3TMOA

The catalytic domain of human deubiquitinase duba
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
141
Chain Sequence
AARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTU domain-containing protein 5
publication title Phosphorylation-dependent activity of the deubiquitinase DUBA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 33
structure length 141
sequence length 158
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tmoA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tmoA01
3TMOA 3PFYA
chains in the Genus database with same CATH superfamily
1BN5A 4ZJJA 4XRSG 4G3CA 4WIHA 1DQUA 3ANRA 4RX7A 3TP0A 1KE5A 3FQSA 1P5EA 3DTCA 4G5JA 5FLMJ 2GWRA 4IH8A 2QGUA 2UZWE 1HKQA 2PMOX 4H3PA 4K18A 3PSCA 3OW3A 1CF7B 3NUUA 2DDBA 5D8LB 4YHFA 3CJRB 4G7HF 1NVQA 1XBBA 5HNBA 4MD9E 2PMZN 4FKGA 3OHTA 4XRLA 2OJFE 3FZ1A 4OBQA 3C7JA 4EJ7A 3MBLA 4I4EA 2STTA 4D58A 1ERDA 3G6HA 4IIRA 3RPSA 2JAVA 1PUFA 4RIWA 1PUEE 4RS8A 3VVHA 4AT4A 1H24A 5IQFA 4BDYA 3LFKA 2OGVA 4UALA 4ENKA 5E1XA 5HBEA 1ULYA 3NAUA 5J9LA 1OB3A 4NQWB 3QD3A 3IW4A 3U9NA 5HIBA 3BPVA 2H6CA 2OK1A 4GMYA 5ICCA 2JUGA 1BUHA 2R5TA 4V04A 4FE2A 2PYWA 5D10A 4AX8A 4S32A 1FZPB 4FHTA 4EYMA 4EBVA 3BGQA 4A4LA 4NM0A 2DA7A 4FOBA 3HTUA 3F6XA 2Y0AA 4L44A 2MD5A 4KYWA 3WTTC 5F1JA 2G2IA 1OIRA 4PJMA 3U8WA 4F78A 3TV4A 4B09A 1Q99A 1TWFJ 2WMWA 2O8XA 5LWMA 3UYTA 2FGIA 1REKA 4A6EA 4W4XA 4G3FA 4RT7A 1KOBA 3W2AA 2XUUA 4UUVA 1N75A 4Z2YA 5AJQA 3CO7C 4E7JA 2J5PA 3TEIA 1GJOA 4JL9A 2V7FA 4H0EA 2GNIA 5AEPA 3LCKA 2P5LC 4M74A 1EV7A 4C3RA 2H6DA 2K9SA 4U9AA 4BBEA 2XRUA 4RVMA 2KDZA 1XSDA 1FMVA 4LFUA 4C3HJ 3VUGA 4ZY6A 3L9FA 3K1PA 5FRNA 1PJKA 2N8GA 2MC3A 5GAHJ 1XMMA 4YNOA 3EB0A 1I09A 4FV3A 5CY3A 4UYNA 2J4ZA 1OGYA 5K5OA 3VF9A 4GIIA 3FKIJ 3PSIA 1MRUA 1CM8A 1UA2A 3FAAA 5FD2A 1PYXA 5BPDA 2ZYBA 2IJMA 1YS7A 5BVKA 1FPUA 2AHQA 1BIBA 4XNFA 2IA2A 3F61A 2ME0A 2ELHA 2EWNA 5HKMA 2I8DA 4LMUA 3LIJA 1L0OC 4YJSA 4E4HA 3GO5A 3L00A 5ICFA 5KK1A 3WTXC 1Q97A 5AIRA 2GHLA 3T8OA 2Z16A 3SJMA 1YOVB 3Q3BA 5HGIA 3V8TA 1V5EA 5CEPA 5LGUA 2Z5UA 3PUFA 4D2RA 5IYCJ 3T9IA 5FXSA 2ONLC 2O0UA 2QENA 1UG0A 5B66C 4MCVA 4KIPA 3QOPA 1S9JA 2BZTA 5LLQA 2Y4IC 5LJJA 1WJ5A 3A2KA 3FEGA 4JRVA 5AADA 4XNEA 1OR7C 5IOZA 2ZC2A 4LD5A 2Z2WA 5IA0A 5FEQA 1EH4A 3F8BA 4DFNA 4PMPA 4ORKA 4RLKA 3WE2A 3HECA 1JBPE 1R1TA 2F4JA 4QQ5A 5AA9A 2QC6A 4S34A 2R7TA 3JVRA 3OEZA 1GY3A 2L7ZA 1HDDC 3DBLB 1FVVA 4L46A 4TNDA 4F70A 5M4FA 4PJ0C 4C3IJ 2XNOA 3CDHA 1QO0D 4R1VA 3Q4CA 4FTMA 2OQRA 2XM9A 4BGQA 5DR2A 3L9PA 5CVHA 1G8JA 4Y72A 1KUTA 4I6QA 1YRPA 2HKOA 4ENXA 1MW7A 2K3FA 5ETAA 1IC8A 3AD6A 5L2TA 2I7QA 3MV5A 4CGAA 4YG2F 3NCZA 1C0WA 4P55A 1Y1VJ 3MZHA 1J7IA 2RGPA 2HZDA 1IXRC 3B2WA 2ACXA 3CDLA 2JFMA 3DU8A 2VTNA 3SGCA 3KXNA 5D5WB 3LQ5A 2C5OA 4DH5A 2ZVAA 2F4MB 4QDVA 2QKMB 4ESJA 1G59A 1ND4A 3P86A 2ZJ2A 3KEXA 3UDBA 4N0BA 2CCHA 3CCEI 5HX8A 3KP2A 2KT0A 1Q3WA 5E8YA 3GTLJ 1KQ9A 2P0WA 4W8EA 1ODDA 1PY5A 3KU2A 4KS7A 3GCPA 2K27A 2PMIA 1OQYA 4BN1A 4O0UA 5EG3A 2FUG2 3S16J 3TT0A 4OIOF 4F6SA 2CKOA 4CV8A 3DU5A 2V0DA 5EG0B 4WBOA 3O50A 4CYCA 5LARA 3H5RA 1XBCA 5EQPA 2LY1A 1ZTRA 3HZJA 2UZTA 2XJ2A 4BDFA 2L7MP 2OTJI 3F21A 2KLOA 3CF2A 4PP7A 2YIRA 2KZGA 4AN2A 4P9FA 2A5WA 4EV0A 3CUQC 2XNMA 3NUNA 3KN5A 2BHZA 4GFOA 2WIPA 1YWNA 1HSTA 4AOJA 1EKEA 4RLQA 4EYJA 4I2OA 4QEBA 1ETWA 2PVNA 4M3EA 2V22A 4IF4A 4HBLA 2MGQA 2VT3A 4FV0A 3HL2A 4JDJA 5FXQA 4JX5A 4ITHA 2FEZA 4IACA 4ASDA 4ZLYA 3COHA 1F0QA 4F1OA 3TZ9A 4E7HA 5AUWA 2AXTC 3WF5A 4CO8A 3OYCA 1BJZA 2QOOA 2XHKA 5E9EA 2V5QA 3QYZA 3BYSA 3E8NA 5CSXA 3UIMA 3PVWA 3F6VA 4ABZA 4XYFA 3R0TA 2YU3A 4JVGA 3N4UA 5CQWA 3H0ZA 4KIOA 4PZJA 2YCSA 3CO6C 3F6OA 2ZXJA 4P5OA 3LCOA 3FSFA 4PTCA 3OWTA 4EJNA 3T9TA 4F55A 3KZZA 4LIVA 2YIYA 3RYPA 3MA6A 1E17A 4EOOA 5LOHA 3ZUUA 2OSCA 5BNGA 2R7SA 4KBAA 5EKNA 1WI3A 3MPMA 3TNWA 2IAIA 4XR6A 4HSTA 3V5PA 3VBXA 3K69A 3F2RA 4YZCA 3LA7A 5LGNA 3G5DA 5AV2A 2YJRA 2H09A 3UDTA 5DR9A 3QPHA 3EN7A 2FRHA 3EKKA 2Y69H 2XAFA 4S31A 4XP3A 3OOMA 3R8UA 2IW9A 4HPUE 2P33A 3V8KA 3Q4TA 4U97A 3H9RA 1JHHA 3E88A 2BYVE 5FB2A 5FLVA 3ZP5A 3OOUA 4RZVA 5K3YA 4EONA 2CNQA 2QBYB 2WAFA 4UYAA 5C8MA 2QKWB 4HOKA 4QMMA 1IN7A 1U5TC 3EN9A 3RAKA 4D9UA 2QO2A 1TL8A 2FO0A 1Y8YA 5GPAA 1SFEA 4AF3A 3OYIA 1QZYA 4I5HA 2XS0A 4BZNA 2EIJH 3JRFA 2XGDA 1BI3A 1DGWY 2GS7A 4EZ5A 4A06A 3Q0UA 1S8NA 4FTAA 2W25A 1VQKI 2QQ7A 1KU9A 3J7AO 2AUHA 3O96A 4YFKF 3ZR8X 2E2HJ 3PQJA 1U59A 4IRGA 1YIJI 3ZQIA 3HRCA 3L2CA 3JRBA 2JRTA 2XRNA 4XV3A 4RB1A 4KAOA 1TNSA 3FV8A 1X3WB 4FEWA 2R7WA 3HOYJ 1OL2A 5T3QA 3OOPA 2PVHA 3C18A 3S1QJ 3G6GA 4R3RA 3VQHA 3K54A 4G3DA 5CEMA 2R3RA 4EH5A 4APPA 4L9IA 3KXMA 5FTQA 4Z6YA 3I5ZA 3S3MA 1LFUP 1XWSA 5EK7A 3R83A 4FT9A 2QHMA 3L2UA 4BKJA 2WTWA 1T38A 3ZMVA 1KZHA 5HOOA 2BBYA 4MBIA 4RIYB 4WCGA 2RC4A 4EK4A 3KL8A 2OW3A 2O8YA 3LAJA 4HVGA 2QOCA 3H0YA 1PDNC 4QT1A 3FM5A 4Y5HA 4FSWA 2M2EA 4GVJA 3F3VA 4HZSA 3N4VA 1Y8QB 3AMAA 3ISPA 1W7PD 5E79C 2RDPA 5JLXA 1RUOA 3C0IA 4LUEA 2FA2A 3DTEA 4CFWA 2VQLA 5CVFA 2QHNA 3LFAA 1UHWA 3UC3A 5KO1A 3HZTA 5KNJA 1G6NA 3BV2A 2R3SA 4XSZF 3BYMA 2VKHA 4C35A 4F1TA 3HG9A 3M3YJ 5KKRC 2Z99A 1KU7A 3HOZJ 4J8NA 3AG1H 4F99A 