3TMOA

The catalytic domain of human deubiquitinase duba
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
141
Chain Sequence
AARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords OTU domain-containing protein 5
publication title Phosphorylation-dependent activity of the deubiquitinase DUBA.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 141
sequence length 158
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tmoA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tmoA01
3TMOA 3PFYA
chains in the Genus database with same CATH superfamily
1XPXA 3ORPA 2YUSA 3S95A 2JVGA 5F0CA 1ONVA 4A2UA 3G5DA 4AF3A 2AC5A 3R7UA 1VQLI 5ITAA 2QCOA 4FYNA 3BY6A 3V6RA 4UXLA 3W0SA 3GUDA 3RAKA 1F43A 4AAYA 3U55A 4G8XA 3F2AA 3SJMA 2IVMA 3UYSA 3EFWA 4AU8A 3RKWA 2R7ZJ 1P4WA 3BV3A 2J90A 4LV7A 4F7LA 1PW2A 1OMWA 4BI1A 4LGWA 3VF8A 1H1RA 2X6DA 1P6RA 4XLPF 3LA7A 2FMYA 2Q2EA 5EYDA 2XAFA 1GIHA 4C3FA 2M4GA 3NYVA 4NL0A 4IHWA 2PVRA 2EQRA 1MBEA 2QSHX 1OCOH 3Q9VA 2W57A 4CXAA 1QGPA 4GFOA 4BDEA 4IE9A 4YTHA 5GPCA 5LJJA 2VNYA 5FDXA 4IL6C 4YO4A 4IBMA 4BR3A 5J3LA 4ON0A 2A6HF 2ZV8A 4AQKA 2X6OA 1BJZA 3LLTA 1FVRA 1MRVA 1JT6A 1ZR4A 5F0FA 4AGUA 4XV1A 1IF1A 2OBPA 3RCOA 1A6IA 3DBCA 4Y95A 1D1AA 4WRSA 1MBHA 4LK1F 4FZAB 4G34A 5FTQA 3V04A 2MC3A 4G6QA 2XANA 2W05A 4TN6A 3L9MA 3A03A 4ESBA 3RMFA 2PBIA 2CSOA 4L6QA 3FYJX 4PQNA 4YMJA 1R71A 4ZZOA 3PA4A 4BE1A 1K78B 3D5SC 4EKLA 4CFXA 1M2PA 4I93A 2OQRA 1OQYA 2Z2WA 3W55A 1Y1WJ 5ANIA 2ME0A 3TQNA 3A0BC 5DH3A 2UW9A 3QQUA 2QO7A 2O5RA 2BHHA 1QPJA 2M8EA 1D8KA 1J7LA 1GY3A 3W3CA 3SOCA 3MBLA 4J8NA 3MN2A 3V3VA 1JPAA 3GXOA 2YM3A 3L9PA 4EOPA 3NCGA 2VO3A 4R6VA 3CP8A 5AA9A 3F9KA 3A4PA 3O0GA 4KIPA 1F4KA 3GB2A 4FIFA 1N75A 4C4JA 1PYXA 4YZNA 4OIRF 4OUCA 2XDVA 5GPAA 5AV4A 2UW6A 1X4PA 4H39A 4OTHA 2BRHA 2QG5A 3LXLA 5M4CA 1K78A 5LVNA 2WAEA 3ZLWA 4FTRA 2HK5A 4BZOA 4O83A 3OW4A 4IWPA 3DKOA 4O7VA 2OH4A 4YHFA 2ETHA 2HXIA 1LDDA 5IA5A 1O3TA 1TFFA 4XEYA 4DCEA 1RW8A 1YX3A 5F04A 3GTOJ 2NXNB 3MB7A 3W2PA 4HF0A 4CG8A 4NW6A 3FMLA 1SD4A 3FMQA 3MCZA 3IOKA 3SZTA 2ZXJA 3I55I 1FYMA 3NIEA 2XARA 3BU3A 2CLQA 3PUFA 4HOBA 1IG7A 5HS7A 4L67A 4I6FA 3OVVA 4XONA 2WO6A 3L9LA 3MESA 3VYRB 3VJOA 4UXQA 4KIGA 4KKGA 2FA2A 2YA9A 4AE6A 3E3VA 1G3NA 2WMBA 5HLPA 5BVWA 4FV6A 3CKXA 2UW8A 5HE2A 3RTPA 2JA8J 1MBGA 4PDSA 3ZMMA 3FHNA 2X6WA 1OFCX 1TWHJ 3IDCA 4XV3A 2Z3YA 2VWBA 3IWFA 1OL5A 2BY1A 4FV2A 1CKJA 4OTRA 3LQ8A 4DJAA 3C2GA 1RE8A 5FEEA 1UAAA 4PTCA 4Q47A 5DEQA 5G1XA 4FSQA 1RUOA 5FM3A 3SG9A 2Y69H 3ALNA 3V8JA 2ZCWA 4TRLA 4CZUA 2R5YB 2OU2A 5HESA 4QYGA 1T6SA 1WBWA 1WSUA 2WTIA 2J50A 4YIIA 2ZAZA 2JDRA 4GSBA 4BDJA 1B9NA 3Q9YA 3MKZA 2BRNA 1YG2A 4BE0A 4YUQA 3ANQA 3BHUA 1FOXA 3IHUA 4PP9A 1H1WA 4ZEGA 4BCNA 3GXLA 2XEZA 4CSWA 3GLXA 3QODA 5CI7A 3FXXA 1P14A 4IFGA 2BXZA 4EQQA 5LOHA 3OY3A 2MLGA 2L7KA 3CTAA 1NK3P 4C02A 2QWWA 1EKEA 4PTGA 4Y73A 1LDKB 5I9XA 3DNDA 3PVUA 2AO9A 3F5XA 3SYTA 1XGNA 1MRUA 3DZQA 3KETA 3JR9A 3E8CA 5E90A 1KE9A 2X39A 4IM0A 1XDUA 1P4OA 2TDXA 1DP3A 5L6OA 3R61A 2ITXA 4DH3A 2XGXA 2A69F 2HQNA 1CSNA 3ULZA 1W84A 2LP0A 4AIHA 3M4OJ 3HOYJ 3AMAA 2P4WA 2R5YA 3ZQGA 2FSMX 4DGOA 2CQNA 4F6WA 4B09A 5IQHA 4GL9A 2C5XA 2R92J 2GS6A 1A48A 3HZJA 4LG4A 2R3RA 2W9ZB 2XAUA 3CJTB 1PDNC 3QQHA 4PF4A 1J7KA 4HBLA 4MBJA 4CMOA 3AKZA 1WZYA 2Z5UA 2HOGA 3B02A 3DFCB 4TXCA 3R9OA 3LCOA 2BBYA 2CV0A 4QMLA 3AGMA 3KLNA 2BYVE 2OZAB 3ASNH 3C3WA 3G33A 3B6AA 3PZHA 2KZGA 4RAGA 2Z02A 2RKHA 4I5HA 3PIYA 3Q6UA 5ANGA 4LB5A 3CTHA 2Z9OA 5FXSA 4DEGA 3AKJA 4Z16A 3K4CA 4AU7A 2C3LA 3RDIA 4MX9A 4H3PA 1GZKA 1OCCH 4EONA 3ZPLA 3DK3A 5H8BA 1D5YA 2AHQA 2Y9YA 1IXCA 3D15A 5IOZA 2VL8A 4M13A 1LUJB 3QTWA 2HKXA 3DAKA 4A06A 4ZS4A 3R8ZA 3MPAA 3BPXA 4R8HA 5DE2A 3SC1A 3NWWA 4U0WA 1SFKA 3W2AA 3ZN0A 4IX5A 4QEBA 4AX8A 3H1CA 1GZ8A 4YLLA 4O96A 3ORTA 3U2RA 3LXPA 4FV3A 2OIQA 3HA6A 3VBVA 3HMIA 3H4JA 2QURA 4XG7A 4IXAA 2RFEA 4IVDA 4ENMA 1UU3A 3Q5FA 3CCSI 3MVLA 4FKVA 3RHXA 2OZAA 3R0TA 2V1XA 4OGRA 2ZV2A 2XYUA 3WF7A 4EL9A 2RREA 1V55H 2O7OA 4RM3A 2XK3A 3I7BA 2BDJA 2YCSA 3UG1A 5CVJA 5HCYA 3CGFA 5EEAA 1LEAA 5K5XA 4KS7A 3A02A 2HXOA 1QPEA 2YAAA 1BMKA 4FKTA 3R6XA 1OJLA 3SD0A 3HOXJ 5EDPA 3UO6A 3KRLA 3CLQA 1YI6A 4CMUA 2FSTX 4FSWA 1H4LA 2O2UA 4F0FA 4IX3A 5ANDA 4PZJA 2ITWA 5JFRA 1E17A 1T56A 4V0GB 4FEWA 1VYZA 1G8AA 2FBKA 4FETA 5I9YA 1OL6A 4I5CA 1CKPA 3C50A 1Q4LA 4HGTA 5A3XA 2Y0MA 2Q0NA 2QEXI 5KAFC 4EOOA 5HIEA 1QRYA 5HO7A 1BL7A 3EQCA 4G6TB 1GIIA 3A7JA 5AUZA 4L9JA 4XLCA 3ZYAA 1MMDA 3KP7A 4EUUA 1XH6A 1U5TB 1IN4A 2NNYA 3Q2JA 4X2FA 2R5TA 5LEKA 2WMUA 2GU8A 5D7VA 2C0OA 1SMTA 4C3JJ 2UW7A 4KISA 2XK8A 2JVHA 2YN8A 1MGTA 4B8XA 4FBXA 3K6GA 4OTFA 3U6HA 3KRRA 4CNHA 1WJDA 3N51A 4RDUA 4BCIA 4I99C 2XKOA 4B99A 2A68F 1UU8A 2DBBA 3KVXA 1U8BA 2XM8A 4ACCA 4LRKA 2OJ9A 5CQEA 1WJBA 4A69C 3R0AA 3D5LA 4TL0A 4DOZA 2O8YA 3WF6A 4CV8A 3PPJA 4FTQA 5IQIA 5EDNA 3LFSA 5BVEA 1R3CA 5CALA 4GFMA 4QT1A 2HELA 1PXJA 3J80K 2YM6A 1MJAA 4XN0A 2KISA 2BW3B 1U5TA 2QO2A 4KBCA 4FEVA 2M87A 1XGSA 3FXKA 4F0IA 4FOCA 4G9CA 4GRBA 2XEYA 2LAVA 2Z16A 4YJSA 1TQPA 2QC6A 2LRDA 3MJ2A 4HVHA 1ETQA 2LY9A 4F55A 4BZNA 3NARA 4MH7A 1RR7A 2Y9ZA 5A9UA 4D1ZA 3NRMA 