3TMOA

The catalytic domain of human deubiquitinase duba
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
141
Chain Sequence
AARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Phosphorylation-dependent activity of the deubiquitinase DUBA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords OTU domain-containing protein 5
total genus 33
structure length 141
sequence length 158
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tmoA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tmoA01
3TMOA 3PFYA
chains in the Genus database with same CATH superfamily
4HDUA 4FX0A 3BHUA 3EUHA 3LSGA 5FDPA 3IW6A 2VKVA 2VTNA 2I10A 1MP8A 3NIZA 2AQFA 4OTGA 3LNQA 4O38A 5LWMA 2NP8A 3GO5A 3V8KA 5JFWA 2YM8A 5K5XA 4LMYA 3AG4H 4BTJA 3POOA 3R0JA 1FBNA 2FMLA 5I9WA 3HXLA 2FSLX 4ZTQA 1RRJA 2UZNA 3Q4UA 1ZH5A 5CPRB 3TV6A 4M3EA 1X1BA 1FMWA 3GU8A 2MC3A 2XEZA 1ZYRF 5CVGA 5EK7A 5C26A 3KK8A 3DFAA 3CCVI 3PJRA 1AGWA 4G6NA 4B9DA 1WJFA 3BWJA 2Y2ZA 3KN5A 5EHOA 4CT1A 2GCDA 3L2QA 3FXQA 4B4LA 1OLTA 3OBGA 3QYZA 4BHCA 3ZMTA 4B44A 4JLCA 3RNYA 2CSNA 1FVTA 3LMMA 3JCUC 3JRGA 2EUFB 2MD5A 3PFYA 2NVUB 2HTSA 3LFNA 1BC7C 1T2KA 1ZLKA 3BEAA 4LJZF 2DYSH 3QYEA 3AGLA 4IM2A 2XGEA 1HSJA 2P6TA 3IGOA 3GFMA 4TYHB 3D9VA 2CLQA 2TDXA 4FX3A 3CMEI 4EH6A 4HNUA 4AU8A 4CZUA 5GJDA 3LFKA 4DHJA 1W7PD 3WARA 2GHGA 1XB4A 4G3DA 5D5XB 2YR2A 4KIGA 3OUKA 2PUNA 1QVUA 1GVDA 4EI4A 2FA5A 5K9IA 4WO5A 3CCRI 2X7OA 1Q8TA 5I0BA 5JZNA 3C4WA 3F23A 1H08A 3GFIA 4CEGA 4XG7A 5FKOA 1R1VA 3IW4A 2PYWA 2MLKA 3PXZA 2PMZN 1A48A 3I0TA 1J5YA 3MA3A 2IVVA 3ZC6A 3M07A 2X81A 1FINA 1GIHA 4RJ6A 5JFVA 3W0QA 4M12A 5AONA 2W84A 4YP8A 1NW1A 4AS0A 2GDOA 4YBKA 5LMKC 5JI6A 2DDBA 1LEAA 2OQGA 4BCPA 1LB2A 2DA6A 2X4FA 3CR0A 2EILH 1RZ4A 2E9VA 3VW6A 2BFYA 4FV5A 5I9YA 4EV0A 4IAZA 5J7HA 4HX7A 5J1WA 2OICA 4H3QA 5CU0A 3U8WA 3L2UA 1U4DA 2ESMA 1HBXG 2VTSA 4II5A 5EEHA 4XYFA 1B59A 4EK5A 2YIQA 1YX3A 2JVHA 2M7BA 1DGRM 1CQTA 2F5CA 3UPXA 4E6KG 5GIOE 2VJ4A 4YJOA 5J1YA 1VQ4I 3C9WA 4PL4A 4YHFA 3O0GA 3DEWA 1WVXA 4DG0E 4ZLOA 2WA0A 3D5WA 3Q32A 2KKOA 4EC8A 5IA1A 3NWSA 1W98A 1WQ2A 3R7UA 3VWBA 3RZDJ 3SAYA 3O51A 4BCJA 3SHFA 3KEQA 3FPQA 4BY1J 2L7MP 1E3OC 2R7VA 3NYVA 1P2FA 5M07A 2VBXA 3UTOA 4JJRA 1TNSA 5C4XJ 2AO9A 2PJRB 9ANTA 2LYCA 1K6YA 1ETXA 5DM7F 4Q9SA 5C4KA 4RM2A 2DOFA 2PLYA 3L9FA 3IQ7A 2KP6A 3CLOA 4GFBA 3FMMA 3VS3A 4DYQA 4DCAA 4O27B 2VD5A 3DBLB 3TZ9A 4XP2A 2QLQA 3FKIJ 3LSJA 2WO6A 4I22A 3TNPC 3ULZA 2MW8A 2LP0A 2WMBA 4I0BA 4QP3A 5BVWA 1F5QA 1YXVA 3JTGA 1FNNA 4UB7A 3Q5FA 1WJCA 2VWZA 4X2NA 2G15A 3BJ6A 5C1QB 3R71A 2EFWA 3DBFA 4DEAA 3K3JA 3ZMUA 3DBDA 1OI9A 2WB1N 4I0AA 3B73A 4P1WA 1WVYA 2QZ8A 3EL8A 3P5KA 3KXGA 4OLIA 1USSA 2M30A 2Z5UA 4IX4A 4I7HA 1JT0A 2C5VA 3R4KA 2ZDUA 4H0EA 2WY7Q 2ACXA 2VN2A 1D0XA 4XV3A 2R0QC 2KL4A 2C5OA 2P0WA 1QZZA 1W36D 1VR2A 3GU5A 1J7IA 4AXDA 1Q1VA 5KMNA 3KXZA 1Y8RB 4F63A 3Q60A 4H1JA 4XRSG 3G2BA 1I44A 3KB7A 2PVRA 4QPQA 4CRLA 5KMIA 5KMKA 4PDKA 4F08A 2CMPA 3QTZA 4XLFA 3UZPA 4B8MA 4C3JJ 3ONQA 3RINA 3F21A 1GY3A 2HGCA 2CMWA 4WUNA 2PJRA 4UXLA 3CQUA 4U41A 4RGSA 3RPYA 3F5UA 4TW9A 2A5WA 3G1LA 3I4MJ 1JQHA 5EYKA 3V7CA 3HSRA 5CU3A 3BP8A 2EFNA 4RIYA 2L5QA 4DBRA 4RS8A 2VWBA 3S15J 4BAYA 4F1TA 3U2RA 2OD5A 2J7TA 3D5LA 2WTWA 1UVRA 5EG0B 5M4CA 1FP1D 1V55H 2YCRA 5ETCA 2P33A 3FZVA 5FD6A 5HVYA 4BDBA 1S7OA 4BN1A 4A3FJ 4UWCA 3FK7A 5C27A 3QTWA 4KS7A 4KA4A 3BGZA 4BE1A 1TWAJ 2VBYA 3PNVA 3TDWA 4XRFA 4CCJA 4PJMA 2ZMCA 3BOQA 2QC6A 4E5AX 3QRIA 3BR0A 5FTOA 4GK3A 4FTOA 3F61A 1P7IA 3HKZN 3TZ7A 3E5QA 1D5YA 3JPVA 5IP6A 3JR1A 3ZRKA 5DBXA 4AN9A 3I64A 5D1JA 4L7FA 5AIQA 5AA9A 3VS7A 1VJYA 1XCBA 4S0HB 4WUAA 1YHWA 1YXTA 3B2TA 4FT3A 4XMOA 1LJ9A 4GDFA 4NM5A 3LMIA 2B52A 2LY2A 1ZARA 4EYJA 1BBYA 5TJJA 2OI4X 4IKFA 2VU3A 1TBXA 3GTMJ 3T9IA 3V5TA 5IOZA 1EF4A 3MV5A 3R8ZA 4ITHA 5FDXA 3VUDA 4RIYB 2KIQA 3OV8A 2VC1A 3BZCA 4EJOA 5FLXZ 5CEIA 1X4PA 2BHEA 4DE4A 4EBVA 5TF9A 3SZGA 2YACA 1PMEA 4AFJA 4YZBA 4O6JA 1ZXEA 2W9FB 1BMKA 3R8VA 2Q8KA 3VVHA 2MG4A 4UWYA 4YBJA 5DN3A 2HOAA 4KRDA 3QZIA 4ZDOA 3D15A 3TNQB 4S34A 3BCBA 3S2PA 2A6TA 2GQRA 5CT0A 2E9NA 5AP6A 4FIIA 3OYJA 1SFXA 2HCKA 4FSWA 1FQ1B 2QQAA 2IZUA 3GMEA 1U8RA 2E5ZA 4X3JA 5AX9A 1KQ8A 5CF5A 4FTTA 4BEHB 4IFCA 1JUMA 4DFXE 4RG0A 4LD5A 4RX5A 3W16A 1HKQA 4A0XA 4IEBA 2ZJWA 4E4XA 3TL4X 4EGYA 1CM8A 4XP0A 1UAAA 4QMLA 2HOEA 4A9YA 1TQMA 3F9NA 1SMTA 4M9ZA 4M3GA 5KCMA 4QWQA 3TUBA 4LDTA 3ZQHA 5H6QA 3LFSA 2XK4A 4RJ5A 3ITZA 2YN8A 4G5PA 4O2ZA 2X6XA 2PSQA 3BL7A 3B8RA 3F8CA 5DR6A 4ZYDA 1Q62A 3CLYA 1B8IB 4EYMA 1LVAA 1W36C 3P5JC 3NS9A 2XK9A 3QX2A 1TWFJ 2HZTA 3C4ZA 3K69A 2I0HA 1M14A 3LJ0A 3ODZX 4IHSA 3TP3A 3P7NA 4YC3A 3MFSA 1QPIA 2P55A 4MTDA 2XP2A 2QLZA 4RJ4A 3GT8A 4HSRA 2DXIA 4P5OA 3DOGA 4KINA 1Y8GA 5EH0A 4DHIB 4FZFB 2J5EA 3VS5A 3BYOA 2V22A 3O23A 4HDVA 1A6QA 3QX4A 3OSGA 2X1DA 5HGIA 2UZWE 5CSWA 2Z1DA 2I5UA 2VIXA 3BG6A 2VO6A 2ZXJA 3RIRA 3S3IA 2IO6A 4BTMA 3OYGA 4JQ8A 4FEQA 4R3CA 3T0YA 4BQOA 4AN2A 3C2HA 1MNMC 2GXBA 1WI3A 2W57A 1YRPA 1FWZA 2R3IA 2IGKA 2MABA 1DAWA 3RCOA 1R4MB 2P4IA 5IP9J 3V6SA 2ZFYA 3OYEA 2DT7B 4I41A 1MBGA 3IK3A 2V26A 4UYNA 1S6LA 2XCHA 1VQ9I 3GCQA 2C4GA 4Y5HA 1B8IA 