4O3MA 1ITYA 4FODA 1FINA 2PFBA 3OYHA 1XQZA 5LVOA 5LHHA 2KL4A 5EOLA 4WBBB 4HYHA 4CFFA 1NG6A 4R78A 1DPRA 1LFBA 4RB2C 1A36A 3WTYC 4LI5A 3L8VA 3QC9A 3JSOA 5J1UA 2VX1A 1TC3C 3TACA 2HDDA 3J7ZI 3LQ8A 1YWRA 2JA2A 4CVAA 2A5YB 1EH6A 5AONA 5KNLA 1N78A 3NNUA 1IAJA 4FNYA 4DGGA 3K1NA 2WTVA 4GYIA 3V5LA 5D1JA 4RGRA 4UV0A 2XKCA 1QZEA 4Q9ZA 4HDVA 2IW5A 2Z7LA 3PJ8A 1XDUA 2ZMEC 3FZVA 2JRMA 3TNQB 1WMKA 3HL7A 5EYRA 1DM2A 4ZK5A 2E35A 4OTQA 4D1QA 2G1TA 3WF8A 4CG9A 4HSRA 2I10A 5TGTA 3KMMA 3O8HA 3COKA 1IRZA 2ITUA 1SMYF 3PIZA 2VJ4A 3QC4A 2BY1A 1G2HA 3OP5A 4ZC3A 4XRSA 1XR1A 4KKEA 1FIPA 3RWQA 3R6XA 2UZEA 1S7AA 4AM3A 4PGGA 2MH9A 5E3MA 2QLZA 3NYVA 3E87A 4PSXA 2Y31A 4JBAA 5JFWA 2XB0X 4BI1A 5AUYA 2ZB9A 2NXNB 2XZSA 1O3RA 5IT9Z 2YX7A 4NH1A 3VWAA 3KMUA 3O3KA 1PW2A 1SZMA 3R01A 5T68A 2M87A 4X6RA 2NVXJ 5A4CA 4CTCA 4V0GB 5B3SH 3U6HA 3BL9A 3MFKA 1MP8A 1I44A 4FASD 3GT8A 4DFUA 1JT6A 4DT8A 2WQEA 2IZTA 2LDUA 2W1ZA 3AQVA 3C4EA 4H39A 4AXFA 2HW7A 3RP9A 3RI4A 3C4ZA 4CMUA 1E1XA 4XG8A 1UNHA 3D5SC 4DYCA 3NYOA 4M69B 3Q5FA 3K1MA 4XG7A 4RLFA 3VOEA 1W4MA 4M84A 1LEZA 3R00A 4L01A 3W2CA 3ZOSA 4Y4RA 4HF1A 4WO5A 3R7YA 4RAYA 2P3GX 4RMZA 3R6SA 3L9MA 3BTJA 2PTKA 3PE2A 1WZYA 4I6ZA 1Q8YA 2L2OA 2E7WA 3RZBA 3WU1B 2PVKA 3KCFA 2JPBA 4PX6A 3PXRA 4I5MA 2QO9A 4DFXE 5HD4A 1WAKA 1D0XA 4HNTA 2L9NA 1WGXA 2UVZA 3NS9A 3O0GA 5M09A 4LLLA 2EILH 2ITTA 2BHEA 5BQTA 3W0MA 5J9YA 4GCJA 3VEPA 4DDIA 4RJ8A 2R64A 2VI6A 4DTKA 1NK2P 2K40A 5DDGA 3RAHA 2JLDA 4FV9A 4MXYA 5HU9A 4D1SA 4AG8A 3CUOA 3NR9A 3TJCA 2ZB0A 1JKSA 3FXXA 5E1EA 4XOZA 3KYDB 3MFSA 3T3UA 2ZB1A 4RA2A 2NRUA 4AGWA 4GKIA 4CRSA 4FZ7A 3E0JB 2XF5A 4G5PA 2CPKE 3ZMTA 3MQ0A 1OYWA 2HTSA 2RG6A 3ZSIA 4L7FA 3AOXA 1A48A 4HV5A 5LHIA 4MQVA 5GADJ 3DPUA 4E6DA 2M1BA 2OH0E 2FU4A 3TUCA 1XB4A 3BQYA 4AIKA 4AUXA 4R79A 3E92A 5M55A 5DH3A 3CZ6A 4EBWA 3EMGA 3N9XA 5HLTA 4PDPA 3RAIA 4FV5A 3FLQA 1IAHA 3ZQ7A 3MA3A 1X1PA 4YC3A 2WV0A 4LITA 3SVVA 4A9YA 2HQ5A 5GAGJ 4IZ5A 3ZSGA 2HAKA 4B7TA 2R7FA 2DMPA 3UG2A 2IS2A 2KQRA 3EQLF 1D8KA 5JHFA 1YXVA 3I5NA 2XAJA 2EV6A 2JDVA 4QP6A 2PUIA 3PJ2A 5DG5A 2IVTA 2ZM3A 5M4CA 3UYSA 2BAKA 2R3PA 3GU6A 3BROA 3VN9A 3LFDA 4U3YA 1WBTA 1V0BA 3TV6A 2JPCA 3KP3A 2B63J 3ZMMA 4YFXF 1T45A 3C50A 3OC1A 4PMSA 4XOPA 2ERZE 1OIUA 2CGXA 5CSWA 2CSOA 1URWA 3NYNA 4EOQA 5KMJA 4Q5HA 3AMBA 1SNXA 3UMWA 2QD9A 1I6XA 4BRXA 4UB6C 4FTOA 3K4CA 4XIDA 2W96B 3VUIA 2V79A 3HGGA 2EXCX 5LXMA 4BY9E 1YLFA 1YFHA 5M5WJ 3DK3A 4FV4A 3TZ8A 2KMUA 4ALVA 1QMZA 3ZCLA 4HCVA 2OUMA 1U5RA 2WMBA 4XOYA 5HCZA 2P6TA 1OL1A 2ITYA 5LVMA 1SYKA 2V1NA 5BNJA 4MO7A 3NAXA 1J7UA 4KICA 4OTIA 5KBQA 3D1NI 3QRJA 3GCUA 1WJDA 1XN7A 2LBFA 4G6OA 5HS9A 1JT0A 4O6JA 1MKMA 5AUUA 5E8VA 4FKIA 4JDIA 2UW0A 3BKBA 3LFBA 1LEAA 1VQ8I 3TL8A 2O0YA 3I1AA 1T33A 4J7BA 1M2QA 3CC2I 2VAGA 3DDQA 3CIKA 4KD1A 3JR9A 2UZUE 3DV3A 4N70A 3NW5A 3CCSI 2R4BA 3U4UA 1UB9A 4ZOGA 3HNGA 1QRYA 3ZZEA 4BIDA 5GINE 4JQFA 5ANKA 3GBGA 2X6OA 4DOZA 3A0BC 4UXQA 5AUZA 3QTXA 4J52A 4FBXA 4G6NA 4XG9A 4FKWA 4EK8A 4DYRA 2Y6OA 1PXIA 1ZYRF 3GOPA 2LG4A 2RV8A 3U1KA 4EVIA 2FH9A 4DBNA 5IQGA 2VO3A 5L3EA 4FYOA 4FG9A 4LFIA 4E6QA 4IB0A 5DIAA 2HPIA 3T1BA 3MN3A 2X8DA 4O22A 5FLFA 2UWMA 3QU0A 3I4BA 4DDGA 2FNPA 4U7DA 4XONA 2C5XA 4K0YA 5GPCA 5F94A 1KE8A 3D7TB 4JK1X 3LZBA 4FGBA 2L4AA 1WQ2A 3QAHA 3JR1A 3UVRA 2FSLX 2WTEA 3M8EA 3R8VA 3VBVA 1I3QJ 5FJ8J 3T5XA 3MSSA 3KFWX 3W33A 3HUBA 3O2PE 4QYEA 4WG5A 2DO7A 4PDOA 3SW4A 3CE3A 3ZHPC 2HY0A 2V7OA 1HXDA 1ZXEA 3R28A 4GO1A 2IVMA 3IRQA 4Y73A 3Q9SA 4H3BA 2BMCA 5GP9A 3DZOA 4EUUA 3RYRA 1JTYA 5EYDA 4ANJA 5K4IA 1J7KA 3IO7A 1R36A 2E19A 1GZ8A 3V5JA 2WY8Q 3I64A 2Z7QA 5J87A 5HI2A 1XO2B 4K33A 3E7OA 1TWCJ 3ROCA 3CQZJ 1OCOH 4ZSGA 4ZTHA 4RWLA 2CN5A 4JIAA 4F64A 4YPDA 2BDJA 3S2WA 4DZPA 5M3MJ 3TGNA 1MMSA 3AGLA 1P4WA 2Z2SB 4JG8A 2A6EF 2MA3A 3D15A 4YIFA 2W82A 3QQJA 4JQEA 5EQEA 1FEXA 4ANQA 4AD9A 3V6RA 4ACCA 3KB7A 1MDMA 1MBEA 3KULA 3ABKH 4E93A 2MFZA 3IGGA 2RF9A 1T6SA 5D4RA 2X85A 4M0ZA 3NW6A 4ZYGA 2OU2A 5HIEA 1W7HA 4KBCA 2W57A 2VO7A 1FBQA 4D5KA 4MIMA 3SEZA 3RK7A 4J53A 4CXAA 4DH8A 3NYXA 1SNUA 3GYHX 4B43A 3QYWA 3CY2A 1O9UA 3SXSA 2XVDA 5DNRA 4QLCU 1ZG1A 3ORPA 4WUAA 1K79A 4LIUA 5J4YA 3H3UA 3GC7A 4IEJA 1M7QA 1BOBA 3U9CA 3M1EA 3A2CA 2WAJA 2O8KA 4C2UA 1I5ZA 5EI2A 3TKHA 1KV2A 5LEJA 4HCTA 1YW8A 5KCMA 3E97A 3CY3A 3MH3A 3BJAA 4NC7A 2VOOA 3LMIA 1VQ7I 1V3FA 1J59A 1YQJA 2XANA 3AKKA 3BGZA 4FTNA 2QR8A 3ZC5A 3IC7A 4CT2A 5HE0A 3SFIA 2A6TA 3CKXA 4IC8A 3D5LA 2W4OA 3P23A 3QRFF 4KRDA 2C6IA 4WWCA 2VZ6A 3PVUA 2WMQA 4UWBA 4ASNA 4BB4A 2E1OA 3G33A 3RNIA 3VC4A 1H88C 3RJPA 3DK6A 5AV0A 2VB6A 2IT0A 3SG8A 3E8DA 4M71A 2C6LA 4K1BA 2MLKA 2FOWA 2GLOA 3QTZA 2GOXB 5DRBA 1WJCA 4BDGA 5BQ0A 3GTQJ 1ZGJA 3FKNA 4G1WA 4TY1A 2JIUA 3OUKA 4MLOA 4QMLA 5ETCA 3ACJA 3H9OA 3HYHA 2ZCWA 3W10A 4ENMA 4E7SA 4BDJA 2DODA 3TUDA 1Q3DA 3OYDA 4A5MA 2GQSA 3KP4A 1M1EB 3A4OX 5FDXA 2F9GA 2YWVA 3GZNB 2IG7A 3GCSA 4TWNA 4F4PA 3ULQB 1SVMA 3SZGA 4X3FA 2W4KA 5J8IA 4W8DA 4GDFA 2CW0F 3GVUA 3O8GA 2FF4A 1IUFA 3VS0A 3O2MA 5CX9A 1NVSA 2OU7A 3ABLH 3BG6A 5F08A 1Q5KA 3RQ4A 3SZTA 2IRFG 2C0IA 5FKNA 4C2MJ 1NH3A 4Z16A 3K2AA 3HV7A 2PJPA 3RPUD 2QOFA 2ELKA 2XNGA 4NCTC 2JN6A 3D5UA 1B38A 