2R7FA 5LQFA 1JBPE 3BZ3A 3QP5A 3PJ8A 2STWA 2P7CB 3MZHA 5JRQA 2OCCH 5EFQA 2X6EA 4DGWB 2WOTA 1R1WA 2W1ZA 2LYCA 4BDGA 4B4CA 3WYYA 1GVJA 4XUFA 2Z33A 3AC1A 3TNHA 2UW5A 4YURA 2E34A 3IGGA 1LFPA 3PRIA 3TKUA 3CMAI 5M5YJ 2BUJA 3C0IA 4ALVA 3V8WA 1ZRCA 3UNGC 4HSRA 4AFEA 2BW3A 3I1AA 4E73A 3E5XA 4EH8A 1Q8ZA 5HBEA 4CA0A 1XTAA 2M45A 3A7IA 4KS8A 2XKDA 1QMZA 2J0IA 1V54H 3F3TA 4ZSLA 2QQBA 4BE2A 2UVZA 3GOKA 1ZKGA 2P3GX 3KN5A 3TW7A 3H35A 3TN8A 3LJ2A 3ZDIA 3PQJA 1PRYA 3H0DA 5J4VA 4NQWA 3DB6A 2J5EA 3SXYA 2JAVA 4BHZA 4XS2A 3FXOA 5FKNA 3QYFA 2JQ7A 1HA8A 4O0YA 5HLGA 5HBJA 5HODA 1XMXA 2YCRA 5E8ZA 1VFCA 4P55A 2DPDA 1FPQA 3CCMI 2C69A 3CMEI 1VR2A 4ERWA 1B4AA 2QGUA 4B44A 1YKRA 5BPYA 1I1GA 1M2RA 4FZ7A 2KIUA 3P9JA 1X3WB 4M0ZA 4E93A 3SGCA 2PMIA 4L3LA 3FLQA 5ETCA 2GZWA 3EQBA 4XKWA 2EFPA 4EC9A 2XB0X 3GU7A 1T33A 3ULIA 4JBAA 1WH7A 3Q9ZA 1AQ1A 1MMNA 3ROYA 3MTLA 3GFLA 4LFUA 3OD6X 2CHLA 5JFXA 5M44A 2HIWA 2M30A 3FI2A 3GP0A 4D5FA 4NUSA 1JSUA 5FD5A 5JKGA 2VE8A 5CVVA 2FUMA 1OGUA 5ACKA 3MTFA 1FTTA 3M07A 1YXXA 5I9VA 4NC8A 4DT9A 1Q3WA 5M08A 2K40A 2PMHA 4BDBA 2W4KA 3ULQB 3ENHA 2C6OA 3OYDA 3IOPA 3Q96A 2ZOQA 2L7MP 4FL2A 3WF5A 2XAHA 1Y39A 2BXYA 4DBQA 4D0PA 3O8UA 3QTZA 4IJ9A 4CT1A 4ASDA 2CGPA 5DM7F 4P4CA 4UN0C 3PA5A 2HVQA 1YW9A 3R8LA 3BPRA 1FMOE 5DVRA 3K1PA 5TR6A 2C6EA 1LJ9A 4MXAA 3EOCA 3TCPA 5A6NA 5FP5A 4NNJA 3U4UA 3JTHA 3UOKA 1E0EA 1SC7A 2X1EA 2I40A 2BFXA 2JKOA 3OS3A 4D9TA 1U2WA 4PWNA 2BFYA 5BX0A 2F48A 3UZTA 4BXFA 4ZTLA 4QTRA 4MAOA 4MD9E 3DKFA 4MLOA 2O0YA 3KFWX 2XRLA 1U8RA 4FTKA 5LRSA 3GFJA 4U8ZA 2E7WA 3OS0A 3OSGA 4ZS0A 2DW4A 3D0SA 3H5NA 5C3EJ 1POGA 1BI0A 5HG9A 2IZRA 3FI4A 4E5WA 3CUQC 3NS9A 2JDOA 2UZEA 4AS0A 3DWLE 2GQQA 4WF2A 4U9AA 4II5A 1OISA 4MNEB 1HDDC 5HDKA 1YOMA 3MJ1A 3Q6WA 2GXAA 3BLYA 5CVGA 3DTWA 3MV5A 4EQUA 4I6LA 2KZVA 1WBTA 4GS6A 3PFQA 1P2FA 2OG8A 4X2JA 3H9OA 3RNIA 1PYVA 3UP2A 5IEVA 5DRBA 5HDNA 3CIKA 4XJ0A 4EEVA 2W5BA 3VNTA 3IS5A 2YX7A 2QHNA 5A6OA 2OIDA 5J8CA 4IAZA 2VJJA 3JSPA 3BHTA 2HTSA 3GTMJ 1F0QA 4QPAA 3E3BX 1PKGA 4D1QA 3MI9A 5HS9A 2VC0A 3ZM4A 4HPUE 5FFXA 3OSFA 4KDPA 5HG7A 2HQRA 1K4SA 4CTBA 3ML6A 2QENA 1HW1A 4BDDA 4YFXF 2WQNA 4JDJA 5C26A 3KRXA 1IV8A 1FPUA 2ZFYA 4IMYA 3EHAA 3FXLA 2NOJB 3EQPA 4BDIA 5L6PA 4MNEA 2QOKA 1B38A 5IYCJ 4TNBA 4WBOA 3KYDB 5LMKA 3DBHB 1BI8A 2ETKA 3CDHA 2ZMEC 4DFLA 2WU7A 2R0UA 1OPLA 5JR3A 3HM5A 3W33A 4O82A 2XYNA 5JVTA 1H0WA 3UQGA 4NDLA 5FKKA 1YWNA 3W6VA 4U7ZA 4L5JA 3HV7A 1XHAA 2ESHA 4EH7A 5D6EA 5JHUA 4XYFA 3TACA 1YHVA 2J6MA 5I9WA 3OYGA 4JQ7A 3DB8A 2YDKA 4FTUA 1TWCJ 2CCHA 3I4PA 5IF1A 4ALWA 1MJ9A 5B1AH 5K9IA 1JHHA 2CNUA 5B2KA 2OZOA 4DGNA 3AG9A 3WHBA 5CF5A 2AEGA 2REIA 5ILVA 1H89C 2MD5A 3BCEA 2L4AA 2P5LC 3ZMSA 3IDBA 3PJRA 4YFKF 2OJGA 3C1DA 4ZTFA 1YTYA 1DS5A 1IO2A 2HKOA 1OPCA 3ZMUA 1TWAJ 2BAKA 3VONA 1OL7A 2K9QA 2WMAA 4JBOA 1Q8UA 3QXPA 4E4LA 3QTXA 5DRDA 5CAQA 4BBFA 4MIMA 4LJZF 4ZAUA 4C3PA 3OZ6A 1YOLA 3OV8A 4Y4RA 3EQHA 2MABA 3U21A 3I58A 1QCFA 4AGCA 4FVPA 2BAQA 2EILH 2OJFE 5CTPA 2YWPA 4W8EA 3DEEA 2JKKA 4XG6A 3MZ8A 2VRXA 4RIWB 1ZH5A 3ALOA 3I4MJ 4ASNA 3MDYA 2VU3A 4MGRA 2MFZA 3F3XA 1K4TA 4JK1X 2BY0A 4C37A 4A9YA 3ZMVA 4U44A 3RYPA 4AA5A 5EOBA 3W6JB 3ZXZA 5D5XB 1OIYA 4I5MA 3V7CA 4C38A 3UO4A 1V5FA 3CD8A 2VQCA 4YU2A 1TL8A 3BROA 5CNNA 4ZYAA 4CZCA 3RK9A 4RQKA 3NPCA 3IRRA 5FRMA 2KPMA 2WMRA 4EK8A 5CASA 1Z67A 3Q53A 3EFKA 2WNTA 4LRMA 4FK6A 1DI8A 3OS2A 4U41A 1LPUA 3DAEA 3KN6A 3LOCA 3SRVB 4RGSA 2EFOA 2OV7A 1VQOI 3P79A 4RIWA 2DT7B 2JWTA 5K7HA 2JUCA 3ATTA 4CH7A 4A4LA 1PHKA 2BPMA 3O2MA 3E88A 3UVQA 4GK2A 2GHGA 4HNTA 2H1KA 3HVCA 5B7VA 2XJ1A 3LCKA 5E91A 1ND4A 5F27A 4WRGA 2W82A 4KRCA 3QL8A 5E3NA 1O3RA 3F8CA 2ZO4A 2AS5F 4FTTA 3JCUC 3MWUA 1ZN2A 1SMHA 5M3MJ 2ZVAA 5DG5A 3LSRA 2NRYA 4E7LA 5F1ZA 4BUPA 2QU6A 3TW6A 5EDQA 5D5UB 2QOBA 4RLKA 3OWLA 2BR1A 1U6GA 4MK0A 3HXLA 4CRLA 3LKMA 2BKKA 4CD0A 5CEOA 3UOLA 3ZO3A 1V0OA 1OZ1A 2K3PA 4N9HA 2DN0A 4RIYB 4ENNA 3H9JA 2L9NA 4GJ3A 4E4XA 5JLXA 4BDAA 2JIIA 4LV5A 3L9NA 4KN4X 2LNBA 3QRFF 5BPDA 4O7LA 4J00A 2WADA 2STTA 2CGXA 4EUTA 4YNEA 5LVMA 1OCPA 3OTVA 3IW4A 2GFSA 4WHZA 2C5VA 2BVLA 5LHIA 4Z3VA 2H8HA 3RWPA 3EL7A 5FDPA 5FFZA 4AT5A 3WE2A 5A2QZ 4C2MJ 2PMZN 5CX9A 1X4OA 1FOWA 3QYEA 4YIRX 1MQBA 4BIEA 4RPVA 4ZTMA 1WBPA 2WMXA 3FZSA 4ZSAA 3RINA 2PWLA 4FKUA 4AVZA 1S6LA 3OYJA 5IT3A 4CFFA 2EPFA 2D1VA 3W2CA 4A3DJ 3BG5A 3BELA 4F9WA 5HU9A 4BHCA 1LB2A 2QHMA 3I60A 3BCAA 2F2UA 3A60A 4RIYA 3GFIA 3FY0A 1Q41A 2VGOA 1H8AC 4OIOF 1QL6A 3K4MA 4V2GA 1B8IB 5IP9J 1M7QA 3VW6A 5E8VA 4PUZA 4U0VA 4IRHA 3JY9A 5M4FA 1XWSA 5EM8A 3QCYA 4F7ZA 4EH2A 1X1AA 4M68A 3IAS2 5EZHA 4RAZA 3E3PA 2E1MB 1YIOA 4ZZNA 3P0MA 5FD2A 2GXBA 2H1LA 3G1LA 4QMOA 3QUPA 3TZ8A 3CC6A 5KZIA 5FLXZ 3HB9A 3DDPA 1ZYSA 2C6LA 4ASXA 5HKMA 1S3JA 2GNGA 4PL5A 4CO8A 4FUYA 1PXKA 4CKIA 3E63A 2WQMA 1O3SA 2H34A 1PXPA 4AWIA 1K79A 1P5EA 5J47A 2F5FA 1E1XA 4FL3A 2F6CA 3LNQA 4FGRA 4L18B 2E9VA 4JQFA 3E6DA 3MSSA 1ZZ2A 4HVGA 3HX4A 2JITA 3IONA 4XG8A 3HRUA 2GTNA 5D8LB 2JFMA 4ACHA 3GGFA 2A5YB 3RP9A 1ETYA 1B8IA 2I1MA 4WG5A 3EUHA 3CF2A 4C2VA 3L8XA 3A62A 2LDUA 4FKQA 3FDYA 5ICGA 4D2RA 3PNYA 4JR3A 4S30A 5DA3A 1XGMA 2QONA 2DFIA 4YLJA 3ORLA 1IG1A 2BHEA 