3TMOA

The catalytic domain of human deubiquitinase duba
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
141
Chain Sequence
b'AARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTU domain-containing protein 5
publication title Phosphorylation-dependent activity of the deubiquitinase DUBA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 33
structure length 141
sequence length 158
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tmoA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tmoA01
3PFYA 3TMOA
chains in the Genus database with same CATH superfamily
4Z6YA 3BYVA 4PZJA 5M3MJ 2ZV2A 3MV5A 1WBTA 3G1LA 3ZN0A 4YPDA 4U43A 5IH6A 4N70A 5ANDA 2FEZA 5CJ9A 2GS6A 2GQRA 4CVAA 4HGTA 1FGKA 3SRVB 4BDZA 3O51A 2C5NA 3GENA 4MWHA 4C33A 1CSNA 2COMA 4IEJA 4M7IA 2DT5A 3LQ3A 4D1QA 4LITA 2YEXA 1QPEA 2VQCA 2VTPA 1ZYLA 5J40A 1WJDA 2OAZA 3K4JA 1XBCA 4AXDA 1H9GA 2C69A 3D7TB 2P4WA 3DOGA 2XV4S 3H10A 2PWLA 3ZC6A 5EQPA 3DS6A 4D9UA 4F6WA 4E4NA 4AUXA 1X1CA 1RUNA 5TGTA 1FBUA 4DGOA 1Z05A 4OLIA 1AD5A 1UVRA 3MN3A 4C3FA 5H8EA 1CTPE 5J47A 3CR0A 5CQUA 2FNAA 2LYCA 4HYHA 3LPBA 4AW0A 4B4CA 5IISA 5HS8A 5IMXA 3UE4A 1IN5A 3HIFA 5C4XJ 1U5QA 5L2SA 2XK9A 3Q5ZA 1H25A 3NAXA 1EH7A 3TOAA 1EH6A 2VONA 2DA3A 3ERED 3VHEA 3L9PA 2MBFA 1FBNA 4PDYA 4GKHA 4MTAA 3CC6A 2PUNA 2RFEA 3CO7C 1BUHA 4FV8A 5FG8A 1XDUA 3QODA 1JSUA 1STZA 2FSWA 4MQ9F 3C2HA 3P4KA 3POOA 2M9HA 4PV0A 5JGAA 2ID3A 3P7BA 5LVNA 5JZNA 2JKKA 3RYRA 3QA8A 2DT7B 4XLVA 4U41A 3GUDA 3PUPA 1H24A 4BYYA 1UU8A 3HC7A 3Q0VA 2X6WA 2FQ3A 2UVXA 3QHWA 1M2QA 3OYKA 4DJAA 3IKTA 3FI2A 5DCMA 3VBWA 2M30A 3MH1A 5H9BA 1WI3A 3G6EI 1JUPA 4I93A 4HYSA 3JPVA 3I60A 4IM0A 3E8CA 3HHGA 3JRFA 2WOUA 3UKGA 4RM3A 3KCCA 2J51A 2NYXA 2CHLA 1N75A 2IGMA 5FFZA 4BJ6C 5F04A 2PPQA 1R1TA 4HVIA 5IZFA 4EJUA 4FK3A 5C3EJ 4FKWA 4NNJA 3AQVA 3GU6A 3AKKA 4B4LA 3PP1A 2QO9A 5HE2A 4ANBA 1F1ZA 2KKOA 5LGUA 3I1AA 1OKYA 4USEA 3W10A 1SM2A 2WB8A 3S3IA 1YJNI 2BW3A 3JS2A 3OOUA 3WGGA 3I81A 5JH6A 1H88C 1BIBA 1O3SA 3OEZA 2QR7A 1ZGAA 1BW6A 2R3OA 3DLLF 5CX9A 4AXEA 1A48A 3JRAA 3MYGA 1TWCJ 3NIZA 3VPRA 3SKCA 1FMKA 2IPXA 4FT9A 3OS3A 3V42A 3CPBA 3HSFA 3LSRA 1FMOE 3TL8A 3VBTA 4V01A 4LFIA 5CLSA 3V04A 4BCFA 1GXPA 3OD6X 2BFXA 2VV9A 1I1GA 1JKLA 1ATPE 4FHTA 4AM3A 5IA0A 3QQHA 2CH0A 4BYIA 4DYCA 1ZRZA 3M9AA 4N6ZA 4OIQF 3V5LA 4IX3A 3IW5A 2XAJA 3QU6A 1VZ0A 2FSTX 3RMFA 4P1WA 4U81A 1U4DA 1VJYA 4F0GA 4EMSA 4R7BA 1CKIA 5E1ZB 2WMTA 1FSHA 2UZVA 3K54A 4FE2A 4B47A 2R3GA 4GGGA 2PE1A 3BU6A 4BDIA 2IS4A 3OC1A 1PYXA 4EKLA 3DBDA 2DOEA 4M6VA 5G1XA 1AWCA 1VFCA 1U78A 3K2LA 2WO6A 2JPCA 3CP8A 3TO7A 4PJNA 3AAFA 5F20A 4E7LA 5K4IA 2XKOA 5BVKA 5LEJA 4X3FC 3NUAA 3PIZA 1Z9XA 3DTKA 4CMUA 2Q1ZB 2BDJA 4BDBA 4PJ0C 2QODA 4JL9A 5AIKA 4H1MA 1X3WB 5IQFA 3ULQB 5AIQA 4FTCA 3WTYC 3W0OA 3ZQGA 2R7SA 1KUTA 2IGOA 4O6LA 4XORA 4EONA 4L3PA 2HKXA 4GL9A 3MCZA 1P4OA 2DMUA 4NL0A 3CQEA 3CTQA 1YI4A 3R28A 4MBIA 5L2TA 1SAUA 4OIOF 4EHEA 4HPTE 2QBYB 2DN0A 5BVEA 1SD7A 2UZWE 4WF2A 2BZTA 2VX0A 1ND4A 5EDRA 4CFMA 4EORA 3K4KA 2YDJA 1XX5A 4DHZA 2EFNA 5ILSA 3SZGA 