4N6YA 4BBSJ 2HTJA 3KC3A 4HNVA 5LVMA 2ETMA 2YM5A 2V55A 3OCBA 3PA5A 5ICCA 1ZGWA 4CHUA 3NRMA 1LKXA 4M9XA 5IYBJ 2YX7A 3IWZA 4MXAA 3DPKA 1WCMJ 4N4SA 4YLJA 3AFHA 5J6XA 3ML1A 3TWJA 3FQEA 3EFWA 4HA8A 5FRNA 3OOGA 4QYGA 3CMMA 3G3ZA 4ANSA 3CKXA 3CDIA 2GNGA 2NRAC 4HGEA 3MKLA 3AMYA 1TL8A 5IEYA 3WF9A 3GF2A 2RVCA 1VQNI 1OYWA 4MBIA 3BWFA 2QO9A 4BGQA 2DLLA 4ON0A 2ID3A 2EBIA 4EJ7A 4NC7A 2PI0A 2QR8A 1TWCJ 2JD5A 2DBBA 1DP3A 5IT9Z 4JBOA 3GBGA 3EFLA 1X58A 2JT1A 2TCTA 3PIXA 1T0FC 3R9RA 1U9NA 2J0IA 5AV0A 3D5RC 5CALA 3J7AO 4YTCA 2L9SA 1YOMA 1Q97A 4RC4A 3FXZA 1RNLA 1Z9XA 2WAJA 4UZHA 2I8DA 5BYZA 4AGDA 5HVKA 1O3QA 4D5KA 3KZIC 3QGYA 4O0VA 5J40A 3RPRA 3EYYA 1JKSA 2JSPA 5M56A 4D5HA 3M8FA 1VLRA 1WBNA 4U6RA 3OY3A 5ANIA 3HOWJ 4EOOA 2CH0A 3DPUA 2HDCA 3TCPA 3BI6A 1LE8B 3T3VA 3ZQQA 4RZWA 3HP5A 3VUMA 3PRIA 3V4GA 2DA3A 1B9NA 3EWHA 4I6FA 4IAAA 3HPGA 1G59A 1Z3XA 1SVLA 4WHZA 3B6AA 5GAHJ 5BOXA 3RTRA 1R1TA 1YWVA 3F2AA 1KU3A 2XANA 4GK2A 3REOA 4B48A 3KLNA 1IR3A 4FEXA 2J9MA 4K11A 5KVRA 4NUBA 4RGUA 2E60A 2XRWA 4AYBN 5KHWA 4MFDA 4EJTA 3BC8A 2GS6A 2QOIA 3OS3A 5CVJA 3FLYA 2W4OA 1VQKI 4O5VA 4XHKB 1R9TJ 3PQJA 4XSXF 3RQIA 3BYSA 2OQRA 5HNIX 2EV0A 3TV4A 4UY8I 4QPSA 3Q04A 3HECA 5DH3A 2L7ZA 4L9NA 5K7HA 3WTSC 5ANJA 4MHGA 3VJOA 4CLJA 4FSNA 4NM7A 2E1NA 4J00A 1IRKA 1WJAA 1SVOA 3QCXA 3W2CA 4MKCA 1UNLA 2IWIA 2VTHA 3UE4A 3UNGC 3PO2J 1F3MC 4L46A 4W4XA 3CPCA 4MXCA 4A6EA 2J6MA 4DLIA 2WQOA 3E5XA 4DF3A 4EHGA 2P5KA 4YC8A 2G0EA 4ZJJA 5AP2A 3H3CA 1OIUA 3VDXA 5FD5A 1QBJA 2I0VA 4B47A 1H0VA 3O8PA 4GT5A 2M87A 2QWWA 4IC7A 5JFSA 3OR1C 2GQGA 3LM5A 4M3QA 2JBPA 5AADA 3ZLSA 3FMDA 4E4MA 2PVMA 1XMMA 1NTCA 4LOCA 4CKJA 3E3PA 2PMZA 4KISA 2VTJA 3TGNA 2HY0A 3W0NA 2LD5A 4OT6A 4EQCA 3OWLA 2QOCA 2DA4A 4HZSA 5DUIA 2R7XA 3BE9A 1KE9A 3L8SA 3UC4A 2BRNA 3R1QA 3SXFA 4AZFA 3JAMZ 1SMYF 1FTZA 4XG3A 3O3KA 5DD4A 2IS6A 5L3BA 4C34A 3I56I 4TWPA 3RNIA 1KGSA 4ASNA 2CNUA 1WBTA 3CD8A 4AZWA 3FMHA 4N0BA 4XG4A 4RAFA 3GLXA 3W2AA 2R3NA 2VOOA 5A9UA 4I99C 4GYGA 1RKWA 3QHWA 3QU6A 3MKYB 3K4CA 4B3XA 4L5IA 4AU7A 3PA3A 1WZYA 4P96A 3OYAA 1FYMA 3NGAA 2OPTA 4KJZA 2FBKA 2R3JA 3E87A 3Q9ZA 5J9ZA 3W1FA 1RE8A 4FTQA 2DTZA 2OUMA 5KNLA 1MH3A 4O7RA 2F7XE 3I60A 4JK1X 2QENA 2Q83A 5L3EA 2Q0NA 4FV6A 4O7LA 5FKNA 1MMNA 4XBRA 4A2UA 3RHKA 4YHJA 3K2AA 2CGPA 3NNVA 2VWIA 4FIEA 2Z3YA 3U6IA 3CQZJ 4KIFA 2E19A 4JP0A 4RA2A 5B2KA 3ORPA 1AKHA 1UJ8A 2FO0A 2ZV9A 3HL2A 4II3A 1XHAA 1MRUA 2QR7A 4YTFA 2CUZA 3ID6C 1N77A 4J8MA 3QTIA 5AUYA 4NW6A 4PL5A 2F49A 2XNEA 3ZZEA 2E2BA 5DCFA 4I5CA 4Q5HA 4FK6A 3E64A 3V51A 1YI4A 2MFZA 4E7JA 3KRLA 2C6IA 2IN6A 4MTAA 4U0IA 2BZKB 3PNYA 2DI3A 1SFEA 3Q0WA 3E88A 3HSFA 3DU5A 2PPQA 4O6EA 4O96A 3C4FA 4HPUE 5C44J 3A8XA 1HQCA 5E91A 4DH7A 2XGDA 3ABTA 4O0WA 3P0MA 2WV1A 5TKDA 2K3PA 5CVFA 3SC1A 4IE9A 4DEEA 4MXOA 3K1MA 3S16J 3EN4A 2XM9A 2UZVA 4KIOA 4AOTA 1GOLA 3QQUA 4L0ZB 4LV5A 3R28A 5D7VA 2XV4S 5GHVA 3HUGA 2VKDA 2C47A 5F1RA 2X9FA 2W5AA 4J71A 4A5MA 1BI7A 1KOAA 1SEUA 4Y85A 1D3YA 3EKNA 4AW5A 2Y0SA 4RVMA 2EXMA 5DFPA 3H5RA 5ANEA 1RKTA 3ORTA 1J91A 2QG7A 4YO6A 4I6HA 3RWQA 3TW7A 4ID7A 5EKOA 3IKAA 2BVLA 1S3JA 1WBOA 1OZ1A 3GFLA 1ZRFA 1OVEA 3EQRA 1OM1A 2RNGA 4E26A 4ZZOA 1K4SA 4BS9A 2VNWA 3HDMA 1NT2A 4JX3A 5LVLA 4MXXA 2OK1A 2JA2A 4J01A 3C51A 4R5YA 3KP5A 4F55A 1YX5A 3ACJA 4IEJA 5L6OA 5IA4A 5HTBA 3GLLA 3MEXA 4NM0A 3UZRA 4FC0A 4IVDA 4GKIA 1VF9A 3WTXC 5DD8A 1JBPE 2DYRH 5IMXA 5IPAA 3NAUA 1XBBA 2R5TA 4ITIA 1IV8A 3ZMVA 5L8JA 4UZDA 4F3QA 2W4SA 1J9IA 5M51A 3LWFA 4K2RA 4FKPA 4C37A 2ZNYA 5L3DA 2CUJA 4AOIA 4MBLA 4Y73A 2QM3A 3HX4A 2PZPA 5CU2A 1H9GA 4IDVA 3ZDUA 1W7PA 4PNIA 1U5RA 3O96A 2E36A 1YHVA 2Z33A 5IEXA 3MW1A 3LQRA 1OBDA 4BKJA 5L3CA 2OV7A 2X51A 4W8EA 4EWQA 3VWAA 4U44A 4HRIA 5DT0A 1XMLA 3R1SA 5EG0A 5EHYA 4HGLA 4QRCA 4X6QC 4WNOA 3MA6A 2XPUA 2BRMA 2JMWA 4R7HA 2GXAA 3V42A 2HY81 4O86A 4BZDA 2O0UA 2HAKA 4FV1A 2EVAA 3HB9A 1XH8A 2HXQA 4BYJA 2PBIA 2XBJA 4U0VA 3FZSA 1XSVA 3BBWA 1HW1A 2X6DA 2RNJA 2PUIA 4E4NA 1OKVA 1YJNI 4IXAA 2C5NA 3ANQA 3HRMA 4BRXA 1X1DA 4BICA 4GIIA 4GW8A 3FJQE 4E4HA 3W2OA 4AG8A 1FVRA 5JFXA 2ERKA 2J50A 2G2HA 2BY1A 3RALA 4I5MA 3R8LA 1VYWA 1HA8A 4F64A 3TP0A 3BU3A 2EFPA 2AXLA 5M57A 3VUKA 2RGPA 4RT7A 3QP5A 5AUWA 2E1CA 2X9EA 4G8XA 1H88C 3S1RJ 5HBHA 4Y72A 4DBQA 3GBZA 2J5PA 2PMLX 4KFCA 5BNGA 3W0OA 1CKPA 1H27A 3B6CA 2XB5A 2J51A 2OFUA 4FVQA 2V4JC 4MAOA 3CJFA 3E5AA 3OMYA 3ABKH 1EJ9A 4AUAA 1IG1A 1RIOH 4IVBA 1MMAA 4UEUA 4AXCA 5K4IA 3OS0A 4LGGA 3QD4A 3RK9A 4OU0A 4FICA 5CZIA 5AP7A 3T5XA 3C13A 5IUIA 4MQ9F 4MQ1A 3FBIB 3UG2A 3K4JA 4GU9A 3OYDA 4GFOA 3W0PA 4YGAA 1EKEA 4CUGA 3ZOSA 1X1CA 4AOJA 3D5VA 3L8VA 5CSHA 2EIJH 2QEXI 3KGAA 3IDPA 4UHTA 5HODA 1C0WA 4DH8A 3FXWA 4C38A 2OTLI 4FX4A 1AWCA 4KUMA 1W0XC 1QPMA 3M1EA 3CTJA 3EZVA 1HC8A 4DGLC 2WMAA 4FKRA 2KJCA 5CWZA 4FKQA 5FBNC 3LFAA 2BIKB 4K6ZA 5HTCA 4U7BA 5IDPA 1LFBA 5JGAA 1SYKA 3DKCA 2ZKZA 2JKKA 4ZEGA 4UUVA 5HG5A 2VXDA 2C6DA 5FG8A 2KPMA 1IF1A 3F8BA 3NYNA 2YM4A 5E9EA 4G3GA 5DG5A 3QQGA 3ZO2A 3C1XA 4QMZA 3BG3A 1F0QA 5LVNA 3FQHA 4JDIA 1T6SA 3LXLA 3ORMA 2X7GA 3ZDIA 4LQMA 4IHWA 5BMMA 1X8BA 5LRSA 4U87A 1OCRH 1MGTA 2O3PA 2DA1A 2ITYA 3QCQA 2Q1ZB 5K7ZA 2RDPA 2AUHA 3S2WA 