2VTSA 3S3OA 3PY3A 4BY7J 4A3CJ 2PUPA 4E4NA 3V6SA 4EK4A 3S3IA 1R36A 2IA0A 3O7LB 2X4FA 3JPVA 1X1CA 4PJLA 1QPMA 3VRZA 3UPXA 3ZO4A 4DFZE 2DU9A 2IGOA 4C62A 2Y31A 1JGSA 5H8GA 3LMIA 3AKLA 5TJJA 4FTJA 3QXOA 4PDKA 4PFPA 2VTAA 4C9YA 4O81A 4A3LJ 3KEYA 2QQ9A 2GM4A 5IA2A 3U6IA 2XS0A 5LFAA 5DYMA 2DA1A 2XNPA 3CF5F 3FY2A 1FMVA 2PULA 3KZZA 3NAXA 5CSWA 4DZJA 2WMSA 4GCVA 3J7YJ 3BLRA 1YFHA 3VDXA 2A05A 4KJZA 3F8NA 2PMUA 2RN7A 4LI5A 3MPMA 2EH3A 2YZAA 1S72I 2PVKA 4A4OA 4ZTHA 1NVRA 3FWQA 3U9NA 4B0GA 4N4OB 4CYCB 1H1QA 5CPRB 2VTMA 4ITJA 4CVAA 4U42A 3LFKA 4HZFA 1YO5C 4MWIA 4LG0B 4BIBA 3VEPA 4MBIA 3MMYB 2YFXA 3M1SA 3EFLA 2DTZA 4JBQA 4U5JA 4UUVA 2LBFB 4WNMA 3FISA 1WGXA 3R02A 4F65A 3HLLA 3K1NA 1T0FA 4Y72A 3O7LD 3GVAA 5JFSA 3BLHA 4BBSJ 2AXTC 5J9YA 3KYCB 4M3QA 2IVUA 2XGCA 4A07A 3DPUA 1W36D 2EA2A 4F1OA 3DOGA 4LLNA 5AP3A 4D7MA 4EJTA 2XNEA 5E7RA 1YVJA 1W5TA 3OL3A 5KBQA 1H9GA 2X7OA 3RPUD 2YDJA 4NCTC 4CT2A 2GQSA 4YSJA 1SFEA 1PXMA 3KK8A 4EH3A 2VTPA 4XK4A 3GCQA 4IZAA 4ZDPA 4U7DA 2VODA 1E2XA 5ERIA 3R7EA 1TZLA 2OTLI 1FP1D 1QO0D 2P6SA 2K5CA 4N0SA 4O6LA 4FIEA 4ZXTA 1GUUA 4D0WA 5CLSA 4H0EA 5BYZA 4CYCA 4LG0A 4G7HF 2X1NA 3QD2B 4ANMA 4K8AA 2WV1A 3J7AO 2CYYA 3C2BA 4O7NA 2KRHA 4TWPA 2K4BA 2M0CA 3O8HA 1JT0A 4F70A 2CGWA 2LBFA 4QP6A 2ITOA 1LFBA 4X2KA 3DAJA 3ZZWA 4F3QA 5JK3A 1FQ1B 1JHFA 4OAZA 3GMEA 4EOSA 4P5ZA 2Z99A 1RNLA 1IXSB 2ZNZA 3H5AA 3H3VK 1Q5KA 3CCYA 2CUJA 4CZTA 5HG5A 5FJ8J 1JKLA 4AFJA 3I53A 4BXXJ 4A4XA 3GZNB 1X1BA 5HORA 4JIKA 2A6EF 1UZCA 1PMVA 1WPKA 2A0CX 1WQ2A 4QYFA 3PPZA 2ELKA 4XQFA 5CYIA 4JX5A 4YEJA 4UVAA 2ZXIA 4O0VA 1O4XA 1IXRC 1W7PB 4LL5A 3CY3A 3FXMA 4XP0A 1WJFA 5DUKA 2RGPA 2XF6A 2L0KA 2ID3A 1DP7P 3PP1A 3A8WA 3EQGA 2A27A 1M1EB 3DU8A 4O3MA 1L3RE 1IN8A 5HICA 1J59A 3ZO1A 3OCTA 2R4BA 5HX6A 4V19K 3H10A 5I4NA 1IR3A 4DLJA 4Y15A 3JRAA 2F4OB 3Q2MA 1Y8GA 3Q4ZA 1UNHA 2HAKA 4C3RA 4U43A 4EBVA 4WXCA 3KK9A 5EG0B 3BR3A 3OMYA 3ZRGA 1XMKA 4YRVA 3AC5A 2VGPA 1AWCA 2GXGA 4DCAA 2KHMA 3LFEA 4XR6A 2QD9A 3TM0A 4L45A 3BR2A 2DA5A 3SW4A 4O7WA 2WIPA 5L6WL 3HTUA 4LUDA 1Q97A 3QTUA 4M73A 3U87A 4G2FA 5C4XJ 1ZY5A 1UELB 3R4KA 1W7PA 4N0BA 1HKQA 1R49A 2OH0E 2W5AA 4NFMA 3ZSGA 3OG7A 1GZNA 4NC7A 4E6KG 1R58A 2FNPA 3QOPA 3HMOA 4U3ZA 2C3JA 2ZC2A 2XNGA 3JVRA 5E3MA 2XK7A 2ITVA 1YI3A 4FCYA 2VASA 1JGGA 1UHSA 1XQZA 5M4IA 3FBIB 2R93J 3W0MA 2E2HJ 5EG0A 2XKCA 5A54A 5HNBA 4HF1A 5L2TA 2XF0A 1XSDA 4K77A 3Q60A 3C1XA 4IAIA 3UDTA 3W6KB 5CVUA 2C0IA 4XG4A 1YITI 2VC1A 5IUIA 3S17J 4FOBA 1HQCA 1PXIA 4B47A 4TPTA 1R00A 3LFFA 3OHTA 3F6OA 3A8XA 3UNKA 3R8PA 2YR2A 2R7UA 2XJ0A 2VJ5A 3AQVA 5AFVA 4JDIA 3TP0A 4FVQA 4EYJA 3QCQA 2LREA 3RQIA 4RA4A 3RSNA 3HEFA 4IM2A 3CUOA 1ACIA 3BLAA 4AA4A 2A4LA 4DYQA 3L2QA 5CAPA 4HQMA 3P4KA 4EKKA 2HZIA 5I0BA 5H2UA 3VS0A 5K4JA 2W84A 2NYXA 3BG6A 1B72B 4NC6A 1N25A 2CWEA 1GNGA 1TW2A 3ZH8A 1R1VA 2CQKA 2PG4A 4IRGA 1J9IA 1JVPP 1Z1DA 4Y3OA 1XBAA 1X1PA 5J1UA 3GTGJ 4FV7A 3EH9A 3PE1A 2Y30A 2J0JA 4L5EA 2XNOA 1ON1A 2B7AA 1P9QC 4BCMA 5LRRA 1W98A 2DODA 2EK5A 3GNIB 3BU5A 1X1DA 2ZB9A 2B63J 5F9EA 2XH5A 5H2FC 1GAGA 3WTUC 3H3UA 4AE9A 4QMWA 2LFBA 4AG8A 4JAJA 4RMNA 5C01A 4UWCA 3LZBA 4BY9E 4X0MA 2B52A 2HWPA 4D5KA 5E8XA 4YBKA 4CRSA 2VT3A 3AC4A 4IHXA 2CW8A 5EYKA 1E3OC 1FINA 1MQ4A 4AW1A 5CZHA 1YHSA 3IWZA 2CKOA 3GQIA 4XLEA 3G71I 2UZBA 3MKYB 3R71A 3TXOA 3H9GA 4FR4A 5H9BA 3W2SA 1B72A 4TKSA 5K3YA 1I5ZA 3ZQ7A 5EI8A 1I44A 3GBGA 5E1SA 4PNIA 4QTBA 1NVQA 2OGVA 3KKVA 4OLIA 4JXFA 2YS9A 4FV1A 4BKJA 4GGGA 2GIVA 4K9YA 2I10A 2I0YA 4HZRA 3KQ7A 3G9NA 3F3WA 4V05A 3LMHA 4V04A 3KE2A 1P2AA 3GF2A 2J0LA 2HENA 3LFDA 3DKGA 2ERKA 1A04A 3UNJA 3ABUA 3E7OA 4UVCA 2XIXA 2JLDA 4FSMA 3CS9A 3PJ3A 3ABKH 3LJ1A 3SAYA 2WY7Q 1TWFJ 4C4GA 3NUUA 1Z6RA 3IW5A 4RFYA 1SFOJ 4I76A 2NS8A 1C0WA 3T9IA 4CCMA 4ZC3A 5D1JA 1FT9A 4ASEA 3TO7A 4O0RA 3NYNA 3QGYA 5T6KA 1O6YA 3ZDUA 2FBIA 3MGYA 5BQTA 2NVXJ 1JJ8C 1HKTA 4IACA 4KKEA 2KIQA 3IRQA 1D3YA 1B1BA 4W4XA 4E8AA 1D0YA 2VPLA 2Y4PA 1EF4A 4XKCA 3PWYA 4I23A 3DK6A 4IB1A 3EZVA 3M8FA 2C6TA 4S0HB 2QUFA 1A06A 4IO9F 3ORNA 3UQFA 2VT2A 1ZOHA 4M3EA 3G73A 3FM5A 1YQJA 5CSXA 4CGAA 1UCRA 1UHMA 3FKOA 2JDSA 4QLCU 3FK7A 4F7NA 3C2HA 4WK8F 2BZKB 3JR1A 4XG2A 4M8TA 2B1PA 2PYWA 5J1YA 3UO5A 4L42A 4C35A 4WA9A 4F6SA 4K0YA 1T46A 2G0EA 4MEXF 2O3PA 1I50J 2BALA 4YP8A 4XORA 4YBJA 4D55A 2ZJWA 4G3FA 2J0MB 3K5VA 3S3MA 2WB8A 1BI2A 4Z7GA 2E1OA 3ENMA 4FT8A 2UVYA 1BC8C 2CUZA 2IA1A 5H20A 4GJ2A 2X8EA 4M6XA 4RJ6A 4L00A 5BS6A 5HO8A 3POZA 3DJ7A 5KCMA 1XCVA 2VUWA 2R3MA 3F5GA 4R5SA 4BH9A 1Y56A 3H3ZA 2WY8Q 5DBXA 5DNRA 4QMYA 3SX9A 1SYKA 3F3VA 5CVHA 2EZHA 3RQ4A 4ANSA 1REJA 1WI3A 5IQGA 2WAQN 4Y8DA 4U7BA 3OCGA 3HDDA 3O17A 4JDHA 4P7EA 3M2WA 1BX6A 2WKMA 3OYCA 3VO3A 4I0AA 4HOKA 1VQKI 4X6QC 3VBYA 3NNVA 4G6DA 1T08B 1SAXA 3LSMA 3KCFA 2KMUA 3E8EA 4BC6A 1WJ5A 3FMHA 4TWOA 3FZPA 4YO6A 1DU6A 2M5WA 2FA5A 3QC9A 2Z60A 3K0LA 4JNWA 1KU9A 3EETA 1SZMA 5JGAA 3VSKA 4IZ7A 1W8CA 2GFCA 3CLYA 3EN4A 5ICCA 3EB0A 2OZ6A 1VQPI 2QLZA 2G01A 4GO1A 3BL7A 4R3PA 1ZHFA 3EYGA 4PDYA 5AP2A 4DYCA 1VYWA 5IQDA 2OI4X 1LKXA 3FZOA 4RWKA 4JI9A 4HJOA 3FI3A 1UV5A 5IH5A 4PL3A 2IWIA 4UB7A 4XV2A 2W1GA 1W0XC 4FG8A 4C4IA 4XOZA 4IPAA 1ZMUA 2HOEA 4BYIA 