5J1UA 1Y1WJ 2PBIA 5J8IA 1EH8A 1BW5A 4IL6C 2R4BA 4IVAA 2VQLA 2E9PA 2YCSA 3LSIA 3OXIA 4ZTJA 3LKMA 3R04A 2ME0A 2P8TA 1AKHA 3DKWA 2JKQA 4ZY5A 2GCDA 3GW2A 3OYBA 3FYJX 1REJA 5KMKA 3R7YA 4TYHB 2OC6A 1SFKA 3U54A 3QC9A 2GTMA 1Y56A 4L6QA 3ETAA 1P9QC 3C9WA 4HZSA 2LKXA 2OICA 4MNEA 5J1WA 3SXRA 2E1CA 4D5CA 3W6KB 4WSYA 5IA3A 2KHMA 4Z7GA 4HSTA 2XF6A 2BZJA 5BV3A 1R36A 5IUHA 2STWA 5HNFA 3KL8A 2HDCA 2B0LA 2NNNA 1YWRA 4A4OA 1S29A 4BBSJ 3BR6A 2QSGX 3QQLA 2M0CA 1FIAA 2GXAA 3K7AJ 2OD5A 2IA0A 4RMZA 1SVMA 4RX5A 5EKNA 1OUKA 2QC6A 4HGEA 2BY3A 2ETMA 2HY0A 5FTOA 4I6QA 1H0MA 5HLTA 2R0QC 3Q2JA 3BYUA 2WQMA 4MQ2A 3GCQA 3W2PA 3K5VA 4A0ZA 5ETAA 1J2XA 1ZZ2A 4RB0A 1PXMA 3OS2A 2WQOA 1BA5A 3P5JA 4A3GJ 2KRHA 3ZPLA 1IDZA 3KK9A 4FMQA 2CQKA 2YN8A 1I3QJ 3HMOA 4BRXA 2CLQA 2R3JA 3EQLF 3U9CA 2KLOA 3IAS2 3FBIB 5DTDA 1SMTA 3PRFA 1JAMA 3U21A 5ICPA 2XPWA 2XF0A 3H3CA 5AUZA 3COHA 5E79C 4M12A 3TT0A 4BTJA 4CG8A 4RA4A 1WBSA 3AC1A 2J0IA 2VN2A 3EQDA 5LMKA 3RPSA 2ZNZA 5EG0A 1BN5A 1APLC 5HLPA 3NNVA 3E6CC 5CVJA 3H5NA 3PJ3A 3IRQA 1F36A 3AC3A 4DEEA 4DHJA 4C0TA 2HENA 3EDPA 5FTQA 2L7ZA 2FMYA 1UHSA 2PLYA 1HA8A 3ZRGA 3BLHA 4I7HA 5AUXA 4S32A 2RF9A 3ZM4A 5AV3A 2IW8A 4JBQA 4L00A 4QQ5A 3BTLA 2GFCA 4O0RA 4W4WA 4CMTA 2K3FA 2Z1DA 4ZMFA 3DFGA 3EKNA 4IAAA 2YZAA 4S0HB 3P0MA 3R83A 3QF9A 1Y1VJ 3HRBA 3BZKA 3MIAA 2F7ZE 3MVLA 4DZPA 2PI0A 2W99B 3NFGB 4LQMA 1MBKA 2C6KA 5IDPA 1PXLA 2QURA 3C51A 1H1RA 3TTJA 5IA2A 3CJTB 4KICA 3ZRLA 1BI8A 1CKJA 4YEJA 3ZMVA 2V62A 5BS6A 3IW4A 4MXOA 2F49A 3BE2A 4BEHA 4O7WA 4TYEA 3BWFA 4R3CA 3NAUA 2LY1A 5J9ZA 3K70C 1VQ6I 4C7TA 4YTCA 4GG5A 4KNYA 2VJJA 5CT7A 4LOCA 2YZLA 3KP6A 3TACA 2F7EE 1WJCA 4O22A 2C0TA 3V8SA 5EM6A 4A3DJ 3KMUA 2X39A 2O65A 3C1XA 3M7GA 2PUUA 3Q4ZA 3V6RA 4EM0B 3ZSHA 1R4MB 3VODA 2GS2A 4MFEA 3IC7A 4FSNA 4XHKB 2XKPA 3R1YA 2Q0OA 4HSRA 3TIYA 1F43A 5HKMA 2P3GX 4LIVA 3R6XA 3H0DA 2QCSA 2IO6A 4LRMA 3QL8A 4CUGA 5E92A 3VSKA 3K1NA 4BCHA 2LY2A 4KBCA 4FKJA 4DYRA 3WARA 1LE8A 4U45A 5J7HA 4D0PA 3Q96A 1FBQA 2CG4A 2QQ9A 2XH5A 5H8GA 5IQGA 3FDYA 2XIGA 5IEVA 4FV6A 2ETRA 2TRTA 2JIIA 4QYEA 2PMLX 5GAGJ 3QQFA 3JTHA 2HKOA 3BZ3A 5IP9J 4KKHA 2PY3A 3COKA 5BVNA 5DBXA 4BBMA 2IA2A 2I8DA 4KSQA 1SNXA 5K3YA 5DM7F 3BTJA 1PJKA 4CYDA 4FCYA 4IWDA 2J0LA 4QP8A 4NC7A 5IA4A 3MW1A 1NA7A 3ORPA 1SFXA 3MKLA 4RVTA 4A07A 3GI3A 3VF8A 4ASNA 3UOKA 3VS4A 2WZJA 3LL7A 1FP2A 2OZUA 5ICCA 3CCMI 4AZTA 2HOEA 1N77A 2ZXIA 3UNZA 2CV2A 1AGWA 1P6RA 3QZHA 3R7VA 4EZ3A 2CUZA 1JGGA 2KZVA 1U9NA 3PLSA 3WF7A 2IJMA 2F5DA 2NPQA 3ZMUA 4ZH4F 3HUGB 5LRRA 3HOWJ 4ZJZA 2W57A 2W9ZB 5D5XB 3PXKA 3OYEA 1D8JA 1EJ9A 3T3VA 1XGSA 1J7UA 2OKRA 1P5EA 3TZ7A 4EUTA 2Y7JA 3R73A 3EQHA 3R9RA 4TL0A 4EJ7A 3HECA 3P5KA 3HOTA 2WMVA 4CTCA 4YFXF 3IWZA 2FVDA 4RC2A 2VODA 3VW6A 1YVJA 2CN5A 4AA4A 2B7AA 2ETKA 3IKAA 3DDQA 3PWDA 2PVJA 2QF7A 3GZ5A 4AQCA 2XCHA 3FDNA 2R64A 4FVQA 2HEOA 4H1JA 2W1IA 2VNYA 4UUSB 2OH4A 2W1DA 2UZEA 2XK8A 5CU2A 4EK5A 5EDQA 1XMMA 4E93A 2A07F 2W4KA 1B72B 4OBOA 3Q2MA 3GC7A 5DR9A 2K7LA 2PZ5A 3ZOBA 4PP7A 1M1EB 3LLAA 4LMYA 4Q9ZA 3MKYB 5AV4A 1KQ9A 1LEBA 1OFCX 2WMQA 3PSIA 