLA 3BTJA 4X2JA 4BC6A 3IW6A 4YFKF 3ZSHA 2MABA 2HWOA 3BU6A 4L01A 2ZMDA 2PVMA 2FXAA 4QQCA 3DKWA 4WBOA 3SHFA 2CQXA 3CR0A 2JKQA 2OZAB 2VTOA 3N05A 1OKVA 1ZRCA 3PP0A 1SFUA 2ERZE 2EINH 3WG7H 4A0XA 4BYIA 3GBGA 2ZV2A 1W4MA 2JTVA 3WTUC 5J7HA 2YJRA 5B1AH 1JLUE 3C2HA 2NOGA 4FT9A 4BIEA 3RPVA 4G6QA 1W8CA 3RGFA 3PJ8A 1GV2A 4QMSA 1VQ9I 1R5GA 3CUQA 3QTZA 2F2EA 1WJDA 4AG8A 2MG4A 4XG6A 2EA2A 5IDNA 1QPMA 2TCTA 5LFAA 5JFSA 4IZYA 2OUMA 5EM7A 2DJIA 1GNGA 2YITA 1HCRA 5AAEA 4PMTA 5FXQA 3HKOA 2IPQX 1OL2A 5LARA 2ZV7A 3ZPLA 2CMWA 5CU4A 2XRNA 2VZ6A 4CYCA 2WEIA 4QP6A 5AFVA 3C4XA 4DINA 4XUFA 4P9FA 4W4YA 1HKSA 2R7FA 1MW7A 2J51A 2FOKA 4XQFA 3VC4A 4C7TA 4GCVA 4IOCF 5HE2A 2V26A 4J52A 4ZZOA 4IJPA 3K4JA 2EWNA 4CMTA 3UC4A 1TQIA 3DFGA 4II3A 1SVHA 1YS7A 2UV1A 1G3WA 4JX5A 5IQHA 3KFWX 5F08A 3FLNC 3I5ZA 3C2BA 3KRRA 1YW8A 3VIDA 1NVSA 4AW2A 2IA2A 4O7SA 2J0JA 2XARA 4PX6A 4QP3A 2WC2A 4BHCA 4ASNA 4FTIA 1PVEA 4JBOA 1YI2I 3U1KA 5HD7A 2R92J 2YUSA 3QA8A 4JOAA 4R6VA 3I5UA 3D15A 3VOEA 1B6CB 4GCJA 1HCKA 3QWJA 4U0WA 2A1AB 3R71A 3VW6A 1H0WA 3CCYA 5LHGA 2HKOA 3DB6A 2P7VB 3L1SA 3NIZA 4C2VA 1M1EB 3UDBA 3F8FA 2VTRA 2DJNA 3EYGA 4V01A 1RJBA 3DKCA 3MW1A 1ZMVA 2BAKA 3I0OA 2IGOA 2CV2A 5DG5A 1F5QA 3L2CA 2VX1A 5EHOA 3BLHA 4F7LA 5F95A 3VF9A 3VUMA 3IK3A 4MXCA 3Q9XA 5EOBA 2X6XA 2ESMA 2J4ZA 1EV7A 4CHUA 5IYCJ 3HAMA 5M53A 1YI6A 2QA4I 4MCVA 5DHJA 2HFHA 1JOWB 5I4NA 5JFXA 1APLC 3BZ6A 5BS6A 3GEZA 4CDGA 3LOCA 3OUKA 3ML6A 3TV7A 2XRWA 4BZNA 3GTQJ 3KCCA 2IS1A 2HZ4A 4B9DA 5GIOE 2M8EA 5BVNA 3HV3A 2R9SA 4AIJA 2OXXA 4ERWA 5JN2A 3FZSA 3KULA 1WWXA 5E3LA 5J8IA 3NWSA 5DIAA 4WNKA 3ABUA 1S8NA 4EJUA 3VBVA 3VSLA 2CSOA 2HVSA 4HPUE 3R9RA 1A35A 3SJMA 3J7YJ 4FOBA 1H8AC 3BLRA 2EQRA 2FA2A 2PVRA 5A2QK 3WYYA 2Q0BA 4I93A 3HUBA 5TOZA 1UNGA 5B1BH 3FWEA 3WTXC 3G3ZA 1FGIA 2GWRA 4B0GA 3R0TA 1B9MA 4QNYA 5DOSA 3RWQA 3LCKA 3JVSA 5JRQA 1D8KA 4FKUA 4DZJA 4G5PA 3GXOA 3S4QA 2W1EA 1UKHA 5GHVA 1YW7A 1VYZA 3F5PA 4IW0A 1Y6BA 5L3EA 1SD6A 2RL5A 3MZ8A 2BYVE 3FV8A 2R7RA 3EQPA 1OZ1A 1GLNA 1E3PA 3RCDA 5EDNA 3VS2A 4DFYA 1OCCH 3GO5A 1D5VA 4P5ZA 5DLSA 4XG2A 4FX4A 2OIBA 3HGKA 2GFCA 3C13A 2TRTA 3P86A 1IGNA 2EIKH 3IDBA 4HNUA 3AKZA 5E90A 1SFXA 4FTAA 4E4XA 4BU2A 1MDMA 3F8NA 1A36A 2OZOA 3LCDA 4OWRB 3W0PA 2V6EA 2BZIB 1MBEA 4JG8A 4FIFA 3EDPA 4N0BA 4XP0A 4ZYEA 1RW8A 1ETQA 5CKTA 3GYHX 1RQQA 2OO8X 5CLPA 5CLSA 2XH5A 1DI8A 3K5VA 2BPMA 4IVDA 3LQRA 3JAMK 5LVMA 2QG7A 3DZQA 4G94A 3FMQA 2MBFA 3EOCA 2QCSA 2OZ6A 3EUKL 3PPZA 2VQGA 3PZEA 3QD3A 4O0WA 4RJ4A 1F1ZA 1XBAA 1JSTA 2Y4PA 3S93A 3AXWA 3NQOA 4M8TA 4OR5A 4DG2E 2DDBA 2NS0A 2XMYA 4D9UA 1FBQA 4APCA 4RLKA 3W2CA 2VT2A 4IRGA 3MA3A 4J53A 5K9IA 3EH9A 1BI8A 4RA2A 2BY0A 4B3AA 2V6CA 2PWLA 2OFVA 3DKFA 4EKLA 1WFXA 3IQ7A 3I55I 5L8LA 3AFHA 5HDKA 4PV0A 4AOJA 3QLFA 2PUNA 3FMKA 2QLQA 5KZ0A 3R60A 1SAXA 5JFVA 4EL9A 3BTCA 3KVWA 4X0GA 4XYFA 5LJJA 4XRJA 2R5YB 3OY3A 5BQTA 3LM0A 1ZGAA 1U9NA 5KNLA 2DK5A 4E5AX 2LY1A 1E3HA 4DEBA 4GDFA 3T8RA 1ENHA 5A54A 4C35A 2AXLA 3SXRA 4ZJIA 2JZYA 5FD6A 1YOMA 3K3JA 5FG8A 2YDKA 1CKIA 3A02A 3K9TA 3EQIA 4QDEA 2O03A 3E8DA 2R3HA 2AXTC 1DDNA 3H5AA 4FVRA 2C6YA 2GQGA 2FQ4A 2MGQA 3PLAE 1Y91A 3BR0A 4KIBA 3ZXTA 1XMXA 2E60A 2QSHX 1JKQC 5BVDA 2WAQA 1YRPA 1WH5A 2YR2A 4ANMA 3HOSA 3KYDB 4E7ZA 4V05A 1OKWA 4ZDOA 5CVUA 3HMNA 4AUXA 4WOVA 1YJ9I 3M11A 4C4HA 3DA6A 3JS2A 4HX8A 5M56A 3JRDA 2JC6A 2E1MC 4HG2A 2XALA 2L3DA 4YJQA 4KITB 3GCSA 2YISA 4MFDA 4JMQA 4RFMA 4YZ9A 4HV5A 4DT8A 5GAEJ 2ZXHA 4A4OA 5DWRA 1M17A 2EZHA 3MY0A 2YX7A 4NQWB 4CMUA 4HZRA 1ETXA 3EFLA 1ZXEA 1KU9A 5DFPA 5J47A 4TV7A 2DDAA 4ZLOA 3MMYB 4NB5A 3JTHA 3AC5A 3GTLJ 1ACIA 2KFDA 2BEOA 4C3JJ 3Q5FA 4BIBA 1LPUA 3QXOA 5LVOA 1TTYA 4A9RA 5J1RA 1X2NA 3CP2A 3SG9A 5IA4A 1IAWA 2HDDA 1WVWA 4UN0C 1YXUA 3P7BA 3R30A 2XCKA 1HA8A 4KFCA 5AUVA 3PIYA 2RNJA 4YJRA 3WBLA 2JAVA 3BHTA 3DPUA 3RK9A 3RHXA 4JLCA 1RUNA 2BRBA 4HNIA 4M6YA 5EKNA 1OYYA 2X1EA 2I40A 3QGYA 4JX6A 5GJDA 4WG4A 3H0GJ 5LLQA 3OHTA 4U3ZA 2V22A 3UOHA 1T0FA 3R61A 3HOUJ 4M72A 4FTTA 4F92B 3ZGKA 1BA5A 2XVDA 3PIZA 4EOKA 3DF8A 3ATSA 5F1JA 4BI1A 4D4VA 1IAHA 3C2GA 2VGPA 3EL8A 1Q99A 2JDTA 2Y6MA 2ZM1A 2OIQA 5HG7A 2Q2EA 3NAXA 2O65A 3QQGA 2E35A 5LRSA 4CCOA 2JKKA 1IASA 2UW3A 2LRDA 3TKYA 3JRFA 3TUBA 4M9ZA 3POOA 3E7OA 4QYHA 3QRUA 4O6EA 2OA4A 1YW2A 3SDJA 3EPZA 4IRIA 4IX7A 4YPDA 3KP5A 5DEQA 1A5JA 3RP9A 2XVCA 5D10A 4R7HA 1TC3C 4S33A 4TWPA 2C6LA 3CQWA 4FKPA 3QYBA 4DGOA 2IVUA 2GHMA 2KPMA 1XH7A 3ATTA 1X1DA 4K0YA 1UHMA 2XNEA 2B9HA 3R9OA 3CCEI 1IR3A 2V1XA 2EIMH 5L2SA 2VTJA 4YEJA 2B63J 3OC1A 1RETA 3UG2A 5D5VB 3GT8A 1KOAA 3NVMB 3FLWA 3JUHA 