4XCUA 1R23A 3P5JA 4AUAA 3JSOA 5AIKA 4MXZA 4PNKA 3QLGA 3ZFXA 4GYIA 4FYOA 3NGAA 4FTCA 3N05A 2W9FB 4JRVA 3DJ5A 4EZ7A 4J95A 1H08A 3DPLC 5E92A 2CKPA 5HDGA 4GYGA 3PSCA 1URWA 4IVNA 2M34A 4BDYA 2BAJA 3W0PA 3C51A 3FMMA 4KINA 4C4HA 4EHGA 2B9SA 1BL0A 4B6LA 3ROCA 2VTHA 4J52A 2VZ6A 2DQ7X 3TBIA 1I6XA 2BZJA 4DTAA 4ZSGA 3DLAA 1HOMA 1QVTA 5A2QK 4HNVA 4L53A 5EHOA 1VTNC 3U1DA 3PNTA 3TV4A 2JK3A 1VQ8I 4RBLA 3FSKA 2F2CB 4A5MA 5KMLA 1OBGA 3P9IA 3P9KA 4Y52J 1USTA 5LEJA 3NEWA 3R2YA 4MBLA 2KDZA 4OW8A 5J6XA 3UPZA 4FT3A 3JRGA 3EN5A 4NJDA 2UZKA 3ZEWA 3PUFC 2HW7A 4DYRA 2W4SA 3HZTA 5DOSA 4HVIA 1OBDA 1TLHB 3R63A 3I54A 2J51A 2C5NA 3I56I 1Y91A 5EQPA 3DS6A 2ITTA 4EC8A 1OYYA 3F23A 4RJ4A 4OTDA 4WKQA 3K4BA 3CMYA 4LFIA 3OMVA 4ZJVA 2FH9A 1Y8RB 4FKRA 3RKYA 3QWKA 1YYVA 4XG9A 4EJNA 3E62A 5FLXK 3M3YJ 1VNDA 3OR1C 2F5DA 4BBRJ 1BIBA 2CKQA 2QZ8A 3D4QA 4JG7A 1UA2A 3S16J 2YJSA 4BCJA 1CQTA 5FKMA 3T1BA 3W2OA 5HD4A 2ITZA 3BKBA 4G7ZF 2KKOA 4XSXF 2VWZA 2QLUA 1YLFA 1QNTA 2WAQA 4BAYA 3FZTA 2Z7RA 1XBBA 2K3FA 3DA6A 3ZTXA 2G9XA 4IHTA 2ZV7A 2UZLA 3AT3A 3SW7A 1HCLA 3CQUA 3O2PE 4M69B 4G6OA 4RA5A 5FM2A 3OYKA 5CQWA 3CP9A 4E70A 1I39A 2QKLB 5BMSA 4B3XA 4KWPA 4FIGA 4UHTA 4M84A 3I4BA 3HMMA 1P7JA 4C33A 1Q61A 2LSOA 4I24A 5E8SA 1PXNA 4ETSA 1OGYA 4D4SA 3A4OX 4QTCA 4ZIMA 1PP8F 4FL1A 2E9NA 5CAVA 2PZYA 2FXAA 3L2WA 2DDAA 1WCCA 2WAFA 3SG8A 1Z57A 2AQEA 2QKRA 4JLCA 2QF7A 2K86A 3PA3A 3ZS5A 1F5TA 2XKEA 2X8DA 4O0SA 4I22A 4QYYA 3WIGA 2CG4A 1OKYA 1WBNA 3QHRA 4JVGA 1U0JA 1KOAA 3DBLB 4BKXA 3GFEA 1G6NA 3FHIA 3GLLA 1DU0A 3JRDA 1D8JA 2OC6A 1MSEC 1YRPA 3NVMB 3ZCLA 3I0OA 2A19B 2JFLA 2JA7J 3LFBA 5KKRB 4FIJA 3AD4A 3ASOH 2W1EA 2CFXA 2DJNA 3T9TA 4UV8A 3VHKA 4FX3A 3P23A 4IFCA 2BY2A 2IEKA 2DYLA 2YJRA 5CU2A 3NNXA 1H01A 1K9AA 4MYGA 4S31A 4C34A 3TJCA 3QWLA 4XOYA 1RRJA 3PXFA 4XRMA 3DJ6A 5D10A 1ZGWA 2C6IA 5BMZA 3LCDA 2IZUA 2ZB0A 3G0EA 3AOXA 3D5UA 4E26A 3PG1A 4RB0A 3AFHA 4FNZA 5DT3A 3SV0A 3QQFA 5DGZA 2P4IA 1T95A 3D14A 3LCSA 2OD5A 5DI1A 3ABMH 2BY3A 1R22A 4IADA 3GU6A 2PSQA 2CGUA 3FQSA 5JN2A 4IOCF 2XIGA 2XK4A 1BL6A 3FQEA 1N78A 3G6GA 2VTQA 4G3EA 5DPVA 2NNNA 3GCSA 4CG9A 2IGNA 2ZBKA 2AXLA 4HGSA 3RZDJ 2K7LA 3FLNC 4RGRA 3HRMA 4CCOA 5H6QA 4DH8A 3K2ZA 1SAUA 4RS8A 4JRNA 3PZEA 4IIRA 4GFGA 5CU3A 2QYOA 3FQHA 5BNJA 4HGEA 3S1QJ 1J7IA 1PF8A 2C1AA 3EFJA 4F63A 5CU6A 3ZUUA 4L8MA 5DN3A 5E4HA 1ETVA 4FT0A 3RYRA 5DDGA 3BJOA 2H8WA 1SD6A 3LA3A 1F1ZA 3G9LX 2CW7A 1O57A 4P1WA 4FGBA 3NAYA 3FZRA 2JA2A 3OROA 4ESFA 1J5YA 1BI7A 3CO7C 5E1WA 4K2EA 4I5PA 2CV2A 3ZP5A 1KSWA 1Q8TA 2PUIA 1QBJA 2V7OA 4A3EJ 4RIOA 2WEIA 2O8XA 2DFFA 2FQ4A 1Z0XA 5CNOA 1IDZA 1FGIA 4X3FB 3B73A 5GAHJ 4HYUA 5HBHA 2CN5A 1MH4A 2LF8A 2B9FA 4K11A 5ACBC 1V0BA 4JX7A 3TI1A 3RNYA 4ZZDA 2WIHA 1D0XA 3KYLA 3OP5A 5HVJA 1U54B 1PMNA 4YJOA 2R3NA 3BL9A 3ZBXA 3BE2A 4QNAA 3OYIA 4JBVA 1TW3A 2NRUA 3LMMA 4MXYA 4FSYA 3VHEA 4YHTA 3GBZA 1ETXA 4QYEA 4U97A 1W1WE 2QOLA 4A9UA 5FUTA 4A9RA 2EV0A 3PSIA 3RJPA 4ZY4A 2F49A 1MBJA 3TOBA 4ASZA 3MPTA 3JAMZ 2WTEA 3PJ2A 4YJTA 2FOWA 2O61A 5LVPA 3PSDA 4UV0A 2NRAC 4R1VA 2E1CA 3BQRA 4FUXA 2M7BA 3HRBA 2IVVA 1TT0A 2PLYA 3QQAA 2QVSE 3NVKI 5CVRA 4X3FA 3OW3A 2K4JA 3DV8A 3S93A 3KU2A 2EJRA 5FD6A 2UW4A 2FBHA 3O51A 3ODYX 1V0PA 4ENXA 3WILA 2ICWG 4RLFA 2CJJA 1U5TC 4FZFB 1CM8A 4YJUA 2QOCA 3BJAA 3NUSA 4LM5A 3V42A 5HIBA 1S8NA 3E6CC 1U54A 2VN9A 5J1VA 4M3DA 2OF7A 5EEGA 4E20A 4X6AJ 2HOAA 3E1SA 3WF9A 2ZYBA 3IQ7A 2Y7JA 3FXWA 4XMOA 3REOA 3QQLA 2GA1A 3K2LA 3D94A 3HUGB 2VB6A 4YPSA 4GK3A 3OXZA 1A31A 1OYIA 3OOUA 2BZHB 5GIOE 2QI8A 4JYKA 3F3ZA 3V5JA 1MBKA 2Y4IB 4JMQA 3BU6A 4BTMA 5E20A 2V7AA 4EJVA 2Z7SA 1MP8A 3HKZN 4GRIA 4QP2A 4BDZA 1QHHD 5L3CA 4XIDA 3EYIA 1YXVA 5A14A 3IH2A 1IDYA 3LSPA 4R1YA 5IPJA 4Z6YA 4F9BA 4MTEA 2R7DA 4BTFA 1SFUA 3R04A 2L9RA 3AT2A 3NYXA 3EQFA 1HCRA 4BEHB 2HFHA 3D1NI 3RAHA 2XSJC 4C4FA 3H36A 2XSDC 5CEIA 5AV3A 2LF7A 3BYVA 2XKPA 3HUGA 3C4WA 2V26A 1R7JA 3AL0B 3OUNB 2DA7A 2B9IA 4D2SA 4ZSJA 1ZG3A 4M9XA 4QMNA 4XOTA 3KGAA 4KA4A 4WT6A 2OJJA 3V5WA 4JQ8A 4I1ZA 4G1WA 4C2UA 4Y85A 4E6CA 4E6AA 2WA0A 5GIPE 3KP6A 4ACGA 3E6BA 2F5VA 2L7ZA 1HF0A 4QPQA 2K9SA 2WQEA 3HOSA 5L3FA 1IASA 3CJQB 3O6BB 2JAMA 2HZNA 3UOJA 1YS7A 4XP3A 1RDQE 4BEHA 4RMZA 1FC3A 3EPZA 2XK9A 2VWIA 2R3QA 4TWNA 3OYLA 2VX3A 1NG7A 5LHGA 2R7IA 1BJAA 4F09A 3SZPA 3ZCOA 2GNIA 3GC8A 2RNGA 3OWTA 5JGDA 1ZOEA 4QOXA 5EM6A 4OTGA 5AX9A 4WNPA 5GJGA 1Z9XA 2GOMA 2YPRA 4ENKA 2B7EA 3OIQA 4RFMA 4M3GA 4WO5A 3HMPA 4XV9A 1N77A 1HXDA 3TGNA 2VPRA 1VQ5I 3W2VA 4IWDA 4PJ0C 2JSPA 4EHVA 1S7AA 5EF6A 1VQ6I 3S3NA 2DA4A 1OECA 2YIXA 3OYNA 5LGTA 1BA5A 5LWNA 2HI3A 3DFGA 4PX6A 2GLOA 4HQEA 4FASD 4Y5HA 1WWXA 4N4SA 4R1HA 3BV2A 3CCRI 2EBIA 1PXLA 5EDRA 1JTYA 4KFCA 3TTIA 3QHWA 4XL9A 3REPA 5TF9A 2WTDA 4M14A 2LKPA 2Z7QA 2HGCA 2IP2A 1TKIA 4GIHA 1TT5B 3FF5A 1I27A 2XAQA 5IT9Z 4JR7A 2BDWA 3CJGA 4FKWA 4WG4A 1MZBA 2E7XA 1K2PA 3BR6A 2ZNYA 2W00A 3KA0A 3FI8A 2W7NA 3W32A 2W4OA 2F7ZE 4M67A 3HHGA 3T3VA 4BCHA 4JT3A 4LD5A 5KHXA 3OOGA 3L7WA 4YC6A 4RJ5A 4A3JJ 3FBVA 2EWAA 4HW0A 2OJIA 3TKIA 3H92A 3LQ3A 4RLLA 4FNXA 5CJ9A 1ZRFA 1ZREA 4DGGA 3TEIA 3QD4A 4FTLA 3UBDA 3VQHA 3ELKA 4JJRA 3V51A 4FSTA 4DEAA 5HTCA 1IN6A 1APLC 