3JR9A 1VQ8I 3BQYA 2P55A 4IAZA 3IONA 2VWIA 3R9DA 3AMAA 4BIBA 1GOLA 2Y0SA 4NKSA 4YNOA 3SAYA 3DXJF 3I54A 2GA1A 1YJWI 3IAM2 3W2AA 4H36A 5AP5A 3DXNA 3DTEA 4CYCA 3GCVA 2R7QA 2X6OA 4XKWA 4L5IA 3IGGA 3RI4A 4CZZA 2PVKA 1D5VA 1LKXA 3F5XA 5EM7A 5J3LA 1OR7A 4WBBB 1S9HA 5FKMA 3KN5A 3LXNA 4K8AA 3R02A 2BIYA 4YU2A 3QU0A 3QPTA 2EV0A 3EETA 3T8RA 3QU3A 1SYKA 4Q5EA 3LFUA 2M4GA 2Y69H 1MIJA 3AMYA 4I01A 3B6CA 2XPVA 4DDGA 1KE6A 4BGGA 3J7AY 1M14A 2E9NA 2ELKA 4ZZDA 3D9VA 5HHWA 4L52A 1Q8ZA 3TNQB 4J8NA 3WTZA 2BRHA 2J4ZA 1TWAJ 5JKGA 2K9SA 3A4CA 2R3RA 3CQWA 4TNBA 3S2WA 2CFOA 2L4MA 4AXAA 2VNWA 2VJ5A 3U87A 2R3SA 4DLIA 3H5AA 2UZBA 4A12A 5J6XA 4D7NA 4ZTFA 5EZHA 2X8EA 3TYKA 1WVWA 1ETOA 5DEQA 3O8GA 1J7KA 1BI0A 2HCKA 3C5UA 2R3MA 4O91A 1K83J 4D0WA 3OWTA 3Q5FA 3J81Z 2DO7A 3OXZA 4F93B 2RDPA 2ONLA 1J3HA 4PJLA 3BBWA 3HPGA 2IW9A 1XSDA 4KA3A 2PZYA 3OYLA 4RWKA 3W0SA 2VTQA 4A0XA 4HYIA 2CUEA 4YUQA 5EI6A 3SX9A 3R21A 2Y30A 1ITYA 4FASD 3D83A 1YHQI 1YFHA 3DF8A 1E3OC 4F78A 3MEXA 2DBBA 3MGYA 1MMAA 3Q04A 2B63J 4FKLA 3FHNA 2WOTA 4KYWA 3ABLH 3MD2A 3TKHA 3ORKA 3PNVA 4K1BA 4O6JA 1R9TJ 2MH2A 2WEIA 1H4LA 3PJ8A 4QPOA 4II5A 2E2HJ 4D4RA 1DQUA 2EILH 3R60A 5AUUA 3CPCA 2M8GX 2YR2A 1M2PA 1TL8A 3LLTA 4FZ6A 3A7JA 4CRSA 5I0BA 5AP0A 2L02A 3CGFA 3DBFA 1JKPC 4ABZA 1JSVA 2EK5A 4L01A 2D1VA 4XBRA 1WWXA 4BCIA 5HDKA 4O0UA 4P2KA 3RQIA 1R4NB 1I3AA 3QZGA 2QKWB 2XNBA 4BHPA 4BHBA 3PIXA 3FKLA 3AC2A 1BC8C 1YDTE 2R3PA 4XEYA 3TI1A 4XOZA 3CC4I 4G8XA 1O57A 4BDYA 2WIPA 2FSLX 4C4JA 4HVDA 4JIKA 3UR3C 2YIWA 1YXXA 4IW0A 3FMDA 1T95A 4S31A 3BGQA 4BKJA 5AUYA 1OPCA 2AQFA 1O9UA 5DUKA 3ZZEA 3BRBA 1PXPA 3OCBA 1M7NA 3IW8A 1ZYJA 3ACJA 5BUIA 5EJCA 3ZEWA 5E91A 1KA8A 3G2BA 2RGPA 3D7ZA 1XH4A 4ERWA 3LAJA 4BUPA 2HI3A 2OUMA 3OIQA 1PMNA 5F0FA 1XBAA 4BTFA 4LUEA 4BI0A 3SG9A 3DZOA 5CLPA 5K5NA 1BI3A 3HMMA 4LJZF 2CUFA 3U8WA 2OU7A 2BHZA 3NPCA 4BICA 3ASOH 5GINE 2UZTA 3FIWA 3FMHA 1A06A 2WMUA 3UVQA 1HCKA 3FUPA 5EM8A 4M3QA 3MVPA 4BGHA 2Y8OA 4GYGA 4KFCA 3OYGA 3W8QA 1GZOA 3SQQA 2BUJA 4TWPA 3CSVA 3BR1A 4LL0A 5B2LA 5KMLA 3R7EA 3P9IA 2DA6A 3PQJA 4I5MA 3OYCA 4PGGA 4BGQA 2G0EA 3KF4A 2WTCA 1UCRA 4ZZLA 2O3PA 4JJRA 5FP5A 2B9IA 2ISZA 4ENXA 1ZGJA 3RSNA 4RAZA 3DCVA 3TUBA 5CQEA 3WTXC 4C59A 4JQFA 5K7HA 3JYAA 4B99A 3SDGA 1OB3A 3MZYA 3NW5A 1R1VA 5K4JA 3BC8A 1YOJA 4DH8A 4BNCA 4LG0B 4LGGA 4C61A 3DDPA 3AC5A 4ZJJA 1YITI 5HO8A 3NX8A 4X21A 3RPQA 4NTTA 4X2KA 1HDPA 3TW6A 5HLGA 4BCMA 1OYWA 4NQWB 4OTFA 5H6QA 4M8TA 2VE8A 4AD9A 1XGMA 4CGAA 3TO6A 4ZP5A 4AAYA 3QGYA 1YOLA 2EFOA 1OIQA 1OCTC 4EKKA 2DAOA 3NRVA 2B9FA 2C30A 4XV9A 1UKHA 2WTKC 5D4RA 2PZPA 5IYBJ 4UUVA 2VWYA 3TZMA 2JSPA 2A6EF 2R7WA 4G6LA 2DYSH 2CU7A 1A9UA 4YZCA 4HVSA 3RGFA 3A8WA 2OF7A 3RM6A 2R7TA 3PVBA 5EHYA 3L8PA 2Y0MA 4FG9A 3JAMK 3CCJI 2WNTA 1QZZA 5J87A 4FSMA 3A62A 1YS6A 5F08A 1FT9A 3UC4A 1NXKA 3R8LA 3OCSA 3V5PA 1YHWA 4LL5A 4J52A 3L09A 2XKEA 3F5PA 4EH2A 4W4YA 2LMDA 4QO9A 4I6HA 3K4NA 3HSRA 4WG4A 3KFWX 4JX6A 4P4CA 2WA0A 3OY9A 2QSFX 2V9KA 2XIKA 2NP8A 4G16A 3DQXA 3CZ6A 4QMVA 3GUBA 4ANLA 1O6KA 2B53A 5JK3A 1VQOI 2W96B 4L9IA 3RDIA 4E6KG 