4XSZF 5AV1A 2L9VA 2VU3A 2X7GA 3IS5A 2HXIA 3SD0A 2F48A 3TTIA 4WK8F 1BLXA 4YR8A 2QKMB 5BPIA 4U81A 3UNZA 2ZJPF 4D0PA 1R1UA 3DTWA 1ETYA 2ELKA 4QTRA 2BW3A 4EWHA 2QBYB 3MN3A 3HL7A 4AN2A 3FM5A 3GZ5A 3AC2A 2Y8OA 3OOPA 4ZSAA 3W33A 1MKMA 5D12A 5FLVA 1IN6A 4L45A 1IRZA 4TYIA 1O7LA 3ZOBA 4FV7A 2NRYA 3V8WA 5A14A 2LKPA 4L0YB 2WZJA 5AV4A 4V2FA 2EK5A 1YO5C 4Y13A 4RJ7A 3EJ1A 1KE7A 4AGDA 1OR7A 2JIIA 4C3HJ 4J00A 3I56I 3OIOA 2FEZA 4BJ5C 5EI2A 2V0DA 1NG7A 4XMYA 3KP7A 4DEDA 4HVGA 3ANQA 4I4EA 2DW4A 4U9AA 1STZA 2D5VA 3JVRA 2CFOA 3TUCA 2W7NA 1OMWA 3BL9A 4MAOA 3ZM9A 2JPCA 3IW7A 5CALA 4KD1A 3FBVA 4M97A 3UE4A 1KUTA 2I1MA 4M3GA 2UZEA 3Q5IA 2NVQJ 4GRBA 2E34A 3W0QA 4ZMFA 3QQLA 2F4IA 4G2FA 3OCSA 2QEXI 2XK6A 4O7ZA 3BZ3A 3WIKA 4BF2A 4QSHA 4RLLA 4JYKA 3CTQA 3DQXA 3HKZN 3WF6A 4GSBA 4AVZA 5E1EA 5DCMB 4GXOA 1WVRA 2X6DA 5GTIC 4M3EA 1K3AA 3MFSA 3Q6WA 4DLJA 4R5YA 4FZ6A 5KUPA 4QQJA 5M51A 3GCMA 3AG3H 3GZ6A 2BTSA 1OBDA 1PY5A 4FKGA 3ZONA 2R7DA 4CCLA 3CC4I 3QQKA 4E7KA 4IOAF 4WNOA 1AQ1A 2YU9J 2H96A 3V8LA 2DXIA 1H1QA 1VF9A 4E4NA 4EH3A 4WG3A 4LG0B 2LBFB 4GW8A 3KZIC 4J97A 5DN3A 1ZREA 3O50A 4BTKA 2C5NA 5FKOA 3QTXA 1G6NA 3RK7A 3ZP5A 4YJUA 1O57A 2ETRA 2KDOA 2UZNA 2KL4A 4O21A 3BWJA 2IGKA 2L02A 2ELJA 4GU9A 4HSRA 3JR1A 4JX7A 3LMHA 3C7JA 3IAS2 2ESHA 3IWZA 4MXXA 3FXMA 2WADA 3CDIA 2KLOA 5E79C 2KTYA 1Q8YA 1BM9A 3SZGA 3HRUA 2L2OA 2GXBA 3SA0A 3C0GA 4ZIMA 2ITTA 3K2LA 2QVSE 4M6VA 4KBCA 2XIYA 5IH6A 5KBQA 4BB4A 3W6JB 2CFXA 2ZMEB 1D0ZA 4YFNF 3S0OA 4NKAA 3CMAI 3LNQA 2XF5A 1DU0A 4R3CA 1W0TA 4ZTJA 2DMQA 3M8JA 4RAFA 3DEEA 4J71A 3LJ2A 3AQVA 5IQBA 2RREA 3PJCA 1S6LA 4AWIA 2ME0A 2BHEA 2WEVA 3OYEA 3PFIA 2ZFYA 4RVMA 1OIRA 4U3YA 4AW0A 1HBXG 3FXJA 1WH7A 3OV8A 1VFCA 4L3PA 3SXSA 2B55A 2BVAA 4BBMA 1FT9A 1VYWA 2AO9A 3K1NA 4B48A 2E2IJ 1KQ9A 1IF1A 2UZLA 2GSFA 3BV2A 5ICEA 3WGIA 1XMKA 1GOLA 1G3YA 5EYCA 4TYHA 3KPHA 4CG9A 4AGCA 4BDJA 4CT1A 2JA7J 5EH0A 4P7EA 1SC7A 4YELA 3SRVA 2ETMA 3JYAA 4AVPA 4L3LA 2RFSA 1FPUA 4EJVA 5HU3A 5J9LA 4AXAA 2HPMA 4NUBA 2DO7A 1WZ2A 3E8NA 4FKWA 5ED4A 1JGSA 2W85A 3QCXA 4ITIA 3F0CA 4R3RA 1IN7A 5IQAA 4KAOA 3QGWA 3ERKA 4JQ8A 4HQEA 5IEYA 5LRRA 5HLWA 3P7CA 3DKYA 2BKZA 1ERDA 2JKOA 4ZZDA 4RSSA 2WQNA 4ZLZA 2X0GA 4CXFA 2PSQA 4I0SA 1U2WA 3ZMDA 2QHNA 3LCTA 2DPUA 3PUFA 2J0LA 2QENA 1UCRA 4MTAA 3SQNA 2OKRA 4D5KA 1DP3A 3G33A 3NW6A 1GIHA 5EHLA 3ZFXA 2L5QA 3NEUA 3WHBA 3FSKA 5D9HA 3ULZA 4MBLA 5CNNA 1V4RA 3EYHA 2HR3A 4ZY5A 1L0OC 5DRDA 3RI4A 4JG6A 2ZBKA 5GJFA 5FKKA 3PA3A 1ST4A 4K11A 1BJAA 4FC0A 2MSYA 3W18A 1DAWA 2X81A 2Y31A 4PMMA 4GK3A 3OS2A 2HVQA 5EHYA 4XR6A 3H5NA 4GT4A 5FB2A 4QTCA 2DUVA 2W57A 1O6YA 2HXOA 4EJTA 3PJ2A 3MEXA 2WAQN 3PVUA 4IX4A 4G17A 1BI2A 1WSUA 3E3BX 2W1HA 3R28A 4L44A 5DCFA 3NNXA 3C0IA 3EN4A 2VL8A 2ID6A 3P23A 3HDMA 2R3GA 3LSIA 3RKYA 1GIIA 2CV0A 1VJYA 3PL8A 3P7NA 4ACCA 2FA5A 3BJOA 2HOTA 4FKJA 1POGA 3PRIA 4M12A 4CRSA 2VTQA 3L9PA 4LI5A 4IAZA 3H4JA 2YU3A 3DJ7A 4TYHB 4FNZA 2E9UA 5AA9A 3COHA 1QPIA 5AONA 4LM5A 3D5VA 2EXMA 2HZNA 3V7CA 3M1EA 1MUOA 3PVWA 4P2KA 4WX9A 3MJ2A 2P81A 2R3KA 3MYGA 1PXOA 3SAYA 5TJJA 3AD6A 4Y73A 4TZRA 3R8VA 3PO2J 1MJAA 3ZUVA 4JBQA 1BUHA 3BHUA 5BVEA 5GJGA 4EONA 4MXAA 3VHKA 1GJOA 4JX4A 5BUEA 2XAUA 1X2MA 2V79A 5E3MA 2LH9A 2XA4A 2VJIA 5AP7A 2FBKA 5ICGA 3ZLXA 3QXPA 5LVNA 4Z2YA 5HS9A 4AIDA 5B2LA 4MYGA 2FF4A 2JA8J 3Q9WA 2XRUA 1SMHA 5E3NA 4FKQA 3TNQB 1DGWY 3Q60A 1ZGJA 2G1TA 4LUDA 3UC3A 4U43A 1W1WE 4EZ7A 1JGGA 4WCGA 4OAZA 5BPYA 3L7WA 2HQRA 5C03A 4FG7A 3ZQIA 3FMMA 3SGCA 2YA9A 2PMZA 1YVJA 4YO4A 1IO2A 4AF3A 1B39A 3KQ7A 2F7EE 3M8EA 2B0QA 2LGCA 4KA4A 3MPMA 4M14A 1J7KA 5LOHA 3PG3A 3QLGA 4ESFA 2DFFA 3VS7A 3TT0A 3CGOA 4KABA 1XBCA 5CT0A 4GL9A 1H1RA 3D1NI 3NZ0A 4XV3A 4C02A 3TDUC 3OYJA 3TL8A 2HOEA 2WTJA 4FV8A 3DCFA 1EH7A 2VIXA 5GTHC 3H3UA 3H35A 2B4SB 4OTIA 1PKDA 3K70C 2R3FA 4DFZE 4G7HF 3O51A 2H6BA 5AIQA 2PU8A 4FEWA 2P2IA 1T6SA 2GS2A 4DDGA 3HMPA 5JFRA 2X1NA 5KMJA 4FV4A 2VBZA 3BR3A 4FG9A 2RGVA 2ZAZA 5F1RA 3R6XA 2Q2EB 5E8GA 1PXIA 4O7TA 3OS1A 5DRBA 2I10A 4RWJA 2R5YA 3PSBA 5IPAA 3FZPA 2B7EA 2CU7A 3ULQB 5EI6A 5DM6F 2DA6A 1FOWA 1U8RA 5DR9A 2E36A 5E1ZB 2GHLA 3R2YA 4AXEA 4U42A 4ZTQA 4EC8A 4YMJA 4L9NA 1LJ9A 4CSWA 4NTTA 4DEEA 3R4KA 4MVFA 3OCBA 5CTPA 3W2QA 4X6AJ 4LGGA 1H26A 3RKQA 4LIVA 5M3MJ 3NNUA 3F6VA 3A8XA 1RPWA 4UZDA 1H27A 4ZTSA 5DUIA 1U46A 4G6TB 3U9GA 4CRLA 3S1RJ 3JSOA 1U54A 3CCRI 4IB1A 4QTBA 3FMEA 4WXCA 2HW7A 4KIPA 3CCJI 3NUYA 3RCJA 2F49A 4RB2C 4H05A 1UJ8A 3F7ZA 4YHFA 1K78B 1P4OA 5LCJA 4JIKA 4KRDA 4ZTRA 1A06A 1N77A 3A4PA 3LOKA 4IQ4A 1KU7A 4J98A 4UUSA 1FYLA 1K6OA 1JQHA 3DPKA 1X4OA 5BVWA 