2H8RA 3NLBA 1ERKA 1VLRA 2WMVA 2YHVA 3IDPA 2D45A 5L3GA 2E7XA 3LSHA 1E3OC 1HOWA 3GW2A 2PULA 1R1WA 2WY7Q 1JJ8C 4GFBA 4MEXF 4ZMFA 3LLAA 1AGWA 1D3YA 1W8CA 3P9IA 1KWPA 2G2FA 1IRKA 3K10A 2IVUA 3F82A 2B53A 2DT6A 3V7SA 5EEAA 4RGUA 3SLSA 2M45A 3TM0A 3S1MJ 4O0XA 3U2RA 2QG5A 2FBHA 2IVVA 3BCAA 4QMTA 1KONA 1CTPE 3QYFA 3PRIA 4LOQA 4YTFA 4RJ7A 4ZTQA 4UWCA 4EEFG 2P5KA 4AWIA 2YZLA 3MH1A 3NUXA 1JUMA 2E2BA 1XSVA 4IB3A 2E9PA 5HLWA 1YQAA 3UOKA 3GP0A 1O3QA 1XDSA 2W1OA 4FTLA 4TTHB 4L5JA 4U80A 1KU3A 2CQKA 1GZOA 2J7TA 3COIA 2XA4A 3EZVA 5HG7A 3CS9A 2O3FA 2JK3A 3TTIA 5GAEJ 4EH9A 2L0KA 2QONA 4MNEB 3U4WA 2KP6A 5IZFA 2Q2EA 1JUPA 1BYGA 1VYWA 4AVZA 4I0BA 2XRWA 4G9CA 3GCQA 3C51A 4LV8A 4M6VA 4PP9A 5IDNA 2CSNA 4NU1A 1R4MB 3NNWA 1U8RA 1SC7A 2W06A 4C62A 4QNYA 1OL5A 1IASA 4C3FA 2OPTA 1B6AA 1YWVA 2BAJA 3EQDA 4ON0A 5AA8A 2F57A 4XM3A 3HDNA 2B9HA 4QTRA 4A0XA 5CEKA 3LOCA 2PVJA 1JAMA 4LDTA 1DAYA 4FSRA 4KDPA 2W1IA 2XJ1A 3QPLA 3CMEI 2D2WA 3BL7A 2HVQA 3KN6A 4XV1A 2P7VB 2RAEA 3D83A 2F49A 3CJNA 2FXAA 2KRHA 4EOPA 4L8MA 3WZKA 2GPHA 2IP2A 2O61A 3E6MA 2BGCA 2UUZA 1YDTE 2XAMA 1OL6A 3PJCA 2JKQA 2MW8A 4D5CA 4JMQA 1EA3A 4DIQA 2HZTA 1MUOA 4U0IA 1OMIA 2M30A 2G15A 4PV0A 1LDJA 3V5TA 1LUJB 3CBLA 4BTFA 2O64A 2OJJA 3HSRA 4BQOA 4PL4A 4RM2A 2DYLA 2EVAA 1SVEA 4FSMA 2BOLA 3WE3A 2GSFA 4LV5A 2XNBA 2D5VA 4JR7A 1B72A 1UFMA 4YZDA 4D1XA 3IH4A 3H9GA 4C3PA 3R02A 5H8GA 1MNMC 4DFYA 4I6FA 3HV4A 4S33A 3SDJA 2VWUA 4CV9A 4BJJA 1TZLA 3R8LA 5HE2A 3GCVA 4FL2A 5JSMA 4KISA 5CF6A 1MH3A 3EYGA 4O7ZA 2YCQA 5HZNA 3ATSA 1ACIA 4BGGA 2X2LA 3REPA 4CCNA 4EGZA 4Y83A 4XG2A 3RALA 3I4MJ 5E1WA 2WELA 3KXHA 2WMAA 4LRJA 1V0OA 4FT0A 4FSUA 4FQGA 3FJQE 1WJAA 3TBIA 1MDMB 2XNEA 1W7PA 4BF2A 4JIKA 5L3BA 5CPRB 1PXNA 4O2PA 1K2PA 4LGHA 2OJED 2QQ8A 1BM9A 4G6DA 3BV3A 4LRKA 1FIAA 1D0YA 1A6QA 4IZ7A 2XBAA 1R5HA 5BMZA 4G12A 3W55A 2A07F 3QZFA 4L68A 3MYGA 1OL7A 3NVMB 3RGFA 3C4WA 3LJ2A 5D6EA 4ZLZA 3O6BB 2FBIA 1FBNA 5BVEA 2X6EA 4J96A 1FSHA 4BCIA 1U0JA 1YRNB 4M3DA 1HF0A 4PSWA 3DT1A 3VS4A 1WVYA 1PVEA 3NPCA 4DGMA 1NW1A 3RTRA 2OQGA 1TFFA 3FM3A 2X6WA 1KQ8A 5IF1A 4XKWA 2VWWA 2H27A 3DXNA 4C0TA 2PMLX 3DBQA 2YITA 4DGNA 4O38A 3D5WA 2W4JA 3QYEA 2R7ZJ 4GVAA 4KIBA 5HNFA 4JT3A 3BZCA 4FKOA 4FT5A 4D5FA 1BA5A 2PZPA 3FL5A 3W2RA 2W9ZB 2JBPA 4O7RA 2XEZA 1XSXA 1AHDP 2OD5A 1R4NB 3TNHA 1Y6AA 1WWXA 4NM7A 2JKOA 4BJ5C 3PVBA 4TT7A 3IH2A 2IGOA 2HY81 3CC4I 1VR2A 4JR3A 3MAJA 3QPTA 3EQCA 2HYYA 4I92A 1H0WA 2DQRA 3PZEA 3KP5A 3C5IA 4ETSA 1ZKGA 3TIYA 4DFLA 1YG2A 5CEQA 1AU7A 1YOMA 3HHGA 4OT5A 2X9DA 3UDZA 1KE6A 2FJ1A 1W98A 5CJ9A 4I41A 4IE9A 4FOCA 3DXPA 1I39A 2ESNA 5JKGA 1FMWA 2PMUA 5HU3A 3OWKA 1F36A 3C4FA 3VS3A 3IW8A 5TO8A 4BL0B 4JX6A 4IM3A 1O6KA 5EW9A 3M11A 3IWZA 4QPSA 3TP3A 3COMA 5D5UB 3KRLA 4AA0A 3JRAA 5J1WA 3PP0A 1JGGA 4XJ0A 5C8NA 4JOMA 4F7NA 3BG3A 2W7XA 3ALNA 1MJBA 4MD8E 1Z0XA 4GK3A 2QF7A 5AP4A 3PXZA 3DEWA 4WNMA 2LLKA 3CXWA 2DUVA 4AT5A 4ZS0A 4LK0F 3W6JB 5H3QA 3AKZA 5F20A 3GTGJ 1IZ1A 4GCVA 5DBXA 3QA0A 1I3AA 4A3JJ 3FISA 3H9QA 3OR2C 3TXOA 1XGOA 4AGDA 2XEYA 3PP1A 5ICGA 4QTAA 2NVQJ 3I59B 2ITOA 3QGWA 2ZAZA 1QPEA 3ORTA 3EN6A 3IWFA 5KAIC 2UW4A 4U43A 3C4XA 4N9HA 2C3LA 4LMYA 4C30A 3MB6A 4FJVA 4UUSB 1XTAA 2NVTJ 3UVPA 5ILUA 4PMTA 4J98A 4HNIA 1X8BA 2PZ5A 2W4SA 4IAYA 4UN0C 5IQBA 4ZJIA 3RPRA 4E5BA 4O0VA 4IVNA 3F72A 4IHXA 2ZNZA 3AC3A 2E34A 1F1ZA 2YUSA 3FUPA 1SM2A 3D9VA 4RJ3A 4HQEA 2J0MB 3IW7A 3LXLA 1YW2A 3NRMA 5DVRA 4CUGA 4ZSAA 3ABMH 2PJRA 4ZSJA 3K6GA 4N4SA 3P7AA 5D8KB 4KSPA 1IDYA 1LKXA 1B6CB 1YXTA 4F08A 4BJTA 3EUKL 3DEEA 3KA0A 3FMDA 4TYHB 4A9RA 3GFMA 1XH8A 4IBMA 4XKCA 3DTIA 3GU4A 2XGCA 1R39A 2VXDA 4CFXA 3MJ2A 4RJ6A 4Q5SF 2LR8A 1GV5A 2EFWA 2C4GA 5EW8A 4OT6A 2YAAA 3IAM2 2J5EA 4FKSA 5ETIA 1POGA 1TNTA 1PF8A 1SFKA 5TKDA 2R3OA 4YIIA 1FBUA 2UW9A 4R7IA 5D41A 3GZ5A 3VS5A 1G3WA 2O03A 1TTYA 3GGFA 4A0YA 4ZYHA 4JRNA 4A2UA 2ITXA 4RPVA 3WTWC 3ETAA 4O96A 4C36A 4JBQA 5CU0A 4O0WA 1ON1A 1T56A 5EZGA 1RRJA 1I50J 4FC0A 5I9ZA 1VTNC 1BMKA 3CPBA 3EL8A 2OZAA 4FTRA 1MBGA 4BHPA 1ZZ2A 3K4MA 5IQCA 2EZLA 1TW2A 1O7FA 2GM4A 5I0BA 2R5ZA 2LY9A 3OUNB 5TT7A 3B2TA 2NNWB 2JA5J 4E73A 2J0LA 4ZJVA 3UPZA 3NRVA 5DD4A 3S17J 5ANEA 3FX3A 2ZXHA 1FYKA 1H8AC 1BI1A 4B6LA 4QP9A 3BCEA 3MESA 3DXJF 4MWHA 1RPWA 3DAEA 1QVUA 3VS1A 4F6UA 3L8XA 2OF7A 3I6UA 2V9KA 1NXKA 4AFEA 4IFCA 5AP7A 3WYYA 3R61A 4CFUA 1YIOA 3QCQA 2QOBA 3D2KA 3EH9A 4BCJA 2NOJB 4FV8A 1F5TA 3MDYA 4E5WA 1W84A 1D1CA 2G9WA 5FD6A 2XPVA 4XRMA 4C4GA 2M4KA 4MQ2A 4J95A 4Q2AA 3TUBA 4Y15A 4Y33A 1JE8A 4G6TB 1Z5MA 2QQ9A 4CT1A 1QPCA 2UVXA 3V8JA 3HB9A 4PNIA 4V01A 4M6YA 4ASXA 1U4DA 1LVAA 3FYKX 4I21A 1W1WE 2WQNA 5IH5A 4HGLA 4A3IJ 5IY5H 1STCE 1QVTA 1Z67A 3G9NA 4IHWA 4F9WA 4YLJA 2RKHA 1FOYA 5HG9A 3I56I 3QCSA 2YJSA 3GTPJ 3VWBA 3F8FA 2ZO4A 5AP2A 3SRVA 4RIXA 3ZQGA 5A14A 3E8EA 1SVHA 3ID6C 1FYLA 2XKDA 4O91A 5BX0A 2XV4S 4IM2A 1H9GA 1VYZA 2PE0A 4F65A 1GHCA 1OKWA 2GNGA 1X4OA 4BXUA 2EB7A 4BHBA 2FQ3A 2CO5A 5I9UA 3FXKA 2FA5A 3IG7A 2OCEA 4OINF 3BOQA 4M73A 4FIJA 4H05A 3RI1A 2VKDA 2XKFA 4DLIA 2GA2A 1QGPA 3MWUA 4YTCA 3LL7A 3FMEA 3HV5A 3R8PA 5EJCA 1ZAOA 3CCUI 2HEOA 5HCXA 2R7QA 1MZBA 1VQOI 1YHVA 5GTIC 3UQGA 2OBJA 1XKKA 3QALE 4W4VA 