4OUCA 1T0FA 3LFAA 4M68A 4U7DA 4KISA 1USSA 1DGRM 4JG8A 3ANQA 1G59A 1BR2A 2Z7LA 3EMGA 4PWNA 3UC3A 5GJDA 3WTWC 3LA7A 4M74A 5C4LA 3RVGA 2VXDA 1VQ9I 2DA7A 2HK5A 2JDSA 3L2VA 5D41A 5ACBC 2XP2A 3QAHA 2UW3A 3AGMA 3UTOA 3FZTA 3PTGA 2PG4A 3R6SA 1H0VA 4D1ZA 1XR1A 3UBDA 1TWHJ 4U0IA 5D11A 3MH0A 4XR6A 1O6LA 2XIXA 2OIBA 3DEEA 5HVYA 3WF9A 4EH8A 2FBHA 2OJJA 2GZWA 2A5WA 2Z02A 1TWGJ 3D4QA 3KXMA 4B0GA 2VC0A 4KRDA 4DGMA 3TZ9A 3CLQA 2QM3A 4X0MA 3B6AA 3FSKA 3SFZA 2L7FP 3QQJA 4CFNA 5C01A 3DQVC 1GVDA 4I0AA 3J81K 2GWRA 5M55A 3VQHA 4BY1J 2YIQA 2YM7A 5AEPA 1WBWA 5C8KA 4DEAA 4ESBA 4IHYA 2MABA 4MK0A 2NXNB 2YCFA 2R5TA 1JVPP 3AMBA 4QQTA 4NWMA 2R3LA 4YZMA 3HRTA 4IWOA 1WJ5A 4UWBA 2QI8A 3UNKA 3EWHA 4QP2A 2DK5A 3ODZX 4CGZA 4BTMA 2YM6A 5IT9Z 2RN7A 1PYEA 4O27B 1BLXA 4ENNA 4QSHA 2LR8A 3VBQA 1FVRA 4JNWA 4R7IA 3R00A 2E1MB 3MTFA 3FLWA 2R7IA 3KXNA 1FTTA 3REOA 3R0AA 4BJJB 1JKTA 1WHUA 3V4GA 4HQEA 3EZRA 3VDXA 1PHKA 5BNGA 2WMBA 4NZWB 2ZB9A 4HYEA 4QQJA 4J01A 1XBBA 5DD8A 5CU6A 3ZUVA 4TY1A 4ALVA 3PNTA 2A19B 4HQMA 4PMSA 2V7AA 2W25A 2WIHA 2HXOA 3RZBA 5F95A 3LVPA 3E92A 1HBXG 1DP3A 4A3JJ 4A9RA 4I5HA 3WHBA 3FZ1A 3BG3A 1WJEA 3CJQB 1FC3A 2CNUA 1U54A 1LFUP 4EOPA 4LRJA 4MNFA 1P92A 3O7LB 2ZMEB 3ML1A 4XOPA 2Q0BA 1DGWY 2DJIA 3KYDB 3WZEA 1OIRA 3CC2I 4IVDA 4D5FA 5DHJA 2QG7A 1DAWA 4D9JA 5FKLA 3PSDA 4F9BA 4G9YA 1JHFA 3PZEA 1D1CA 3COAC 2X6DA 2JC6A 3FC2A 4YJRA 1DI9A 1RESA 2CSOA 2IW5A 4UV8A 3IHUA 5TISC 4ZEGA 4FT5A 1ERDA 4ERKA 3I58A 3UZRA 3RAIA 4ZSGA 2QOOA 4FEXA 2O5KA 3HMNA 4JDKA 2XNEA 4K0YA 3MFKA 1CMKE 3DKYA 1IJWC 1JTYA 3HDDA 3HKZA 1GDTA 4RLQA 4QNAA 4ZJVA 2QQ8A 3ZXSA 2YCQA 5JRQA 4EJVA 1USTA 3AL0C 5KE0A 4YJNA 2PFBA 4FV5A 1JQHA 4DYQA 1IGNA 4P9UA 2R7RA 5EYCA 5LVOA 4CFUA 4HW0A 3KN6A 2IZRA 5GJGA 4GH2A 2R92J 1MJBA 3NNXA 3JCUC 4I23A 4UYAA 3DPTA 1ZARA 3MQ0A 2K9LA 3ROUA 3MDYA 3BIZA 2YDKA 1F3MC 1MBJA 2OG8A 3R71A 1LPUA 4EWHA 2JRMA 2YM4A 4W1UA 2BTRA 4CTBA 3PA3A 3R8VA 2ZC2A 4HRIA 2Y0SN 2YM3A 2ZAZA 5AA9A 4Z9LA 4AWIA 3PPKA 5HS9A 2UW6A 2ELHA 4MQVA 5A6OA 4MF1A 1I09A 5D6EA 3DU8A 4O81A 2L9SA 4ZYAA 4IWPA 1F5TA 4PMTA 2E60A 4N57A 3KB7A 4O7SA 3FLYA 4F99A 1XMKA 3I64A 2HOTA 4B48A 5FP6A 3ZN1A 3HAMA 3ULIA 2PMZN 1V5GA 1XQZA 4IAIA 2C5YA 2P7CB 5ETIA 1R5HA 1B59A 1BOAA 1QQIA 5HZNA 2ITVA 3W0NA 4J8MA 3S4QA 4C3IJ 2XB7A 3HOXJ 3OOGA 3R0TA 4BJ5C 3ZO2A 4Y4RA 4D9TA 1I6XA 2O03A 4ETSA 2PZRA 2ITQA 3G1OA 2ZMDA 4AU8A 3CEKA 5AP6A 3TEIA 1R3CA 5A54A 2I10A 5EQYA 2HVRA 3F2RA 4NC6A 4ZYGA 1ZREA 4P96A 3CUQB 4KIGA 3QZFA 5HBEA 2KMUA 5FM3A 4I02A 4I4FA 2W5HA 3W0PA 1D0XA 5T68A 4APCA 3O17A 4BCQA 3VS7A 3CC7I 3FKIJ 5LEKA 2H6CA 1KQ0A 4JDIA 4OTIA 4FG8A 4CCBA 5AONA 3VAPA 2FX0A 1NG7A 1IC8A 2WD1A 1YS7A 5BQ0A 4EOLA 1W82A 5M4UA 2OF2A 4LLNA 4ENYA 2W82A 3DU6A 3LMIA 4IH8A 3Q4UA 4RT7A 1ZLJA 5I9UA 5HICA 1QBJA 2LY9A 1OL5A 3I53A 2PHKA 3R2BA 4NB5A 3R0JA 5LARA 2G01A 3QOEA 2V22A 4FV7A 2OO8X 5K5XA 2R7VA 3IL2A 3IV5A 3KXHA 4G3DA 5L6PA 3HBLA 4NKAA 4JQEA 4YTIA 3EFJA 4UV0A 3DPLC 2WU7A 4AZVA 1OCPA 2IZUA 4KS8A 3QYZA 4ZTHA 3BKBA 1HKQA 4I09A 4MHGA 3OWPA 4AN2A 3VWBA 2JJ7A 2VKEA 4NU1A 3ZZWA 3A7IA 