4I1ZA 5L6OA 3ENMA 1NTCA 2GM4A 1WBSA 1J9IA 1PXNA 1A6IA 4M9XA 1QGPA 2XK4A 1EKEA 1M2RA 5LEJA 4X3FA 5EI8A 3UZPA 1OIUA 3IG7A 4CKIA 1T0FC 4CYDA 2WMBA 4CZUA 4QMQA 1O3QA 2JFLA 2H8HA 3KXGA 3DBRB 2OLCA 4XS2A 4W4VA 1V3FA 5A2QZ 3E8EA 1FEXA 4RZVA 4BTJA 4DYRA 2XK7A 4GFOA 3EN5A 3DCVA 3NR9A 2YAAA 1R0EA 4R77A 2VOPA 3TDVA 2W25A 1YHWA 1XH8A 4EWQA 3ZR8X 3L2WA 3V7SA 1BI3A 4I6FA 3L9FA 1XMLA 1TBXA 4BXUA 4A2UA 3RAHA 3TKHA 2W82A 1HSTA 1OCRH 3P5JA 4HVHA 3I3LA 2ID3A 3FLSA 4YZBA 2A5YB 5HDNA 2ETKA 2CQNA 2X2LA 5T68A 1LUJB 3DXNA 3EQHA 3N9XA 2ACXA 4HYHA 3ORPA 1R7JA 5FLXZ 1WBNA 4IC7A 2HZTA 3F8MA 1NHAA 2A07F 2UV2A 4RLQA 3NRVA 2YHVA 1G4DA 2KP6A 4GT3A 3IOKA 4LQMA 4PQNA 3AKJA 3BQZA 3H1CA 1FBUA 3BZKA 1RKTA 3ZN0A 5I9YA 1G3TA 3TDWA 1VQKI 2FSLX 2DK8A 3LXKA 1O7FA 4TRLA 4PDOA 4L00A 5JHFA 4FTMA 3PRFA 4M69B 5H8BA 3BU3A 4F65A 3O17A 3OW4A 2IW9A 3KEXA 5FEEA 2X2KA 4QP1A 5HOOA 4Y83A 5CSXA 3T8OA 3K4MA 3PZHA 5D5WB 3D94A 2X51A 4ID7A 2ZXJA 3CSVA 2IA0A 3ALNA 3PE2A 1M2QA 2MD5A 1VLRA 3Q9YA 4GKHA 4E6QA 5JRSA 1R49A 4L5JA 4RMNA 4JT3A 3BHVA 4C3FA 2ZFUA 2PMNX 3I79A 3HXLA 5FBNC 4GFBA 5LVLA 3ZLWA 5CSHA 4YNOA 4G9YA 2VO7A 4QIWN 2QOLA 1B9NA 4QOXA 1Z21A 4PJ0C 3UIBA 2RNGA 4FIHA 3FHZA 4E7JA 1KE8A 2BIYA 2WV1A 2VAGA 5AM6A 2W4JA 2FVDA 3LQQA 3NLBA 1K9AA 1N75A 4XKCA 2B52A 2W1GA 1M7NA 1QPCA 2XEZA 1Y6IA 4Y8DA 4D1SA 4FZFB 1MBGA 2XAFA 2B53A 3Q4UA 2R7WA 3ZCLA 3CC7I 4AGWA 2HYJA 4YRVA 3RKBA 1PMUA 4LIUA 4GKIA 3WZJA 4BL0B 4WD5A 1ZARA 1HCLA 4RJ5A 3KXNA 2UXXA 1D0XA 3Q2JA 5DCMA 5E9EA 4CMOA 3M8FA 4DHIB 2JSCA 3CO7C 3QKMA 4AZFA 3QC9A 3DEWA 4HV6A 4BGDA 1NT2A 2ITWA 5CENA 1FJLA 2UZWE 4BY9E 4JP0A 3J7AO 3NUSA 3MFTA 4L68A 4IHYA 4YZMA 1GV5A 3I0TA 4I20A 2QO7A 1FMKA 4P5OA 3KF7A 5J1YA 2FSMX 2GS6A 3AC1A 3MZHA 2VQCA 3FMRA 3RVGA 4LV7A 2ZMEA 3HC7A 3S1QJ 4F78A 1ZOEA 1XHAA 3TJCA 2VKHA 3IL2A 5JMSA 3IUOA 1UNLA 3V5QA 1OQYA 4HA8A 3ZRGA 2XAMA 2PMHA 4ZXTA 4Z16A 3NAUA 3V8TA 2X6EA 1R22A 2X9FA 3FXUA 4MQVA 4EKKA 2DODA 4YLJA 2JK3A 3IW4A 3LFQA 4RMZA 4RFYA 3LMIA 4GMYA 3Q96A 3LJ1A 3MH3A 2EFWA 5CX9A 3ECOA 2C5YA 4DCEA 4ZSGA 4MNUA 2Q0NA 4IH8A 1B4AA 4A5NA 4A3EJ 2G01A 4NC7A 4UWYA 2YIYA 2PMOX 4Y52J 3OMVA 5M55A 3QPHA 3LSJA 3NWTA 4Y7NJ 4EH9A 3OIQA 1VQ6I 4EQMA 3UOKA 4Q48A 3OYHA 3H9RA 4F08A 1JKOC 2JLDA 3JR9A 5TO8A 3SHEA 3HSRA 1R36A 4QEBA 3UIUA 3ZU7A 4Y72A 2L7ZA 4YU2A 2VPLA 4L67A 3NFFB 3B2TA 1KOBA 3JXWA 1MNDA 5K1YA 3PY0A 1K6YA 1R71A 1RKWA 3OIPA 4EOOA 3TDZC 2KRHA 2GTNA 5C4LA 3BCBA 1J7UA 1QCFA 3II5A 5HORA 3DKGA 3GC9A 4RVLA 2WAFA 3VULA 5E8TA 3DBDA 1SVLA 2VI6A 2ITOA 4QO9A 2X6WA 2LC2A 3RZOJ 2H09A 3HOXJ 2ZJ2A 3AMAA 1GHCA 1HQCA 1YHVA 3OUNB 1M52A 4A5MA 3GCVA 4NTSA 1Y1WJ 4YBKA 1ORKA 3GOPA 2UZVA 4QMMA 2Z33A 2WTDA 4EH2A 2ZNZA 3OT3A 2LD5A 4IZAA 2LLKA 5AV2A 2W9ZB 1UHWA 2ACJA 3PYYA 1TW3A 2BHZA 3MFRA 2PN6A 4FSNA 3FBIB 2DT6A 3TIZA 4HDVA 3S95A 4NFNA 3RZBA 5HNIX 2M8GX 4BI2A 1BL6A 3LFCA 4JI9A 4I7HA 4RGXA 4JS8A 1SNXA 2DYLA 2KIUA 5CQEA 3GU6A 3BG5A 4UV9A 1CKJA 5M4IA 3F3UA 1IUYA 2XIXA 3TWJA 5EDPA 3MZYA 3F3VA 2LFBA 5DEWA 1PF8A 2PVYA 1URWA 5K3YA 2OQRA 4B3XA 3BZCA 4I5MA 2CUFA 4XRSG 3S2DJ 4AW5A 3QU0A 4OU0A 1S29A 1E9HA 1MRYA 3V5LA 3R9DA 1OPCA 3ORNA 3CC2I 3FLQA 4CZCA 3ABTA 3HZJA 3CF2A 1JUSA 5J6XA 3V8KA 4HCVA 3OEFX 2UW5A 4C37A 3TV6A 1K78A 4DFNA 2XUBA 2GIVA 3G9LX 4YC6A 1RNLA 4KWPA 3S3OA 3KRJA 5B5EC 3WARA 4MD7E 3CUQC 4JR7A 3L2VA 2FYSA 3LKMA 1U0JA 3LXLA 4BS9A 2M34A 2R4GA 2V9VA 3L9NA 5HU9A 1J75A 1ZRZA 2WU7A 4BJJB 2R0QC 3FKLA 1D3YA 4RX7A 3BPRA 4OTHA 5HLTA 2C3IB 3I53A 4L9JA 3F3WA 4PNIA 3V8SA 2IS4A 3AL0C 4ANLA 2A5WA 3ZM4A 1KZHA 4XV9A 2HWPA 2LNBA 3U1DA 1H89C 3ET7A 1OVEA 5I9VA 3KEOA 2BUJA 1G8SA 1VI0A 4OMYA 2R5ZB 2XAJA 3RNIA 3Q0VA 5CZIA 3PIXA 1IN8A 1LNWA 2UUEA 3DBFA 5CF5A 4DTBA 2CUZA 3K54A 3SV0A 1NVQA 3TYKA 4IM0A 5CU2A 2QSFX 1YI3A 4EV0A 1Y56A 4S2ZA 4AU8A 1GZ8A 5DI1A 3BI6A 1V0BA 2IZTA 4MKCA 4BQAA 5IZFA 4S32A 4AIKA 5AP5A 2F4JA 3CZ6A 3DV8A 4I6ZA 5BVFA 4V04A 4IBMA 1IUFA 4IAYA 3HTUA 5IU2A 3K4CA 2QU5A 4D55A 2IVTA 4FV1A 3QKKA 5DYJA 5FROA 1FSEA 2I5UA 4FASD 2C5VA 5KHDA 1QZYA 3UPZA 4A12A 3SFZA 1HKTA 3O8UA 4D9JA 3Q4TA 1MH3A 1B72A 4XG7A 3L9LA 1S9JA 4E5BA 4OT5A 3POZA 3ELJA 4EI4A 4D7MA 3NUPA 5ILSA 2GXGA 1OGYA 2R3QA 1O6LA 4DF3A 1H9GA 2VTHA 2XBJA 5EK7A 3WZDA 1FLIA 3RYPA 4MQ2A 2VV9A 3HL2A 1KQ8A 3AL0B 2W1ZA 4ZZNA 5KMLA 1STCE 2QZ8A 2E9PA 2K85A 1T45A 2Y0AA 2VGOA 3ORTA 4CSVA 1XC5A 4AZVA 4J99A 3UVRA 1X1BA 5FLFA 3U4UA 1FYKA 2YM6A 1FYMA 1WZYA 1YXVA 2V9PA 4RIYB 1IDZA 1P9QC 3MH1A 5BV3A 2XUUA 3CMEI 5JGDA 1DU6A 3JY0A 5E8XA 2JDVA 2LY9A 4DBXA 4O7NA 3ZUUA 4F3QA 4ZZMA 4XOYA 3QQFA 2QQ8A 4F09A 5CASA 3AG4H 