3A4CA 1BI1A 5D5WB 5JVGF 1VZOA 3HRFA 2GSFA 1TVOA 4CCNA 2VKEA 1JNKA 5K5RA 2WQOA 4TT7A 3PVGA 2BV6A 4TYIA 3ABTA 5DHJA 3UDZA 2ECCA 3DDQA 4C4EA 3R6SA 5FQDC 4N4NB 3ORKA 5HE0A 4XLFA 3M1EA 2UVXA 4L9NA 1KQ8A 4B4LA 4PMMA 4ZTRA 4ACMA 4HVSA 2HPMA 3RHKA 3FKIJ 4FE4A 1W7HA 4AXCA 3GYHX 3JRIA 3OWJA 5KO1A 3QKMA 4FMQA 2XALA 5M53A 5C8NA 5AP1A 3CTJA 4P5OA 4Z7HA 1FBNA 1R6RA 3F66A 1L8TA 2I7QA 1XG1A 2IW6A 3BWJA 4FV9A 5CVFA 2OAZA 1DI9A 3ZU7A 3PY0A 5J7HA 4F7SA 1CKIA 4FTOA 3SZGA 1EH7A 3F0CA 4OBOA 1H0VA 2H6BA 3RVGA 3G15A 3UZPA 2XF7A 2V9VA 4YJVA 1MMSA 4I4EA 4FKIA 3E0JB 4PGHA 5LMKC 3U9GA 2XPVA 3O96A 2R7BA 3E7VA 4ID7A 5FBNC 3KCCA 4XSZF 5EYRA 1GLNA 3MY5A 3VFZA 2QKMB 5ANEA 3PUBA 4OOIA 1JUSA 2UW0A 5CU0A 3VUGA 3VJNA 3HL2A 5F1JA 2VOOA 3CO6C 4CCUA 2DMQA 4J96A 4FKLA 1YWVA 3M42A 5HD7A 2E2JJ 2DQLA 2DT6A 4A3GJ 3QD3A 4XRSA 5IZFA 3WODF 3G1OA 2E2BA 4HVDA 4BRXA 3WU1B 1XMLA 3WZUA 5EQYA 1HCKA 5GINE 5HLHA 2FE3A 4IKFA 2R2PA 2ME6A 4IQ6A 3QU6A 5J1WA 4F93B 3ERED 1ZY4A 1L0OC 1XH7A 2HDCA 1LP4A 3BQCA 3H3CA 3IH4A 2X9EA 1IAHA 5IQFA 3RK7A 3AG4H 3VUMA 4OU0A 5J9LA 4W4WA 4KN7X 5GAGJ 1FJLA 3MKLA 2R3OA 1H24A 2VWWA 3ZSHA 3HRTA 2WD1A 5CSVA 4TZRA 2YCFA 2PE1A 5H6RA 3DBDA 1EJ9A 4IAYA 1ZMVA 2OW3A 4NH1A 3S2PA 4BQAA 5EG3A 1FBQA 5HEZA 3VS6A 3E93A 1Y0UA 3D0EA 4AXFA 4L9IA 4AZTA 4Y17A 4EGZA 5JFWA 3V8SA 3FLYA 3ZLXA 2X2MA 4A5NA 1JKRC 3RTRA 3OOPA 3QA8A 1OB3A 4O7RA 4A6DA 2BDFA 4FSNA 3QBNA 5M09A 3R8UA 5DV5A 3MFRA 2RGVA 5CS6A 2E1NA 5FXQA 3L2UA 2ZJ2A 2QOFA 2RAEA 3KRWA 2ZSIB 3FAAA 2GCDA 4KNBA 3BR5A 3NNWA 4QP1A 1H26A 2B55A 1KE8A 4NFNA 3CCJI 2O9LA 3PSBA 4JIAA 5LCKA 5F6FA 3BQYA 2AC3A 2AYPA 5CVIA 4J8MA 1IAWA 3K10A 3ERMA 5AP7A 2ZJPF 4FT5A 2WBMA 2ID6A 1I1SA 4RGJA 2VTJA 2OPTA 3LSTA 4KABA 4MO7A 2ISZA 2NOGA 4AZFA 5CSPA 3A7HA 5HX8A 1IV6A 4K1BA 3NDMA 4HCUA 5HLNA 1ZLKA 1U5RA 1LNWA 4IDTA 3ZFYA 1EV7A 2YZLA 5GTHC 3LM5A 4ONAA 5BVOA 4NHJA 2COMA 2PVLA 1XB4A 1Y1VJ 4YJRA 4BN1A 1K83J 4LDTA 2EFWA 4L46A 4TYGA 3QU0A 2QQAA 3VBXA 3WTYC 4YLKA 2J5PA 3JY0A 2ZMCA 3CJNA 5D12A 2B53A 3RJCA 2XKFA 3WG9A 2EB3A 4AQCA 4F9CA 4AT4A 1ZARA 5LLQA 2Y0SN 3GENA 2QNJA 1G3WA 1YW2A 5FLVA 3VS3A 3FM3A 1NW1A 3ML1A 2IS2A 3HSEA 2B9JA 3LXNA 3WHCA 3ZQCA 3GT8A 4L9VA 2L2OA 4GUEA 2EZIA 5LVOA 2PZIA 1MNDA 2TRTA 2VXDA 3I79A 2RIOA 5BVFA 1JSVA 3MY1A 3BYMA 3OF0A 3NUPA 2X48A 4E7IA 4X21A 2NVTJ 4B9DA 1YRNB 4AD9A 1SVMA 4K18A 2FU4A 5AUYA 4PV0A 4IB5A 4A9TA 3R9RA 3DT1A 3BOQA 3CTQA 4RBOA 1JKSA 4LL0A 4M74A 3I4NJ 2GMXA 2ONLA 2C1BA 3R21A 2GQRA 2AUHA 1W4MA 4GK4A 1OUKA 1R5HA 1ODDA 5LD2C 3TOAA 5C1QB 5ICPA 5L3DA 3WZEA 2L02A 1ZYDA 5FEDA 2BIYA 2B0LA 4GMYA 3VUIA 3FPQA 3U8WA 5BV3A 4C2TA 2QOHA 1LR4A 4Z2YA 3LE6A 4XKBA 2XCKA 2HU9A 2F7EE 4AXDA 3CCUI 1W83A 4I6BA 3KB7A 4EOMA 2M7AA 1SNUA 3R1QA 2C6DA 2FF4A 4O7SA 4S05A 4IOAF 3BTLA 3L2RA 1OVEA 3VS4A 5BOXA 3MYGA 3SHEA 1FOYA 4ACDA 4BDFA 1VQ9I 1YRNA 1WH5A 3TL8A 3SQNA 4F78A 3PIZA 3EL8A 4FV5A 4W8DA 4KD1A 4BF2A 4G9YA 4EOKA 4I6QA 3BPVA 2FUG2 3A61A 2EFNA 5T3QA 3FX3A 2HEOA 5AEPA 3TL4X 3ISPA 4Q5SF 3PVBA 5ANKA 4O2PA 4YJNA 2W06A 1MMGA 3MVPA 3K9TA 3CMMA 2F5EA 2VN2A 2FVDA 3BC8A 2PVMA 3M8JA 1Z77A 4K33A 4A3FJ 3BWGA 5KAIC 2WGJA 3K69A 2JKQA 2DUVA 4IC8A 3UOHA 3KXXA 4R7IA 3Q4TA 3PNVA 1W0TA 2YACA 5FO5A 1DGWY 3GVUA 2QOIA 2HR3A 1OPJA 1GV5A 1BLXA 3AMBA 3OCSA 3PXQA 4AWXB 3KRJA 4O91A 5JZNA 2Q0BA 1Q62A 1WCMJ 3NX8A 3SDJA 3WTVC 3F82A 2EXCX 2IZSA 1BR2A 2YIRA 2JEDA 3B2TA 1YHQI 3FMSA 1YW7A 4KYWA 4MHGA 3LSKA 4GG7A 4V0GA 4QMSA 3VS5A 3LFQA 4HZSA 4C0TA 2J5FA 4I0BA 1SD7A 2FGIA 3EUHC 1LPQA 2F7XE 3TIZA 3HAMA 4G6NA 2PE0A 4FSRA 1IA9A 2GAUA 4OBPA 3OY9A 5M5XJ 3VULA 5CQGA 3PLSA 4EH6A 2E1MC 2GTMA 2XUBA 2CSNA 3FV8A 1XD7A 3FMJA 5GNKA 3Q9SA 1UJ8A 3L1SA 5DR9A 3UE4A 1STZA 3CGOA 2IRFG 2V5QA 5D6FA 2GNFA 3E5AA 2VO0A 4FVRA 2XAJA 3FXJA 2VTNA 4XRFA 3R1YA 1LE8B 4P9UA 1E9HA 2DS1A 3FBNB 2VE9A 5L3AA 2L54A 3VOEA 2UZUE 3JAMK 4ZZMA 2MH9A 2Y9QA 3TUDA 4NCTA 4APPA 2Q1ZB 1R1UA 4YC3A 3N4VA 3O8PA 4F9AA 2R3HA 4AOJA 1BUHA 1NHAA 5C4KA 3GUBA 3WYXA 2Y6OA 3IW7A 1FWZA 4R7HA 4FHTA 4K6ZA 4ALUA 2M0MA 1VF9A 5LBQA 3EUKL 1MBFA 1DAWA 1JXSA 2HDWA 2HOSA 2IZTA 4FI1A 4N6ZA 2A3SA 4JL9A 2EINH 4WNKA 4BZDA 1ETOA 3SQQA 2BIKB 5A4TA 2I8DA 5D4SA 1WBSA 1KGSA 4PMPA 4EJOA 4MEDA 1XO2B 4QWQA 5FLMJ 1HSTA 1T0FC 1LE8A 2C3IB 1QU3A 5B2LA 5TISC 2CDZA 4WNOA 3WU0A 4CKRA 3KIOA 2GNJA 4U6RA 3UG2A 4OAYA 3P7BA 2LD5A 2KRCA 3DQXA 5HVQC 3GFWA 4QSHA 4A12A 3GU5A 2RFSA 3R30A 4IAAA 5HLWA 3R73A 3GW2A 1R5GA 1W82A 4UWBA 1V4RA 4PSWA 3KY2A 2NS7A 4G7OF 5TGTA 1ZXEA 4YTFA 3ABLH 5FGKA 3HECA 5M06A 5AV0A 4IRIA 1CTPE 4ZYEA 3KCKA 1OR7A 5AJQA 4QMMA 4ZOGA 5DYJA 1XX5A 1YXUA 4XMYA 3HG9A 4QMPA 1OUYA 5BNGA 4JS8A 4KUMA 3TDUC 1UKIA 2G1TA 1V5EA 1ON2A 1WVRA 1O6KA 4LOCA 4BJ5C 3S4QA 5AP4A 3MIYA 1IN5A 3DY7A 3EWHA 4L3PA 4EATA 4UZDA 5J40A 2PFBA 4RWIA 4EM2A 1Z6TA 4IAKA 2C6YA 4S32A 1VQ7I 2R3LA 3PLAE 5FKLA 2LK2A 1EA3A 1XN7A 1H00A 4EOJA 4QTEA 4U0YA 3QYWA 2N8GA 2BZIB 3BYOA 3R2BA 1TNSA 1S9HA 3COKA 5BQ0A 2DYSH 2MYSA 4NW5A 5D9HA 4NTSA 1SFXA 3K3IA 3DV3A 2YU3A 1EH8A 3E7LA 1YOVB 2R64A 3HOVJ 4IJPA 3G6HA 3CCLI 1MSFC 4A3IJ 3KULB 1FBUA 3Q9XA 2J5OA 1ZAOA 3OIOA 2XM9A 2R7QA 4DE4A 4G94A 2I5UA 2W1CA 4AW2A 5CT0A 3QZHA 2YM4A 