2FO0A 3GLXA 3BTIA 4WUNA 3ZQIA 3I56I 1YX3A 5AM6A 3GLLA 3QD0A 3IWFA 5DDGA 3WF5A 3OF0A 4NH1A 2E9VA 2CKPA 2X4FA 2X8IA 3RWQA 4LFUA 3F72A 4CT1A 4C4FA 4KRCA 3DKXA 3OCGA 2L9VA 3NAYA 1YXTA 5I9WA 1LDJA 3H3ZA 2CO5A 2HYFA 3CCUI 4GFBA 3HUBA 2NS8A 3ZOSA 2YDIA 3ALOA 5FJ8J 4G5JA 3FMQA 3AXWA 3PVGA 1S5LC 4AOTA 2X1NA 4IZ7A 1YX5A 1K3AA 4CCKA 4C37A 3OMVA 1QRYA 1O4XA 4EC9A 4YIFA 1CQTA 2IVUA 4IM3A 5E8VA 4DTAA 2BIKB 2XALA 2ESNA 2J9MA 2P2HA 2M2EA 5HCYA 3MI9A 4A5MA 3A0HC 2VTIA 4FEUA 3ZDIA 4QYFA 2C3IB 4A6EA 3F0CA 5EFQA 2VO3A 3AG1H 4M9XA 4M3EA 1DAYA 4MEDA 2G15A 4IO9F 1ZYCA 5ERIA 2BHYA 2UXNA 1IV8A 2ITZA 3D7TA 1Y6IA 3OSFA 1V3FA 4DNCA 2HU9A 3ZUUA 4A9SA 3BEAA 4CCLA 4EBWA 5KZIA 3OWKA 4BYJA 1OL1A 5IQAA 4MO7A 2BE5F 2B9JA 2QEXI 5A4CA 1ERKA 2G9XA 3IQ7A 4YZBA 3N4VA 1TFFA 3SXSA 1OLTA 5E1EA 2PN6A 3LHJA 4KDPA 4BS9A 1FMWA 2R7DA 2XANA 4U0WA 1F0QA 2E34A 2ISYA 2W48A 3AD5A 4U3ZA 2EB7A 2AUHA 2A4LA 5E8UA 2ZBKA 4AA0A 2EA2A 3F9NA 4BZOA 2J90A 4E70A 1XHAA 4GG7A 2DOAA 2BAKA 1S9IA 2IVMA 3Q0WA 4QP3A 4X3JA 4PCQA 1Y39A 3M1EA 5CVRA 1OL6A 3OTUA 4D5KA 2BZHB 5IPJA 2P5KA 1DUXC 3GOPA 3C5IA 5AP1A 4H3QA 3CF5F 3WE3A 2QO7A 2DLLA 2ZMCA 4JLCA 3HRSA 3F3VA 2KRCA 3IPHA 3B2TA 3FXXA 5DT4A 5BMSA 2CCIA 2ZJQF 3WZUA 5EHLA 3ELJA 2W84A 2PUPA 5AV2A 4M14A 4P7EA 2O2UA 4K9YA 3SA0A 3DLSA 5KVRA 2XB0X 3H3VK 4DITA 3OS1A 1U2WA 3DBRB 3SLSA 2PVRA 1NTCA 3FLSA 3ASNH 2ZM4A 4XRFA 2YWVA 1IN7A 4F7NA 2HQRA 5TJJA 4X6AJ 2W4OA 4WG3A 4YZNA 1WFCA 3HRCA 1LVKA 1AOYA 3LFBA 2MLKA 4JOAA 1WFXA 3TL4X 4NM5A 3DTIA 2WTEA 4GMYA 3KREA 3C7QA 1A6IA 4QMOA 1V1KA 4ACCA 4RAFA 1DU6A 4CXAA 3S0OA 1IA9A 3KULB 5HX6A 3HV5A 4L9VA 2JTVA 1WSUA 1QGPA 3J80K 5FROA 3TNPC 1J1CA 4XCUA 3EQRA 3S1MJ 3PJRA 3E5XA 3REPA 1IAHA 5DEYA 2VE9A 1JKRC 4ACDA 1YI2I 1T08B 4JBOA 4F7SA 1OECA 5AAFA 2QSHX 1F9NA 3F6OA 5AP3A 4A3EJ 1FIPA 1OBGA 4PP9A 3ZQFA 1P7JA 3BLRA 2DUVA 1KZHA 3KEXA 4S2ZA 4EC8A 4WO5A 4FKTA 2C6YA 3WILA 3FZVA 2XJ2A 5B7VA 1ORKA 3C0IA 2W1ZA 1R49A 1BJAA 3GBZA 4HOKA 3QALE 3HPHA 2HDWA 2AQEA 4G1WA 1NW1A 4G5PA 4XBUA 3IG7A 3OIOA 5ICGA 3CS9A 2J7TA 4L5JA 3QTWA 1MQBA 3H9GA 5BQTA 4O3MA 1XTAA 3RHKA 3G71I 3VW8A 4UXNA 3MKZA 3K4BA 2NVUB 4L9NA 5HORA 1XGNA 1R0EA 3MZHA 4K18A 1BM9A 2OV7A 3O8TA 5L3FA 1RC9A 4YIRX 3PXRA 3SDBA 3DPKA 5EGOB 1YLFA 2RNJA 2CNQA 1O6YA 4V05A 1VQ7I 3G1MA 2LAVA 2FD5A 3IK3A 2DK8A 5CF5A 3DEUA 2QOCA 1WMKA 4FIEA 4HGSA 1UAAA 3S15J 1Z57A 3VBXA 3KP3A 4BF2A 4JQ8A 5IP6A 4DQ2A 4UB8C 1YRNB 1R22A 5CVVA 3OG7A 2C6LA 1XC5A 4AXCA 4ORKA 1E1VA 5HBHA 4UY8I 1KOAA 3KRWA 3MWUA 3MKWB 4RIXB 4HNVA 1R00A 2QBYA 3ROCA 4FX3A 2EA4A 2JFMA 1Q1HA 2FGIA 3BP8A 3G51A 3AC8A 4XX9A 3EN6A 4K2RA 4D4VA 1PXIA 2EZHA 3FMKA 1J7LA 5FB2A 3M1CA 4R5SA 4F7LA 3P79A 3PP0A 1SVLA 2FF4A 2XAHA 4Q5HA 4AE6A 4ESJA 2N8GA 1GV5A 4A0YA 4FL1A 3O8UA 1AA7A 2BXZA 2V4JC 3C4WA 2LF7A 3QUEA 4OIRF 4TYHA 3PY0A 2LK2A 3E8NA 4FI1A 4XRMA 4P5QA 3R7OA 2VKHA 1H9TA 4QTCA 3ML6A 4J96A 3TNIA 2OU2A 2EFPA 4G6NA 4AW5A 1MP8A 5L3AA 2WTVA 1XH8A 2R5YB 3PSFA 3RHXA 4AX8A 2CWEA 1T98A 4XK4A 4NYEA 3EUKL 2DTZA 2Z16A 5LVPA 2YUSA 3OYAA 5CVHA 2P5VA 3VYTB 2HXLA 3I59B 2CYYA 