2XK3A 1OUYA 3A7FA 4YC8A 4FV6A 4YJPA 4WUNA 1SAUA 4AXCA 4AIHA 1S72I 3D0EA 3UDZA 3PPJA 1Z5MA 4EJOA 3W0SA 1UU7A 4P55A 4MNFA 1F4KA 5EZHA 2W1CA 4DBQA 5F64A 3REOA 3MV5A 2O3FA 2VN2A 5HG9A 2HWVA 4D1XA 4D4SA 3CCNA 5AP1A 3ZSIA 2R3PA 5K7FA 3QQUA 3NCGA 3OVVA 4KBAA 4RG0A 3WZUA 4AFJA 4AFEA 3TNIA 4BGHA 3GU7A 5HI2A 4Q9ZA 3OSFA 3FHIA 3ELKA 5LGUA 2ZV8A 5FBOA 4O7LA 4QPAA 5D8LB 4XOTA 5HQ0A 2XK8A 1WJCA 2HY0A 4RBOA 5DT0A 2MC4A 1KWPA 4Z55A 2BBYA 3GF2A 1HOWA 5HNBA 4Q5HA 5HVYA 5L2TA 3MVHA 2XB5A 1BW5A 4BUPA 3DLSA 3PWDA 4QMTA 4FTHA 3EWHA 2CG4A 3FYJX 4BDZA 2F4OB 1G59A 5J9YA 1USSA 2PZYA 2J50A 2P7CB 1BIBA 3C51A 3HUCA 5AIKA 4AWXB 1IW7F 2D2WA 5C8KA 1H1PA 2HY81 2ZDTA 2VO3A 5HKMA 5G6VA 2PQ8A 4CZZA 2CJMA 1S9IA 2R4BA 3FZ1A 1LKXA 1Y8GA 2A19B 4HGLA 3ORZA 3AOXA 4IZ5A 4RWLA 1YTYA 3CDHA 1KYWA 1I3QJ 3TZ8A 2JQ7A 3MESA 1J1CA 4G31A 1I50J 3BYSA 1P4AA 4IF4A 2HYFA 3DFAA 4FTUA 4TYJA 5AP6A 5F1ZA 2EB2A 2XKCA 1Q24A 4JBVA 1B8IA 4XRFA 3TL4X 2JIUA 5H9BA 4ASZA 1CM8A 5EW3A 4FTCA 4JRVA 4O6JA 3CD8A 3WGGA 3Q9SA 3QX2A 5BYYA 1XH5A 3ORKA 1WHUA 2NXNB 3MB6A 3KIOC 4C38A 4ZJJA 3CCSI 3PE1A 5LHHA 4RIWB 1U5RA 4PNKA 2BZHB 5KMNA 4GV1A 1Z57A 1MNEA 5D1JA 2KT0A 2FMLA 3EKKA 3BROA 2R7ZJ 1H0MA 3W0NA 1YIOA 2QOHA 4HCTA 2OSCA 4BDEA 5KHXA 4NNJA 3FI4A 1FSHA 2O3PA 3H0ZA 4A6DA 2B7AA 3GWZA 2EUFB 4OBQA 1OI9A 3SKCA 3QPSA 2VTAA 1FOXA 3T3VA 2IS2A 3WU0A 5AP4A 3O2MA 5F6FA 1WVYA 4I6LA 4GG7A 1DPUA 2QR7A 5ICFA 2AC5A 3IH2A 5ACBC 1H25A 2IJMA 4ENJA 2E1OA 4ASXA 3ZQFA 4BDKA 3BQCA 4DBRA 3CKXA 3ZBFA 2RAEA 3OWJA 5C1QB 3R8ZA 2X8DA 2EIJH 2DFHA 5JK3A 1U4DA 2XKEA 3FBNB 3TV4A 1J91A 3BG7A 2Y9QA 2YERA 2QURA 3MFUA 5CAUA 3O2PE 1R1WA 5TISC 1LEZA 4A3MJ 3O8GA 4USFA 1CQTA 1XGNA 5IMEA 5DNRA 3QWLA 3I7BA 2PLYA 4FSRA 5HICA 3TO9A 4HEA2 2AEGA 4J8NA 4F9AA 3ABKH 4RQKA 5D4RA 3B8RA 1PYEA 5LHIA 4X6RA 2WMWA 4Y46A 5LBQA 5L6WL 5ERIA 1H4LA 1GAGA 4IX6A 5FD5A 2IO6A 5I5ZA 2UZKA 1ZLKA 1MBKA 3BLAA 1Z6RA 3I4PA 3WOWA 5FEQA 3DB8A 3ZSGA 3ZO2A 2PJRA 4EOLA 4ZTHA 1KE5A 4QTAA 4AT3A 1UU9A 3OOMA 3HV4A 2Y6OA 1RDQE 4BICA 1IV8A 2XAOA 3OYBA 1MQBA 4KIGA 2HEOA 1XGOA 1DQUA 3BCAA 1AGWA 3LFUA 3LLAA 2V62A 3E7VA 4D9TA 5HCXA 3DXJF 4DJAA 1T38A 3ONQA 4Y85A 2ZVAA 2JDRA 1B6AA 1VEBA 1S9HA 5BMSA 2YIRA 1QZZA 5IA5A 5J8FA 2COMA 2BVLA 4A06A 3KMMA 4F7JA 4C3RA 3MWMA 1AKHB 2OJED 2OF7A 4UVAA 2WTVA 3R7IA 1Y39A 1ON1A 4BCPA 5JEBA 4RB3C 5KMKA 2A69F 4RGUA 3JRGA 3A0HC 4DYMA 4CFFA 3NIEA 2W00A 3L09A 3T8TA 3IO7A 2VUWA 4F1MA 3DFCB 4JL9A 2XC7A 3CE3A 2GHGA 3J7AY 4HNVA 1OIYA 2R7UA 4FV2A 5E1WA 3MD2A 3BYVA 3D5XA 2ITVA 2YFXA 5HS8A 2FRHA 2WTCA 3BR5A 3JY9A 4G6NA 5CSVA 4ERKA 4A9UA 2YJSA 2WMVA 3LSGA 2YDIA 4QYYA 2EA4A 3OBJA 1UZCA 2CKQA 2ZMCA 1B38A 4XN3A 2PBIA 4S31A 4AA5A 3LJ0A 4IDTA 3IKTA 1S5LC 2LR8A 2W7XA 3DS6A 3GEQA 2E19A 3VUHA 2WGJA 1UWHA 3PSIA 4IAFA 5IP6A 4CVAA 3LA2A 4HLYA 5DH3A 4JJRA 3KU2A 3V5JA 1VQMI 2CYYA 3HBLA 1R9TJ 3DPTA 4O22A 5IQDA 2DU9A 2L4MA 3EL7A 3B6CA 2IT0A 3BT9A 2HOSA 1OCPA 1CDKA 3O5AA 1YXSA 3CESA 4BZDA 4I5HA 4XIDA 2XAHA 3QF9A 3TEDA 4AS0A 3ZXSA 2JFMA 1FY7A 2QVOA 4C62A 3PXRA 3WG9A 2ITYA 4BVUA 2LYCA 2CKPA 3ZC5A 4N4SA 3DAKA 3NDMA 1WBVA 3BQRA 1SMTA 2C69A 2VTPA 3GUDA 4BXXJ 2YCFA 3RDIA 2DYRH 4KNBA 1BR4A 1WFCA 1RE8A 5EYMA 1AD5A 2W4SA 2DT7B 1AU7A 2VO6A 3F5GA 4UB6C 3OYLA 4BIDA 3TZMA 4QMYA 1UG0A 1Z3YA 3TNPC 1VTNC 1ETOA 4IHXA 1OL1A 5EFQA 2EV0A 3AKKA 3HMMA 4M6XA 3EQCA 3QCSA 5E1SA 3D4QA 4UVBA 1ZZ2A 5FRMA 4XOZA 4UEUA 5H3QA 3VAPA 4IX3A 3HHHA 2L7KA 4IEJA 2ZCWA 1Z91A 4TYEA 1XBBA 3OYGA 4GRIA 2XF7A 2O8XA 3IOPA 3F3ZA 4DN5A 3W3CA 3ROUA 2OFUA 2OGVA 3GXLA 3SXYA 4EOSA 5M09A 2MH2A 2YCQA 3NCZA 5K5NA 3P4KA 2PFBA 3DDQA 5A6NA 3EN7A 4F9WA 3UNGC 2R3RA 3RAWA 2P55A 3PQKA 3KXMA 5KVRA 1RESA 4M3DA 3KZZA 1W5TA 3R2BA 1Z0XA 3DTCA 4O2PA 3QD2B 4H36A 2RQPA 3IWFA 3ID6C 4XBUA 2L9SA 3E6DA 4B7TA 4F63A 4XK4A 1JKRC 4Y17A 5ANDA 2R5TA 3S32A 2OU2A 3U51A 2HU9A 5A46A 3SQQA 3W8LA 1ZLTA 2E1CA 5IQIA 5CANA 3IRQA 2FD5A 4TWNA 3QUEA 5E17F 2REIA 2JSPA 2OXDA 2QM3A 3A7GA 1QHGA 5EGOB 4LYNA 3FMHA 5AP3A 2SRCA 4RX9A 2LTPA 3LLTA 3C7QA 3GC8A 5IDPA 2LDUA 4HYIA 4IWOA 3A7JA 5JKGA 4CH7A 3LSMA 4QMXA 4FG8A 3ABMH 2XJ0A 4WG5A 4AAAA 3Q0UA 1UNHA 4ZOGA 3E1SA 5GPAA 4FEUA 5FP5A 4MK0A 3T1BA 1YE9A 1JXSA 1TW2A 3PFQA 4MO7A 1XPXA 3ROCA 3V6SA 2LP0A 2HPIA 3QALE 1K61A 4UX9A 1RR7A 3TW6A 1M14A 4DEIA 5M44A 2HDWA 2ECCA 4ORKA 1I6HJ 3G6GA 3P0MA 1U3EM 4DT9A 2VKDA 4RQVA 1HW5A 3ZO4A 4WWCA 3X2QH 3ANRA 5E4HA 3ZDUA 2VTLA 1P2AA 3QRFF 1Z3XA 3GMEA 3F5XA 1LUFA 4XV1A 2XDVA 4LRMA 4RVKA 3I71A 1F43A 3HA8A 3VFZA 2DA4A 4AW1A 5BNJA 3UO5A 1ZH5A 2OWBA 2HTSA 2IVMA 2XIZA 1LQ1A 2IP2A 3LL7A 4M3BA 