3UNKA 2W1CA 2XIYA 3QD4A 3ZBXA 2EB3A 5A2QZ 5FGKA 2NYXA 4DYQA 1M7NA 5IUGA 1QU3A 4MF1A 5LCKA 1T98A 4GFMA 3R1YA 5H6QA 1E3PA 3E93A 3M42A 3BBWA 1BR1A 3PIXA 4O82A 3BT9A 3LSGA 4A12A 1VZ0A 4FK3A 3FK6A 2BY0A 2WOUA 4KIFA 3E7VA 5EH0A 2R3HA 3P79A 5KMIA 3VUDA 4JNWA 4Z9LA 3VHKA 4DG2E 1U6GA 1KYWA 1P92A 4A3MJ 3A4CA 4NKAA 4DEGA 4M72A 1FT9A 1XH4A 4LGGA 2FD5A 5DCMB 4AE6A 1NTCA 3BQRA 1K78B 2GNFA 3UBDA 2X9FA 4ZTNA 1JI8A 4EC8A 2P5VA 5F27A 1HW2A 4ENYA 2IPQX 2OZUA 3U54A 3UP2A 3IRRA 4EHGA 1IR3A 3SFZA 5ILVA 4DHFA 2KJCA 3BR3A 5JQ8A 2E36A 3JAMK 2HOGA 2VTMA 3VFZA 1OPLA 1UKIA 2WZJA 3QTSA 5HORA 2DJNA 3ZRLA 3K5VA 2R7OA 3D0EA 2FVDA 1S5LC 4DGOA 2BY2A 4M9ZA 3AG3H 1UWHA 2CW8A 3GU5A 5C4JJ 1FMOE 4M3FA 3CESA 3LSRA 4Z7HA 4WRSA 1J3HA 3M1SA 3DQXA 3UZRA 1SFXA 4WNOA 1IW7F 4YU2A 2BPMA 1ETYA 4BY1J 4AXDA 2BW3B 3HBLA 4E6AA 3MKZA 2BDFA 5BMMA 3RMFA 2PVFA 4GS6A 4ZXTA 1O3TA 1PXMA 2E1NA 1JLUE 1DS5A 4LM5A 4OUCA 3BR6A 1REJA 4KFCA 2Y9YA 4ITJA 4NBQA 2OG8A 2ADUA 4HF2A 3H30A 2GS6A 4C4IA 4A0ZA 4UWYA 1SVGA 4Z7GA 4NM5A 1YE9A 2M3AA 1OGUA 3MJ1A 3AC1A 1A35A 3NNXA 4FR4A 4B9DA 1UKHA 4BQAA 3BQCA 4WHZA 4JLCA 1P9QC 2R5YB 1H26A 1XCVA 5K4JA 5EGOA 1PXOA 2HXQA 4FKLA 3UKGA 3ZQFA 5M4UA 3VJOA 3HV3A 3BR2A 3FHIA 3C2GA 3DLZA 4E8AA 4L9VA 1MNDA 3G6EI 3BQZA 5IPAA 1ZY4A 4NFMA 2E9VA 2F7ZE 2BHHA 5JN2A 3DK7A 4OIRF 2PJRB 3AMYA 3KIOC 4TNBA 2FE3A 3ZDIA 3BEGA 3FDNA 1OUYA 2DA2A 3BEAA 4GV1A 3ORLA 2NRYA 2XP2A 3HOXJ 4IZYA 4C7TA 3E63A 4XBFA 1OITA 1T2KA 4BCHA 5KHXA 4KNBA 5E8TA 4RZWA 3Q5ZA 4UY9A 3JSPA 4DEHA 4CD0A 1JSUA 1S72I 1ZHFA 4E70A 5AP3A 4MHGA 4U87A 1LE8B 2HR3A 1Z3YA 4A3BJ 3S1HA 5HVYA 5B0XA 4V2FA 4CICA 3WZUA 2MH2A 3GFIA 3ATTA 2KULA 4J99A 3ZRGA 3QRTA 3BLAA 4I1ZA 4IHVA 4EOSA 2JEDA 2X7OA 4IC7A 1ZY5A 3KEQA 2VX0A 3W0OA 4F9BA 4RWIA 1IRFA 4RFMA 2ZJPF 4NT4A 2OZAB 3RPUA 5CF5A 2GHGA 5D4SA 2CFXA 4M3GA 4BBSJ 3A01B 4IX5A 5AP5A 3QRUA 2AQEA 5BYYA 3ODYX 2W84A 1GT0C 2YM3A 4F3QA 1B59A 4QMXA 3O7LB 2CFOA 3VBTA 4LRMA 4RC2A 3I7BA 3HLLA 4IFGA 2WTIA 4QMOA 2DA6A 1XC5A 2GOMA 2BZJA 1UMQA 3JRIA 4EJUA 2PWLA 4RBLA 2C6EA 2UXXA 1M14A 4XKBA 2QVOA 4UXNA 3EUAA 3QAME 3KEYA 4LJZF 2W99B 5BYLA 1IEPA 2HWOA 3GUDA 2VKVA 3PA4A 4TN6A 2CNUA 2X7GA 3AD4A 2HI3A 2DFIA 2OC6A 3TDUC 1HA8A 2UV2A 1YI2I 4JBVA 4Y17A 5A4TA 1WI9A 3BZKA 3QWKA 4EOJA 3ZMUA 1VQMI 2A61A 3WF9A 1TQMA 1NVRA 5JVGF 4NJDA 3R7IA 4EORA 1AOYA 1URCA 3DQWA 4YJVA 1QA6A 3VULA 1ZWSA 2GFSA 1XH9A 3FE3A 3A62A 4HQMA 3JTGA 2WNTA 3ECHA 3SRVB 4RIXB 3O8TA 3FI4A 3BHHA 3P7BA 4ZS4A 4FTQA 5JQ5A 2BFYA 4XLNF 2BXZA 3OV8A 4RJ4A 4Q48A 4ZZOA 3RPOA 4QMQA 2QOIA 2VQCA 3RAWA 4YTHA 2ICWG 2IS6A 1JJ6C 2VTSA 3TKUA 4MXZA 2CUEA 3S0OA 3TIZA 2QNJA 4ZTSA 1ZQ3P 2G9XA 2DPDA 3E8CA 4NDLA 4FTIA 2MBFA 1CKJA 5DFPA 1R1VA 4KBKA 1ETKA 3G9LX 1R6RA 1LPQA 1HW5A 3R9NA 5CVVA 2Z8CA 3PWDA 1HBXG 3GEZA 3U6IA 2O63A 3JPVA 2IBDA 1Z7LA 2EJRA 5HLIA 2VOPA 1CKPA 1IG7A 1XHAA 4FIFA 2H94A 3C2BA 2VWXA 3F22A 4QRCA 3OROA 1HLVA 3RQIA 2YACA 3LE6A 3H0DA 4IQ6A 4BGHA 5DT3A 1JNKA 4BTJA 3F5UA 3HRFA 4II5A 3E6BA 4CZUA 1TW3A 3IKAA 5BPIA 4YJNA 3GLLA 2AYPA 3N51A 2NS7A 3QX2A 2XIKA 3OVVA 1EJ9A 3FBIB 3A8WA 2X8EA 4JX3A 2XK8A 4R77A 2O7OA 3JCUC 4BI2A 3ZLWA 2F5CA 5FKMA 3SZPA 4X0GA 3V6SA 1IXSB 3PM1A 3LQRA 4G34A 2ONLA 5IQDA 5BUJA 4CSWA 3N97A 1WVXA 4FA2A 1ZYLA 4II2A 3NCGA 5AP6A 4L9JA 2PLYA 2UW6A 2RVCA 3VRYA 3VF8A 3QQUA 3LOKA 4WD5A 3J80Z 5AIQA 3PO3J 1WPKA 5IUIA 2Y6MA 3CCMI 2Y75A 4OAZA 2C3IB 1H89C 4RGSA 5FM2A 4AA5A 2E5ZA 1OR7A 2KPMA 3NQOA 4A9TA 3HHHA 2YWPA 5AIKA 2BKZA 1IF1A 1U46A 3OL3A 1BL7A 2WIHA 1P4FA 1JKQC 4HZRA 3H0GJ 3UIUA 1ZG3A 4UZHA 2R92J 1MBHA 4PTGA 1K4TA 2HQRA 5AP1A 5DE2A 5DR6A 2HU9A 4EK6A 5I4NA 4E7LA 3OY1A 4FZAB 2FMLA 1WBOA 2HVSA 3IAS2 3GMEA 4C4JA 4QQTA 4KJZA 2RQQA 3QCYA 3GQIA 4ENNA 5CQEA 4BR3A 1JOWB 3I9V2 1R00A 4IO9F 3UOJA 3QGYA 2BRNA 3QQHA 3A61A 4QYYA 5JT2A 2BIKB 1G8SA 2XAGA 3ZH8A 4LG3A 4IAAA 4Y85A 4EKLA 5IH4A 2MSYA 2XARA 5HCYA 3BCBA 4BTMA 1YS6A 2WPAA 2EINH 1DI9A 2RREA 3KVWA 5C4XJ 4LV7A 4C61A 5FQDC 4DBRA 2DT5A 4GRBA 1P14A 3VQUA 3REOA 3HXLA 1PP8F 4BGDA 3HM5A 1P2AA 3PWYA 1IAWA 2COBA 3MMYB 3UZPA 3VYTB 2BY3A 5CXZA 1OPKA 2YIQA 5C4KA 3DLLF 1H1WA 5IA1A 1F3MC 2LF7A 1P7JA 2X1EA 3MVLA 3E5AA 2NYAA 2L01A 3MB7A 1JXSA 4FL1A 1PRYA 3GFJA 1RNLA 4AZEA 3BG7A 2C5YA 3PXQA 2L7KA 4AIJA 2UZDA 3ENMA 5J1YA 2RFNA 4S0HB 1LNWA 3BGPA 4NW5A 2IGKA 4EH7A 3SD0A 2F5EA 4FV7A 4CCJA 4UVAA 2CQNA 5HODA 2PEXA 1MBJA 4YZBA 4DG0E 2D1HA 3CUQA 5E18F 5EM5A 3HJEA 3V51A 3QBNA 1MRVA 2ESMA 2R3LA 3I58A 5HDNA 5E8SA 4UV9A 3VIDA 5FRIA 2EB2A 3GLXA 2NNNA 3DOGA 5AX9A 2C30A 4YEJA 3AAFA 2GU8A 4OMZA 5KMLA 2CHLA 3QODA 3BYUA 3HEGA 5JFRA 2H34A 1X2NA 3AT3A 4G8XA 1MSFC 2ESHA 2VQGA 3RKBA 3HMOA 4B0GA 2PI0A 4KITB 3MPAA 3LSJA 4S2ZA 4WA9A 4QYHA 2JZYA 3NIZA 4HNFA 1H07A 4P4CA 3JRDA 3I5UA 2YM6A 4Y46A 1SEUA 2R7XA 2RGVA 5FG8A 1Y0UA 3Q52A 3JTHA 2YSRA 3PYYA 2ID6A 1AA7A 3QP5A 3FHZA 3CP2A 5JGDA 2WTKB 4QQJA 3ZFMA 2J50A 3KXGA 4A3LJ 3H1CA 3DGKA 3A02A 3CCNA 2XAOA 3LSMA 1KOAA 3BC8A 1ZZLA 1J2XA 3D2IA 5JGBA 2IZRA 4U6RA 3QU3A 4EOMA 4YIRX 3SOCA 5M3FJ 2V6EA 4I7HA 5F04A 3SW7A 3O8PA 5EEHA 3QD0A 3IK3A 3OCSA 1B8IA 3L9NA 1F4KA 2RQPA 2AS5F 3ML1A 3FI8A 2B4SB 3NSZA 4FEXA 3WU2C 2OCCH 4BIEA 