2X0LA 5HCXA 4M97A 5J4VA 1A36A 4CLJA 1VTNC 4BY9E 2XJ1A 1K78B 2W24A 3MPMA 2VPRA 2WADA 3SV0A 3KZIC 2L54A 3UVPA 3OV8A 2XNPA 2BPMA 5JVGF 3VYSB 4R1VA 3QA0A 4H0EA 1XH7A 4JX7A 3IP4B 4L67A 1H89C 4FV1A 3TNWA 5M5YJ 4F63A 1Q1VA 5KCVA 4U3YA 4CKRA 4WCGA 1S6LA 4DLJA 2XAOA 4GYIA 2HW7A 4I1ZA 4CV8A 4I0BA 4XSXF 4U9AA 2JPBA 4GEOA 4I3ZA 3GTKJ 1BJZA 2L0KA 3ECOA 1M2RA 4YBKA 3HL7A 4Q48A 2JIUA 5DWRA 2R7ZJ 2EIMH 2HWPA 2ZFYA 2ZXWH 5TT7A 5AUVA 5D5VB 2WXVA 5KHWA 2J0JA 2GPHA 2O0YA 3R8MA 4AE9A 2F4OB 5E3MA 2Y4PA 2QA4I 3ZHPC 3DTCA 1VQ4I 2VTNA 2AHQA 5AX3A 2OSCA 3K2AA 3R8PA 2QU6A 5BUJA 3U9NA 3TOBA 4RWLA 3ATSA 2XKFA 3G0FA 4C2WA 4BHCA 3PPZA 4UEUA 4F9CA 1FINA 1AHDP 1NK2P 3ELKA 4CZTA 4FG7A 4AGUA 4HEA2 4BXXJ 1NVSA 5LFAA 2IWIA 3BR3A 3ATTA 5D9HA 3CJNA 1MSEC 3LCTA 5KBRA 2WBMA 4Y15A 3KQ7A 1Q62A 2JITA 1FOYA 3Q60A 4E5AX 2BKZA 4BBRJ 4ZTMA 3COIA 4BHZA 1GVJA 3RCOA 3MB6A 2R93J 1PJRA 2VGOA 3KX2A 2M7AA 3ZMSA 1OITA 4QEBA 4L46A 4Z16A 4KAOA 4KT6A 3HZJA 2ERZE 4JRNA 1ZH5A 4OTRA 2WTJA 5J4YA 5M56A 3EUHA 3DK6A 3JRIA 3Q9XA 5CT0A 3CCQI 4GXOA 1P4FA 4XH6A 2X2KA 4PX6A 5CNOA 1SEUA 5DD4A 2XKCA 4XG3A 4LDTA 2IS1A 5FRNA 4BE2A 4FQGA 2WAJA 4MWIA 1XS9A 5HO7A 2K9QA 2H1KA 4EOQA 1MW7A 2IA1A 4E8AA 1PP7U 2H34A 5L6WL 2HVSA 1TW3A 2WHBA 5JFRA 3UNJA 2ECBA 3FI3A 1XJDA 3AD4A 3LFDA 3GC8A 4R1YA 5LMAA 2W06A 1FWZA 2HS5A 1OR7C 2C1BA 5HDGA 3ORZA 4IB0A 2H94A 3BGPA 3LQRA 4BCOA 3PQKA 1IRFA 4G7OF 3ZFXA 3BJ6A 4X1EA 2I5UA 3BQZA 3FX3A 3FHIA 2CS3A 3FMNA 4MH7A 4JX3A 3L1PA 4EBVA 4QNYA 3EQCA 5IQBA 1DU0A 2E35A 2Y48A 4OTWA 2RKHA 3RWPA 4TV7A 1G2HA 3UP2A 4RAYA 2ZYBA 2VX1A 1H26A 5EHOA 1UMQA 2L7KA 2EZLA 3EN7A 4IM2A 4TKSA 2X1EA 1OGYA 5JT2A 3BG5A 2J6MA 3PO2J 4MTEA 4BDAA 2O64A 4XLNF 1Y8RB 3DCFA 4KMUX 2WMAA 4D58A 4BB4A 3WG9A 1HQCA 3EUAA 2ONLC 5KAIC 2XGDA 5EZGA 4QPAA 1R58A 2E36A 1LR4A 2C47A 3U55A 2Q2EB 1GHCA 4PDKA 5C27A 2RG6A 1OM1A 3ZMTA 3E7OA 4E7IA 1J09A 2R4GA 3PG1A 2DODA 2XBAA 2VI6A 5I9XA 3BBTB 4AA5A 5CSVA 3J7ZI 3B73A 3KZYA 2VT2A 4BXUA 5FGMA 3HUGA 1U9OA 1T39A 2MD0A 4GUBA 2CW8A 3G90X 4J19A 2ZFWA 5D12A 4EJTA 4OGRA 3H30A 2XSDC 1SD6A 3UG2A 1FPUA 2RFDA 2WAEA 3EQFA 2XNGA 1JKOC 4AS0A 4DH5A 2ZVAA 2A69F 1HCLA 4YLLA 3QWKA 4JIAA 3DA6A 2L5QA 1R1UA 2JVHA 3OOMA 4UZHA 1JTXA 4E26A 4E1ZA 5AV1A 1B1BA 1RKWA 3KRLA 3QTUA 2RQPA 4FSZA 2CW7A 5BMMA 3QXPA 4HCUA 5CSHA 4FTNA 5F9EA 4ITJA 3LA2A 1Z91A 3KVXA 4QP4A 4UUSA 1HOWA 1X1PA 5FD2A 1SFOJ 3FLNC 1I44A 5M4FA 1B72A 3VUMA 2OIQA 1VQ5I 3JRHA 3PSCA 2C6EA 1JBPE 2PJRB 2HQ5A 4U0YA 1KE8A 4TRLA 2L4AA 3OUKA 5JLWA 2FOWA 2GA2A 1RR8C 1LUFA 4HYUA 4RB2C 3UP7A 3BG6A 3FMSA 4FKPA 2IJLA 4ZDPA 2RKUA 3BHYA 1H28A 5DR6A 4JDJA 3NSZA 5CEIA 4BR3A 4OBPA 4FKUA 4FL2A 2Q0NA 2V5QA 3S93A 5CI7A 3EKKA 4R79A 1ULYA 3FXQA 3VRZA 4A9YA 2OJFE 4PL4A 3S95A 2NNYA 3MA3A 3OCTA 3W0MA 2JFLA 2VTLA 4K77A 4RX7A 3FL4A 2XRUA 4AF3A 3C0HA 2LG4A 2P6TA 2XGEA 3PSBA 3GFJA 2CGUA 4BHNA 4YJPA 1O3RA 2IZSA 3L9NA 4TXCA 3NRMA 2FA5A 3EFLA 4IDVA 3PVWA 1ZG3A 3UZTA 2LP0A 4AGWA 3HDNA 4M15A 4RAGA 5LMBA 3DFAA 5CEOA 1EA3A 4GVJA 3GTLJ 2HOAA 3PXFA 4RGUA 1DDNA 4EGYA 3SOCA 4U40A 2IVVA 3GFWA 4EYJA 3MPAA 