2P5LC 4M71A 1Z6TA 4NFNA 1V3FA 2P81A 3E63A 1R49A 4MEXF 1FMOE 2BRGA 1Z0XA 2BBYA 1PXMA 1MMDA 2EK5A 4UVBA 2ELKA 3MZYA 3LFEA 2EPFA 2K85A 5A4CA 4BDDA 1XCVA 1YRNB 2YAKA 4ZMFA 3MQ0A 5D12A 1HOWA 3BT9A 2P7VB 4GG7A 3M7GA 3KRXA 3PLAE 1LPQA 1IN5A 3B8QA 3L8XA 4BHZA 4QYHA 4KT6A 3FYKX 1OL6A 2XM8A 3F5PA 5L2IA 2GZWA 4IANA 1VYZA 2OAZA 3EHAA 4RWKA 4CZCA 5EI8A 4KYWA 4I6LA 2WV0A 3F72A 2DT5A 1R0PA 3HUGB 5EW9A 3GC7A 4V05A 4YHTA 3ZS5A 3EL7A 5CF8A 1RR8C 3DEEA 5HE2A 4PP7A 4XM3A 3RDIA 3THBA 4EHVA 1W5SA 2L2OA 4RX7A 2JDSA 5AAEA 3E6BA 4I5PA 3CJGA 4CV9A 1V54H 4Y33A 2VO0A 5FTGA 3QKLA 4FT9A 3S14J 2CJJA 2PEXA 5HCXA 3PJ1A 5CNOA 4IWDA 3PTGA 3FMEA 4P5QA 4U97A 1WBVA 4G6LA 3QAME 4IRGA 2MSYA 3BDDA 3CP9A 2YCFA 3COIA 1DI8A 4F9BA 5KZ0A 4DYCA 2W99B 1GNGA 3A4CA 4PFOA 4BE0A 1R4NB 3QGWA 3NYOA 4O0UA 1MQ4A 4R3RA 3PSFA 5KCVA 3FKJA 3TNIA 3DJ5A 3DA6A 2GM4A 1XH9A 2VRXA 2F6CA 3FSFA 4L67A 2DAOA 4AGUA 4I76A 3AC4A 2OKRA 5D10A 1ZG5A 4KD1A 3H5NA 3ZM9A 4P9UA 3EPZA 2ZMEA 3KYCB 3AAFA 3QWKA 2WB8A 2O6GE 4A69C 2LRDA 3VS4A 1K79A 4RLLA 4KIPA 5FLFA 3FBNB 3AG3H 2HS5A 1JWHA 4FL1A 3KCKA 5E8VA 5EYMA 2M34A 5BPYA 2PE0A 4HX8A 3CE3A 4FBXA 2K3FA 3VF8A 1M7QA 1Z1DA 5E1EA 3G2FA 2WMVA 4XICA 4AA5A 4NH1A 2LY9A 3MFKA 3N51A 1XH7A 1SD4A 3H9QA 1HCRA 4IHTA 2XEYA 3FI3A 4OBPA 4GV1A 4X6RA 4FL2A 1IASA 3HDDA 4XLHA 4YJRA 2R3SA 3OY1A 5HEZA 2H34A 1YW9A 3MVJA 2J0KA 3LFFA 2P5VA 4N6ZA 2YERA 4LFIA 4ZDLA 4M3BA 4CYCB 4JOMA 4DFNA 5M44A 1YW7A 3BTJA 2IAIA 1UMQA 3JS2A 3VEPA 3EQIA 4BDAA 1H8FA 3ANRA 4AIHA 2A1AB 5B3SH 1LE8A 3WTUC 2DCEA 1UU9A 3OOUA 3BLHA 3SW7A 4U45A 4L68A 1FBSA 2NVYJ 3WZJA 5AUXA 4M9SA 2ZV8A 1DDNA 1XWSA 4C4IA 5H8GA 3FXMA 4RFZA 1IG7A 4CFWA 2V5QA 4HZRA 4J95A 4Z9LA 3ZYAA 5ICFA 2G9XA 5HQ0A 3ACKA 4ZS0A 2QU6A 3F8NA 5E3OA 1R5ID 3LLTA 2CKEA 4K2EA 4LV7A 5DVRA 4ESJA 3EIDA 4NKSA 2ETHA 5KE0A 3IAS2 3K4LA 4YRVA 3JUHA 5C8NA 2G2FA 3UJGA 5CYIA 3ECHA 4BJJA 3W2QA 2ZOQA 1Z57A 4PY1A 4EM1A 4F0FA 3I7CA 5IG1A 3HBLA 4JQ7A 4XV2A 2I40A 2BYVE 4C58A 4BDFA 2R7WA 2R3GA 3R0AA 5TO8A 4EZ3A 4RIWA 2DUVA 4RX9A 2F2UA 3N05A 4UUTA 1REPC 1URWA 2CHLA 3I6WA 3HNGA 2BRBA 5E79C 1ETQA 4AE9A 4ACGA 1G3YA 3U4WA 2JJ7A 4MTEA 4RB1A 1V4RA 5D11A 2UW0A 5J87A 3R1NA 1D5VA 5F0HA 2XAOA 4GO1A 1QCFA 4M8TA 4FV4A 4L5JA 4WKQA 2QSFX 2C3IB 4IIRA 1ZZ2A 2LBFB 2OH0E 2WMRA 3L9PA 3MH0A 1VQOI 3TBIA 1SVEA 4L18B 4LGHA 3C4EA 4RJ7A 2FRHA 4AC0A 5TGTA 3BHVA 3WILA 5HLNA 2OFVA 4KN4X 3SDGA 3VB2A 4NZWB 3L09A 4A3DJ 3OROA 5AAFA 3NUPA 3FXLA 5GADJ 4DC2A 3RPUA 1GT0C 3AD4A 5JGDA 4ZZNA 1EH7A 2V62A 3VIDA 3VQHA 4X21A 1H28A 2PULA 5B2MA 1Q1HA 4O84A 3QTRA 1JHFA 1H0WA 3DJ7A 4ANMA 3KK9A 2XNBA 4YJTA 5A2QZ 3AC5A 5J95A 4WA9A 3I0QA 2JFMA 4RAGA 4GGGA 3ZQCA 3QZGA 4Q47A 4C3RA 3H4JA 4XSZF 5EGOB 2NS8A 3Q9WA 3V8LA 2ITPA 1I1GA 3CC7I 2KT0A 5E20A 5FGMA 3S17J 4IVCA 2WWYA 2UZOA 4IX3A 2WKMA 4HVSA 3I7BA 5HZNA 1M17A 4LLLA 4M67A 1PF8A 4U0YA 1H26A 2PZ5A 4A3CJ 3HV3A 4RA4A 4ZTNA 1KQ9A 4AXFA 4AF3A 3VONA 3CLQA 4QTRA 3I4PA 3EH9A 3IDCA 4TXCA 5IZFA 4QMSA 3Q3BA 1W7PB 1PXNA 1R71A 3LA3A 3BTCA 4QSHA 2QG5A 3TOBA 5DIAA 4FKUA 3R7EA 3QLFA 4KSQA 5HKMA 4E6QA 5CNNA 5E8SA 3ZFYA 1H1WA 4BDJA 2LNBA 1TKIA 5TISC 4OINF 3BE2A 4RIXA 4I09A 5D6EA 4IX5A 5AP1A 5AUTA 2OXXA 4KIBA 2QBYB 4FK3A 3PFQA 2MH9A 3TUCA 5HLPA 5C9CA 2LK2A 3ZQLA 3JSPA 4RGJA 4K8AA 4BXXJ 3LQQA 3VFZA 5BVEA 4BC6A 4P9FA 3U87A 3EKKA 3V8TA 5EF6A 2ITQA 5H3QA 3CJRB 3BQCA 4U80A 3G6EI 5IUGA 5LVPA 5BUEA 1OCCH 4GKHA 4PMPA 2HZIA 3PRFA 4KRCA 5ANGA 4FIFA 4O21A 2EJRA 1OUYA 5J9YA 2F4MB 3ZU7A 3SD0A 1XKKA 5EGOA 4YUQA 4BYYA 4F7NA 3U21A 4ZZLA 2NPQA 4H58A 4QTAA 2XNPA 3H3VK 2A19B 2E2IJ 3S93A 4F0IA 3ZQGA 4S04A 3HOUJ 4BCFA 4A3MJ 3RP9A 3WTZA 4HVGA 1G3SA 4A3GJ 2ZM3A 1ENHA 4YELA 2EQRA 5CVHA 3QAHA 1P4AA 5IISA 3WGGA 5IT3A 3H0GJ 3O2PE 2PUPA 4HOKA 3BIZA 3ZO3A 3TJDA 4HEA2 4CSWA 2OF7A 1JUSA 1W84A 5AIKA 4L53A 3GUBA 5HBJA 2OH4A 3L1PA 2EB3A 2GNJA 4Z55A 3MCZA 3LCDA 2DMUA 2UXNA 4RMNA 2A6HF 2UZDA 2CKOA 2GIVA 4BVUA 1Q61A 2QBYA 3QFVA 3C0HA 4YR8A 5E1SA 1BI0A 1PXOA 2JRMA 5FKLA 2Q0OA 1Q3WA 4OWRB 5CZHA 1PYEA 1BI3A 2LDUA 1W7HA 3K54A 3R8MA 1BIAA 4PGGA 3N4MA 3ERED 1MRYA 2QOFA 3P78A 3CP2A 4G3EA 3P4KA 1YOVB 2CSOA 3G73A 3LSRA 4LB5A 4G1WA 3KMUA 3FZOA 1VQ5I 3IDBA 1OL7A 5FLXK 4HX4A 4ASDA 4JVGA 4EMSA 5FROA 1R1UA 2JGZA 4IHVA 4V19K 2XALA 3QKMA 4Q2AA 5DEWA 3MESA 2BGCA 4XIDA 3P9CA 3G6GA 2KDZA 2X4ZA 4PP9A 4E73A 4W1UA 3PYYA 5FP6A 1X4OA 4AIDA 4XV9A 3HRSA 3J80K 5EQEA 4KDPA 5FUTA 5J9LA 5J3LA 2XBAA 3QWLA 1P92A 3GXOA 3AT3A 1XMAA 3GC0A 4PSXA 1FMKA 1ZMWA 1D1AA 2FJ1A 3NARA 3VN9A 2DFFA 3R1YA 1TWGJ 3W2WA 2ONLA 3BBTB 3DTWA 2XYNA 2M8EA 2EIMH 4XOZA 2FBHA 2R3KA 3WBLA 4USFA 1SD7A 4OIOF 1YWNA 4JBQA 1Q8YA 1T38A 2W7XA 2CN8A 5AIRA 1KYWA 2W1HA 4R3PA 2Y4PA 2RQQA 1SFKA 3HM5A 3WHBA 4TZRA 4FUXA 5E90A 2QOOA 2Y75A 2W0JA 3HUBA 5F95A 4D4YA 4C35A 4IFGA 3E62A 2B9HA 4KKEA 1NY3A 3C2GA 3OG7A 3RWPA 2P3GX 5HE3A 3PNTA 4IOAF 1OKZA 4R1VA 4ZJIA 4Y7NJ 2GA2A 2IA0A 4Z7HA 3RAIA 3DY7A 3DZQA 4M97A 5J8FA 4FGBA 1BIBA 2HDDA 3ZXSA 4JOAA 4IZ5A 2V7FA 4BH9A 4MLOA 5HD4A 3BR1A 2JA8J 5ITAA 3ZUTA 4NTSA 1OGYA 1Y6IA 2XIXA 4EUUA 3TNWA 1PP8F 5AP5A 4M0YA 2B9SA 4DH1A 1IN7A 2EB2A 3KCFA 1OYYA 4D7NA 3N4VA 1XDSA 4QNYA 2GIZA 2MD0A 