3TQNA 3OP5A 5J3LA 3IECA 3A61A 2W4KA 5IUIA 2K40A 3BGPA 3CQEA 4M15A 3U6IA 3VWAA 2WMTA 4E20A 3O8TA 1PDNC 1W36D 4USDA 1YOJA 2VBYA 1H9TA 3HSEA 4U7ZA 4EJNA 4YJSA 4I3ZA 5LEKA 3BU5A 4FT0A 3SX9A 2V9KA 3NMUF 3BPXA 3M07A 3OYIA 2QOBA 1Z67A 1QVUA 4RC3A 3WI6A 3T3UA 2EZKA 4X3JA 3KXXA 4AE6A 1J7IA 3QQJA 4LITA 4C34A 4A3LJ 2XKPA 3RQIA 4R78A 1K4TA 1ZRFA 2C6OA 4M13A 3H9FA 2FJ1A 3QFVA 4C2MJ 4KNYA 1BL0A 2C6IA 2CNVA 4Q5EA 2PI0A 3LXNA 3O23A 2CH0A 4RBLA 3PJ1A 5IOYA 3W2OA 1JSVA 2IBDA 4MQ9F 2P5VA 5ACKA 4FSQA 1GXQA 5JI6A 5CNOA 4G5JA 1OYWA 3FK7A 3GI3A 3V3VA 4C61A 1MRUA 3AGMA 3BCEA 4CFVA 3G71I 4EOJA 4XV2A 4F99A 3C4CA 3OWLA 1E2XA 4S04A 2BDWA 2KRFA 3DAJA 3S1NJ 3L8PA 3MVJA 4HSTA 2PYWA 1ZK8A 4EK4A 4HVSA 3G15A 1XSVA 3ORMA 4GUBA 3F2RA 5IP7J 2Z7LA 3QKLA 4NSTA 2XS0A 1MSEC 5I0BA 3V5PA 2VE9A 5JZJA 3Q04A 3FK6A 2FMYA 4XHKB 4HX4A 3FZTA 4QPSA 4M74A 4C3PA 2XEYA 1WCMJ 3CLQA 3HOWJ 3TTJA 3FPQA 3VBQA 2XPUA 2YM4A 3CJFA 2J5OA 5M5WJ 1KA8A 2UW0A 3RYRA 2VTNA 3NAYA 5E1XA 1WJEA 1ZMUA 4ENYA 4JRNA 3D2IA 2IZUA 4YPSA 4DNCA 3OYFA 3M2WA 2X7OA 4L9VA 3FXXA 2ONLC 3R7OA 2X4ZA 3Q3BA 1BR2A 1UHSA 4FOCA 1RRJA 4HVDA 2LKXA 5BPDA 3NW7A 2WHBA 5E18F 4UY9A 4FKIA 2XAGA 3OYCA 1IRFA 3CP8A 1XH4A 1KV2A 4BCGA 2Y2ZA 1D1AA 2W5BA 3DTEA 4FV5A 3FPMA 3W1FA 4FTJA 4IB0A 3CD3A 3FXRA 2H34A 4EK6A 4ZTFA 4A4XA 3K1MA 4JNWA 5I9UA 4MWIA 1P7JA 1FWZA 3QD4A 4EORA 5E3OA 5KKRB 2ERKA 1USTA 4I98B 4HNTA 3QU6A 3ZMMA 4FVQA 4RDUA 2LREA 3HECA 4N9HA 4D4RA 4YP8A 3UZRA 4LJZF 4DHFA 3RK5A 3OR1C 5EYKA 3OSGA 3TBIA 3T0YA 4PWNA 4N57A 1I27A 3IH3A 4PSXA 3DP7A 3BEGA 3D9VA 3KN5A 1XCVA 2PVJA 4BN1A 4PL5A 3KB7A 5IH4A 1EJ9A 4RC4A 5JLWA 3RTPA 3VHEA 5ANKA 2C0TA 2G7HA 3OXTA 4TT7A 5AUUA 5AUTA 3WTYC 3BR1A 2DMPA 3TOBA 2ZNYA 1P14A 4FKSA 3LWFA 4QMLA 2HI3A 4ZK5A 4KUMA 3CPBA 2DAOA 4EQCA 3EQFA 3ERED 2LY2A 1FIPA 4N0SA 3DT1A 2HGCA 5ETFA 2XYNA 2DQRA 3GTOJ 4MFEA 5HBHA 4LD5A 3A4CA 1K83J 1ZYLA 2JEDA 4PL3A 5AIPA 4ANJA 2EB7A 3VBWA 2CNUA 3E93A 4NM7A 3KMWA 4E7HA 4KUJA 3HIFA 5G1XA 1BI7A 4N6ZA 4YLLA 1QNTA 2ELHA 3CIKA 2HYYA 1OL5A 4W8DA 2I7QA 1J0RA 4RIXB 3VDXA 3MIAA 2PMZN 4L53A 4FIGA 1EH4A 4E6KG 5GNKA 1NVRA 1XH6A 5HNHA 2WV0A 3MQ0A 3RJCA 5KNJA 2Y48A 3PUFC 4C58A 5D8KB 1AWCA 5H2FC 4LL0A 4ZC3A 4EEFG 1TWHJ 2A0CX 1U59A 2KULA 1H8FA 4C2UA 3QZGA 1SFOJ 2ZOQA 4U79A 3F8CA 4KSPA 4FZ7A 4HNFA 3EQDA 2IEKA 2O64A 2V55A 4BDHA 3HRFA 5IUGA 5FKNA 3FEGA 5F27A 4RLFA 3IW5A 3GTPJ 2VWXA 1V5GA 5F04A 3VEPA 3CCMI 4GT5A 2VASA 2EFOA 3ZLSA 4HX7A 4I6HA 4H39A 3U9CA 4R1HA 2KZGA 1UA2A 5J4VA 3TP3A 1Y57A 2VWVA 5EM8A 4PF4A 5CWZA 3VYUB 2OTJI 4CCNA 4YHTA 4L42A 4EEVA 3LM5A 3KC3A 3WILA 2J5EA 4DG3E 3PNTA 1XDUA 1T46A 3F72A 3H0YA 4Y95A 1WGXA 1ZHFA 3UDTA 4V19K 2CCHA 3ZQHA 3OYAA 3QC4A 3VUGA 2AQFA 1IZ1A 1Q62A 1WPKA 4RA5A 4CGAA 4XKBA 1YFHA 3JRIA 5LD2C 3BIZA 1DGRM 3CCQI 5KO1A 1G8XA 4DTAA 4MEDA 3ASNH 4L7SA 2JVGA 5AAFA 4BACA 4XBFA 4PDKA 5M4FA 2K3FA 3S14J 3I60A 3KXHA 4P4CA 4F93B 2EV5A 3WGHA 3F2AA 2OXYA 4G9CA 2X9DA 3F82A 2P0CA 3FLYA 3FX3A 3MKWB 2K5CA 2F5VA 2QOFA 3HSFA 4KDPA 2Y69H 1P5EA 4E4HA 3EFJA 3J7ZI 5CSPA 4OBPA 1JKPC 4A93J 3CPCA 3JSPA 3WYXA 2HDCA 3DGKA 5L3CA 1ON2A 1Q1HA 2BKKA 4J95A 3CTHA 3KULB 3W6KB 4LFIA 3W8QA 2DQLA 4NUSA 1R5ID 3SXFA 4DCAA 4XH6A 1VQ5I 4DH5A 3OZ6A 2JAMA 3P5KA 5FQDC 3NWWA 4O7VA 2VJ4A 1FMWA 1PUFB 2YCRA 1H1SA 1FNNA 3B73A 3EQBA 2HZIA 2ZM4A 4GH2A 3UQCA 1NY3A 2DYSH 2J0KA 2VT3A 3ORIA 3MWUA 1YX5A 3AT3A 1UWJA 1F5TA 5C8MA 2P6SA 5DUKA 3PIOF 2LKSA 2GQSA 1Y1VJ 1KE6A 2NNNA 3AC8A 3HUGB 3OS0A 4N6YA 4QRCA 5F0FA 3ZTXA 4X21A 2Z2SB 1P4WA 2J5PA 2ADUA 4IZ7A 5ANEA 4YTCA 2XHKA 2AC3A 3JRAA 2EZLA 3HRMA 4O0VA 3U9NA 3WTTC 2P6TA 1JUPA 4NW6A 4YNEA 4FV3A 2PVNA 3CTAA 2EV6A 3DBLB 4QMOA 5CVHA 2A27A 1ZG5A 2A6EF 2PVLA 2PZPA 3BELA 3VW8A 4ZTMA 3IONA 1I39A 4R79A 2C30A 4CV9A 3L9MA 3Q2MA 3UOJA 4G6OA 4M3FA 5H20A 4EM1A 5GAHJ 2JKMA 2XB0X 3BBTB 1ZN2A 3COKA 5D7AA 1P4XA 4CFXA 3OS3A 3I64A 1UKIA 4RIXA 3HEFA 5JZNA 2M30A 4FBXA 1MNMC 2X1DA 1XGSA 3GP0A 1IJWC 2VX3A 4A3DJ 3W2PA 3HOVJ 4CCUA 2GNHA 1K4SA 4NH1A 3DXPA 4A3JJ 4ZMEA 2UW4A 5DT4A 4BEHA 4AD9A 1WI3A 5HLPA 4MHGA 1OBGA 3CTJA 5FDPA 3FISA 1TNSA 3TZ7A 4AUAA 1FTZA 3AD5A 4O0XA 4ACHA 4BDIA 4DW6A 2Z9OA 3R73A 2STWA 3D5WA 4IHVA 1GZOA 2XRLA 2JBPA 3DV3A 5HDGA 5TF9A 4UYAA 3FAAA 3FXKA 2GMXA 3WF8A 5EKOA 2OAZA 2X6YA 2FSTX 4IIRA 2GQQA 2C6DA 2M3AA 1QQIA 1YS6A 5GINE 4CA0A 4O82A 2GTMA 3TO6A 1JT0A 4E6CA 3MVPA 2FB8A 2W1FA 4J8MA 5L3FA 1W83A 4L5IA 3BYUA 5KBRA 1TT5B 1Y8YA 3WTWC 2A6TA 1ZTRA 2QNJA 3PXKA 5J87A 3LQ5A 1XQZA 3SC1A 4IJAA 4NDLA 1XKKA 3OW3A 4I0TA 2X4FA 3UO4A 4MH7A 5EM5A 3EHAA 5EG0A 4EZ3A 2UXNA 1YLFA 4YFXF 