3RIRA 4IX4A 4MUQA 1QPDA 1MBFA 1P14A 3WHCA 3R4KA 4IAYA 4OU0A 2XC7A 2VO0A 3BR0A 3EH9A 2JUGA 3BZ6A 3OOPA 5E3OA 1PW2A 1OPKA 1MRUA 3ORXA 3F9KA 1UFMA 3BHTA 1TNTA 2QYOA 3A1YA 1FP1D 5CVUA 4I98B 3O5AA 1Z77A 1XPXA 4QMXA 3ABKH 4LB6B 1NG6A 3HRMA 3MSSA 3DP7A 3KEYA 1WJBA 2XPUA 2C1AA 3RKWA 4RQKA 2PVMA 2J5EA 4M84A 4DDIA 4A4LA 2GHGA 1P7IA 4RIYB 3PVUA 5HODA 3HM5A 4LV8A 1CF7A 4DFBA 2CN8A 3SDJA 1B38A 2HTSA 4KJZA 2CPKE 5T3QA 3B02A 5HOOA 1BMKA 3GEQA 1KYZA 4PQNA 4QTEA 4LK0F 2UUEA 2PTKA 3IW6A 2YU3A 4XG2A 1DP7P 4R78A 4YC3A 2M1BA 5K5RA 2Z5UA 2B0QA 1YQAA 2E1NA 1T2KA 2WV1A 3BY6A 4FSTA 4F0FA 1VI0A 2X9DA 4FTHA 3FXMA 3QYFA 4YO4A 1LUJB 4YFKF 1NVQA 4JI9A 5I9YA 3A61A 4X2JA 2I0EA 4EJWA 3F69A 2UW0A 4ZOGA 4TT7A 3NMUF 2DQRA 3VUGA 4Y33A 3QQKA 2FQ4A 3GVAA 4ANJA 1Z6TA 4LK1F 4IDTA 5EEAA 3FYKX 4FVPA 3OBGA 2QGUA 2BGCA 1U8RA 1JKKA 4M0YA 3HOUJ 1SD4A 3GMEA 2C6DA 3V8KA 4XLAA 3P7NA 1OL2A 4QMZA 3D5RC 2AS5F 2LBFB 4QP7A 3FSFA 4WNOA 5H3QA 4B9DA 3OYFA 3MY1A 2UUZA 3M11A 2JDOA 2W9FB 1A6QA 4XRJA 1T0FC 5IF1A 1ZELA 4JBVA 2TDXA 1G3TA 2PE0A 4O5VA 2VBWA 1R23A 4DGWB 4UY9A 4YO6A 5DT0A 3E63A 3BV3A 2J5OA 4PTCA 4WK8F 1WZ2A 3PE1A 3D5LA 4WX9A 4CZUA 2JEDA 4XRLA 1KU2A 3N4MA 3QLFA 4EEVA 5EOLA 3TNHA 1U5TB 2XSJC 3ZO3A 2D2WA 2O8XA 3JY9A 4EH3A 4MNUA 4IC7A 5CSPA 2GQSA 4GCJA 4KUMA 4EH4A 1MD0A 1TZLA 3OHTA 4C3PA 4RVLA 2DXIA 2IZTA 4OWRB 1REPC 1BL7A 1PXNA 4DFLA 2CKQA 1YJ9I 5KNJA 4DZJA 4RDUA 1OKVA 4L45A 1Q41A 2WTIA 2K02A 2BILB 3UQFA 4PFPA 2J50A 1IN4A 4IRIA 1LB2A 2QOHA 4XP0A 5CI6A 1NHAA 1MBEA 1W98A 4YR8A 1Y6BA 5FXRA 3EFWA 3TDZC 4XOYA 3NLBA 4BI1A 1NT2A 2UWMA 5HLHA 1DPRA 3GQLA 2D45A 4EOMA 4CCOA 4FNWA 2VX3A 2O0UA 3MFSA 1LEAA 2CUJA 1JJ8C 2JDRA 5GNKA 5M44A 1JLUE 3IDPA 3WE4A 4FIJA 5AP7A 3DKGA 3FQEA 3MPTA 4G3EA 5CS6A 4EOKA 1ZTRA 2XMYA 4BDDA 5IEXA 1L8TA 1QZYA 4C2TA 4YGAA 3V5WA 3BELA 3BHVA 3ZYAA 4JG7A 2K85A 2J0KA 4O0TA 2NVXJ 4BACA 3LZBA 4MCVA 2JDVA 1Q8UA 4C2MJ 1RJBA 2ID6A 2WGJA 3LFNA 4KB8A 2BRNA 4UB6C 2Z7SA 3CKXA 1E2XA 2MGQA 4LG0A 4FTIA 2WB1A 4B44A 4GW8A 4RJ7A 1TC3C 4GFGA 4BVUA 1YE9A 2JDTA 4QP9A 1VNDA 4HNUA 1O7LA 2UVYA 3EYHA 3LQ8A 5IUIA 4FT8A 4HPQA 4NQWA 2OI4X 4A9TA 3THBA 4KBAA 3G9LX 4YC8A 4EOJA 3QAME 2PU8A 4OINF 1CKPA 3BL7A 4RA5A 5IOZA 3V6SA 1K7AA 2H6BA 4B6LA 3E6DA 3LSGA 3OP5A 2OA4A 3FLQA 4KMFA 4IF4A 2IVSA 4FTRA 4IFGA 3L9FA 4IOCF 3NYNA 5KNLA 4YC6A 4DHIB 3FM5A 4XV2A 1ZXEA 2QVSE 2UZDA 4XMOA 3QCYA 3N05A 4EH6A 4GU9A 2V7FA 2X6EA 3GCPA 2CW0F 1E1XA 3A7HA 4OAZA 3I7BA 2ITXA 4FTOA 2E2JJ 2X9FA 4J53A 2ZJPF 1MSFC 1Z3YA 3KU2A 3TV6A 3ZU7A 3OSGA 3V51A 5DG5A 2L9NA 3KEOA 3V5QA 2HZTA 1UNHA 4U44A 4E7HA 4DT9A 4HGLA 3OBJA 2KIFA 5I4NA 2XNNA 2DPDA 4L7SA 1L0OC 4YURA 2HNHA 4B43A 1EH4A 1MNEA 1TT5B 1VLRA 3TKUA 4O0XA 5HCZA 1H27A 2EB3A 3WE8A 2XARA 4OTDA 1J5YA 2LD5A 5ITAA 2Y0AA 1BI1A 4BN1A 5DI1A 3FKJA 4L7FA 2DT6A 3ECHA 4DT8A 2R0IA 5K5OA 4IAFA 2DMQA 2VPLA 3T3UA 2O63A 4KT5C 4Y95A 3M8EA 4WRSA 2IAIA 2KQRA 3U1DA 2OF4A 3O96A 4EK6A 4LGHA 3OL3A 5B1BH 5JR3A 2ZDUA 3N51A 1HC8A 1VEBA 3QCSA 3Q4CA 2X8DA 3OWJA 3U6JA 3HGYA 3NYXA 5LQFA 3ZC5A 4AQKA 3JVRA 4UWCA 4J71A 2NRAC 1X2NA 