3FIWA 4FSYA 3IG7A 4OTIA 3I6UA 1OFCX 2XSDC 3UG1A 4C2MJ 2GFCA 2BROA 4KT5C 3AOXA 3DS6A 3GVAA 3TT0A 4DG3E 1B72A 5TT7A 3MH2A 3AL0B 1ZLTA 3WG7H 5L2TA 2Z9OA 1AA7A 2C69A 2L9RA 2R5ZB 4AT5A 1UA2A 3D0SA 4S33A 4BCNA 4HF0A 3FXXA 1XD7A 3ZEPA 3KE2A 3VHKA 2WGJA 2P2HA 4C2TA 1LDJA 4A4OA 4L01A 5AP4A 2VTPA 1GZKA 3ZCLA 3E97A 5FTQA 3DK7A 3FEGA 3GTPJ 3QPSA 3OW4A 2DA7A 4NUSA 2GS7A 4AAAA 3IKTA 2B0LA 3G5DA 2BCJA 4CGAA 3TNHA 3CSVA 5E8TA 3AG9A 3GW2A 3B02A 2CW0F 4DEGA 2V7OA 4AQKA 2E7XA 3M42A 4UY9A 4EJVA 4M68A 3LM0A 4BJJB 1NA7A 1U0JA 4BCQA 3GZ6A 3C5UA 3ZH8A 3IV5A 4EH5A 2NNWB 2L54A 5M55A 2J5FA 5KBRA 4DNCA 2QNJA 4H05A 3WZKA 3UMWA 1I6XA 4HPTE 1OCPA 4I93A 3BGPA 1B1BA 1V5GA 3NNWA 1IN4A 4BBEA 4E7LA 2QOKA 2XYUA 5AA8A 3UOKA 1RETA 4P55A 1YXXA 2ITWA 3LAUA 3EUHC 3JTHA 4C61A 1D8KA 2CFXA 3RHXA 2VJ5A 5CQUA 3NUXA 2XMYA 3R0TA 2GQSA 2FSMX 3DNDA 2EIKH 4IMYA 4ZTSA 1J0RA 4F9AA 4TYIA 2PE2A 2H8WA 2M0MA 3MVLA 4QMNA 2A0CX 4D5FA 5E8UA 1DS5A 2P6SA 4HBLA 3VHEA 5F1ZA 3MVMA 3PJ8A 3GTQJ 1Y56A 4IX6A 4I0RA 1QVTA 4EQQA 1O3SA 1QU3A 5CF6A 1O7FA 1MRVA 1R5GA 1CGPA 1GV5A 2M45A 2Y8OA 4ZLZA 3FISA 4MNEA 1PY5A 2WFYA 4APPA 3Q9SA 2P4WA 4M7IA 5BUJA 1YS7A 3TO9A 1BI8A 3BCEA 5A4QA 1YVJA 4JT3A 5E1XA 3HMPA 4BDEA 2JTVA 5CAPA 4OBQA 1F5TA 3DAKA 3QU3A 3O8TA 1X1AA 3T3UA 2GSFA 3HDNA 1F1ZA 4WXDA 4ABZA 2WTEA 3QYWA 1KE8A 3RAKA 4FL3A 3H0DA 4OW8A 3MKWB 5E1ZB 1TWHJ 4UXNA 1ERDA 2WOTA 4M6YA 3ZBXA 4A07A 5CAOA 4YG2F 1IXSB 2OU2A 1T33A 3F5GA 3LHJA 3O7LD 3OWPA 3Q2JA 4GU6A 4NFMA 1U2WA 1OJLA 5JQ5A 5D7AA 3EETA 1V0PA 3UO5A 1R0EA 4EC9A 4E7WA 3FMNA 4EL9A 1PYXA 4ZTJA 3A60A 5A6NA 4FYNA 3B2WA 4XNEA 4F65A 3QYBA 4EH3A 3NZ0A 1JKKA 4XOYA 4I4FA 2EA4A 1J09A 3ORIA 2IW9A 4Q48A 3O6BB 4TN6A 4B7TA 5FXRA 2K40A 4ITVA 4RIXB 4BUPA 1JKOC 2KIFA 3FV8A 4X3FC 1OECA 2W9ZB 3FDYA 2XROA 3QD0A 2WQEA 3HKOA 2IGMA 4ACHA 4HF2A 1QPEA 2W96B 4GH2A 2E1OA 2C0OA 4ZAUA 1UHSA 2W1CA 4D0PA 2X6OA 1BR4A 5AFVA 1L3RE 5FO5A 2CLXA 1GJOA 5M4FA 3AKKA 3WU0A 4QTBA 1Z91A 1PHKA 4EK6A 1X2MA 1PXIA 3J80Z 2HIWA 2R7IA 1OKWA 3WG9A 1G8XA 4MD9E 3P9JA 1H25A 2XC7A 2DK5A 4OT5A 2CG4A 3M11A 4FV8A 3ERKA 4WBOA 2JC6A 4FTAA 2QCSA 2IZRA 3QC9A 2HKXA 1H1RA 2ZJPF 1ST4A 4XG8A 3I54A 4ZOGA 3SZPA 2HYGD 4F1OA 4A93J 1REJA 2UVXA 4WCGA 1WMKA 3CCSI 3OIOA 2H6BA 2WTJA 3CY2A 4LB6B 1YKRA 3OBJA 4EONA 3HA8A 5C8KA 5BYYA 3GCMA 4ZYGA 4IAKA 4NTTA 2V7AA 1K78B 3T8TA 3KY2A 2L02A 1OGUA 4YSMA 4D5CA 3BR5A 4I01A 3P5JA 4AA4A 4JS8A 2XNNA 4IWPA 1Y0UA 4L9JA 2VQCA 4OR5A 4YEJA 4YNOA 1R7JA 3DT1A 4FNYA 1B72B 1FLIA 4AX8A 2PMHA 5JRQA 1J1CA 3GNIB 2DMNA 1OIQA 4EJUA 2W1IA 1YRNA 4RB3C 4MFEA 3ZLWA 2OIBA 5GAEJ 4JQFA 3IL2A 3KEOA 2LBFA 5IP7J 4FZAB 5LEJA 3MPTA 4DOZA 3DCFA 1ETYA 4MEDA 2R3QA 2E71A 3EQFA 5ICPA 5DEYA 2K4BA 3H1CA 3R6SA 5HESA 3E3BX 4JDJA 2L01A 1MJBA 2JBOA 3HAMA 3U1DA 1Y8QB 3BR3A 3L2VA 3VS2A 1Q5KA 3DBHB 4G9CA 2OJED 4AIJA 3VRZA 2VTMA 1XG1A 2B7AA 3NW5A 4CYDA 4GVJA 2M3AA 3W0RA 5JQ8A 2CGVA 5IQIA 1F36A 2O0YA 4IO9F 4XG9A 3R7VA 1ZOHA 4XQFA 2WIPA 2YJSA 4HG2A 2FU4A 1BW6A 2QODA 2DQ7X 2XAJA 1JOWB 4AXEA 4HV6A 5FEQA 2W05A 5EM6A 5E3LA 3VULA 4FKTA 3OMVA 4MEYF 5BS6A 1FVVA 3LCTA 1SFOJ 3RPVA 1BI2A 4JG6A 1Q3DA 3ESWB 3CF5F 2CUFA 2OW3A 5CQWA 2DJNA 2REIA 5FP5A 5T6KA 5BMSA 3AGMA 4DH5A 4BGGA 5LLQA 1PJRA 2X7FA 2FF4A 3TV7A 1SAXA 4M15A 4EJWA 2X6WA 2W5HA 1R00A 1QGPA 3ZP5A 3FHIA 5EKNA 2JKMA 3W2RA 5KKRB 3WZEA 3IONA 2QYOA 4HOBA 3BZ6A 1QPCA 3HV7A 2QOLA 5E4HA 3PL8A 5HX6A 1YDSE 2ELJA 4JR7A 5L8LA 1S72I 3O2MA 1I6HJ 2XB0X 4C59A 2C1AA 1TZLA 3JXWA 3R8PA 3ZUVA 4RLFA 4PK4A 1PYVA 4DEDA 5G1XA 1OB3A 4LG0A 3CCJI 1IRZA 3AQVA 3QQJA 1Y39A 2DODA 1HDPA 3M9AA 5EOLA 5AUUA 4ZTRA 1RW8A 4QMTA 3TDVA 3OWTA 3QQKA 3S1NJ 3GP0A 3BR2A 1J2XA 4XRLA 5DS9A 1U8BA 4FE4A 3CDLA 2OZUA 3I58A 1Y8YA 4LL5A 3LMGA 2R4GA 3KCCA 4HGSA 4FOBA 5CLPA 1OCOH 4BTFA 4U42A 3DTCA 5H20A 5CXZA 1ZG1A 3Q0VA 2PTKA 3PIYA 3D0EA 1KZHA 3MYGA 2EV5A 2XAMA 1GXQA 4CYCA 3KIOA 5M08A 4UX9A 3WI6A 3DBCA 3QRJA 3FLWA 3E3VA 4YZMA 1J7LA 2UZUE 3CS9A 2E1MC 3AMAA 3WU1B 5ANOA 1ZYJA 2UW7A 2OF2A 2H9VA 3OS2A 4ZTFA 4QPAA 1X3UA 3ZHPC 3K1PA 4YLKA 3R7IA 4E7HA 1ETKA 4EHZA 1XMKA 1F9NA 4L3PA 2OWBA 2WMXA 4DITA 3BLRA 3S1QJ 4AQCA 3G9NA 4PUSA 1W8CA 2R2PA 5LBQA 1B6CB 3AT2A 2N8GA 4PMSA 3COHA 1T08B 4L9VA 3PXFA 1VQ6I 3GC8A 3KP7A 4O82A 3NX8A 4EWHA 3KREA 2KIMA 2X2KA 4XLAA 3I5ZA 4YZDA 3K0LA 3CXWA 5EDPA 1URCA 4FTIA 3PWDA 4CKIA 4XRJA 3TOAA 2CW7A 1WJDA 5L8KA 2OJIA 3JVSA 3OEZA 2KRFA 3Q5ZA 4XK4A 4G3FA 4BIBA 2IS2A 1LFPA 5HLHA 3JSOA 3A02A 4LV8A 4GXOA 4BBMA 2DO7A 3HA6A 3BEGA 3A62A 3QL8A 4B3AA 4E6AA 1YXSA 3ABLH 2L7KA 3WE2A 4E7SA 4EHEA 4CICA 1ZREA 4HZFA 3K6GA 3EYGA 1IN6A 1JHHA 3OL4A 1ODDA 5F6FA 1O6LA 4DTKA 3ZSGA 3TDUC 4JI9A 2LMDA 2UW3A 3FI8A 3J81K 2L0KA 4BDHA 4BY9E 2LY1A 4V04A 3RPUD 1YTYA 4S31A 3IRQA 3EN5A 3QRFF 2ZVAA 1HSTA 4Y83A 5DE2A 1S9HA 2OZAA 2DQLA 5HE0A 4FKJA 4L6QA 4LRJA 2HXOA 1PW2A 2BHYA 2K4JA 2BKZA 4QQJA 3MS9A 4XKWA 4K9YA 2ZJQF 3RZBA 3IO7A 4K33A 5LD2C 3ZBFA 4E1ZA 2K7LA 4XBFA 2HOTA 3CGFA 4XLPF 4P90A 4HW0A 5E17F 2KULA 1TP4A 1WJBA 5IQGA 4RWLA 3V8SA 3S1MJ 3VYSB 3S00A 4V2FA 5IYDJ 1GIIA 2W4JA 2AS5F 4PDPA 5IA2A 3G33A 2CGXA 4JBVA 2C3KA 4ZYHA 1K78A 2QKLB 4BJ5C 2VBZA 4CCOA 2LKXA 2OJGA 4A3IJ 