5T6KA 5ICCA 1IRKA 3W0MA 4KKHA 4L8MA 3I0QA 3CJNA 3KLNA 4PTCA 2H6DA 4PDPA 4IZZA 3OXZA 5LWMA 1W7PB 5T3QA 4BBSJ 2WWYA 4ZTNA 5HG8A 4OINF 4NHJA 3H9QA 4QMNA 3G5DA 3WF9A 4KMUX 3GTGJ 3QZHA 1OM1A 4BRXA 3UYTA 3BRBA 3SLSA 4IB3A 5ETCA 2QCOA 2BDFA 3R8MA 3EKNA 2B9FA 1R23A 4I4FA 3TKIA 2XCHA 4U6RA 3RINA 4A9TA 2CUEA 4K1BA 4FQGA 1D5YA 4QYFA 2GPHA 4IACA 1NA7A 4A3IJ 4LLGF 3P1AA 5CU0A 3ZZEA 2G0EA 1FMOE 1TQPA 2PUUA 3HDDA 2RG5A 3EMGA 2HYGD 2Z60A 2L7FP 3QQAA 4KA3A 2RQQA 2NOJB 4BI0A 2NAZA 2VE8A 1U5QA 4DEGA 5C26A 4FTOA 1HDPA 1IN4A 3CDLA 5F94A 1H00A 1IV6A 5E8WA 1XD7A 2X85A 2V7OA 3K7AJ 4LK0F 4LGWA 2A4LA 2ME6A 3QODA 3D5SC 4KT5C 4WO5A 4U0VA 3GZNB 4GJ3A 4MQ1A 2BDJA 2R7OA 1NK3P 2CWEA 2GXAA 2Y9ZA 1ZKGA 4F9CA 3EN6A 3O71A 1DS5A 5KAIC 3NUAA 1ZWSA 5EM6A 2X0LA 4I22A 5E8IA 2DFIA 3UNJA 3W2SA 4DGNA 3OYKA 4JR3A 5JT2A 3C18A 4PTEA 1MJ9A 2R2PA 4PP7A 2EJRA 4GO1A 4J19A 1YKRA 2VC0A 4EHZA 3M1CA 4ESBA 4AOTA 3NRMA 2JPBA 1T08B 3C9WA 5ITAA 2XKFA 4BDYA 3O0GA 5GAGJ 4YJVA 2VB6A 4I6QA 4WSYA 4QP4A 4RS8A 1LEWA 5FXRA 5CF4A 1WI9A 5B0XA 5IYDJ 4S0HB 1BW6A 2RVCA 5M3FJ 3QTSA 1TL8A 5CEOA 2Z99A 4P96A 2VOOA 1KSWA 2OBJA 2FQ3A 3MGYA 1MP8A 1PXLA 4Z7HA 2GBYA 2G2IA 2XAQA 4G6DA 1U54B 1MMSA 2QF7A 3DBHB 5AUZA 2QG5A 2VO0A 3GFWA 3W16A 4F9YA 3R9HA 1B59A 3TIYA 3H0DA 5L3AA 3QZIA 3VS0A 1FTTA 1D8JA 5CEPA 3GC0A 3CY3A 2RFEA 2L54A 1EF4A 4G3EA 1O9UA 4NC6A 3VSKA 2ECBA 2HK5A 3UTOA 4NCTA 4FV9A 2HXQA 3D0SA 3BTIA 2DN0A 3DU8A 1WJFA 1MZBA 2A6HF 5EZGA 2DOEA 4MF1A 3NW5A 2BZJA 1OUKA 4N4OB 4IAKA 3NARA 5FKMA 3R6SA 3BGQA 1R4NB 3HB9A 4KBKA 4BHPA 4EGYA 4YZDA 2F6CA 4JAIA 4G7ZF 2Y30A 3I5NA 3VBYA 2YWVA 5EEAA 4CZTA 4IE9A 4S05A 3U55A 2UZOA 1WJBA 1H0VA 4D7NA 2QOKA 2QBYA 2VXZA 4FZAB 4II5A 1LP4A 3M9AA 4D2SA 4BCQA 2R7XA 3K6GA 3PSCA 4A9SA 1Q3WA 4FSUA 3KRLA 4EQUA 1TFFA 4AXDA 1U8BA 4A9YA 5K5XA 3FSFA 4TYGA 4ON0A 3R01A 4QMVA 3TP0A 4KKGA 3FWQA 2K7LA 2G7UA 3FI3A 1H08A 5M06A 2C3KA 3AG1H 3AGLA 4MD8E 4HVIA 3QOPA 2EILH 2ZMEC 4DQ2A 2OJ9A 2WKMA 2XGXA 4E7WA 1I5ZA 3RJPA 4A3FJ 3VYSB 4I24A 4GIHA 2E7XA 2PMIA 2HTJA 2KISA 4EJ7A 1YDTE 4XLIA 3LIJA 2C4GA 2BVMA 3GCQA 3ECHA 2J7TA 4AZEA 2VBWA 3HP5A 1MMNA 4DDIA 2HQNA 4OGRA 5D4SA 4GYGA 5GPCA 3QWKA 4DFXE 4E70A 2C5XA 1XMAA 3R7EA 2XNOA 2IVVA 3N4TA 1V54H 1SFKA 1HW1A 4P1WA 4D0WA 3H9JA 3NNWA 3JREA 4KT6A 4CV8A 2EH3A 2DA5A 4CKJA 4PGHA 2XIGA 2VWYA 2WELA 2CQKA 4DH3A 4HRIA 4EK8A 1K79A 2GA1A 3HRCA 3H10A 4I41A 1PYVA 2A2AA 5E8VA 3I9V2 4EK5A 1H24A 4Q47A 2WY7Q 3PVGA 1HLVA 3K4LA 3L1PA 4YO6A 2HENA 4AZTA 4HPTE 3BE9A 3IGOA 4YGAA 5JR3A 4U80A 4FCYA 3FQHA 4ENNA 3LAUA 1BX6A 3IGGA 1YWRA 4IM3A 3P08A 1SYKA 4MXZA 4PY1A 3VS4A 1GXPA 3MA6A 4K77A 5F0HA 2X2MA 2E1NA 4XICA 2QOIA 1H07A 1TWGJ 4AAYA 4O91A 2P2HA 4EOIA 4EYJA 1ATPE 3OYMA 3SEZA 4RGRA 4K9YA 2XASA 3CUQB 3RPSA 4D0XA 2CRGA 4Z3VA 3K3IA 5BQ0A 3AD4A 3ZRLA 4CKRA 3RPRA 2ZM3A 4QQTA 5BVKA 1R00A 2BGCA 4PK4A 3BBWA 3DLLF 2RFDA 2HQ5A 4AN9A 5EOLA 5L3DA 1WBTA 3F66A 4F0GA 4PFPA 2ZDUA 2OW3A 2IPXA 2NP8A 2M4GA 2CW8A 1HSJA 2YM8A 4WNMA 1U5TB 1ZELA 5CU3A 3D7TA 3EZRA 3D5RC 3WTZA 5ANJA 3ZEWA 3ZQCA 1QVTA 3DEUA 3S3NA 3ESWB 4QP9A 3N4MA 1TP4A 4M73A 2VC1A 2HXLA 4O0TA 3M1SA 1I6XA 4B8MA 1QHHD 2C3LA 1YG2A 3QX4A 2Z7QA 3R00A 2K3PA 1DI9A 3HKZA 5IA3A 3FL4A 4JBPA 5TGTA 4EH6A 4BAYA 4Y3OA 2VTTA 3NVKI 1VQ7I 3K2AA 3A1YA 2WMSA 4ONAA 3Q4ZA 3DLZA 4BCIA 3DK7A 1PYXA 2K9QA 5AWMA 3HRTA 4RM2A 2QD9A 4BBRJ 2HNHA 2IW6A 3Q4CA 4O27B 2L9RA 1OCOH 4CFUA 1OCZH 3E6CC 3VB2A 3D5UA 4FTLA 4J01A 1F0QA 4ASDA 4IWPA 2O2UA 4H3BA 4PGGA 3M42A 3F6XA 4IADA 1XJDA 3LAJA 3CGFA 4KIQA 4YSMA 3IDCA 1NG6A 2NPQA 2FGIA 1OECA 5FM2A 4HYSA 4H1JA 3GLLA 3PY3A 4LOCA 4ZLYA 1BC7C 3V6RA 1JHHA 2OZUA 4BYJA 2M0CA 3FHRA 2W84A 2B0LA 2R3IA 2GOMA 3CJRB 4E6DA 2XSJC 5BYZA 4GFMA 2BY1A 3HEGA 2W5HA 3E97A 5FP6A 3BOQA 4E7IA 2XNNA 1ZAOA 4HGTA 5L3BA 3MSSA 3UIMA 3FMSA 4ITHA 3TW7A 1XO2B 1VZOA 4BDCA 2NNYA 2PJPA 2OJIA 1JKSA 4QYGA 2F5CA 3FLZA 4YC3A 3ODZX 4ZS0A 4NWMA 4GUEA 3QBNA 2F2CB 5HIDA 1J2XA 1W7PD 4PRJA 3CLYA 2YIQA 4TL0A 4DG0E 4EUTA 3RQ4A 2R3OA 2B54A 3UIXA 3HRBA 1TQMA 5LGTA 1LDJA 4FSZA 4TN6A 4G16A 4FGBA 3DKOA 2X7FA 2O8YA 2OJFE 2HOAA 4Y15A 3S1MJ 4AP7A 3P79A 2KHMA 3VF8A 2RIOA 1YOVB 4PUZA 4PMPA 4R1YA 3Q32A 3TNHA 3OT8A 2YIWA 1R39A 2W4OA 4E5WA 4F52A 4EBWA 1XS9A 3S1HA 1BN5A 2JDOA 2F9GA 5DV5A 3OTVA 3QCYA 1D0YA 3S3IA 1JUMA 2WIPA 2XJ1A 2WO6A 2FSWA 4CFNA 2P0WA 2Z2WA 2ETHA 5JHUA 2FOWA 1XTAA 4R7IA 5LXMA 3QTIA 4EHVA 1T95A 2ISZA 3PA4A 2IGMA 2GNGA 4N4NB 3IKAA 1W0XC 1ZG3A 2O8KA 4CFMA 4GG5A 1ZYCA 3DNEA 3RWPA 1I44A 3R7YA 5LWNA 5KKRC 3GB2A 5KCVA 4TWOA 1BOAA 5CT7A 2ZXWH 3S15J 2V1UA 4DTKA 1TNTA 