3TNWA 2I0VA 4I2OA 3JXWA 3ZOSA 1IRXA 4DFXE 4USFA 3WZJA 4FKSA 5HGIA 3R28A 4FKOA 5IY5H 4Q5EA 5E8YA 3ECOA 4QP3A 1R5ID 2WMQA 2DLLA 1KU2A 3L2CA 3QF9A 4FKGA 3W8LA 1T39A 1XGOA 4MQ9F 2ACXA 2LC2A 4IHSA 2UZNA 1BIAA 3K70D 3QFVA 2GA2A 1LFUP 4NIFB 2HWVA 5CSHA 2VX1A 4Q2AA 2JPBA 3DPKA 1GVDA 4FZDB 4I0SA 4BHNA 5JT2A 5JH6A 3C4ZA 5LWMA 3IKTA 2DYRH 3FEGA 2A2AA 3KULA 4X7QA 4I21A 1FVTA 1BR1A 2LR8A 3DKYA 3WIKA 3R22A 4DC2A 2IS6A 5F20A 2HWOA 2ZMDA 1UNGA 4EYMA 5EI2A 4B1RA 2E60A 4DF3A 5HZNA 4APCA 2IW9A 3KMUA 4LIUA 3TNIA 4QNYA 4AZWA 4CQEA 3L9FA 1FIAA 3K1MA 4KMFA 1DAYA 4BY1J 3CCVI 3RZBA 4BICA 4KSPA 4PJMA 1X58A 5ANJA 2V1NA 3GC9A 1O6LA 4P90A 4ZTJA 2WOUA 3F7WA 3G2FA 5IT9K 2JA5J 3BHYA 2NVQJ 2HQAA 2QKWB 4D4RA 5M3FJ 3TTJA 1UWJA 3AG1H 3LAJA 4M15A 3VAPA 1BKXA 4E5BA 3F88A 4N57A 2X2KA 5F0HA 4J98A 4YZMA 4BB4A 3MW1A 4YZDA 1V1KA 1ZG5A 3H9RA 4RIXB 4G17A 5KCVA 2CN8A 4O27B 4ANQA 4EZ3A 1PJKA 1Z7LA 4P5QA 4PUSA 4RX7A 2VONA 3T8TA 3SDBA 1M14A 3R8VA 3SFZA 4KRDA 3QU3A 2LKSA 4IB3A 2I0HA 5IQEA 4EJUA 5KBRA 1H0MA 3KXZA 4NM0A 1YJWI 1WMKA 1R1TA 2P33A 3DXNA 3CJRB 1F9NA 3NCZA 5LHHA 4II3A 2LTPA 3COHA 3HSRA 4JOMA 4MNFA 2VIXA 1R9TJ 1WI9A 3HUCA 4XBFA 1U3EM 3DLLF 5AV2A 5EI6A 1J0RA 3W2WA 4UB8C 3UTOA 4LYNA 2K27A 1P4AA 2JPCA 1ERKA 3PVWA 4CKJA 5LMBA 3HEGA 5BUIA 1R0EA 3H30A 2D2WA 4BS9A 4AYBN 4ZYDA 2WTCA 3UJGA 1OCTC 5BVDA 1S7EA 5EHLA 3EQRA 3NWSA 4ZSEA 4HSTA 4RIXA 4BCPA 3AXWA 2Q2EB 5DCMB 4E5AX 1D0ZA 1JWHA 3FXQA 4V01A 2YWVA 4J53A 4AXAA 2ECBA 4QP8A 4TNDA 3TUBA 1IEPA 4DTKA 1G4DA 4HCVA 2IVSA 3HTSB 3H0ZA 4B3AA 1RJBA 3CBLA 4BQOA 2WU6A 1TQMA 3OYHA 2WB1N 1DM2A 4I6HA 2C47A 1NT2A 5DR2A 1HW5A 5ILSA 4CCLA 4M97A 4DN5A 5AWMA 2VTLA 4ZMEA 5LGNA 3VVHA 1KOBA 2MBFA 2WELA 4LV8A 5GTIC 4CCJA 2XIRA 5DT0A 5J95A 3W0OA 1KONA 1TNTA 2OJED 3BR1A 4IX4A 4EH9A 3EN6A 1FLIA 3HOTA 2E36A 3UIXA 3M11A 2H8RA 4NT4A 3TG1A 3FMRA 3C5IA 4F7JA 4KBKA 3BP8A 3MH0A 5L8LA 4U88A 3I81A 2ZKZA 5DCMA 5M4UA 1KE6A 5CAUA 3PJCA 4Z9LA 4Q4ZF 3KXNA 2XNBA 4DITA 3PE2A 4H36A 4O0UA 5ANOA 2K9NA 2UZTA 1T8IA 1ZYRF 3A01B 4AOTA 5A46A 4FQGA 4WIHA 1JE8A 3QRTA 2FD5A 5CEPA 3Q5ZA 4GIIA 3M7GA 3S15J 2DWBA 2VKDA 2OSCA 3ZEPA 3VB2A 4HRIA 2C5OA 3GC0A 2MH2A 2YIYA 3QWJA 3LXKA 3W10A 5DS9A 3ROUA 3N4TA 2OXDA 4I41A 2HZ0A 4BTKA 5M07A 3WARA 4ZYHA 3DXPA 3E5UA 1PUEE 2XAOA 3BI6A 4XLIA 3LA2A 4L5IA 2WTKB 4C3IJ 1YQAA 3QC4A 4YJPA 3V01A 2IJLA 3AGLA 4UUSB 2NNWB 2EUFB 3VYSB 4CLIA 2VTOA 1FP2A 2M2EA 3UMXA 2EA4A 2BEOA 5KZ0A 1ZMWA 5IU2A 1ZZLA 4AT3A 3DEWA 2ITUA 4RZVA 3GTQJ 3BG3A 1G8XA 3DTKA 3PQKA 4DHIB 1AU7A 4GW8A 2FJ1A 4QQCA 5DUIA 3A01A 3FXZA 3QRIA 4HCTA 4P2KA 3ZQIA 5CLPA 4JG6A 4BIDA 5JI6A 3RCJA 3P9CA 4FKPA 2X9DA 5E8IA 1Y0NA 2ZM1A 2RFDA 3NAUA 3OL4A 2HYYA 2G7HA 5DTDA 5BUJA 3LHJA 1AKHB 4O0TA 4RA2A 2XB5A 1BM9A 2GS7A 2X81A 2Y8OA 2XIZA 5E3OA 1Q24A 3DZOA 5KNLA 3POOA 3VODA 1IGNA 5J5SA 4XH6A 1HDPA 1WRJA 3GEZA 4AYBA 4QDVA 4JX3A 3BEGA 3IO7A 3SRVA 3ZGKA 2JKMA 3RKQA 4CFWA 2QU5A 3I6WA 3QALE 1JKQC 2X8IA 3C7QA 1IAJA 4EK5A 4UUSA 5HNHA 4RQVA 2C4GA 3LFUA 5KUPA 3ITZA 3FXUA 3MD2A 4YELA 1Q99A 5EKNA 1CDKA 2QR8A 3PRFA 3CLOA 1GT0C 4IX7A 5EOLA 3FK6A 4GH2A 5CF6A 2V9KA 4FSZA 3S1HA 2R7SA 4RSSA 3UVPA 4LLLA 5GJFA 2FX0A 4PJJA 2WB1A 1LEZA 2JRMA 4N9IA 3CCQI 4Y83A 4DLIA 2ADUA 4RB2C 4DDIA 3KMMA 3ZM9A 3RI4A 2JA6J 5B2MA 4AVPA 5DD4A 5FRNA 3KVWA 3RGFA 4C3HJ 4LQMA 5D7AA 4D7NA 1FVVA 3CCNA 2W7XA 3ZOBA 1AKHA 3LFAA 4MQVA 1TWGJ 4E7JA 3WTTC 4NK9A 3ZRKA 1APME 2ETRA 1X19A 3COIA 5HLTA 2KP6A 3VC4A 2VI6A 4BJ6C 2JC6A 3ZQLA 3AC8A 5HI2A 3SEZA 3PM1A 2OQGA 4YHJA 3EN9A 2W85A 3TDVA 3WTXC 1G2HA 4DH7A 1LUFA 2DOEA 3P5JC 2X2LA 4F9YA 4HYIA 1UVRA 2PE2A 1KV1A 2JBPA 1DGRM 4ANJA 3NQOA 3I0QA 4EQMA 3D5WA 2G7UA 3BZKA 4XRSG 4BGHA 1EH6A 3ORXA 4RM2A 2GNHA 4M6YA 2WFYA 5DEWA 2R0QC 3BGPA 3G3ZA 2EB2A 1RETA 3UP7A 4DEHA 3AD6A 4X6RA 4U80A 4DHZA 3C18A 5JLWA 1HKSA 4X3JA 4NJ3A 1ORKA 2P0CA 3KP5A 2BROA 3FL5A 4OWRB 3P7AA 2JMWA 4QRCA 3ORIA 2UV2A 4YFNF 1XH5A 4HLYA 1A36A 5E79C 3P5KA 4FEUA 4HYHA 1Y8YA 3C4EA 4XHKB 1JSTA 3DU6A 4UB6C 2I0EA 2FEZA 5AIRA 3NRVA 3T0YA 5FGMA 3QPTA 5ED4A 2YABA 1J7UA 2OO8X 1X8BA 1V3FA 4AUXA 3LOKA 2CKEA 1WJCA 4HNUA 2VBZA 5J8IA 3DNEA 1FBSA 4D0XA 4RX9A 4R3CA 2H94A 1PY5A 2HZTA 4ESJA 3SA0A 3ZLYA 2OBJA 4QYHA 4AN3A 1QQIA 3U54A 5C4JJ 5AV1A 3A7FA 2W5HA 4AA0A 3QGWA 4DHJA 2FNAA 4DHFA 4WX9A 2PI0A 3H9FA 4CICA 3G4SI 4OR5A 3ZQQA 3UODA 4DEIA 1BI3A 3KF7A 4EJ7A 4BCOA 4D28A 4J99A 2WTJA 2PUNA 1X3ZB 2BRGA 1BC7C 3R7OA 3MH3A 3ZUTA 2XAGA 4E6QA 3CD3A 2W17A 1ENHA 3IAM2 1H28A 3QCXA 4KICA 1HOWA 2KTYA 4ANLA 3NLBA 3HHHA 3ET7A 2DA3A 4ZJJA 3SDGA 4FSUA 3OUKA 3BX5A 4GEOA 2ITYA 5C44J 1J1BA 4QMQA 1MMAA 4JQEA 1OL1A 2XPWA 4X1EA 3MZYA 3G2BA 2GDOA 4DGLC 3JTGA 2W48A 4CV9A 2V1DA 3SXSA 4EQCA 3GI3A 2DAOA 1A35A 2PMZA 4M0YA 3V5PA 5AIQA 3V7RA 2J0KA 3CDLA 4FNYA 3I71A 2UWMA 1V5GA 1BW5A 3MFUA 2XUUA 4EWQA 5CF4A 3R8MA 2KLOA 3OWPA 2UZDA 3RPUA 4CCKA 2VQHA 4WSYA 3P1AA 3OR2C 2LG4A 3VYUB 1FNNA 5IMEA 2BILB 4U81A 4HX4A 3DTCA 4DTBA 2BOLA 5BPIA 2HOTA 1ZGJA 4XRLA 1STCE 3P78A 2P6TA 1PVEA 3FXRA 5HTBA 3SEQA 3ZQFA 1FTZA 4LG3A 3MIAA 4EH4A 2GOXB 3HIFA 3ORMA 4TYJA 5J4YA 1YJ9I 4L44A 3EDPA 4R7BA 1CF7B 4NM5A 4XICA 5CEKA 1NA7A 2V7FA 2L4MA 