2ISYA 4DCAA 1ZK8A 2EV0A 3MIYA 1UZCA 2C68A 4K8AA 3DTWA 2JUCA 3PQKA 4UXLA 5J1RA 3VYRB 2XH5A 4LG0A 3GQLA 2CWEA 2DLLA 1ZMWA 1YO5C 3KXXA 3O51A 2DTZA 2PE1A 2EXMA 2YISA 3EFKA 1HCKA 5GTHC 3HUGB 4AZFA 2KIQA 3FLSA 2LC2A 2LMDA 2XB7A 4BZOA 4HVSA 1U5TA 1I1GA 4YJPA 4PCQA 1ZR2A 2VC1A 4KUJA 3V3VA 5HVQC 2CMPA 3OYNA 2E71A 1DI8A 5A3XA 3WARA 5KZ0A 2UZLA 5IA5A 3AC4A 3LXNA 1FTZA 3W0SA 2Y30A 2IO6A 1GZNA 3BP8A 3HUCA 3DCVA 2J2IB 2X9EA 5CALA 3OTUA 1OCPA 3MY0A 2DYSH 4JQ8A 4L45A 3C3WA 1GV2A 4Q9SA 4HCUA 5AM7A 2ETHA 3PNVA 3Q60A 1USSA 4E26A 1W82A 2REIA 1FLIA 4ITIA 4DQ2A 4FKPA 4IAKA 1WCMJ 4I6LA 2R2PA 4I22A 4IX7A 2MD0A 4PJNA 3OFMA 3ML6A 2XVCA 4AA4A 2VTIA 3DLAA 2OICA 3BR5A 4E4LA 2YM7A 1FPQA 1L3RE 5F64A 3RPQA 1WFCA 1QL6A 4M7IA 1NY3A 4YLLA 3PNTA 5FLXZ 4XKVA 3MD2A 3VBYA 3E64A 4D55A 1Y6BA 1NK3P 3SG9A 1RZ4A 1U54A 1LQ1A 2ZJWA 4BUPA 2BALA 5KBRA 3BR1A 3W2QA 2JGZA 1UG2A 5EYMA 3IPHA 1PJRA 5JMSA 3G2FA 2ZFUA 4K9YA 2NVYJ 3WG9A 3ZEPA 2WTDA 4QIWN 4CCOA 4ZTRA 5D6FA 2B1PA 3HRSA 4JOAA 4LG4A 4CTBA 4PUSA 4CFVA 4F6WA 3LCDA 3DXQA 5L3AA 2J0IA 4A3EJ 3ZOBA 4F1MA 2VL8A 1H4LA 2WEIA 3UGCA 3S3NA 3S3IA 4RX8A 3HDDA 1CDKA 2MG4A 3VW8A 2QLUA 2OIDA 2XIXA 3WODF 3CMAI 2W5AA 3ZC6A 5AUTA 1Z1DA 1PXKA 5JFVA 4ZY4A 2P2HA 2VJ5A 2VUWA 2XIZA 1GVDA 2GNLA 3NNVA 1DP7P 3SDGA 2C1BA 2R0UA 4IANA 3ZLSA 5E20A 5L2SA 1YJNI 4DZJA 3ELJA 3QTRA 1AQ1A 5G6VA 3H5NA 3CGOA 1A9UA 4WNPA 2QCOA 3UVQA 5IA2A 5BV3A 2R3QA 1PMNA 4HGTA 1HKSA 2NS8A 3RDIA 4DHIB 4Q47A 3QA8A 1R22A 4NKSA 3W1FA 1P6RA 5HESA 1XGMA 1JWHA 4BE0A 4F9AA 3DAKA 1PYVA 1AD5A 5TRDA 5I5ZA 3K4LA 3H3CA 2RN7A 2ZMEA 2V1UA 3CTHA 1JHFA 3TZMA 2DA3A 2YDKA 4DEAA 4QTCA 3WE8A 4TV7A 1UVRA 5C1QB 4GKHA 4CMOA 2LP0A 4MVFA 4MXOA 1YXSA 4CMTA 1O7LA 4FZDB 3SQQA 4B99A 3OZ6A 4UEUA 1Z9CA 4RJ5A 2XK9A 2GNJA 2Q1ZB 4USEA 1ZYJA 4HYUA 4GU9A 4XLEA 3L7WA 4PFPA 2VE8A 3FHRA 2V9VA 4O6LA 5J95A 1UHMA 5JH6A 2IWIA 3CCJI 2QO7A 4CCBA 1ETVA 3R2YA 4BEHA 1H08A 4XLIA 2LD5A 3SV0A 3B8RA 3Q04A 1ZRDA 5T6KA 3H5AA 3Q53A 3FQHA 4WSYA 2VJIA 4IX3A 1E2XA 2K4JA 4QP7A 1ZRCA 4MTEA 3KYLA 3ORIA 2IGMA 2JSCA 3R0JA 3BR0A 4C33A 4QTEA 3OS1A 3W3CA 3LW0A 4OTHA 4YC8A 1SVLA 3PVGA 4V19K 4UHTA 2JA6J 2BV6A 3J81Z 3FXLA 3GTKJ 1BC8C 1ZLTA 2VODA 2VT2A 3C4CA 2WEVA 1V4RA 5D5VB 3CCLI 2JMWA 2KZVA 2GXBA 4QPOA 3E5QA 3H4JA 3R21A 5CEIA 3A8XA 1X58A 3F3TA 2B55A 3ZQQA 2WD1A 5I9YA 4KRCA 2BZKB 3NX8A 5EDQA 3OWPA 9ANTA 5CSVA 5DPVA 1ZMVA 3HA8A 4L5IA 5H8EA 3BRBA 4HDUA 1Y6IA 3G73A 4AU8A 3VDXA 3AL0B 5E17F 3II5A 2HVRA 3ALOA 4DTBA 4OBOA 1E9HA 3CC7I 2J51A 1IA8A 2WO6A 3GB2A 3OXIA 4XLAA 3QUEA 1UU8A 4P5ZA 5E90A 2C6TA 1Z6RA 3AG9A 5EM8A 2OFVA 2ZV2A 4UBAA 3TG1A 3FXJA 2IN6A 3PXYA 5C44J 3QKLA 3WILA 5JRSA 3FMNA 1E3HA 4YPSA 1PUFB 2K4BA 2R7UA 4RIWB 1S7EA 4AP7A 5HDKA 3VO3A 4I0AA 4RRVA 5H8BA 4XMYA 1OCRH 1XMAA 5FFXA 2PMHA 1A5JA 3W32A 5EOBA 2C6KA 5K5QA 2HGCA 4NFNA 4AU7A 4DFBA 4TYGA 1OECA 5FBOA 2R9SA 2XBJA 3VONA 3MH0A 4OLIA 3HPHA 3LHJA 4X6AJ 2Y0SA 4ZTFA 4EWQA 2WWYA 3RINA 3FZTA 1PXLA 2A27A 2VTQA 5JZJA 4QMPA 5IT9K 4QP4A 3KFAA 4MH7A 3L2WA 2UV1A 5EF6A 1GNGA 3GENA 2H96A 3LFEA 4AQKA 2QA4I 1W0TA 2H9VA 4P96A 2WHBA 4IAIA 4A3CJ 3ZXSA 2ISZA 3EPZA 4O84A 3CLYA 3BELA 5EKOA 3EHAA 3FBNB 3L8SA 4ENJA 4NM3A 4O86A 2L7FP 1G5SA 3PIOF 3LLTA 3RPVA 1G8XA 4I4FA 4YUQA 5KMKA 5BPYA 1RR8C 4H58A 4FTCA 3GFLA 3TO7A 3KX2A 3JRCA 3I55I 2G7HA 3NDMA 3BIZA 1KV1A 2B9IA 3GFEA 4IZZA 2Q8KA 4L0YB 4BHCA 1N77A 3GC0A 4HJOA 3PSBA 3BY6A 5FEDA 4AAYA 4G31A 3OXTA 3VBWA 3IQ7A 4X0MA 2DOEA 3KF4A 4M3BA 4QTBA 2X1DA 4PDSA 5KVRA 3A7HA 1YW7A 2HW6A 2VPLA 1VJYA 3KC3A 5F0HA 1Q4LA 1OM1A 3VB2A 2Z60A 4FVPA 4OAYA 5LGTA 2FUMA 3HP2A 4D1ZA 4C3JJ 4QPAA 3GOKA 4CDGA 3IDCA 4I98B 3JUHA 4HZFA 3SHFA 2R7IA 4O0YA 1IG1A 2OIQA 1WZ2A 5IH6A 3RZOJ 2W85A 3TDZC 2JTVA 4TRLA 4GU6A 3BG9A 3FBVA 3DS6A 4FEVA 4FKQA 4U3ZA 4U5JA 4PJJA 2BZHB 2I0HA 3DKWA 3W2SA 5EHOA 2V26A 5AM6A 2X6YA 1R58A 5LVLA 3EQFA 1ZOGA 4ERWA 2DTRA 2GIVA 2GAUA 2RG5A 3PL8A 4IZAA 3R4KA 2XJ0A 3VUHA 5BYZA 5JI6A 4I01A 1KU2A 3ERMA 3TMOA 1YI3A 3ZFXA 5M08A 3I53A 3K4KA 1E1VA 4W97A 3ENHA 5ACKA 2QOLA 1JVPP 1YVJA 3S15J 1BR4A 1Y0NA 5C01A 2YN8A 5BVOA 2VASA 1CF7A 1OMWA 3NEWA 3RCDA 5CF8A 3WGHA 1OLTA 1ZGAA 4O7YA 4L9NA 4MFDA 2F2UA 3EFLA 1BLXA 4I0SA 4E6KG 4MWIA 2DQ7X 2PVYA 5F0CA 3AG4H 2GCDA 5CAOA 2ZKZA 1R23A 4FETA 1ZLJA 4LOOA 4G2FA 4ANBA 4PRJA 3G51A 3ULIA 4E7ZA 2HENA 2ITVA 4AW0A 2R3FA 3DB8A 5CVGA 1APLC 3MZ8A 4FV1A 3RK5A 1ETXA 1IGNA 1D1BA 5H2FC 2XYUA 3QFVA 2LTPA 3OXZA 4IRIA 3PLSA 1SD6A 4PTEA 4NQWA 4IDTA 4LUDA 4ZJZA 1WBSA 1XMXA 2EFQA 5JR3A 2VTJA 2C6OA 5DTDA 2JA7J 3N4TA 2Y9ZA 2M0MA 4HLXA 2FB8A 1OPCA 2XK7A 3H9JA 1FTTA 2ZV8A 3F5XA 1SD5A 2ZXWH 2GS2A 3NZ0A 4M9XA 5J9ZA 4IRHA 1T08B 2KTYA 1BL6A 3T8RA 2GNHA 2GBYA 4CYCB 2KISA 4OU0A 4G16A 5IQAA 5BS6A 3RHXA 1OIQA 1QPJA 2I40A 1XH5A 1GXPA 4X2JA 5JZNA 4JXFA 4EOKA 5BOXA 4XX9A 3TN8A 3Q2JA 1H25A 4R8HA 5L6PA 3S1RJ 3CCQI 4WXCA 2V6CA 2DOFA 3ODZX 4OW8A 2M8GX 1TQIA 2ZJQF 2WQBA 4WNKA 5AWMA 3QD2B 4RC4A 3EQBA 1ZH5A 4L43A 3FWEA 4BXXJ 5HHWA 5K7HA 4DINA 2VNWA 2O2UA 4J00A 2YDIA 3D94A 2VGPA 3HA6A 3DV8A 2MLGA 4UVCA 4I6HA 1BW6A 4IMYA 3N4MA 4L6QA 4D7MA 1MRYA 4F09A 3LJ0A 2LSOA 3R7UA 5LFAA 4HLYA 2YERA 4JDHA 2L5QA 