1MSFC 1OCTC 3BG6A 4A69C 1EA3A 5EYRA 4Q4ZF 1ST0A 3MS9A 3PPKA 2H27A 1ZMWA 3LFNA 5DE2A 2ZSIB 1ZYSA 2VXDA 2P33A 4IMYA 1ZYRF 4UWCA 3RHKA 2WTIA 3LSTA 1JPAA 4DFBA 4UHTA 1ZY5A 2Y4IC 3TCPA 5CEMA 2FU4A 1QZEA 1MMDA 2ZV9A 3OF0A 4JOMA 2OBPA 1XMMA 2CLXA 2M0MA 4OT6A 3S2PA 5IT3A 2WOUA 5BVOA 4H4KC 3VVHA 2I0YA 3ZN1A 3MTLA 1G8JA 5LMBA 3BC8A 2E7WA 3IH4A 4HF2A 4ZDLA 3D14A 4YJTA 4FEQA 4YURA 3QP5A 4O7WA 4QP8A 2VUMJ 3ZFMA 5K7HA 3F8BA 3ULIA 2JA6J 3ACJA 2IGNA 3DTKA 3QL8A 5K4JA 3UDSA 3TM0A 5CVFA 4LGHA 2MD0A 4O38A 2NVYJ 1KE9A 4EHGA 2O5RA 1XSXA 2ITQA 4IHTA 2DCEA 3QRKA 1BR1A 1ULYA 3EN9A 1T2KA 3FQEA 4XG3A 2LSOA 4ZY6A 2YZLA 4A3GJ 1KONA 4K6ZA 1V0OA 2WFYA 4BCKA 2I0HA 4G3CA 4KIFA 3VUIA 5DS9A 2XGDA 4DGWB 3CQZJ 3WE8A 3GNIB 4PSWA 1YJWI 3ASOH 3MI9A 1YW9A 2OZAA 3UPXA 2FX0A 2YZAA 5JQ8A 2TDXA 4QP2A 4L3JA 4A7CA 3HOZJ 1ZGWA 1FBNA 5EDQA 4PP9A 1SVGA 4USEA 1SVMA 3OY1A 4P9UA 3MH2A 2PTKA 4BCNA 3T5XA 1Z77A 2ZKZA 3HNGA 1WJAA 4RZWA 3E7LA 2K9NA 4U44A 4D4YA 3HMOA 3MDYA 1A6QA 5FLXK 1A9UA 2ZJQF 1W5CC 3K5UA 1IC8A 2Y0SN 4R8HA 1G2HA 4BKJA 1W36C 3WZKA 1KV1A 1YQAA 1WMKA 2D1VA 3KZYA 2DA1A 3A62A 2F7XE 3KVXA 5D6FA 4NZWB 2HELA 4RFZA 5CYIA 2NYXA 4WT6A 4XRMA 4NL0A 3W0OA 5TRDA 3QU3A 4U88A 4YJOA 4XX9A 1R1TA 4RM3A 2ZB0A 1Y8QB 1ERKA 3FXWA 2CKEA 5KX8A 3PSDA 3MH0A 2JIVA 2ICWG 3VQUA 5C8NA 2O6GE 3I1AA 3G51A 3UYSA 3QOEA 1ZG1A 2BILB 2W5AA 1O6KA 5D6EA 3MB7A 3DQVC 5D5XB 4LDTA 3I6WA 4EM0B 4BCOA 4FL2A 2OH0E 5A4EA 5K5OA 1HOMA 2BMCA 5FKLA 2UW9A 4O0RA 4AGUA 4ENMA 1TLHB 4F70A 4RA4A 2GNLA 5ETIA 4AC0A 4FICA 1LE8A 1YQJA 2O61A 3RPUA 3DAEA 4BCFA 2QUFA 3PNYA 2PMUA 4F7ZA 4WF2A 3RM7A 4LB6B 4OTRA 4FKLA 4BCMA 3NEWA 3ZO3A 1FIAA 4AACA 2KRCA 5KCMA 2J2IB 4D58A 3HOYJ 1RIOH 5L8JA 3BLYA 3U21A 3VUDA 1FBSA 4IQ6A 4XLHA 4U40A 2ITNA 4G3FA 3F2NA 1OJLA 2WQBA 4M68A 3ZMVA 3E6MA 3FKJA 2R3MA 2Q83A 4IVBA 1PXPA 4EK3A 3IHUA 2KIQA 3PNVA 3HGGA 1BI1A 3J81Z 5CYVA 4FK6A 1LFBA 1B1BA 2ZO4A 4AA4A 2LG4A 3MKYB 5HNFA 4O3MA 2VWZA 3B6AA 3HP2A 3HG9A 3RIRA 2UUZA 3G6EI 4BE1A 2PVKA 4U0YA 3OBGA 2CGPA 2M2EA 2BY2A 1PJKA 4J7BA 4UVCA 4UUVA 3EB0A 4ZAUA 4MEYF 4XLEA 1F3MC 1OIQA 2KKOA 2YX4A 4EMSA 4A3BJ 3GFMA 5HIEA 1UVRA 3TG1A 1Q1VA 3HPGA 3E87A 2P4IA 3AT2A 4DGMA 4WA9A 3H9OA 4BDAA 3GTJJ 4XLAA 4CCMA 2BXZA 3HUGA 5E7RA 3ITZA 3KCKA 3QTQA 3UKGA 4RAGA 3LW0A 4JVGA 3H9GA 2WMUA 2VQLA 1MIJA 2IZSA 3KX2A 3JRBA 2XNBA 2UZBA 2BV6A 4JK1X 4HZFA 5CQWA 3DKXA 2FSOX 4XBRA 4DH1A 4O2ZA 5HTCA 3QRTA 3UQFA 4IX5A 4EYMA 3IW8A 4FKOA 2R0IA 4S34A 1YX3A 3AC3A 1ZOHA 4OOIA 1XDSA 5AV0A 3COIA 4Z9LA 2JITA 5FFXA 2W05A 4RRVA 1LR4A 3ZXZA 1LVAA 5IMXA 3OMYA 2BR1A 3IC7A 4A6EA 4X2GA 1QA6A 1LEBA 4IL6C 2XKOA 4K33A 4UB7A 4YZNA 3KYLA 4PDSA 3EFWA 3R8UA 5A4TA 4DITA 3PTGA 5LCKA 3VODA 5JVGF 3H3VK 1R1VA 5A4QA 4EBVA 2W1IA 1TZLA 4FTRA 2X39A 2MH9A 5JQ5A 2NVTJ 2OCCH 2NS8A 3IKVA 3BYOA 3FKNA 4FNYA 3PY1A 2D45A 3VUKA 1CGPA 1YDRE 1AKHA 4O6LA 4GFGA 1IRGA 5AUYA 3PUBA 3LSKA 4LFUA 4JDKA 2M45A 1T98A 4IFGA 1FVVA 5EQPA 4ZYHA 3R1NA 2PE2A 1HDDC 3OXIA 5HVJA 2F57A 5CVVA 4CYCB 3FC1X 4FX0A 1FP2A 1YWVA 3W2AA 3BG9A 4RPVA 2LF8A 2MLGA 2UZTA 2PPQA 3COMA 5FTOA 2GNIA 2XIKA 1ZR4A 2YM7A 4XM3A 2VX0A 4IAAA 1XG1A 4IB5A 3NX8A 4PJLA 4LB5A 3HV7A 3KRWA 1R0PA 2KIMA 2BRGA 4M0YA 3KYCB 3SW4A 3VS1A 5FGMA 1G3SA 1XH9A 4U45A 4AT5A 4FTNA 3PWYA 5FXSA 3F7WA 2Y4IB 3LQ3A 2GQRA 4IQJA 4IANA 4UNOA 3DY7A 4IC8A 1FVTA 3FMJA 3RAKA 3DBEA 4TTHB 3Q9VA 3UBDA 4J96A 3R9NA 2HZDA 4IPAA 1EH8A 3KEYA 5HG5A 1ETWA 2AQEA 2Z5UA 3LSRA 1N25A 5M5YJ 2DA2A 2FNAA 1MJBA 2EWAA 2QOQA 4RX8A 5M07A 4NBQA 1OKRA 4EH4A 2YABA 1H01A 2XPVA 3GTMJ 3K69A 3F22A 2IJLA 4XKWA 3I4BA 4CO8A 2VKEA 4HQMA 2N8GA 3K0LA 3RZDJ 2WXVA 3LFSA 4KICA 4M3QA 5AEPA 1CMKE 2XV4S 3LSHA 3DPLC 2H8RA 2M7AA 2GNFA 3OY9A 3RI1A 3WZEA 3AAFA 5HEZA 3E5XA 2WQOA 2WQEA 3UVQA 4LOQA 5KK1A 3BGZA 2JUCA 4FSTA 4EATA 5HE3A 3TNWA 1VQOI 2BXYA 3IRRA 5IPJA 3HDNA 3WE2A 3AG2H 3N4VA 3RAIA 3HAVA 1Q41A 3TEIA 3HHGA 4ZYDA 3PJ3A 3GFJA 2W17A 1W84A 3FKIJ 5FM3A 1J5YA 3KN6A 2EXCX 4JQFA 4BBEA 4W97A 2W96B 2YCSA 2OCEA 3HPHA 3DXQA 4NK9A 3Q6UA 1A04A 4II2A 3KKVA 2IG7A 3RM6A 4XCUA 4ACMA 1T8IA 5EYDA 3SOCA 5DTDA 4PZJA 3LCOA 4FIJA 4B99A 3V4GA 1E17A 1XWSA 4C2TA 5CSWA 1BMKA 1S7EA 2QI8A 2R3NA 1E1XA 5E8SA 1NK2P 4O83A 4HAMA 5EDRA 5HLGA 4FMQA 3Q53A 1D1BA 2DTRA 3ZQQA 3ZRKA 4RX5A 3A7IA 5KZIA 4D5HA 2ITUA 5IYBJ 1ETKA 1IXCA 4I0BA 5BMZA 2G15A 1PP8F 2XF6A 4C4IA 5AJQA 2FH9A 5GP9A 2QQ9A 4NM5A 4YIIA 1MMAA 4F1OA 3D2KA 4UV0A 3W55A 4DIQA 5AAGA 3V5TA 5IF1A 2M7BA 3CD6I 3DJ6A 4ASEA 1TVOA 3U54A 5IG1A 1RUOA 4D1ZA 4CUGA 4QPOA 4EHEA 2C5OA 2XSDC 5JFWA 2E5NA 3L8SA 1YXTA 2WY8Q 3ZCOA 3CJGA 