4DN5A 3UBDA 1OR7C 4L45A 3QPTA 3TW6A 2UW5A 2XK6A 3QD2B 2ZV7A 3OYCA 5B5EC 3E8CA 4R78A 4B43A 2Y6MA 4LMUA 1MUOA 3KPHA 3QOEA 2XDVA 4I0TA 4DAWA 1PXPA 2ISYA 4C02A 2IEKA 4B1RA 4BI2A 1R5HA 2A3SA 3NVMB 3DK6A 3KZYA 2K5CA 4WX9A 3KN6A 1IAHA 2I6LA 5I9VA 4B8XA 3MTFA 5CI7A 4FG9A 3DB8A 3FXUA 1WGXA 1UU8A 5AM6A 4FE2A 4YFKF 5T68A 4DJAA 4QP7A 1Q24A 4FKGA 4QMMA 2B9IA 2IGOA 4A0ZA 5EZGA 2R3MA 5BPIA 4ACDA 4DH3A 1UG0A 3VUIA 3BG9A 4EH4A 3IGGA 4TL0A 3R22A 3DU6A 3A7HA 3CCNA 1GZOA 3S32A 4APCA 4O0SA 2LR8A 3PY0A 1GAGA 3RVGA 2XA4A 4ALVA 4C0TA 4II2A 3QYFA 3D4QA 5CVRA 3K4NA 2OJJA 5M5WJ 4RC2A 4FG7A 3SEQA 5CASA 4HGTA 3OOMA 2W1DA 3AKLA 4PGHA 1OKRA 2QU5A 4Y52J 3BPRA 1ERKA 4QO9A 2A27A 1KE6A 1CSNA 1NK2P 2RFSA 3KVXA 4OTQA 5AX3A 3FQSA 4U8ZA 1R6RA 2UV2A 5DYMA 1REKA 4X7QA 3HMOA 3IW7A 4G6QA 1R22A 2QHMA 2A5YB 4BHBA 3NDMA 2UW9A 2ZBKA 3MH1A 4XL9A 3MDYA 2BILB 1O9UA 2FOWA 4TYEA 3E7OA 1ZK8A 4Y4RA 3E6MA 1HLVA 4JIKA 5B0XA 2JUGA 3GVUA 3MB6A 3V5PA 1HCKA 4R7BA 4L5EA 1RJBA 5J4VA 1JKTA 2QI8A 1H07A 1JJ8C 4FGRA 2WTVA 1U5QA 5HI2A 4YIRX 2VPRA 4FKLA 1QZEA 5HOOA 5DTDA 3HTSB 1J1BA 3RK5A 1MQBA 3UYTA 4D1XA 4FV2A 3L9NA 2VASA 3ODYX 2CW8A 4YIFA 2B0QA 1XGSA 2STTA 4BNCA 3H9GA 4WK8F 2CV0A 2C6OA 4XLNF 5D5UB 4RSSA 4RC3A 4BXUA 1LDKB 4HYEA 4TV7A 1STCE 2PQ8A 3OF0A 1A06A 3H3UA 2W17A 5JH6A 5LMAA 4AZTA 1Z7UA 2ISZA 3RKYA 5EJCA 2R7DA 2A6EF 4YFNF 4F9YA 3AL0C 3HIFA 5BVFA 2YSRA 5JK3A 2W24A 4J1RA 4QTEA 2YS9A 4FCYA 1HKTA 2R3HA 5CT7A 3LQ3A 1OPKA 1U78A 5BVKA 2EB7A 3GU7A 5LGTA 3UQGA 3BJOA 3MJ2A 2LTPA 1OISA 2W1OA 2YIXA 3E92A 4IM0A 1K61A 2UUZA 2XAGA 1ZGAA 3A4OX 5F08A 4ZYAA 3SW4A 3K1NA 5HO7A 1ZHFA 3QXPA 4I6BA 5BX0A 1ZY5A 3UKGA 2XKPA 1KV2A 4FKVA 2ERZE 4JRVA 4W4YA 1XSXA 3ZQIA 4OTRA 4DEBA 2BR1A 4YJUA 4M84A 2NVXJ 2GAUA 3FC2A 3QQLA 2QQ7A 5CSVA 5H6RA 4I0SA 4Y95A 2VL8A 5LGUA 4WG3A 4X2KA 4M3DA 4A6DA 4RJ3A 5JFRA 3ROYA 4AM3A 4M0ZA 1UV5A 1FOXA 1S7EA 1Y1WJ 1FY7A 1M2QA 2C6EA 1I5ZA 4QP1A 3D83A 1JUPA 1MSEC 3NUSA 5EDRA 4O7VA 2WTKC 2UWMA 1TW2A 2IVTA 4DFUA 4M72A 4IL6C 4LI5A 3GTJJ 4HYHA 4NCTC 2B9JA 4BACA 2EA2A 1XDUA 3KP2A 5HBEA 1XC5A 4DTBA 1RC9A 4PQNA 2X8IA 3FMLA 3EQBA 3V5WA 5J8IA 5KMMA 1HW2A 4CH7A 1TQPA 1P9QC 1MW7A 2VX0A 3ZMMA 1H1QA 1QO0D 1AHDP 2FMYA 1NH3A 3R6XA 1GVJA 2GWRA 2ZSHB 3F7ZA 1IGNA 3CUQC 4CCLA 2R92J 4K0YA 3TTJA 1W5CC 5L6WL 1FSHA 4NW5A 1TLHB 3ULQB 4FNXA 2IW6A 3QALE 4FT5A 1SFUA 3EYHA 4AIKA 3A99A 4ZSLA 5HX8A 4F99A 3MY1A 4A7CA 3CCUI 1OL1A 3DTKA 3QTQA 4DIQA 2WBMA 3Q6WA 2VTOA 4EOIA 3FLQA 5ETAA 5HCYA 3I55I 5CQGA 1SVHA 3AG1H 4EZ7A 3DKWA 4UUSA 4GIHA 2B7EA 3EQDA 3ECOA 3JR9A 4MHAA 1QHGA 3EZRA 4NHJA 2ONLC 5JEBA 4CTCA 4J19A 1GV2A 4XLIA 2PVYA 5CQEA 3GXLA 2DFHA 1ZN2A 4E70A 4XH6A 3FHRA 5AAGA 3R61A 2HU9A 3PE1A 5FRMA 5D5VB 4BCIA 4WBBB 4XN3A 5ILVA 2COMA 4RIWB 4ZIMA 4Y5QA 4FISA 5HHWA 1I27A 1IXCA 1AU7A 1JXSA 4JG7A 3F6OA 4DYMA 2XNGA 3VS6A 1WZ2A 3CBLA 4J99A 3ZR8X 3CJNA 3HHHA 4A4XA 5JKGA 2CQNA 2W1EA 3KQ7A 4NBQA 3GCUA 2XZSA 4YZNA 2JITA 3ZQ7A 5M4UA 3DKXA 3CCQI 4K77A 4Q5SF 4FHTA 5D6FA 4AE6A 4TPTA 3U55A 2CKQA 4ZY5A 3R2YA 1S5LC 3HZJA 5LXMA 3EJ1A 2X0LA 3ZQFA 2VWVA 3PIOF 3LJ2A 3EB0A 2SRCA 2Z7LA 3OCSA 2IS4A 2R3PA 1WWXA 2EV6A 4A9SA 1Z21A 2HR3A 3ZZWA 1R39A 4GFMA 5FM2A 3NRVA 2HQNA 3QUEA 2J90A 4D28A 1TC3C 4FI1A 4CV8A 1Z5MA 3CCLI 5BV3A 3F5XA 3G0FA 3OOPA 5CAQA 3A0HC 2BZTA 5GPCA 4BHNA 2WAEA 1U6GA 3ZCOA 2BDWA 1M52A 5DYJA 3ET7A 4IHXA 1TT0A 2BHHA 4R8HA 4NKAA 4J53A 2VWXA 3M2WA 4J52A 5F04A 4HVHA 4IM3A 2VQHA 1CDKA 1ZAOA 3FAAA 2R7TA 5JSMA 5JHFA 2DOAA 2X6EA 2QUFA 1WJ5A 1ATPE 5JGBA 2XKOA 2X1NA 1FX7A 2KLOA 5K3YA 4WNPA 4BU2A 2PU8A 2HELA 3F3UA 1AOYA 2WC2A 1JGSA 3GQLA 1O6KA 3R00A 5LQFA 4M69B 5JRSA 1P4OA 2OBPA 3CIKA 4A9UA 4UVAA 4WRGA 3VPRA 1FPQA 5HDGA 5GTIC 4CRSA 2VX1A 3S3OA 5FGKA 3DGKA 3VRYA 2PZYA 4O6LA 1IDZA 3D7ZA 1B38A 1KV1A 4YJPA 5DRBA 4IZAA 5L2WA 1ZYLA 2IW8A 4BJTA 1LEBA 1QQIA 2CQKA 2CGUA 3F69A 3MGYA 4N70A 3TIYA 4PNKA 1UHWA 3GZ5A 2UZBA 4IRHA 5KK1A 3KXMA 2XNOA 4KMUX 3OP5A 3DTIA 2ESNA 2ITVA 5M4IA 3DLSA 4FNZA 2XRLA 2EFOA 4UB8C 4FEVA 1P14A 3ZLXA 2IJLA 4CZZA 2PUUA 2DOEA 3E5UA 4M6VA 1I1SA 2A68F 4FSTA 4RJ8A 1BN5A 4UN0C 3E6DA 2IJMA 4LIVA 1I50J 3UR3C 1UELB 4Y3OA 3FHZA 3DPTA 4HVIA 2EU9A 2WZJA 4YPDA 2JN6A 2R7OA 2XIRA 4F7SA 3E7VA 3GTGJ 1YOJA 3OW3A 4PMTA 5CTPA 4LOOA 1CKIA 5JMSA 1BL6A 3T8OA 4IF4A 4PJNA 4XRSA 2YCSA 3UPZA 3C0GA 3NAXA 4HCUA 4ACCA 1OKYA 3NVKI 3PFIA 2UXXA 4L00A 5KKRC 1YYVA 2UZKA 1F43A 5HNFA 2A4LA 2HWOA 3NCGA 3I5UA 2YZLA 4ZK5A 4AGWA 4BE2A 2KMUA 3VBTA 3DFCB 4CFNA 3H9JA 4GG5A 1YDTE 2YUSA 3O5AA 4BQAA 2TRTA 4JDHA 3HMMA 3QXOA 4XKVA 2YDIA 2V0DA 3LFDA 4RBOA 2BTRA 2NXNB 3ZFXA 1MBEA 5H8EA 1IAJA 3D94A 3FE3A 4MF1A 3K2LA 1Q4LA 4KICA 4NNJA 3U9CA 5J47A 4RQKA 4RVTA 3VUGA 4AN3A 1VZOA 4FVRA 4FT7A 2WAQN 5FLVA 2VWUA 1M7NA 2ZXIA 5HLWA 4LLNA 4PDYA 3MWMA 4C4GA 4AP7A 2HK5A 2X39A 4M73A 4O7NA 3W6KB 3RI1A 5AV3A 5FRIA 5LJJA 3TJCA 2GS2A 5C4JJ 3DQVC 1N75A 2IS1A 1NHAA 4QTDA 2VB6A 3PJ3A 2BV6A 3QQAA 5FKMA 3L00A 1E1XA 2DTRA 4CTBA 3V7RA 5A6OA 1IDYA 5IQEA 3T1BA 2PG4A 3KU2A 4C3IJ 4E4LA 1RESA 2GLOA 2XUUA 4M3FA 3LOKA 2ZJRF 2K9NA 3AKJA 2VZ6A 1A5JA 5E8ZA 5HO8A 4ZY6A 3MY0A 3DQXA 1RUOA 1KQ0A 3HMIA 3LKMA 1YG2A 2WTIA 3LSTA 2EZLA 