1XCBA 3QP6A 3SFIA 1G8KA 2O64A 3QLFA 4L7SA 4E1ZA 5BYYA 4OBQA 2YEXA 3LSHA 4WBBB 4DFYA 3NMUF 2HS5A 3BTCA 4MD8E 4YZBA 5DLSA 3U51A 1L3LA 4EV0A 3WGGA 4KA3A 4ZH4F 2NAZA 3MFKA 5C9CA 3T5XA 4ZDOA 3GCVA 3S0OA 1JUPA 2Y6MA 4RJ7A 2W1FA 1OKVA 4BI2A 4HF2A 5IPAA 2HYGD 4I3ZA 1J2XA 3DXQA 2RQPA 3TV7A 4IB0A 1H27A 5L2SA 1B6AA 2EZLA 3DBEA 4EWHA 4MFEA 4L9TA 3TEDA 5IP7J 3BG7A 3K2AA 4RVLA 3A1YA 2Z7LA 1GHCA 3G0FA 4PGGA 3DKCA 4ZZLA 2HPIA 4UYAA 1ZYCA 2IO6A 5TO8A 3KREA 1CF7A 2VTIA 3F2NA 4UALA 4P9FA 2C5YA 4W4YA 2VBXA 2JGZA 3BZCA 2VO6A 1G59A 3IH3A 3PPKA 1W5SA 5KKRC 3GTKJ 4KIBA 3R9NA 3VPRA 2VV9A 4IHVA 2ZV9A 5A4LA 3G1MA 1GZOA 3QOEA 3GX4X 3P7CA 4MTAA 2W1HA 1OPKA 2W99B 4DFBA 5E18F 1XC5A 4GFBA 1P4XA 4AXEA 1Y6BA 5KHWA 3FLZA 2V79A 4GU6A 2CS3A 3ESWB 2VBWA 2CNQA 2B54A 1UU9A 5D41A 4D4VA 2LOOA 3AG2H 2FRHA 1JKOC 3WI6A 2ERZE 5KHDA 2COBA 5L8KA 2HVSA 5J1RA 3QAHA 4J97A 2ZDTA 3ZONA 4DG2E 4U3YA 2A6TA 3IKAA 1H1PA 1P7IA 1M2QA 1PKDA 2QO9A 1FMKA 4B7TA 3RI1A 1YOJA 2PQ8A 3CC4I 3HMNA 4ZTQA 2J9MA 5IEXA 2VWVA 2IW8A 4G5JA 2X0LA 1M52A 1CMKE 4WXHA 3CY2A 3EQLF 3PIXA 1ZG1A 4AP7A 3HBLA 4BBEA 4FG7A 3BG9A 2GQGA 5LMAA 2W96B 2CCIA 5HE3A 5DWRA 3TKHA 3TYKA 5BMMA 4DAWA 2QA4I 2PVFA 2ESMA 4KMUX 2WHBA 4A3BJ 4GV1A 4CTCA 3HUBA 4NQWB 3V4GA 2GBYA 2UUEA 3BLQA 1Y57A 4DW6A 4F4PA 3I5ZA 2L5QA 4QQ5A 2IJMA 3FUPA 2PJPA 2GIZA 2IXSA 4OT5A 5M55A 1B9MA 4USEA 4BJTA 5I5ZA 1M7NA 4X3FC 3ZXTA 3HNGA 1GXQA 3LW0A 4O21A 5B3SH 1R39A 4ZDLA 2XMYA 4K2RA 1RPWA 4A3MJ 2OTJI 2KRFA 3PUPA 1I6HJ 3W8QA 4XOPA 2HZ4A 3F9NA 4PRJA 3AAFA 4DBXA 4ZYGA 2X51A 3WTWC 4ZLOA 2CW0F 1JKKA 3KLOA 3KP4A 3Q04A 1Z3XA 4FJVA 2DMPA 2M3AA 2L9VA 4U40A 1JOWB 2XRWA 3GZ5A 2VBYA 4BQNA 2YIWA 3VBQA 1W0UA 4XBRA 5H8EA 3R0JA 4HPQA 4JOAA 2R7TA 4IHYA 1KUTA 3RPOA 4OMYA 2YM5A 2HQ5A 2H96A 3ACKA 1UNLA 1H25A 2HVRA 3BIZA 1J91A 2ZXWH 5AADA 3ZHPC 2OICA 5IQAA 4I0RA 3DGKA 3UIBA 2XBAA 4KB8A 2O63A 3JYAA 1RIOH 3FC2A 3NR9A 1IRGA 3CD6I 4FEXA 2XROA 3M1CA 5A4QA 2P7VB 3G90X 3KMWA 4RFZA 3F22A 2O8KA 4L43A 3LL7A 2CPKE 4QTAA 3S2HJ 2PUUA 4RC4A 1MJBA 3UGCA 2PZ5A 2IN6A 5JSMA 4IAFA 4NM3A 3WTZA 3I64A 1WZ2A 3MY0A 2E71A 1CGPA 3CE3A 1YIJI 3O50A 3AD5A 3D83A 3ECHA 2O5KA 5HVYA 2XAMA 3CQWA 5FRIA 4BTJA 4R78A 3V8KA 2EXMA 4ZLYA 3FMDA 1JKPC 3DPTA 4QQTA 2BKZA 1VI0A 2Y4IC 4RX8A 3WOWA 2OFUA 1Y6IA 5CXHA 5ETAA 3VUHA 3LFCA 4EK3A 3EIDA 4DH1A 2YCQA 3PWDA 1MD0A 5DM6F 1JUMA 1QZZA 2ZJQF 1J09A 4FT9A 2JD5A 5A4CA 2DK8A 3J81Z 4CDGA 2RNJA 1MNMC 3QCSA 4CYDA 4BDKA 2C6KA 3NNUA 2OWBA 4YG2F 3JRBA 4LOPA 4QO9A 4XLVA 1K3AA 1XR1A 4N70A 2LVSA 3QTSA 1VQMI 5D11A 3PJ1A 1IA8A 3VN9A 5J87A 1IW7F 4IWQA 5AX3A 4OTWA 2JSCA 2CMPA 4WG3A 4O6EA 4YPDA 3AL0C 1MH3A 1YJNI 1RR8C 4GVJA 1KYZA 4L01A 3MVMA 4LGGA 1KV2A 3TDWA 1OKWA 2G2FA 5BVNA 3E97A 1UFMA 4DDGA 5K5QA 4UXNA 1H88C 3EKNA 1R0PA 2BTSA 1QZYA 2LGCA 3LCTA 3HV4A 5IUHA 3W18A 3JRCA 1OI9A 4XBUA 3CSVA 3M9AA 3S00A 1KWPA 3KEXA 2L9SA 1KE5A 2ZJRF 1T45A 2QM3A 2YDIA 4AGDA 4KUJA 2X6YA 3RALA 3D5XA 4IZ5A 3WE8A 4IHPA 1LDJA 1DPRA 1U59A 2RV8A 5IEYA 5T68A 4XLAA 2X9FA 3HV3A 2EWNA 1J75A 3QUDA 3THBA 3C7JA 1YS6A 5AM7A 3OWKA 2NVUB 2VJIA 3MFTA 4OT6A 2LH9A 4RGUA 3AKKA 4J7BA 5DFPA 5F64A 3NEUA 3NUXA 4BXUA 3MAJA 1T2KA 1HC8A 5ILUA 4RRVA 2R3JA 2VLAA 4YJQA 3ERKA 4UY8I 3IV5A 2XP2A 1FZPB 2CMWA 4GG5A 4BHBA 2WC2A 2HNHA 5IA0A 3MN3A 4GKIA 2XRNA 3AT4A 4JDKA 3E64A 2QSFX 4KAOA 3CKWA 1S5LC 3FJQE 1DQUA 2C68A 5B1BH 2V22A 4FICA 3CCEI 1NXKA 5CANA 2ZDUA 1F36A 3LAPA 3DFAA 4CLJA 1VJYA 1XSXA 2PHKA 2OU7A 3GO5A 4EK6A 5IDPA 2C0TA 1JJ6C 4I20A 1YW8A 1VQ4I 2A07F 3RM6A 1VZ0A 2F57A 4G3GA 5JMSA 3D7TB 4M71A 3PL8A 4M6VA 4G9RA 3Q4UA 4MTDA 5AA8A 5IOYA 2IVTA 1Z7UA 5F94A 1DPUA 5DEYA 1R4NB 3FWEA 3TWJA 3KF4A 1YWRA 2QVOA 4E7KA 2P0WA 4LRJA 2VKVA 3H9QA 4XKVA 4IC7A 3TDZC 2QQ8A 1NY3A 2VWXA 1OYWA 2NS0A 4DBRA 5D4RA 3CZ6A 1Y6AA 3GCMA 4IVCA 3QA0A 2QG7A 4ZY5A 3H5RA 5HE1A 4IVAA 3F5PA 5HU3A 3BRBA 3F2RA 2PZRA 3LQRA 2UV1A 1F3MC 3VIDA 3F8FA 3K54A 4D5HA 1NTCA 1QZEA 2P8TA 1PXOA 5C4LA 5CAOA 4UVBA 1UG2A 5EW8A 4ABZA 2R0IA 2BRBA 3PTGA 3DQWA 1JAMA 1M17A 1FYKA 4OINF 3KZYA 4YGAA 2P5VA 3PIPF 4DNCA 3HSFA 4HDVA 1OCRH 3D7TA 3S1MJ 5CKTA 4YZCA 1VLRA 2DK5A 4XN3A 5DIAA 2VKHA 1BOBA 1ZR2A 4BGGA 1T98A 3ELJA 2OLCA 4AZVA 3RPSA 1UU7A 4U45A 3FZ1A 3R1NA 4OMZA 3NW5A 4E7WA 4ZK5A 4BCFA 1Y8QB 4FTIA 3V5QA 4TYEA 4DEEA 4F0GA 3LJ0A 3LFNA 2Q8KA 2ZXHA 5E9EA 3R00A 1WAKA 2VWUA 2V9PA 4BDCA 4IF4A 3RAIA 4RB1A 5HLIA 2OCEA 3JW4A 3DP7A 5F4NA 3T8OA 2MGQA 4DZPA 3FHZA 3EZRA 3BWFA 2VQGA 4PCQA 5JQ5A 2R9SA 2QQ7A 3U4WA 3T3UA 3MQ0A 4I09A 3QPHA 3ZZEA 4HV5A 4HV6A 1JI8A 2I6LA 4M7IA 3R7VA 3QAME 1BR4A 1IN7A 2HTJA 2BGCA 3TJDA 3EQIA 1PP7U 3LM0A 3UIUA 5E8UA 5AAGA 4DYMA 2Y48A 3F8BA 3C5UA 1OKRA 2P55A 3A99A 4G12A 1KE7A 3KXGA 3IKVA 4I92A 1D1CA 5IMXA 4EMSA 3COMA 3I5UA 3I59B 4QMUA 4II2A 2FSLX 3J7ZI 3WE3A 3U9CA 3JUHA 3GC7A 4B48A 3E8NA 4NWMA 2M4KA 3AC3A 4PSXA 3NIZA 1FEXA 3E5QA 5IQCA 2OXXA 5IH4A 2PU8A 3L09A 2IBDA 3PO2J 3NFGB 4FEQA 2WEVA 4HPTE 3GTPJ 2XPUA 3IUOA 3FZVA 3CESA 4DFNA 1IC8A 2FYSA 3VYTB 1S7OA 3HDNA 2E9UA 5FLFA 2UZWE 4C2WA 4O22A 4C30A 3VQUA 5DCFA 2ITQA 4L3JA 3I9V2 4WCGA 2R7WA 2OUMA 4H05A 5EK7A 2ZSHB 5KX8A 2XK6A 3DBQA 3PXRA 5LXMA 4GKHA 5EJCA 