2W0JA 5IQCA 1S7AA 4ENKA 4ANSA 2LF7A 3QTWA 1Z9XA 3CLOA 3S2HJ 2MA3A 1YYVA 5AV3A 2K86A 4L43A 2PZIA 3NYNA 1MH4A 4V0GA 4NU1A 4XOPA 4FSWA 3DJ5A 5B3SH 5TKDA 3A03A 2C47A 2OD5A 3QPTA 3KY2A 1GIJA 4O5VA 3I54A 4LV5A 2M9HA 4BY1J 4RB0A 3RKXA 5BOXA 4OTGA 3BP8A 4UWBA 5IISA 1OL6A 3EETA 1HXDA 4F0FA 2J90A 1OISA 1OMIA 4WUAA 3IP4B 3OWKA 4E7LA 1PMVA 2V1DA 4IVCA 2OV7A 2DMUA 2JT1A 5HVQC 4KRCA 2DLLA 3FXQA 4RIWA 5EG3A 3UP2A 2MC3A 3J80K 4HW7A 4L5EA 3LAPA 3FY2A 2DFEA 4IO9F 5CEQA 1O3RA 3ORXA 1SD5A 2M4KA 3LE6A 3UO6A 2XNGA 4MTEA 4JDIA 3G0EA 4BY7J 2WNTA 5LVPA 4KS8A 2BZTA 3SDBA 4AZSA 2GNJA 4B44A 4RGSA 1B8IB 4U97A 4G12A 4ENXA 4C9YA 4E7SA 2BROA 2WMRA 5DD4A 4CCKA 1T33A 3NFGB 1LVKA 2EU9A 4ZH4F 4LRKA 4GEOA 1T39A 1MBFA 2XANA 4L9IA 2ESNA 3K70D 2LBFA 2K9LA 4AYBA 1WBWA 4EJWA 2PUIA 4Y5QA 3PM1A 2Y0MA 2YACA 1SD7A 1QRYA 1Z7LA 5IY5H 4MUQA 2L0KA 4HDUA 1OKYA 4B4CA 1NXKA 1IXRC 4RWIA 3THBA 4MHAA 5D11A 4C3IJ 4F91B 2X9EA 4B47A 4DEHA 4L6QA 2R3LA 5DA3A 4E4MA 2YAKA 3EYIA 1Z05A 3VJNA 3VBTA 1Z7UA 1F9NA 2UW7A 5DM7F 2XKDA 2BALA 1WVXA 4HCUA 3PLSA 2E2JJ 3TUDA 3HVCA 1OR7C 3VS6A 1R4MB 4FIIA 4XLVA 3NNVA 4C30A 3AKLA 2XGCA 2JWTA 3QPLA 4E73A 4RB1A 3QUDA 2IW5A 4BXFA 4ALWA 1SZMA 3AMBA 3FHNA 5DD8A 4FUYA 3QD0A 1NW1A 3QYFA 2HIWA 3C4FA 2M5WA 3BWFA 3ZFYA 3C5UA 3C3WA 3GU5A 3PXYA 4F7SA 2B9IA 3N97A 4C33A 4JG7A 4GVAA 4BHZA 2J6MA 2P4WA 3FDNA 2L7MP 3LFEA 3GU4A 3WTSC 2R7SA 4V0GB 3BHHA 2PE1A 3JW4A 1CKPA 4EH5A 5K5QA 3TJDA 2DI3A 3KXZA 3R02A 4FYOA 5I9WA 2XPWA 4BQQA 3U87A 3D5LA 3S16J 2P5LC 1JTYA 1X19A 5E8YA 2Z1DA 3F23A 2GS7A 1FPQA 1X58A 3E63A 3ACKA 2RV8A 2Y9YA 3OCGA 3GFLA 3L00A 3ODYX 1GT0C 4I0RA 4U0IA 1DM2A 3E5AA 4BTFA 3HLLA 5IP9J 2ZJWA 1QU3A 1LB2A 3GUBA 2WMXA 1JJ6C 1HC8A 1R6RA 2EB3A 3R7UA 1BYGA 4X2NA 4FEVA 2E5ZA 1APME 3PXQA 4PJNA 2DS1A 1FMVA 3UR3C 2QHMA 3WU1B 4EUUA 1IXSB 4FTKA 5HIBA 4YSJA 5C4XJ 2X6OA 3BKBA 4CLIA 5A4LA 1SMYF 2AUHA 4C59A 2FNPA 4NJDA 4D2RA 3F88A 1R78A 2P8TA 2Z7RA 4K8AA 4MWHA 3KP4A 2BRMA 1YDSE 3V01A 2NRAC 3Q5ZA 3G1OA 1S3JA 3KE2A 3TOAA 3VS3A 1X8BA 4BGQA 5ILUA 2QU6A 1Q8WA 4FUXA 3MBLA 3CP9A 4G8XA 4CFWA 1REJA 3LCSA 3FF5A 5C3EJ 4BEHB 3TACA 5B66C 4PJJA 3O96A 4JDHA 5AP0A 2HW6A 4ZYAA 5HO7A 2PEXA 2VRXA 2OF2A 2QLZA 3WTVC 1IEPA 1RC9A 2XF0A 4XP3A 1WKMA 2DOAA 4N9IA 2QODA 3CY2A 1YHSA 1V0PA 3C50A 2VLAA 1IRXA 1FOKA 2ONLA 4NQWA 5HX8A 3GLXA 2ZSHB 3LFAA 5CF8A 3QAHA 1VQ4I 4CG8A 1JE8A 3MJ1A 4A07A 4CLJA 2AHQA 1TT0A 3GQIA 5HNGA 3B2WA 3BY6A 3MIYA 2ITXA 2R7BA 3QYEA 5EQYA 1LFPA 5HGIA 4BR3A 2JDSA 3OEZA 2QKLB 2ZC2A 3LFFA 4FE7A 4FL3A 4S30A 5H8GA 2L01A 2R7TA 4N70A 5E92A 1J59A 3A2CA 4G3DA 4DFLA 2LAVA 2BAQA 2DBBA 5L2IA 4FHTA 1Q8TA 4H0EA 1REKA 3WODF 1JKLA 1VNDA 5KMMA 3E3VA 4OTDA 5EQEA 2IN6A 3G0FA 5HLIA 3VQHA 3SZPA 2R7QA 5HCYA 2M87A 1GY3A 4EZ5A 3EUAA 4K2EA 1QPEA 4ANBA 4JX3A 4KSQA 2QONA 1QMZA 4LG3A 1J09A 3I7CA 5ETAA 2GFSA 2UVXA 4H58A 2OI4X 4M71A 1YJNI 3UG1A 4BDDA 1MRVA 5AX3A 4Q9SA 5AUWA 3RALA 2Z16A 1W7HA 1G3NA 4U87A 4B6LA 2K9SA 2C6KA 2RKHA 2UWMA 4GK4A 4FT7A 1V55H 4HYEA 4HOBA 5C44J 3R8PA 1U9OA 3GFIA 2YS9A 3AT4A 2I6LA 3OYNA 1PXMA 5EEGA 4X2FA 3IV5A 3ZMTA 4FSMA 2WAEA 3D7TB 3OD6X 4MXOA 4NYEA 1IAJA 1U5TA 3FMDA 3O8HA 3F6OA 4I2OA 3A7HA 3MKZA 1URCA 4LL5A 3D83A 4EQQA 4BDBA 1J3HA 1Z1DA 3H36A 2R3JA 1Q61A 4ZSEA 3HYHA 4BGGA 1JI8A 4XNEA 4I0AA 2DWBA 2LMDA 2W24A 3PO3J 3KP6A 4UUSB 3V8JA 4X6QC 3A60A 4KJZA 5CAPA 4KB8A 3QTRA 1LE8B 1JBPE 3OROA 4BJTA 2X1CA 3CEKA 3P78A 2W99B 2J0MB 3NUXA 2Z7SA 3KK9A 3U4WA 4DH8A 4I02A 5EGOA 2CQ7A 2B9JA 3V5WA 3CKWA 4BQOA 2VTMA 3NYVA 1L3LA 3UZTA 4QNAA 1Q3DA 5TT7A 4ZP5A 5J5SA 2QLUA 1KU2A 4IHSA 1PMEA 3VPRA 3ORLA 5B2MA 3M3YJ 1N78A 5IUHA 2E9VA 3A2KA 1HF0A 4O81A 5CPRB 2GIZA 3I59B 3VO3A 2B9SA 4ABZA 1GZNA 5ANOA 2HQAA 4E6AA 4WRSA 2XNPA 1DAYA 4ZSLA 4ZY4A 4H3QA 2H6CA 1KYZA 2OG8A 4D28A 5LMAA 3VYTB 3E88A 1OPKA 4W4XA 2PHKA 4MXYA 4CICA 4XLPF 2CGVA 1Q8ZA 2A05A 3F69A 4BQNA 2HOGA 4HGSA 3KETA 2WTKB 1GVDA 4KS7A 4QMUA 1ZOGA 2VWIA 4ZJVA 3DU5A 1V5EA 5JGAA 2J9MA 4RGJA 3OYDA 4MBIA 1PXJA 3QA0A 2PVHA 4GS6A 3FMNA 2GCDA 1P4FA 1BJZA 1R58A 2JA2A 1W98A 1PMNA 3KF4A 5DT3A 3LFBA 3LSPA 4UY8I 3TXOA 4BYYA 4D5CA 1K2PA 1PKGA 3MAJA 4A4LA 1Z6TA 3R04A 4BZOA 4O84A 3VYRB 1MMGA 4W1UA 1FVRA 1WBOA 4IDVA 3CS9A 3VJOA 2IZRA 4CEGA 3SFIA 5AM7A 4QT1A 4WBBB 1IN5A 3N51A 2K4BA 1M7QA 4AZWA 2Y7JA 3NUUA 4ZSJA 2KDZA 4IHWA 3HMIA 4YG2F 5H6RA 3G9NA 1C0WA 5KMIA 2X48A 1X3UA 3CJTB 1BOBA 2R93J 5DEYA 2NS7A 4MTDA 1H88C 4I01A 3RCOA 5FJ8J 3BEAA 5HCZA 3FC2A 4AOIA 5M57A 3KP3A 3GVAA 3FQSA 3ML1A 4I92A 4YJNA 2JJ7A 1G8KA 1REPC 2MYSA 4P5QA 5HESA 3QQHA 5CEIA 1J1BA 2FUMA 2AS5F 3J80Z