1KUTA 1J3HA 3PM1A 4HYUA 4JX7A 5EYRA 3O50A 4DQ2A 3BPXA 4EK4A 1MD0A 4IRIA 2XKFA 3L2WA 2YDKA 3R8UA 3VJNA 5HS8A 1Q41A 3HOTA 2LOOA 1XGOA 4EKKA 3HYHA 2O5RA 5LGNA 4XKCA 1NK3P 3KXHA 5C8MA 3DXQA 2P8TA 2QQ8A 5M06A 4EEFG 3NAYA 4ZS4A 4DTAA 2ZJ2A 3Q53A 4D4SA 5K5OA 3RYPA 2HZNA 2XPVA 4FTNA 1B9MA 2VTQA 4AW1A 2AC3A 3ZFMA 3QP6A 3MJ1A 4OIRF 4PUZA 5DHJA 4ASXA 2XKEA 3DLAA 5ED4A 4L43A 3V8WA 2R7UA 4EH7A 3CF2A 1POGA 3Q3SA 5HNGA 4CA0A 1PVEA 1XR1A 3D7TA 2C6KA 3NUYA 4O7WA 5LHIA 3QU0A 1TW3A 4XKBA 5EFQA 4BIDA 4D9TA 1ZOEA 1WI9A 4AW2A 3FZRA 3PQKA 4M6XA 3FZ1A 3HSEA 3SZTA 2OG8A 2OLCA 2HXIA 1QZYA 1Z6RA 3UDTA 1K9AA 2OCEA 3BTLA 4CXAA 5K4JA 3K5VA 1RUNA 2HZ0A 2KRHA 5E7RA 3GENA 4OAZA 4ZLYA 2COBA 3KP3A 5EYCA 1FIPA 3E1SA 1PXJA 3DKFA 2BVMA 3BHYA 3PG3A 3N4UA 4BYIA 1L0OC 3FXKA 2YHVA 5FEEA 1FBUA 2PN6A 4GT4A 1TFFA 4FTLA 4PZJA 3RAWA 4O0XA 1PP7U 3BLYA 4EH2A 3DKYA 4BHPA 1W0UA 2Y0SN 2CPKE 3F3TA 4X0MA 2VT3A 1ZMVA 1RQQA 3NWWA 3IH4A 4FEWA 2NRUA 2QO7A 4NSTA 3REPA 4E20A 5HDNA 3S3NA 3JY9A 1WHUA 5TRDA 5IU2A 2BXYA 2HVSA 1NG6A 3RKXA 3HAVA 5AM7A 4QQCA 4DHZA 5L3GA 5F0FA 2R7QA 2Z16A 2OIDA 4USDA 3KFAA 4TNDA 5EI2A 3KYLA 3CD3A 3S2HJ 1N25A 1Y91A 1L3LA 3F6XA 2WMQA 4DLJA 4FJVA 3TKYA 4MD8E 4MWHA 3OYFA 2IA1A 2HEOA 5CLSA 4G6TB 1YJWI 2MH2A 4TT7A 1W1WE 1ZRZA 5HG7A 2UW8A 1YFHA 3SQNA 3I0OA 1T8IA 4QDVA 4MO7A 4EJNA 5M53A 3MY5A 4I98B 5ERIA 3PUFC 1QL6A 4ANQA 3MIYA 1EH6A 3OIQA 2BHZA 1S9JA 3IOPA 3BELA 4D4RA 1P4WA 2K9SA 1LPUA 3NFFB 5B2LA 2FGIA 4I1ZA 1HDDC 4F9WA 3K70D 3OYIA 2PVJA 3RPQA 3GU6A 1PUFB 3FZTA 5IA3A 1U5TB 2G2IA 1GZNA 3FPMA 4E6CA 3BV3A 4BB4A 4QDEA 4NWMA 3NWTA 3HOZJ 3AMBA 1YHQI 2B53A 4ZYEA 3O17A 3KKVA 1FGIA 2C1BA 2H09A 3MIAA 3DAEA 1H1PA 5CEPA 3VS0A 2D2WA 2KISA 4L44A 4RFYA 4G31A 2UV1A 3CESA 4CGZA 2C6TA 4FASD 2D1HA 2C3JA 3PLSA 2JLDA 5JN2A 2XK7A 3U4UA 5DEQA 3R9OA 5HICA 3QD3A 1AD5A 4MGRA 4GMYA 1ACIA 1A6IA 3BJAA 2D5VA 5HD7A 3D14A 1ST0A 5CU4A 2K9LA 4ESFA 1WVWA 4GRIA 2IA2A 1LR4A 2R3RA 4YZCA 2CDZA 4O0RA 2FEZA 2PL0A 4S32A 2V1DA 3UNZA 4WXHA 4Z7GA 3VS1A 2NS0A 4G9YA 1I39A 3H10A 4ZZDA 4PRJA 2BZIB 2OSCA 3UVPA 2UZEA 1P4XA 3RKBA 2DU9A 3TN8A 4F78A 4DFBA 4IPAA 4A3BJ 4YSJA 2QQ9A 4JG8A 2QLUA 3TUDA 2XAFA 5HS9A 3ABUA 1H89C 4HNIA 2Y4IC 4IVNA 4QYFA 2LAVA 2ME6A 4MNEB 3SG8A 1TNTA 3A03A 5IYCJ 3UGCA 4U79A 3F88A 3D5UA 5IQAA 1VZ0A 3HP2A 1Y6AA 2BAKA 2VAGA 4KMFA 4U43A 2IP2A 5BVDA 5D5WB 2YFXA 2K02A 4S30A 4KBKA 3I59B 2R5YA 2RN7A 3RI4A 3ZXTA 5BNJA 1YQAA 3ORNA 2VJIA 3O7LB 1VNDA 4QMUA 5LVOA 2A61A 4R77A 3W2SA 2F7EE 2JA6J 1SNXA 1V0OA 2L3DA 4N4NB 4ARKA 2O61A 2UVYA 5JLWA 2FXAA 4E7IA 3PIZA 2M4GA 3UQCA 4GT3A 2E9UA 4CNHA 3A2CA 3GYHX 4AFEA 4NDLA 5HCZA 5LEKA 2BE5F 3UQFA 2F57A 4I20A 2YCQA 1ZOGA 2QHNA 1LEWA 3QQHA 2KIUA 3I5NA 5JVTA 2W5BA 3H5AA 2X6YA 3MPMA 3NEUA 4XCUA 1Q99A 1IW7F 3F0CA 1BL0A 5TOZA 2ZYBA 3BHTA 1O4XA 4UXQA 5L3FA 3HTUA 1A35A 4R1HA 2OU7A 2JKQA 5CEQA 3QZFA 2O3FA 3T8RA 1D1CA 4A3KJ 3LXKA 1SD6A 4RLKA 5DR9A 4FQGA 4W4WA 3Q0UA 3F8MA 5HU9A 4MD7E 2XCKA 1Y57A 4OIPF 2UZTA 2Y6OA 5IA0A 1WBSA 2H1LA 4LIUA 4FTMA 5M3MJ 3H9FA 4FMQA 3J81Z 2EZKA 3NUNA 5IH4A 2O9LA 1FOWA 2ZXWH 1P5EA 1OPJA 3IC7A 2Q0BA 4LG4A 2PE1A 5DM6F 1V1KA 2BY2A 1PUEE 1FZPB 2YU9J 3NFGB 2VXZA 4EOPA 2ME0A 5EOBA 3UOLA 2Z60A 3RK7A 1A36A 5LHHA 2QOHA 2G1TA 1UCRA 3ZM4A 3FMQA 4YZ9A 1K6OA 4LYNA 4R1YA 4O91A 4MXYA 3CC4I 5B66C 4CCNA 4RWJA 2WTKB 3HRBA 4WIHA 3KRWA 2JWTA 4V01A 2ZNZA 3A7JA 3KF4A 1BR2A 3FBVA 1Z7LA 3DDPA 3WYYA 3CD6I 1SM2A 4LOQA 4OMYA 4O81A 5ICGA 1PMNA 1D0YA 3QKKA 5KMOA 1ZQ3P 3G15A 1OR7A 2QOBA 3PY1A 3V3VA 3CMAI 3P7BA 5FLMJ 3ORXA 1Z67A 5DPVA 1SNUA 2XB7A 1ZZLA 1Y6BA 2O63A 3D5XA 4PV0A 4G34A 3OYLA 1Y1VJ 1Y0NA 4PX6A 5LRRA 5KAIC 4K1BA 1LNWA 4D2SA 3SOCA 4M14A 3MVHA 3E8DA 3QTUA 3O8UA 1UZCA 4RAZA 1YXUA 4XNFA 4CVAA 2YAAA 2HQ5A 1RI7A 3RKQA 1UWHA 4BDKA 4JYKA 3V8JA 3FF5A 1JKRC 2NNYA 1UB9A 4DHFA 4BCMA 1M1EB 3DJ6A 3R7OA 1PKGA 1YI6A 4TRLA 5L3AA 4QMYA 4D4VA 2NVQJ 3LXNA 5IQFA 2CJMA 1W83A 3Q9VA 3DZOA 3CMYA 4AWIA 2LLKA 2CKPA 2VTIA 3M1CA 4U3ZA 3NMUF 1FYKA 3HEFA 4IB5A 3QUDA 5H2FC 4QOXA 2ZSIB 4RZVA 3S4QA 3WZDA 1Q8ZA 4WG4A 3PXQA 3MKZA 4DGNA 2HWVA 2VGPA 4YPSA 3UP7A 2BKKA 2QSGX 1WVRA 2GOMA 1Q8UA 4QYYA 4ZMEA 3P9IA 4O0YA 2LC2A 1U46A 1MDMB 1CMKE 3OCGA 1FBQA 2Y9ZA 3J7ZI 3GCVA 2GNIA 4HSTA 5CKTA 3QA8A 5E8YA 4J98A 4A9TA 4O2PA 5IH6A 3A01B 1UNHA 3RQ4A 2R7RA 5EDQA 2F4OB 4F7JA 4EOSA 4KBAA 3VYUB 4UV9A 3LQ8A 2XJ2A 3CUOA 4RVKA 4JIAA 4IJPA 1SC7A 3I79A 3ENMA 1ND4A 4A12A 4OGRA 5JHUA 2WIHA 4CCUA 4ENXA 5LCJA 1JPAA 1QHHD 2HZDA 2R5ZA 3TACA 4ERKA 2GNFA 2PMNX 1YWRA 2ACJA 1JT6A 4ZH4F 2VPLA 4J96A 4EM0B 3UVRA 2IBDA 2XIZA 3R02A 3D7TB 5CSXA 1B39A 3LFUA 4FKSA 4JX6A 3OYMA 4DINA 4AVZA 3TI1A 1J7UA 2VKHA 2CWEA 4QP2A 3W6VA 4AZEA 3TIZA 3W10A 4EK3A 4BZOA 2GBYA 5D41A 4EOJA 2VJJA 2M7AA 4DGWB 3W55A 2F7ZE 3COAC 5CVVA 4IH8A 1LFUP 2HWPA 3POZA 3R63A 4D0WA 2WMWA 4YC6A 1YIJI 4D55A 2L4MA 4DDGA 3ZUUA 2AEGA 2HFHA 4Y17A 4BGHA 2M2EA 3P9KA 4GRBA 2MYSA 2RQPA 4WNMA 4I21A 2NVTJ 1K2PA 3FL5A 4BIEA 3DU8A 2QONA 1H9TA 3FI2A 5CS6A 2A69F 2RREA 4PJJA 2I1MA 4IJAA 2QGUA 3H0YA 4JMQA 3DXJF 4PSWA 4WF2A 3PE2A 1BL7A 5FXQA 5F0CA 3WODF 2Y9QA 4NK9A 4MCVA 4C7TA 3CZ6A 2DN0A 2O03A 3SDBA 1I3QJ 