5GAEJ 4BHPA 1VEBA 2R7VA 3I59A 3C13A 5EM7A 2K9MA 4F52A 5B0XA 1S9IA 3BJ6A 2F9GA 4DA5A 2DDBA 2XRUA 5AP5A 4BGQA 1TBXA 1RZ4A 1GDTA 2QOQA 2X7GA 2QSGX 1RQQA 4EM1A 5LGUA 4O7ZA 5AAEA 2AQFA 5CQUA 2EIMH 4MWHA 4D58A 3ZBFA 4H3BA 4RAFA 2IPXA 4LOOA 5AM6A 4YR8A 3ZRMA 1KYWA 2W0JA 4MXCA 2DFEA 4J19A 3OT3A 1O7LA 5TT7A 2H6CA 3EYHA 1RI7A 3UYTA 2VQLA 4XLNF 1UWHA 4Z55A 3FKLA 1WHUA 5A4EA 2XZSA 3WE4A 3E6MA 4DIQA 2RFNA 3ACJA 3BEAA 2FQ3A 1G3SA 4AIKA 5FTGA 5CI6A 2DPUA 3OTUA 5HNIX 5GHVA 2MD0A 3HOZJ 4FV0A 3BBTB 4AIJA 1E1VA 2D5VA 1WFXA 2IGMA 3WZDA 4BVUA 4MCVA 3BCBA 4FIHA 5CEMA 1WVYA 3QYZA 3WGHA 2WV0A 4ZTSA 3TKYA 3QD0A 1HBXG 3PIOF 4AACA 3Q9WA 3P08A 2HZDA 3DCFA 4H4KC 4S33A 1KA8A 5GP9A 1R78A 1UKHA 4E7HA 2WWYA 1J1CA 4Q9ZA 3X2QH 1E3HA 1MNEA 2PMLX 5CWZA 4IH8A 1WKMA 2ZM3A 2PL0A 3T8RA 2ONLC 2PMOX 4GCJA 2F4JA 3UC3A 3NW7A 2Y2ZA 1LVKA 2PK9A 2CGVA 3WG7H 1XDSA 3NW6A 4LUEA 2SRCA 3QRUA 3HC7A 4O38A 2ETMA 3RPRA 4I94A 3Q4CA 5IISA 1GOLA 5HNFA 4F1MA 3UVRA 2EIJH 3OIPA 1IZ1A 2NVYJ 1SVLA 3I0TA 2UXXA 4FISA 3ZR8X 5BUEA 4Y7NJ 5E1EA 1XJDA 3PSFA 5M51A 3F3UA 5EYCA 3N97A 4RWLA 5DD8A 3OEFX 4EZ5A 2G2IA 3W1FA 4MQ2A 1Q1HA 3RM7A 3ZO2A 2OA4A 4CFUA 3F5UA 4O7TA 2W25A 3C4FA 5EH0A 3TZ7A 4E7SA 1ETWA 4GU9A 4LITA 4PFOA 2RL5A 3HJEA 3CXWA 1HSJA 4RT7A 4CFNA 3O3KA 5E8GA 1H9TA 4KIFA 3CPCA 1ERDA 3UDSA 2YM7A 4J1RA 3FLSA 3GFMA 3S2DJ 4F64A 3IK3A 3NUYA 1DUXC 5L2IA 4XNFA 2PN6A 3SKCA 3PXYA 1WBVA 2HY0A 4OIPF 3S8PA 2X85A 2P2HA 4AOIA 3UMWA 4NU1A 3BTJA 2X4ZA 1B59A 4LGHA 1DDNA 3SXFA 2BCJA 4G3CA 4JBPA 4D1SA 3DTIA 1AD5A 2NP8A 4MVFA 3U1KA 2PY3A 4Q5HA 4C58A 4HA8A 5AONA 3R9HA 4UZHA 3GCUA 2G2HA 4V2FA 4A7CA 3GTJJ 5FG8A 3RPQA 1NK2P 4QMXA 3TUCA 1RC9A 1TQIA 3S32A 3W0RA 3A0HC 2V55A 6PAXA 2RF9A 4PDPA 5IQBA 4UUTA 2KIMA 3JS2A 4MUQA 1XMAA 3B2WA 3DKWA 3FC1X 3KX2A 4BQQA 2WZJA 4EM0B 4HX8A 4F91B 2NPQA 4D9JA 1RKWA 3F69A 5ICFA 3O71A 1X3UA 3K4KA 4MHAA 2EVAA 2DTRA 4S04A 3QRJA 4NKSA 2CQXA 2UUZA 2R3FA 4MF1A 4O0XA 3S14J 3V5TA 4GT5A 3DF8A 3NWTA 3KL8A 3EUAA 4IQJA 2XA4A 1ZLTA 4MQ1A 4GT4A 1G3TA 2GWRA 2EU9A 3ZMTA 5HS8A 1HLVA 2CNVA 3CC2I 3N9XA 1A9UA 4EORA 4O6JA 1ZQ3P 3QZIA 1ZK8A 2BVMA 2X1CA 4X2NA 1Z3YA 2PVJA 4A0ZA 4RVMA 3OY1A 3GTLJ 5AP6A 5KMIA 2ZFUA 2CUEA 1K6OA 3S1NJ 3MH2A 5B66C 4BI0A 3HGGA 1IUFA 3QYBA 1Q1VA 2TCTA 4IANA 3KP3A 2E19A 2JJ7A 5IA1A 2OKRA 3PFYA 1U46A 4WD5A 3DK7A 4RGXA 3BQZA 3ZQHA 4DFUA 4HAMA 5BYLA 3IW8A 3DBRB 3MFSA 3QUEA 1PJRA 5E1XA 4FC0A 3CQZJ 4RJ8A 4OTIA 2JIUA 2R3GA 5K7ZA 3KIOC 1X2MA 2CJMA 4YNOA 4I98B 1MDMB 2YM8A 4A93J 1UB9A 4UV9A 1QPIA 1ZYLA 5IYBJ 2IS1A 5EYMA 4ITHA 5KMJA 1OR7C 4PL4A 1MUOA 3LSGA 3FPMA 3Q3BA 2E35A 2EZKA 3CUQB 3V8LA 2BMCA 4O2ZA 3LMGA 1OM1A 2A61A 1ZYJA 3R9DA 1FYLA 3DLSA 4ENYA 5HOOA 4YTIA 4Y5QA 4LMUA 3ZUVA 3WGIA 3FHRA 2R5ZB 3D2IA 4YSMA 5KMKA 4HEA2 1ST0A 2O3FA 1KU3A 4QMTA 3SHFA 4XX9A 3CP2A 2YAKA 3FYKX 5FTOA 2UW3A 5EEHA 3GQLA 3E92A 1B39A 3DU5A 3HDMA 3LIJA 1ZWSA 4H58A 3FL4A 1MDMA 2Z8CA 2H6DA 2QODA 3MVJA 2DFHA 1D5VA 1QVUA 4H1JA 4L68A 2HW6A 2R7OA 4ZMFA 2ESNA 4AN2A 4FE2A 3F21A 4N6YA 2CUFA 3C0GA 1MW7A 2CH0A 4JP0A 3QQGA 3UR3C 3CUQA 4HX7A 1NG6A 4FTHA 3J81K 2ISYA 3K3JA 4ARKA 2VTRA 3FMNA 2W1IA 1W7PD 3DTEA 2O6GE 3I5NA 4L7FA 3R7YA 4HNFA 3LPBA 2M1BA 4AIDA 2R5ZA 1LVAA 2QCSA 4RC2A 3QZFA 4C59A 4H1MA 4DEBA 5FP6A 2ZMEB 5CXZA 3K70C 2XCHA 3HAVA 3F7ZA 1Z05A 4PK4A 5BVKA 5TOZA 3KEOA 2IAIA 2XBJA 4TYHB 3MA3A 3TIYA 3KP2A 3UIMA 1KZHA 3D2KA 3I7CA 1XMMA 1PUFB 5EZGA 1WVXA 3ZRLA 2MG4A 5JZJA 3NUNA 2PTKA 3HKZA 1H8FA 5F95A 1W5CC 4UWYA 3K5UA 3R60A 3IGOA 3JRHA 5ICEA 4TTHB 5KVRA 2H9VA 4LK0F 5EW9A 3LLAA 5I9ZA 3CQEA 2YISA 1FOKA 1ZRZA 5IH6A 5FBOA 4AAAA 4Y33A 1H07A 2FSWA 3MB6A 4I6ZA 2CQQA 4G3DA 4M9ZA 4NTTA 1O7FA 4AC0A 3WF8A 2EV5A 5C8KA 5EHYA 3PO3J 2DMTA 3K4JA 3OEZA 3ODZX 3ZFMA 4EHZA 1NH3A 1LQ1A 3H0GJ 4R79A 3HRSA 1JTXA 4Q48A 2Z2SB 4QMZA 4OIQF 3FSFA 3EQDA 1F5QA 4ZTNA 2KT0A 3NUAA 3TNPC 1LEBA 2ZMEA 2V6EA 4NBQA 3AG3H 3KZIC 1SM2A 4I0TA 4TYHA 4F99A 2Q83A 2VXZA 4QPSA 1PUFA 3CJFA 4BDHA 2WMVA 2HXLA 4GUBA 2GS2A 1MKMA 2L3DA 4E4MA 1IUYA 1ZTRA 4DQ2A 4CCBA 5CYVA 4NSTA 1TP4A 1OIQA 1GJOA 3RPVA 1I3QJ 4R5YA 3LWFA 4EGYA 3LQ5A 3RAWA 2JZYA 4KIOA 3ZLSA 3AMYA 1QPCA 2DQRA 2W1OA 5JEBA 3BGZA 3GU4A 5E8WA 2VOPA 4DGMA 2XGEA 5AUUA 5KMMA 3IDPA 2JT1A 5FB2A 5AP0A 3RZOJ 4W4VA 1X2NA 5J9ZA 2YITA 4BYYA 3H0YA 3SLSA 2IG7A 2WPAA 3L2VA 2EFQA 4EBWA 1AA7A 1A5JA 1OITA 5C8MA 1SVGA 4F6UA 4ERKA 4AW0A 4UX9A 4A0YA 2RVCA 3RIRA 4RG0A 3HKOA 4D4YA 5HNGA 3W16A 1AHDP 2BHYA 4O7YA 4XRJA 3OOMA 2KL4A 2WTWA 1Q8YA 2P5KA 4MXOA 3HPGA 2ITNA 4AGWA 1FSHA 2PMNX 4FTAA 4MD7E 4I4FA 2KULA 2IGKA 2HY81 4OTQA 4J71A 2E5NA 3TT0A 3L8PA 1FOTA 3ZMDA 3O8TA 3PDTA 2ZFWA 2R4GA 1PYEA 2JBOA 3HYIA 3S1RJ 3ID6C 5TRDA 2KJCA 3MA6A 4AZSA 2PPQA 2BE5F 1WBOA 3QTQA 2XGDA 4EH5A 4E7ZA 1GXPA 4G31A 1U9OA 3CDIA 4IW0A 1GIJA 1YE9A 3IECA 5IA3A 1RESA 3VF9A 2MA3A 2OF2A 4LMYA 5ETFA 2XIYA 3DXJF 1Q8WA 4L0ZB 4F1TA 2A5WA 4QIWN 3EN7A 3SXRA 2R7RA 2IPQX 3HYHA 5CF8A 4A9SA 2YHVA 2KFDA 2H09A 4WOVA 3WTSC 3LSJA 1FSEA 3MH1A 2RKUA 2DT5A 4YIFA 1AGWA 4PMTA 1ZGAA 4R3RA 4M9SA 4J01A 4W97A 2BVAA 4BNCA 3DCVA 3PFIA 4D9UA 2L7FP 2DI3A 2R3PA 3EKKA 4IX6A 4NM7A 1ZOGA 3KXMA 1OIRA 1SVHA 4ZY6A 4HLXA 3LVPA