2ZM4A 3I71A 3K4BA 4C34A 1R78A 1PXJA 1OISA 2CLQA 4YNEA 2A69F 3S1NJ 5K5NA 2LF8A 1J09A 3MH2A 4PQNA 4F63A 3S93A 4YJQA 1HDPA 2GA1A 2OJ9A 4RWKA 2ETKA 4MFEA 3QTUA 1U78A 4FSZA 3P5JC 5GHVA 4BE2A 1PXPA 4HW7A 4G9YA 2AC5A 1MMNA 2DQLA 3W16A 2R3NA 2XC7A 4DITA 3G15A 3R30A 4AXAA 4EJVA 4UNOA 4MBLA 2E60A 4BE1A 2DPUA 1RJBA 3BZ3A 1I6HJ 4R3CA 1XG1A 2IW6A 2L9RA 3UNJA 4IVBA 3R71A 3OIPA 1PMVA 4QMYA 5B1BH 2HZ4A 1FQ1B 4FIEA 5FUTA 3C0GA 4IWPA 3W6KB 2DA1A 3FPQA 5LMAA 2DFEA 3BHVA 3ECOA 5L3FA 4LL0A 2EWAA 4J71A 1YW9A 1W5CC 1Q1VA 3FMJA 4L3LA 2QQBA 2XASA 3SDBA 5LMKC 1D0ZA 3VYSB 4G7OF 4KIGA 2X48A 3LXPA 3EQIA 1ZYDA 4IHYA 2CNVA 3CD8A 5J7HA 4TYIA 3PPKA 3F9NA 2QG7A 2QSHX 2V55A 5HICA 5EDPA 4B8LA 2O3PA 3OF0A 5HLGA 3WZJA 2J9MA 4IEBA 3TO6A 5ACBC 3F8MA 5DS9A 3NMUF 4C4FA 3DQVC 1WH7A 2CJMA 4N57A 4EL9A 5KAFC 4CCLA 5EDNA 4EM0B 1WBVA 3IW6A 5IPJA 2Q0OA 5IMEA 5KHWA 4AGUA 5CI7A 1V5GA 4HF0A 4X2FA 3HTSB 2XK4A 1CQTA 1TWGJ 3KLOA 4XH6A 3AT2A 2NVUB 3LM5A 1T0FC 4EZ3A 3LA2A 5EG0A 4MXAA 4FSNA 2CMWA 3QOEA 4X6QC 2WC2A 4DCEA 3I79A 4XHKB 5HO7A 3QX4A 4DN5A 5CU2A 3RSNA 3QTIA 4O7NA 4NUBA 4YRVA 1N25A 1RQQA 1X1CA 1WFXA 4GW8A 4D28A 4FISA 1T8IA 4D4RA 1RI7A 4FZFB 5ITAA 3D5VA 4S04A 5CU6A 4HGSA 4F7JA 2WMUA 3DA6A 4B47A 2X39A 3C7QA 1UAAA 2VQHA 3KY2A 3AXWA 3KXZA 3ZUVA 5KHDA 5ANJA 2XKEA 4BQNA 4MQ1A 3R9RA 2ZDTA 2CQ7A 3DBRB 2UZBA 2C5NA 3D5RC 4PNKA 3Q32A 4FG7A 1YOJA 5JVTA 1LEBA 2CUZA 5CASA 3NWSA 1BL0A 4L5EA 4IHSA 2BRGA 1UHSA 2IZSA 2OH4A 4S30A 3ZM4A 3DDPA 4EH2A 2WTJA 1IV6A 4ZSLA 2GHMA 5FROA 4D2SA 5KX8A 2E5NA 3BPXA 4Y7NJ 3PO2J 3LQQA 2E1CA 2Y0SN 3WBLA 4CHUA 2IA1A 4FE7A 1ZOHA 2DMNA 2BIYA 3HVCA 5CI6A 4PK4A 3HOWJ 3EYYA 3MN2A 3KP7A 3EOCA 5J5SA 3BU3A 3LSTA 1OCTC 2WTKC 3BI6A 5CS6A 5EHLA 4X2GA 4WKQA 3RKQA 4HW0A 3Q0WA 5C8KA 2RKUA 5BVFA 4RWJA 4AQCA 5JHUA 1FVRA 2J6MA 3HP5A 2JT1A 3LAPA 2XGEA 3GWZA 3TO9A 2P7CB 5HO8A 1OI9A 1YYVA 4BICA 3B6CA 2Z7RA 2DWBA 3NUPA 3K3JA 4GJ3A 3FMRA 3OYGA 2QKLB 2PHKA 1G3SA 4UB7A 3BTIA 5M5YJ 4N6YA 3VHEA 3C1DA 3L2VA 3NFFB 4PGHA 1IN4A 2X51A 3V5WA 4ACGA 4EC9A 3IGOA 2JJ7A 3E5UA 3CMMA 3K4JA 5KZIA 3KKVA 2ZV7A 3A60A 4EUTA 3TZ7A 1F43A 4DHJA 2EQRA 4FCYA 1OUKA 4YSJA 3KRXA 4MYGA 4XQFA 4UX9A 1V54H 4XEYA 4B4LA 4CA0A 3BHTA 3F5PA 3M07A 2QBYA 5HVKA 2F5FA 3CQUA 4RLLA 3MKYB 3CC6A 3VS2A 3MWMA 3MEXA 3E7LA 2WAQN 4XN0A 1V55H 2KKOA 1JKTA 5FRMA 4U42A 2I1MA 3BJOA 4EH6A 4I3ZA 3DBHB 4BDBA 3HKOA 1ZREA 3I6WA 1U9NA 3W0RA 1OKZA 1V0PA 3KRWA 2QOQA 5IA4A 2HWPA 2GXAA 3CQEA 4S05A 2E2JJ 4YJTA 4A3GJ 3CTQA 1BI7A 3DBFA 1JKOC 3FSKA 5FKLA 3PJ1A 3DBDA 4NHJA 2ZJRF 3A1YA 3G0FA 5D7AA 3KQ7A 3ERKA 4XRJA 1L8TA 2CKQA 2XAQA 3FLWA 5DEYA 4FT8A 4EHVA 4FIIA 3FL4A 2OZ6A 3EUHC 3CD6I 2CKPA 4FEUA 3H92A 4NZWB 4FSYA 4AT3A 4P5QA 3WYXA 2PBIA 3GF2A 2IXSA 3UPXA 2WA0A 5LHGA 3ACKA 3R1QA 2WMXA 2HIWA 4GYGA 3W8LA 4FKUA 3E1SA 3CLOA 1RIOH 2HZIA 4AFJA 5M07A 2V4JC 5DUKA 5M53A 1IA9A 4RIYA 4D0PA 4F7SA 5B2LA 3OR1C 2I6LA 2YPRA 1JGSA 3AC8A 4FVRA 4NIFB 4H1MA 1GLNA 2Z3YA 4UY8I 3CQWA 5A9UA 2W1HA 3FZSA 4EJWA 2KRFA 3HGKA 2CUFA 3QUPA 3Q4UA 5L3DA 2K85A 4YHTA 3P9CA 1VQLI 3F88A 2MC4A 1Y57A 3FXUA 3IKVA 2AXLA 2ITWA 3W18A 2WADA 4A4OA 4QMVA 3ZDUA 5E8WA 4ZYDA 4QP2A 5E8GA 1SD4A 2VTRA 4DYMA 3ONQA 3U55A 1FGIA 2HDCA 4MNFA 5IEXA 1X1DA 4L53A 2OKRA 1J7LA 2H8WA 2A6HF 4D9TA 1FNNA 2OXXA 1LEWA 5E8XA 4OMYA 3S2PA 2Y7JA 1MMAA 1FYMA 4BCKA 4XOTA 3IOKA 2JIVA 3DJ6A 4O7LA 4DAWA 5CU4A 4NUSA 4YZ9A 1XD7A 3ZUTA 3F0CA 3ZRMA 4XRFA 5GIOE 1UNGA 2UVYA 4K2RA 1OKRA 3MVPA 2ECCA 3SYTA 3DJ7A 5CNOA 3SA0A 1FBSA 3TTJA 5EM6A 3RKXA 4OOIA 2O5RA 2PVLA 4GUBA 4MAOA 3EYIA 2ECBA 4MNUA 1O3SA 5E4HA 2DFHA 4OTRA 4D7NA 2HYGD 3C2HA 4HEA2 3GUBA 1MD0A 4J8MA 2B0QA 3RCOA 1JKPC 3HMMA 2HNHA 5H9BA 2HXIA 5FTOA 2HOTA 4FI1A 3ZQLA 1X4PA 3HMIA 4OTDA 5F95A 3I81A 2L4MA 3ORMA 3JRHA 4HOBA 5AV3A 3HYIA 4ZMEA 2QOKA 2P2IA 3LMHA 2HPMA 2VE9A 5AAEA 5IQEA 4QMWA 4L9TA 1T95A 4Q5EA 1Y56A 3F2AA 1YHSA 4HVIA 5E3LA 4DGWB 4V0GA 2VKEA 5DEQA 4P90A 2F6CA 4Z3VA 2DMUA 4IKFA 2ZSIB 3ZFYA 2L02A 3PLAE 2LBFB 4O7WA 3G1MA 4F0IA 1FX7A 4M14A 3ZRKA 3OG7A 5EDRA 4DLJA 4IL6C 1U2WA 2L9SA 4Y5QA 4YFNF 3PIPF 3F3XA 3UOLA 4YP8A 4E5AX 5M4IA 2EH3A 3CTAA 3FY2A 3F9KA 5BVDA 3RCJA 3EFWA 3OD6X 2EIMH 5F0FA 1D8JA 2WU7A 3W8QA 2BEOA 3OY9A 4I5PA 3POOA 1ORKA 4MEDA 3CEKA 2R7VA 2F48A 1ATPE 3CF5F 3UTOA 2R3IA 3IL2A 3HAMA 3ZMSA 2C1AA 4IADA 1CGPA 2LREA 4R1HA 3LXKA 4GGGA 3OYFA 1TT0A 2NNYA 2BXYA 1RKWA 3PSDA 3LSPA 2EA4A 3OYKA 1ONVA 1SMHA 2CV0A 3L2QA 3NAYA 4AS0A 4RVTA 1MBKA 4RX9A 5EI6A 2AO9A 5AUXA 5I9WA 2PVRA 2EIKH 3CKWA 2VTHA 3OSGA 2YIWA 4UB8C 3AL0C 4A93J 3R0AA 3AC2A 1PYEA 4AIDA 2C0TA 3TOAA 3PE1A 4A9SA 4R5SA 5HVJA 1MH4A 4RQKA 3PFIA 1H9TA 2EV5A 3LWFA 3LJ1A 5E8ZA 2DBBA 4CCKA 3OEFX 3S2DJ 2ZMDA 5LMBA 4ASZA 3UR3C 2R93J 3LCTA 4ZDPA 2UW8A 2FSOX 3FF5A 3WG7H 4ACDA 5F6FA 3UDSA 4RFYA 4A6DA 3VNTA 2A1AB 5A4EA 3FYJX 4FYNA 5ED4A 3QZHA 3U87A 4CLIA 2W7NA 5FKKA 2VN2A 3PJ3A 3EYHA 3O71A 4CKJA 3RJCA 3EN4A 1BI0A 2BILB 4D5HA 3HEFA 2QURA 3H35A 3PRFA 3VUMA 5ICEA 1M52A 2RL5A 4BACA 1BW5A 2WQOA 4KNYA 3BJ6A 3F8CA 4ZP5A 2YFXA 4G6QA 5LD2C 5CVRA 2HZNA 3JY9A 4QYGA 2LKXA 1RKTA 4CGZA 3ULZA 4GRIA 5LBQA 1MBFA 3ZYAA 2Y2ZA 4F9YA 4BDHA 4LOPA 4UZDA 5ANIA 3OT8A 