2ZV2A 3QPLA 3MVPA 4PMMA 3OT8A 2HYYA 3PVBA 3HV6A 5A14A 2X9DA 4UNOA 3PA4A 1R78A 3MN3A 3FY0A 4IWQA 2XSJC 4ZJZA 3KP4A 1GZ8A 2PMIA 3COKA 3TTIA 2Y69H 3HC7A 5B7VA 3ZO4A 5CXHA 1J75A 3LPBA 3S3MA 3QRTA 4F9CA 2WEIA 4C4FA 4AWXB 2GXGA 3DB6A 4FTUA 2IGNA 5K5RA 3M1SA 1JSUA 2B54A 3OXIA 3VSLA 1I3AA 3OL3A 1XH6A 2Y48A 3U1KA 4X6AJ 2UW4A 5DV5A 2DFEA 3HRFA 5F94A 3HGKA 2IW5A 2ZMDA 4WG5A 2ELHA 3FUPA 1OIYA 4C30A 1LVKA 4AVPA 2BDJA 2WPAA 2ITTA 3HMNA 1U5TC 4CKRA 5CEKA 5F9EA 1FT9A 3MFRA 1EA3A 5BYLA 3VBXA 1XGNA 1XQZA 3Q96A 2VT2A 1TVOA 3MI9A 4KKHA 3P79A 5GNKA 5IF1A 2UVZA 2DFIA 3HJEA 2MBFA 2OZAB 3F22A 4MQVA 1FYLA 2OTJI 2WAQA 1IN8A 3F6VA 1RDQE 4QMVA 1H00A 4DG2E 2JA7J 1PXLA 4L8MA 4FEUA 3HL7A 2VNYA 4EK8A 5K1YA 3CCMI 1FP2A 2QCOA 4DGOA 5K5QA 4N4OB 2HYFA 3ML6A 1ULYA 5DT4A 1E3HA 3H3ZA 2B4SB 4B0GA 2OA4A 3FLNC 2JA5J 3IKVA 3WF7A 2L7FP 2EZHA 3I71A 2J5OA 2YABA 5IQBA 4U81A 2Q2EB 1YLFA 3ZTXA 1VQMI 4DEHA 2H6DA 1UKHA 3L8PA 2EWNA 4Q4ZF 4NCTA 5AV1A 3FWEA 4DA5A 5D8KB 1IRXA 3NW7A 3OT3A 1XJDA 4CXFA 1KU9A 2VTRA 3S2DJ 1K7AA 5FD2A 3OXTA 4BCOA 2HW7A 2C5XA 3E8NA 2GOXB 4C3PA 5FB2A 1FJLA 3H9RA 3K4KA 4BL0B 2W7NA 4CLIA 2X4HA 3CO6C 3L2RA 3D5SC 2ITXA 4AW0A 4J7BA 4D1QA 1D1BA 3VC4A 3IWFA 4BDIA 1N78A 3WOWA 1OMIA 4L42A 4FTHA 2R3LA 3KF7A 3KA0A 3LL7A 3BG7A 4ANBA 2ZB1A 1V5EA 1XTAA 3OXZA 2FOKA 2C5YA 2XARA 2FQ4A 3PSBA 3LXPA 4AAYA 3JRIA 2ITZA 2KZGA 2R0IA 2JFLA 5HIBA 5EM8A 2CGWA 3NIEA 4YU2A 4MUQA 2CCHA 4WXCA 3G6HA 4CCKA 3EQGA 3MB7A 4I02A 4MNUA 1PDNC 4CG9A 2H8RA 3ALNA 2WMUA 3BROA 1JNKA 4H39A 3KLOA 3FDNA 2FNAA 4F52A 3HEGA 2HDWA 4CFUA 1MBHA 2XRNA 4RPVA 4BF2A 3BV2A 4TYHA 2PHKA 5AUZA 5GP9A 4C2VA 2CU7A 3KXNA 3O71A 2CUEA 3A7FA 5ACKA 4FT0A 5H8BA 2DPUA 3HOSA 3GUDA 2R7FA 1G2HA 1OBGA 3HRUA 2VWWA 3WE8A 3OIPA 2RG6A 2FE3A 2UW6A 4CCBA 2NOJB 2C6MA 3F7WA 3FX3A 2FSWA 4HNFA 3OVVA 3K9TA 2QSHX 4ZTLA 1R3CA 2Y7JA 2E34A 2IRFG 2PVLA 1BX6A 4QYEA 3V5JA 2VUMJ 1A31A 2PWLA 3PPKA 3RZOJ 3F9KA 5C3EJ 3ASNH 3VSKA 5CVIA 3ZSHA 2AC5A 5B1BH 2KTYA 3VQUA 3UIBA 3DAJA 1ON1A 3VOEA 2XF7A 4RM3A 3CTQA 1BA5A 2RV8A 1JKPC 3HV5A 2VLAA 4A9RA 4OTWA 4RA5A 2RAEA 4D1ZA 4LK1F 1MKMA 3RMFA 4Y15A 1YOLA 4IJ9A 2WU6A 1H0MA 3X2QH 4IDTA 2HVQA 3ZEWA 2ITOA 3T9TA 3MZ8A 4GJ3A 3K3IA 4MK0A 3TM0A 4F0GA 3LSIA 4D0XA 3LAPA 4DDIA 2YEXA 3GX4X 3DEUA 4ITJA 1MH4A 1YHSA 1SMHA 4L52A 3E93A 3ELJA 2GPHA 3CC2I 5GJGA 3A1YA 3UIXA 1XBCA 4S2ZA 2WQNA 3EQLF 1AQ1A 4U0WA 1IA8A 3TEDA 3R9NA 2W06A 2W82A 1X3WB 3PJCA 2JAVA 2UUEA 2RGVA 2ZB0A 2F5VA 4BI1A 3LSHA 4FSUA 3VF9A 4X3FA 3VBQA 1LDDA 4GCVA 3TKHA 1OITA 4FNWA 3G1MA 4OIQF 4E5BA 4WD5A 5DI1A 1ETOA 2R7ZJ 5I4NA 3MD2A 2V9KA 3CCEI 1UFMA 1QPJA 3BKBA 3MFTA 3NQOA 4X0GA 4F6UA 3A4PA 5DWRA 2CNQA 3UNJA 3GI3A 3MWUA 2JUCA 2XIKA 2WY8Q 4FSZA 4LG0B 2BTSA 3CEKA 2H27A 1KA8A 3MH3A 5ICEA 3LOCA 3LIJA 3M4OJ 1YI3A 2IVMA 4CD0A 4CCMA 1NVRA 4V0GA 3LLAA 2W4KA 2EFQA 4NQWA 4UV8A 4YIIA 2Z02A 3BU5A 1BKXA 1P6RA 3TXOA 3VBVA 2BFXA 3HPHA 3LFBA 5JT2A 1O57A 3NNXA 1XH5A 2PX9A 5G6VA 3TO7A 3FKOA 4RB2C 1O3RA 3CJQB 2Y0MA 2F4IA 2VTTA 3C18A 4HVDA 3II5A 4Z6YA 4IB0A 4UV0A 2HPIA 2E9OA 3E8EA 3PUFA 4KN7X 2AYPA 3V6RA 4YJQA 4P4CA 2L9VA 3R9DA 1ZG3A 4B4CA 5C4LA 3N97A 4BBRJ 4WSYA 3FC1X 4ENMA 1JI8A 4ALWA 3NYXA 3EQCA 4V2GA 4XR6A 3LA7A 3LQ5A 4FV9A 3NEWA 4EGZA 3F3ZA 3ZXZA 5KO1A 2DA2A 3WE3A 5HIEA 4IX7A 4TWOA 5HG8A 2Y4IB 3DXPA 4KABA 3ROCA 1CTPE 3L9LA 2VQGA 4P2KA 4LG3A 2W85A 5LMBA 2V9VA 3EFJA 5EQYA 2OO8X 4E5WA 1W4MA 1VQ8I 3VNTA 2XF6A 3HOYJ 3HZTA 3GCSA 1LUJB 3D2IA 3K4MA 4FIJA 1MSFC 2Q2EA 4EOMA 3SXRA 3IHUA 2XVDA 2ESHA 1PMUA 4ASZA 5BPDA 2GHLA 5M3FJ 2XK8A 4CFXA 3U54A 3TYKA 3WF5A 4UYAA 4R79A 2Z2WA 1PXKA 4PTCA 4GEOA 1U54B 3PPJA 5E8WA 4BCKA 2XF5A 1JSTA 5F1JA 3U51A 3SV0A 2YJRA 4V0GB 3UIUA 4I4EA 2ZCWA 4XUFA 3ORZA 2G9WA 4YTIA 3TZ8A 3CUQA 3DTEA 3QRKA 5FBOA 4JQEA 3QUPA 2WEVA 4C9YA 2E2HJ 3FMJA 5BVOA 2H94A 3KMMA 5ACBC 4ACMA 5HLTA 5A4TA 3CQEA 4CQEA 1JTYA 4QT1A 2ID6A 2M1BA 4GFGA 2FSTX 1L8TA 4XP3A 3QCYA 3U6JA 3LW0A 1ZYDA 4LRKA 4Y13A 2O7OA 4O7ZA 2YWVA 2VX3A 3ABMH 2EXCX 2X8DA 2YIRA 3GWZA 1G8KA 1BI1A 2V79A 1XGMA 2JAMA 1JKLA 5HE1A 1DPRA 3CKWA 1YIOA 4HW7A 1GLNA 4ENJA 1Q8WA 1YS6A 1JJ6C 2P0CA 4P7EA 4AACA 3P08A 5EEGA 5D4SA 2WNTA 2XS0A 4LM5A 4U5JA 4EQUA 4Y46A 5CF4A 4XJ0A 2K9QA 1WBWA 3KYDB 3SRVA 3ZN1A 4PDOA 4JX5A 4FSMA 3DKGA 1DQUA 4NT4A 2OGVA 2PZRA 2ETRA 2IVUA 3R01A 4UWBA 1Z77A 4HYSA 3W8LA 5M5XJ 4ZJVA 3L2CA 2V1UA 3WE4A 4IB3A 1KU2A 3OZ6A 1O3TA 5L6PA 5EW3A 3K10A 2JQ7A 2X1CA 4TNBA 1G8AA 4QLCU 4BDGA 4A5NA 1U54A 3DBQA 4RIOA 4BTKA 4FOCA 3JY0A 4BCHA 4CT2A 1DP7P 1MBKA 3JAMK 4BI0A 4DT8A 5FKKA 1KWPA 4EVIA 3MPAA 4C3FA 3FI4A 3CO7C 2A07F 1Z3YA 4IZYA 3ASOH 1SAUA 1ZYCA 4EH9A 2R0UA 2IZSA 1ETVA 1YE9A 4KKGA 4MQ2A 3SXSA 4CMOA 4IAFA 3MFUA 3KIOC 1OYIA 5IY5H 2C68A 3KFWX 4F70A 3BQRA 2HPMA 2OXYA 1XMXA 3LCOA 3CP8A 4EM2A 3BZ3A 1WBPA 1DI9A 4XLEA 5FJ8J 3SKCA 3SDJA 3MSSA 4GYIA 4XONA 2JKOA 2JZYA 5D8LB 3BTIA 4N57A 3UIMA 2CV1A 3OYBA 5B1AH 4D7MA 3PXRA 2PVKA 4RVLA 5EYDA 2ZC2A 3QCSA 1ZLJA 4JDKA 3LSMA 2OZOA 3A7GA 2VTAA 4G7ZF 5DCMA 2LGCA 4I2OA 5I5ZA 4ETSA 2R4BA 4AXAA 5AJQA 3FXJA 4DZJA 1IA9A 2RFDA 1FOKA 2XJ1A 1DPUA 4E93A 2STWA 3AD5A 4G12A 2HKOA 2YIYA 3I59A 3EDPA 4NC6A 3G9LX 3U9NA 