2BRHA 3C9WA 2KFDA 4XBUA 4WF2A 2EZIA 5I9VA 1YHWA 5TF9A 4F52A 1IN8A 3P5KA 1MMDA 5DYMA 1YTYA 3KULB 5DI1A 4ZTMA 4FX4A 3PNYA 4O0TA 1OVEA 4BC6A 1D5YA 5IA3A 3L9LA 2EK5A 5B2MA 5LQFA 3NUAA 4NSTA 2VWBA 1XMLA 2X2KA 1G3NA 3O23A 1A06A 4AAAA 3MW1A 2LOOA 3LSIA 3FMSA 2EA2A 1WBWA 1XPXA 3PFYA 4AE9A 3VRZA 2UZNA 2HKXA 3UOHA 4E4NA 3HX4A 2IJLA 1MQ4A 4AIHA 2R3JA 2VRXA 3K4NA 4FX0A 1GIIA 4OBPA 4BBFA 3U21A 3MGYA 2JD5A 2EZKA 5FDPA 3VS7A 3KPHA 4KB8A 2GDOA 1USTA 5HLPA 2AEGA 2K7LA 4M13A 3R73A 1IV8A 2V1DA 3WF7A 3FK7A 4NL0A 3EJ1A 1IO2A 4GXOA 2X7FA 3M2WA 2BTSA 4RQVA 4TWCA 1J1BA 1G4DA 3SOAA 3THBA 1G3TA 4EKKA 3JYAA 4XV9A 4RB3C 4O7VA 2JITA 3LFUA 3L8PA 4LB6B 3KYCB 2BAQA 5H2UA 3R63A 4EH4A 4IDVA 4J19A 3LCSA 1B4AA 3ROUA 3FKJA 3PUFC 4BBMA 5IYDJ 2VUMJ 1OIYA 2NOGA 3NW7A 3ESWB 2YR2A 4Y52J 5L3CA 3MIAA 1QQIA 3SX9A 3DKCA 4B48A 3TL4X 1M17A 5HE1A 2DT7B 4QP3A 3MFRA 4XV2A 3KLNA 1JSTA 2YABA 2PUUA 3FY0A 4BJ6C 5E8IA 2XAHA 4AGCA 5FKOA 5TOZA 4LL5A 2LKSA 1R71A 2M0CA 4HX7A 2PU8A 2OWBA 5IP7J 4EQQA 4GT5A 5JEBA 4ZZNA 2XPWA 2P4WA 4BDEA 3FXQA 1LR4A 2XAUA 3PIYA 3UJGA 3IECA 4RFZA 4USDA 1VF9A 2RFEA 6PAXA 3HC7A 3E62A 1TP4A 4MBJA 2EBIA 4FUYA 4X3FB 3R22A 2BKKA 5JGAA 3F2NA 3HOVJ 3PXKA 4AWXB 3NUSA 5CVJA 4PDYA 1R9TJ 2COMA 3ZO4A 2OTLI 2DMQA 1I1SA 3FMQA 1ZGWA 4NTSA 3S8PA 3D7TA 2QCSA 1VI0A 2I0EA 4DF3A 2IS4A 3I4NJ 4KA3A 4FIHA 5M06A 2F4IA 3DPKA 3UC4A 1YHQI 3GX4X 1OFCX 3G1OA 3S2HJ 4BIBA 2C69A 4DA5A 1Z7UA 2BVLA 2G7UA 4AACA 2OI4X 1O6YA 5CXHA 4PDKA 3K5UA 3FXRA 4JYKA 2QLQA 4BDDA 1TWAJ 2F7XE 2ITQA 3KVXA 2VGOA 5E91A 5GIPE 3PY0A 4LOCA 3TJDA 2HOEA 1KQ0A 2C3JA 1D5VA 2DK8A 5K7FA 1H1QA 1V5FA 1R5ID 1FGKA 3BX5A 3PTGA 4XK4A 2X4HA 4O6EA 2O9LA 1K7AA 2C3KA 4A3FJ 4XLVA 3BLHA 2JAMA 4OTFA 2GIZA 4FUXA 3ZMDA 2ZDUA 2HOAA 3IH3A 5DOSA 4ZTLA 5A2QK 3FIWA 4WRGA 1Z6TA 4FX3A 3GVAA 3A0HC 4U0VA 4KINA 3TCPA 4KIQA 5BUIA 1EH7A 2BTRA 3G0EA 3P9JA 3KIOA 3RHKA 1RC9A 4J97A 2W5HA 5DRDA 4BY7J 2LKPA 1JPAA 1DGRM 3C0HA 4TXCA 3OW4A 2PQ8A 3A7IA 1GOLA 4LQMA 3IV5A 5CSPA 3QQFA 3BYVA 3OIOA 2YDJA 1ZMUA 3HSFA 4I94A 1H0MA 4HV6A 1HQCA 5J3LA 3DFAA 3TYKA 2Y48A 1U8BA 2PUPA 5IMXA 1R49A 2WOTA 1H00A 5IG1A 4TW9A 3F23A 2QSFX 2Z33A 4Y95A 3R2BA 2Q2EB 5DT0A 4DC2A 5L2WA 4JG7A 2GQQA 1RDQE 4EK5A 1SMTA 2WBMA 3KCCA 2PG4A 4ERKA 1Y91A 2PE2A 4ZSEA 4O0SA 4RGXA 1R0PA 3HGYA 4TWPA 4N9IA 3LMGA 4ZDOA 3D14A 3O8UA 4BDKA 3HRTA 5FD5A 1TWHJ 3W6VA 4USFA 2YX4A 4U44A 4FVQA 2F5VA 3R7VA 4GL9A 4IX4A 3NWTA 3S32A 3BZ6A 1SFUA 4LMNA 2E9UA 2C6DA 4U8ZA 4HVDA 5FGMA 3EQHA 3K2LA 1JQHA 2GMXA 3COAC 1K61A 2HXLA 3FMLA 1J0RA 3MY5A 3ZCOA 4FKTA 3C13A 3V5QA 4V2GA 2K5CA 4AXCA 4IQ4A 2XF7A 5AP0A 3V8LA 4I09A 4OR5A 3VUKA 4KN4X 2JWTA 5JLWA 3V7RA 4DEDA 5IQHA 4I0RA 1Q8UA 2F7EE 4X21A 4FEQA 4F0FA 2FNAA 4YGAA 3UO5A 2CJJA 1ETOA 1B72B 4C38A 4FZ6A 5FP5A 4AZVA 4MKCA 3VBQA 4E1ZA 3PJRA 3SXRA 4M8TA 1F5QA 3W0NA 3JS2A 3NIEA 4BCNA 4JG6A 4BJJB 1Z91A 5IISA 2ETMA 2EPFA 1FJLA 2LH9A 5KE0A 4GIHA 5GNKA 4QSHA 3QLFA 2VWVA 4FTTA 1ETQA 4HAMA 5M5XJ 4E4XA 4BCMA 5DV5A 2VTPA 2K9NA 4I24A 2FX0A 1FMKA 2HK5A 4I6BA 1W7PB 3OCBA 1B39A 4C59A 1FOWA 2IPXA 3OCTA 3AD5A 4L7SA 4YC6A 2ACJA 5HG8A 1GDTA 1RR7A 2BROA 2HDWA 4XL9A 4O27B 3FZPA 3ZXZA 3O7LD 2P55A 4BI0A 3M8FA 5LVPA 2C47A 2BFXA 1SD7A 5I9XA 4IHTA 4D4VA 3P08A 4I0TA 2FSTX 4NB5A 2XDVA 1LFPA 3BG5A 2WB8A 4MQ9F 3D7ZA 5F9EA 2WXVA 2YU9J 4G3EA 3HKZA 5EZHA 2PL0A 3L1SA 3Q9WA 4O7SA 2WTCA 1UV5A 4QTDA 4GSBA 3I54A 3OS2A 4AC0A 4CCUA 3UIXA 2QSGX 5EI8A 4LB5A 4E7WA 1WCCA 1BI8A 3PPZA 1BX6A 5LRRA 5CAQA 5CVIA 3PA3A 4EMSA 3ZQCA 1GVJA 3KGAA 3FC2A 4WOVA 2CW7A 1SAUA 1WKMA 4JBOA 2X4ZA 5EFQA 5HTBA 4KN7X 3DCFA 4AYBA 2X81A 3KZIC 4ANSA 3W2VA 3D0SA 3ZQHA 2B0LA 1JKLA 2Q83A 2HS5A 3M4OJ 2YS9A 5HQ0A 2ZNYA 3OWJA 4MNEA 2OV7A 4XICA 3TNPC 2LNBA 2NS0A 2M9HA 4I99C 4E6CA 2Z1DA 4Z55A 4DBQA 3CGFA 3G2BA 5GJFA 4EHEA 1WJBA 5K5RA 5IT3A 2RIOA 2XF0A 1NHAA 1FWZA 3NVKI 4D9JA 4F0GA 2DU9A 1QZZA 4PMMA 3K2ZA 4HGEA 3ZMZA 1R5GA 3KK8A 2P4IA 4IJPA 5AV4A 3K0LA 2CG4A 3PSFA 3LFSA 4KKHA 3HPGA 1OCZH 2FMYA 4FL3A 2XK6A 4EI4A 5EQYA 5BUEA 5LVNA 2JC6A 4AZSA 2X2MA 1RESA 2ITPA 2VTTA 1IRXA 3UQCA 3TOBA 1DPUA 3C5UA 4CXFA 4F93B 1RW8A 3EIDA 2XROA 1RETA 1Z3XA 4U79A 1W36C 2L3DA 4B8XA 3RIRA 4K11A 2YCFA 3ZGKA 4IXAA 2DK5A 4MEYF 5LRSA 3GTMJ 1UNLA 2OA4A 3WGIA 2J0KA 3IP4B 3LFQA 3P7CA 4R3PA 2XMYA 3TNIA 2VONA 2CU7A 3QQAA 2A05A 5HTCA 5FTGA 3CCYA 3JRGA 3Q5IA 5TR6A 4RAGA 3ROYA 4ANMA 3PUPA 5DWRA 4NNJA 3KZYA 3VODA 2KIMA 3MFUA 5J8CA 2RFDA 4BZDA 3CCVI 2IW8A 5CAUA 2QU5A 4X1EA 3B8QA 4CQEA 1Z21A 1Q8ZA 4RA5A 3EQRA 1P2FA 5A46A 2A19B 4HG2A 2TRTA 4LYNA 3K70C 5EYKA 4BCFA 2QVSE 3ET7A 1DAWA 3T0YA 4U0WA 4BU2A 1Z9XA 3I0QA 3FWQA 1QNTA 1FSEA 2IEKA 3OSFA 5CAPA 3CJFA 5DEWA 1HCRA 5IP6A 3V8WA 4BYJA 4XLCA 3P78A 4E4MA 2J5OA 1CKIA 3PFQA 3MKLA 4M0YA 2KDOA 3WE4A 5HLHA 3QZIA 3M1CA 2CQQA 2QWWA 1ZRFA 4K77A 2W05A 1AWCA 3F8NA 4D4SA 1FOTA 4CZTA 1M2PA 5CLSA 3ORNA 4IB5A 5CZHA 4GG5A 1M2RA 2X0LA 4KT6A 5FBNC 2JKKA 2HELA 1YRNA 1T39A 3A7FA 5FFZA 3E3PA 3CMYA 1GUUA 4IVDA 4CKRA 3BU5A 2HYFA 2P8TA 4K2EA 1LUFA 2XB5A 1QPDA 5C03A 4RIOA 3J80K 3LNQA 2Z7SA 2X0GA 1Y39A 1TLHB 1UELB 4XP2A 2JIIA 3RPYA 5L6OA 3ZTXA 3S14J 4FV6A 2JDTA 1YX3A 2EFNA 1XH7A 3QRKA 