1WRJA 1E3PA 2VI6A 2J0MB 4HCTA 2O8YA 4RRVA 4MWIA 4AUXA 1U3EM 4DBXA 2M4KA 2WXVA 4PFPA 3CC6A 1JGGA 1G3TA 3KRRA 4Q5EA 2M8GX 3F82A 2JDRA 3N4TA 3VYTB 3DLZA 3Q4ZA 2BXZA 2LSOA 3A0BC 3M8EA 4OMZA 4W97A 4L3LA 4DFYA 3QF9A 4PDSA 2R3OA 2BZJA 4HJOA 4RWIA 1TTYA 3ZSIA 4KNYA 2QQBA 4PWNA 2DQRA 4G16A 5AEPA 3PPZA 4LL0A 4IWOA 4CFFA 3I4BA 1ZWSA 4NQWB 1BR1A 5JVGF 3RM6A 2JIVA 1X2NA 4EOQA 4IQ4A 2BUJA 4KNBA 4Z16A 4MIMA 3J7AY 2VE9A 4L3JA 4LFUA 1V0BA 2KRCA 5AMNA 3TMOA 3ELKA 2V9PA 2W1ZA 2XIGA 4NL0A 4CZTA 1K4TA 1ZRDA 3IW5A 4BDYA 2F2CB 2XH5A 3SQQA 2XVCA 3GTLJ 2VTLA 5M09A 2LREA 1IEPA 4NB5A 3GTKJ 2DPDA 3PUPA 1FMVA 2BW3A 1U59A 5C03A 2EWAA 5IQCA 2WU7A 4OTHA 1JE8A 2LF7A 1P2AA 1XX5A 4LMNA 3RJCA 4PTEA 2WHBA 5BUIA 1IRFA 4RMZA 1BYGA 4YJNA 4YNEA 3WF6A 2VV9A 3GU4A 4F6WA 2E1MB 4C4JA 3W3CA 3PXYA 2VN9A 1QMZA 3EUKL 4C4HA 3W2VA 5IA5A 5IT9K 2KFDA 3FKLA 3PSCA 4KITB 1PMVA 2PVHA 3GFWA 3JRCA 4IQJA 2E7WA 3WTYC 5HVJA 1EH8A 2DMPA 3EOCA 3P7AA 2QKWB 1WAKA 3BPVA 1T95A 3RCDA 5CX9A 1IV6A 2HQAA 2YIWA 2WB1A 2X48A 4FKOA 4YLLA 5A2QK 2M0CA 3KULB 1FPUA 4OOIA 1KYZA 3BYVA 4ANLA 1ZR2A 3WGIA 5T3QA 3C1DA 4JAJA 3DXNA 3F3VA 3ERMA 2V1XA 2FBIA 3VBYA 4HQEA 2XIYA 1APLC 3OC1A 4G9RA 3ZMDA 5BMZA 3A7IA 3FWQA 4BKXA 3ZRMA 1DU0A 3DBRB 1H24A 4KWPA 5ANKA 4CFVA 4EBWA 1D0ZA 3ZRLA 3TEIA 4PJ0C 4FT8A 3OYHA 3AC3A 5AP0A 2RFNA 4XOPA 4OTFA 3RKWA 3AG2H 4E8AA 5J1RA 1OL5A 4TKSA 3HGYA 4L0YB 2WELA 3LFQA 4ENYA 5E92A 4ERWA 5TR6A 4WWCA 2HZ4A 4ZSJA 2E2JJ 5BVNA 1G4DA 5CSPA 3QODA 2NNNA 3KEXA 1M2PA 4IQ6A 1FOYA 2OJFE 4A3JJ 4UB6C 1FSEA 3PZEA 4HYIA 5A54A 1W5TA 2XAQA 4F91B 4FIGA 4FE7A 4GS6A 1DAYA 1HKSA 2VOPA 4HLYA 3FXOA 4F4PA 2RG5A 4DBNA 2X1EA 1YITI 2DK8A 4O3MA 3V5QA 3OWJA 4JXFA 5JR3A 3KZZA 1G8SA 1IAWA 3ORLA 2IVSA 2GHMA 4ESBA 1G3WA 1T45A 3FY2A 4UUSB 3DDQA 5AP3A 2ZM4A 1XSDA 2OJ9A 2DA5A 2Y9YA 4TYGA 5KHDA 5I9XA 1QPDA 4XLCA 2JPCA 2Y30A 4X2GA 1I09A 2XAUA 2F48A 4XRMA 4CSVA 1WFCA 4HPQA 2CN5A 4IHPA 5E3MA 3Q5IA 2F5EA 2XPWA 2X8EA 4E6DA 3DKOA 5FQDC 2H96A 5IEVA 1DM2A 5KHXA 3F3WA 4XEYA 1WH7A 3A01A 3F2RA 4MX9A 4JBAA 3GOKA 4FUYA 4GVAA 4RFMA 1B6AA 5E8GA 3IRRA 2VONA 2XASA 5GPAA 4H3PA 4TTHB 4FV3A 1G6NA 3TKUA 4KBCA 2Z7QA 5F20A 5J4YA 5H9BA 2JDTA 4X3FB 5LFAA 3WZUA 1T46A 3BR6A 2NYAA 3OD6X 3FMRA 3WTVC 5HLIA 1ZR4A 1OUKA 2J4ZA 4R5SA 5GIPE 1ETWA 4L9TA 4DFLA 1SZMA 3IP4B 2VO3A 4LOPA 2NAZA 1VQLI 4JRNA 4M13A 3C2BA 4PCQA 3F2NA 3FZPA 3FLZA 4I92A 1V5FA 2R93J 3EN6A 4QMOA 2HW6A 3L7WA 4B09A 4U9AA 2XRUA 1R1WA 2NS7A 3I4NJ 2PVNA 1T56A 2FA2A 2GNLA 1VI0A 4N0SA 4PF4A 4JL9A 3DLLF 1JKQC 2IPXA 4ZP5A 1PKDA 1MMGA 2IXSA 3PZHA 2QVSE 4FV0A 4DGGA 2DDAA 5CJ9A 2P7CB 2AHQA 1YQJA 3JYAA 5EM7A 4E7KA 1WKMA 4A3LJ 4QP6A 1NXKA 3OTUA 3GFEA 3SLSA 2B1PA 2Z99A 3ENHA 3UDZA 2ZFUA 3RPOA 1DGWY 2KJBA 3RYRA 2ADUA 4G7HF 1XO2B 4AZSA 5CANA 4KIQA 1WCCA 2W1FA 3IUOA 3PVWA 3BRBA 3GZNB 4U88A 2IT0A 4YJSA 3WGHA 2YZAA 1ZELA 4GJ2A 2F2EA 4IZ7A 5F27A 4C2WA 5AWMA 4I3ZA 3KVWA 4O22A 3LMHA 2KHMA 3SVVA 3QA0A 5EEAA 3RCJA 1PJKA 1H01A 3P7CA 4CMUA 3CGOA 4GUBA 2WMTA 1D8JA 2XHKA 4AT4A 4KUJA 4FR4A 4IHYA 1OCZH 3R21A 2Y31A 2CO5A 2E9PA 4ZSAA 3WIGA 1FOTA 2X85A 4ALUA 4C33A 2R9SA 4F09A 3L1SA 2WTCA 2HENA 2PVFA 5DNRA 2FQ3A 4O0TA 3DPLC 2Z7SA 3ETAA 1BW5A 3OYNA 1K3AA 2QVOA 5E18F 4BDCA 2A05A 1ZYSA 5KX8A 3SRVB 2KZVA 5CENA 1JSVA 4HV5A 2H6CA 3CUQB 1HXDA 3K7AJ 2EZIA 3BZKA 5IQDA 2ICWG 2OF4A 2QKMB 4U40A 4LITA 5BQTA 4IAYA 3BYUA 1T98A 5J8CA 1A9UA 4X1EA 3PY3A 3TZMA 1JTXA 3BWGA 4XG6A 3JREA 5D9HA 5LMKA 1QNTA 1U9OA 2IG7A 3GC9A 2FUG2 3MZHA 3HYIA 3LCKA 4DGMA 1CKJA 3CPBA 2BOLA 4BJ6C 2G7HA 2MC4A 1NG7A 4M74A 2UZLA 1M2RA 3DNEA 3RTPA 1JVPP 2GTMA 3JW4A 3AKZA 3G90X 5GINE 4FA2A 2GNHA 1UKIA 3FMKA 4QQTA 3LA2A 2Z8CA 3L9MA 3PVUA 3RJPA 4N9HA 4BGDA 1OQYA 3COMA 2C6YA 2DS1A 2LKSA 5A3XA 4A4LA 4A0YA 4EOKA 3FHNA 1CF7A 4IZZA 3OY9A 2PZIA 5FM3A 4EQMA 4NJ3A 3HVCA 3NPCA 3VODA 1HF0A 4C36A 4DYRA 3H36A 2M5WA 3W0MA 4QEBA 2XKCA 4QIWN 1LEZA 4RLQA 3RM7A 4TWCA 3FXRA 2V6EA 1ORKA 3OTVA 3BCAA 2F4JA 3BG5A 5E1WA 2C3LA 3KEYA 3R60A 1S9IA 1IUYA 3PJ2A 2K86A 4D9UA 4DCEA 2D1VA 3UNKA 1YDRE 3Q2MA 2XGCA 3OCTA 2GA1A 4BY7J 5LARA 3JRHA 1J7KA 2HXLA 2CNVA 5A4EA 4JR3A 1APME 4IACA 2JRTA 3IECA 3IAM2 1XS9A 1XBAA 2FX0A 2L9NA 3W6JB 4G6OA 2K9MA 1Z9CA 3BL9A 1BC8C 3UMXA 2FD5A 2ZFWA 5DUKA 4NU1A 1NVQA 2OIQA 3HUCA 2VODA 5GAGJ 5IOYA 2GTNA 3HG9A 4EUTA 4CFMA 1GUUA 2JK3A 1H8AC 3H30A 5LHGA 1DUXC 2RKUA 5DRDA 2W48A 3IH2A 5KNJA 1MNEA 1XPXA 2V1NA 3Q9YA 1JAMA 2I0EA 2YM6A 2YISA 4GSBA 5E8XA 3R83A 4XS2A 3HRTA 3OFMA 2ITUA 4I24A 4FKIA 2B9FA 5CVUA 5CY3A 1FC3A 1WFXA 4IOCF 4RQVA 2D45A 3SG9A 3S8PA 2DW4A 2WADA 5HLGA 3WTTC 2BIYA 1S29A 2NO3A 5HDKA 3BLQA 3QZHA 3V5LA 3HV4A 3Q4TA 4ZZMA 2J0LA 4FSQA 4IVAA 4FZ6A 5CI6A 4YFXF 1QA6A 3MMYB 1UU7A 3TKIA 4FTKA 3HLLA 3AC2A 4GL9A 4FETA 5DT3A 4XBUA 2XF0A 3W2PA 4X2JA 4XORA 2YITA 3C7QA 4QPOA 4D2RA 4XN0A 3BY6A 2FYSA 3CTHA 4ENNA 1PRYA 3KXXA 2JDOA 3VBWA 5DA3A 4ZC3A 2DYLA 4PJLA 2O2UA 2JEDA 1S7AA 4XV1A 4OUCA 3PVGA 4H36A 3DWLE 2BY3A 3U6HA 4U7DA 2WAFA 2L4AA 5DGZA 3P86A 3SJMA 3WYXA 1HCLA 1WPKA 2ETKA 2LG4A 1TQIA 2BEOA 1MZBA 1EV7A 3ZGKA 2HNHA 4G2FA 1HOMA 4OAYA 3QOPA 4ZXTA 1ZRCA 3TDZC 4WRSA 3KULA 2BW3B 4FZ7A 1FIAA 1B4AA 2B55A