1FOKA 2CDZA 4XS2A 3ZPLA 3SKCA 1H27A 1XH6A 4CCMA 2BVMA 2C6YA 5DHJA 4MX9A 3DB6A 3SHEA 4HPQA 2W1GA 2R5ZB 4V05A 4IVAA 4KS8A 4I5CA 4UUTA 2HCKA 4WXHA 2X4FA 1IJWC 4C4EA 5CSHA 3GEQA 4FTHA 1UWJA 2Y4PA 1EH8A 4A07A 4H3QA 1W5SA 4DFZE 4KT5C 3BPRA 3GU7A 3RVGA 1SANA 1H8FA 5E7RA 1S3JA 3ZSHA 4DEIA 3BLQA 3C1XA 1GIHA 4M97A 4CH7A 3GC9A 4EJOA 4OIPF 2YIXA 1OCCH 3BU6A 5HS7A 1U9OA 2JVGA 2R7RA 2EUFB 4YSMA 4ZDLA 3IDBA 5J8FA 4KSQA 3ZS5A 1UU7A 3FLZA 3KREA 2NP8A 2JA8J 1O4XA 4YELA 4AZTA 4Q4ZF 1OJLA 4P7EA 2CGPA 1DUXC 4FNWA 3HOUJ 3BLRA 3UIBA 4FV2A 2PPQA 3PY1A 3QQKA 5CU3A 2XUBA 3ERED 1H28A 5CNNA 3DNEA 5H20A 4BS9A 5KUPA 2CGWA 4JX7A 4BXFA 3WOWA 3GTJJ 2WFYA 1G3YA 2PZYA 3FMHA 3R8ZA 2G0EA 4XSXF 3I4PA 3EWHA 4NTTA 5BMSA 3NWWA 1YJWI 4DT9A 4C2VA 5JK3A 1GXQA 3L1PA 1U3EM 5M44A 2B52A 2OXYA 3EQGA 4HX8A 4RDUA 2OAZA 1LDDA 2E9OA 5C3EJ 3VSLA 3L2RA 4QOXA 5ANOA 2YCRA 4QWQA 1ZR4A 3DBCA 4XMOA 4R7BA 3DKFA 3F69A 3N05A 3I59A 4KKGA 1B9NA 4U45A 5M57A 2E9NA 5EW3A 3H9FA 2J90A 2H6BA 3OYLA 1IN6A 3H36A 4UUSA 3WTUC 2NO3A 4WG3A 4G3GA 2WU6A 3OY3A 2CKEA 4YR8A 4PL5A 1Z57A 4CLJA 5KMMA 4BHNA 4AOIA 4GK2A 3OS0A 3MPTA 3AT4A 2YEXA 2V9PA 3AKJA 4U0YA 2B9JA 4R7HA 4RMNA 4O7TA 1NG7A 2O6GE 1W5TA 4NJ3A 1X3ZB 1Y8RB 1WH5A 4DG3E 4CZZA 4F92B 2Z9OA 1TQPA 3TKIA 5C4LA 4ZYAA 4C02A 3KRJA 2JSPA 5A4LA 2DN0A 2VO0A 3G4SI 3GBZA 2OBPA 2PVMA 5CT7A 4TYHA 2XSJC 4AXEA 1UU9A 2HOSA 3RNYA 4E20A 1J75A 3FDYA 3O5AA 4XN3A 4RBOA 5HBHA 1HW1A 1F9NA 1IXCA 3QXPA 5CANA 2HYJA 1WVRA 2FOKA 3LA3A 3S95A 1Q8WA 5DYJA 5HEZA 4FKJA 4BQQA 2OO8X 2OLCA 4FE4A 2DI3A 2BUJA 4U81A 2IGNA 3ASNH 4HVHA 4YHJA 2CLXA 4FSQA 2DA5A 3K3IA 2VTAA 5L2IA 2QQAA 3HDMA 4FKVA 4XP0A 2WMRA 4BCPA 5CLPA 3E5XA 1K4SA 3ORZA 2I0YA 4YJUA 2F2CB 4AN9A 3CSVA 3V7CA 4N4OB 2UUEA 3ZBFA 4EZ7A 1XGSA 1KE7A 3D5XA 3OCGA 3PZHA 2F2EA 3BLYA 3I3LA 1WSUA 4IM0A 4HRIA 3ZN0A 3LVPA 2QI8A 3Q9VA 3ORXA 2HQNA 3A99A 1VQNI 1R7JA 2LY2A 4CRLA 4OIQF 2BHYA 1X2MA 4RAFA 3LFNA 4EQMA 5CENA 2W48A 2DA4A 2QR7A 5BVWA 4I93A 1QBJA 1OKYA 2FSWA 5HNGA 1O57A 3W0PA 2WGJA 3PA5A 1JKKA 4TZRA 1WJFA 4FKRA 5DGZA 1K3AA 3QPSA 5D9HA 3NFGB 5B5EC 1OZ1A 4A5NA 4A3KJ 2OXDA 3CJQB 2VX3A 1DP3A 3LPBA 4EEVA 3HKZN 3FMKA 2E1MB 3FXOA 1L3LA 5CZIA 1HKTA 2W9FB 4PWNA 5EGOB 4MK0A 1LP4A 3KP6A 3E6DA 4H1JA 4RVKA 2B9SA 3KCKA 4X2KA 4ZAUA 3GXLA 1TT5B 4RGJA 2SRCA 3CLQA 2VTOA 4FG8A 4IOCF 5J40A 1YDRE 2J5FA 3F3ZA 2R3KA 3DF8A 4L3JA 3F66A 2F4OB 4XG6A 3AFHA 4Y8DA 4BAYA 4XCUA 3OBJA 2L9VA 2JDSA 2BR1A 5HDGA 4BDIA 4NC6A 5FLXK 4AYBN 5C9CA 1ZRZA 4ESBA 4EQUA 1VZOA 5EM7A 1SVOA 1LJ9A 5AAGA 1VQ9I 4FMQA 3OOGA 2VV9A 4EWHA 1XMKA 1XJDA 2GQGA 2Y9QA 4NYEA 4A4XA 2CS3A 4YMJA 2BCJA 3M8JA 4EK3A 5IQIA 2W17A 3SAYA 5FXRA 4E7KA 2W1FA 4PJLA 3AGMA 4YURA 1A04A 2UXNA 3MTLA 3FQEA 3F7ZA 3PDTA 4JS8A 3B02A 5K7ZA 3RM7A 3Q6UA 3UZTA 4MD7E 1D1AA 2A4LA 4IVCA 4AW1A 3ABTA 3QXOA 4IOAF 2DAOA 1TKIA 3GI3A 3WIKA 5CVUA 5LEKA 4TYEA 4AZWA 2LVSA 3X2QH 4XG4A 4N6ZA 2BDWA 3ZU7A 1BBYA 2A68F 2EZHA 4AN3A 1VFCA 4EGYA 2R3MA 4KABA 3Q9YA 1HOMA 5A6NA 4O5VA 1Z77A 4BNCA 4XBRA 2QODA 4IJAA 3QCXA 3R04A 1YJ9I 2HZ0A 5IP9J 3QF9A 3ZO2A 3TQNA 4YO6A 2OF2A 5DCMA 1S29A 1K78A 3P1AA 1Y1WJ 4XORA 2BRMA 1S7OA 1BI2A 2IS1A 2A2AA 2CCIA 2V62A 4MHAA 5DM6F 1WRJA 4X3JA 1Q61A 1GAGA 4G17A 1KA8A 1IDZA 4XLPF 2ZSHB 1VEBA 2ZOQA 3ZEWA 3Q9ZA 4ZTJA 1Y8GA 3BWJA 2QZ8A 2B7AA 2W00A 4BTKA 3ZLXA 4L67A 1BC7C 4C58A 4BYYA 2PN6A 4X3FC 4Y3OA 2WMTA 3IHUA 3Q4ZA 2XSDC 2HQAA 2DS1A 2R3GA 2XKPA 5CEOA 2ERKA 3DY7A 2QYOA 3VSKA 2BW3A 5CYIA 2ME6A 3UO6A 3IW5A 4JI9A 3TI1A 2GTMA 1QPMA 4QYFA 4NK9A 3ZO1A 3CTJA 2O65A 2VPRA 2FSMX 2VLAA 5JFXA 2HXOA 3E3VA 3MI9A 4DNCA 3MKWB 3DNDA 4XUFA 3P7NA 4MXCA 3R9OA 4XLFA 3M7GA 3CJGA 4FK6A 1VNDA 2XALA 1MIJA 3DPLC 2FBKA 3FXWA 4TYJA 2V7AA 3F7WA 2DJIA 4JBPA 2R5YA 4JAJA 3GU8A 4BBRJ 4IHPA 2VTLA 4FGRA 2PY3A 4M67A 5CQUA 3HRBA 3DWLE 1B1BA 3J81K 1K9AA 5GJDA 1J5YA 3WZEA 2XRLA 2W1EA 1KE9A 1G8KA 1GIJA 2DW4A 4FTUA 2HTJA 1FOXA 2AQFA 1EF4A 5AUVA 3MTFA 4WG4A 4KA4A 4IWQA 5DA3A 2M5WA 3BYOA 2WB1A 3NUYA 5IUHA 4W1UA 1RUNA 2OJGA 3QHRA 1YXXA 4RA4A 3R60A 3RK9A 2XIGA 4FNXA 1SFOJ 5G1XA 2FQ4A 1QPIA 3KF7A 1TVOA 5CYVA 1VQ5I 2C5VA 2J0JA 4BKXA 4X7QA 2LAVA 3S3OA 3GTOJ 5CKTA 4ZH4F 3IOPA 3WU0A 4WUNA 4BCQA 3A03A 1LE8A 3EDPA 4WXDA 3QRIA 4HYEA 4L52A 2YZAA 4GT3A 1YITI 2LRDA 3TW6A 4C9YA 3V8SA 4WX9A 3IKTA 1LB2A 3HMPA 1MJAA 1MSEC 2Y4IB 4DW6A 4M6XA 3WHCA 2MYSA 1W0UA 5CWZA 4O21A 5AFVA 2LYCA 1S9HA 1K6OA 2P6SA 4EJTA 5L6WL 1NT2A 1WBNA 5AIPA 1DU0A 2CV2A 2B7EA 2XCHA 5ANGA 4ALUA 4F7LA 2KRCA 4L42A 3DAJA 4JAIA 5HG5A 4JJRA 3A4PA 3G71I 3A01A 2RNJA 2VBWA 4M15A 4XLHA 2CN8A 4WK8F 4QMSA 4IQJA 4TKSA 3HRUA 5CAVA 3WIGA 1YI4A 3K9TA 1UU3A 2QU6A 3FMMA 4DTAA 2BE5F 3J7AY 1H1PA 4DH1A 3MCZA 1KGSA 3HRMA 1AKHA 3S4QA 3MVMA 3G1LA 3ELKA 4PF4A 5FEEA 2YA9A 5J1VA 5ETFA 4MUQA 4C37A 1PP7U 2H1KA 2XCKA 2F5DA 1Q24A 3QLGA 3QL8A 3DJ5A 5J6XA 5EEGA 3OS3A 3FZRA 3DPTA 4YLKA 4ASEA 5HNIX 5DT4A 2VNYA 3LFCA 4PY1A 1P4AA 4L0ZB 2PUNA 1S9IA 5TISC 3BTLA 1PKDA 2GQRA 5FO5A 2EFOA 3IS5A 3LAUA 2ZFWA 3HSEA 3OYAA 3GFWA 3U1DA 2JQ7A 4RM3A 5AAFA 1CMKE 5AMNA 2RFSA 3QU6A 3CP9A 3TDWA 4DEEA 3TKYA 2DCEA 4XG3A 4MTDA 3R1NA 3U6JA 4A3DJ 2CGUA 3P4KA 4LK1F 5ILSA 2ZV9A 3E3B