1YDSE 4RWIA 2I0YA 3C4ZA 4XKVA 4NFNA 2HFHA 5ETCA 4JR3A 2WAQN 4A9UA 4ZMEA 3R1QA 3VS6A 1B4AA 3JRGA 4XUFA 4BCJA 1R5ID 4E5WA 3F8NA 5CVIA 2AYPA 1W84A 4UYNA 1BKXA 4Y5QA 2IXSA 2V6CA 1BBYA 2LC2A 2PVYA 2R0UA 5BOXA 4JS8A 3E87A 4F6UA 2M4KA 2EFWA 5FD6A 1FYKA 1JI8A 3VN9A 1K9AA 4A06A 3C4EA 4C3JJ 1FY7A 3UQGA 3FEGA 4S30A 4NJDA 2DMNA 1I6HJ 3LJ1A 5KHDA 3VS1A 2BVMA 5DYJA 2ZV9A 3OS0A 2FBKA 3PYYA 2LKSA 4G31A 1Q5KA 3OYIA 3TM0A 3Q53A 5C4KA 4A7CA 1NY3A 4NW6A 4IX6A 1QVTA 1IXCA 2YFXA 3OZ6A 1V4RA 2X7GA 5C4JJ 3FZRA 5CXZA 4EWQA 5AV0A 3GT8A 4KIFA 2B9SA 5HQ0A 3Q3SA 3CCLI 1KE5A 2YHVA 2RG5A 4Z3VA 3BROA 4RMNA 1H08A 1RZ4A 3EN4A 4G3GA 4LV7A 2REIA 3IOKA 5TO8A 3ZCOA 2QHMA 4FBXA 5KMJA 4XP2A 3A4OX 3LFFA 4XV3A 1LFPA 2ESHA 5KKRC 4BJJA 1LVAA 3NWTA 4MBLA 2L7MP 1U46A 4M0ZA 1JUSA 2OCCH 3NW6A 1WPKA 3QD3A 2F2UA 3ALNA 4DIQA 1UG0A 3HYIA 1D8KA 3FHRA 2MC4A 5JHUA 2AC3A 4QDEA 5AAGA 5A4LA 1QL6A 4YMJA 3DB8A 3S3OA 3HOVJ 2QU5A 2QQBA 3DT1A 2MH9A 1ZR4A 3UOJA 2IS2A 4G94A 4XOTA 3WF6A 1PMUA 2ZMEA 3F23A 2X85A 1ZK8A 1MDMB 4EYMA 1OYIA 2G7HA 4U0VA 3L7WA 3HNGA 4KINA 5CU4A 2VZ6A 5CVGA 3KKVA 1G8KA 4F52A 4XRSG 4ZSAA 5J95A 3WOWA 2OCEA 5B1AH 1ZLTA 3S1QJ 2X2MA 5E18F 3QPSA 3VS3A 5BPYA 1W36D 4FV2A 4USFA 4AN9A 2GNIA 2VWBA 3ZMZA 4ZDLA 1UZCA 1ZKGA 1RIOH 3S00A 1SAXA 5AP2A 1IN8A 2P81A 4PY1A 5EYMA 4NT4A 4DFZE 1OL7A 4UHTA 5BX0A 1P4XA 3TO9A 3VJNA 5CF6A 1U5TC 2JBOA 3AGLA 1SD5A 4IACA 2CQNA 3UOLA 1JHHA 3IDBA 4F64A 2BDFA 2XEYA 4FV4A 3S1HA 4CSWA 4JK1X 3OYMA 1Q61A 4FVRA 5JFVA 4L3LA 4C2UA 2NO3A 4J95A 2DA4A 3TV4A 3WZJA 4RFYA 5IA5A 1D1BA 4M9SA 4FKQA 2C5VA 4CA0A 1G3WA 3DV8A 1S72I 4M71A 2VBXA 2XYNA 4A3LJ 3PFYA 4TWCA 1RR7A 4BU2A 2R7XA 4EM2A 3FPMA 2G2FA 4O7LA 2XAGA 3IRRA 1X1DA 3WIGA 1ZGWA 1K6YA 4LMUA 5FEDA 3KETA 2LRDA 4L42A 1U59A 4XQFA 5HVKA 3E8EA 4FOBA 3NYVA 3E5AA 4EJNA 3MH3A 2C3LA 3MA6A 1H1WA 4IZAA 3OYDA 5HG7A 3BJAA 3F7WA 4E7SA 3GF2A 5B3SH 4DEGA 2B4SB 4FTJA 3DU5A 2VAGA 2PJPA 3HRUA 2X7FA 3I4BA 1ZZLA 5BYZA 2F4MB 1B8IB 1QVUA 2Y2ZA 2EXMA 3L2RA 2V55A 4CCJA 3F6XA 2JT1A 1ZOEA 2Y4IB 4IRHA 5CYIA 4M3BA 1NK3P 2Z2WA 3D14A 3FAAA 1KONA 3S3MA 4P5OA 1W1WE 3DJ5A 1D3YA 2I6LA 2R2PA 2VB6A 2BVAA 4S04A 4PTEA 4YPSA 4ACHA 2CMPA 2V26A 3HDMA 1GIJA 3E3VA 1WVYA 3DGKA 3RCJA 1IN6A 2BHEA 4QYGA 4HCVA 2XA4A 4Y73A 4MFDA 2X6XA 2OGVA 2QKLB 3HA8A 4ZZMA 5CAPA 5HE0A 4FEQA 1W7PB 3AKZA 3AKJA 3TKIA 3SZTA 2JA8J 3MJ2A 2W1HA 2X4ZA 2VU3A 1Y0UA 5BYLA 4ASXA 1OPLA 5C8MA 1LJ9A 3RPUA 4GFMA 3FJQE 4RC4A 3SOAA 5IQEA 4APPA 1FBSA 3O23A 2ECCA 2VQHA 4AYBN 3FXUA 1PY5A 2ADUA 1IXRC 3KRXA 2HGCA 2OLCA 2CNVA 1OPJA 2XAQA 3IH3A 1MH3A 2EQRA 1YI6A 5JN2A 1YIJI 4NM7A 4V19K 2HDDA 4ZS4A 3SGCA 5LXMA 5HIBA 3L2CA 4RZVA 2I1MA 3HZTA 4Z55A 5CAOA 4MXCA 2HPMA 3GTOJ 3NGAA 4O21A 3S2HJ 4IJ9A 4D4YA 4IIRA 3GFEA 4QMUA 1AQ1A 3QWLA 2RGVA 1X8BA 4D1SA 1YWVA 1K79A 3ITZA 5AAEA 4FNXA 4GU6A 1PRYA 3NW7A 5GJFA 5JI6A 2VWUA 4E20A 3H92A 3F8MA 3DNEA 5IPAA 4HX7A 2GFSA 3A2CA 3CBLA 5CAUA 5M07A 1BR4A 5GIOE 3TJCA 2CFXA 4EQCA 1QZEA 2P33A 5EW8A 3TG1A 4G7HF 4YSJA 4NUBA 1X2MA 5AUWA 2UW8A 3R9OA 1TT0A 1KQ8A 2CLXA 2IVTA 1YOMA 4DOZA 4FGRA 3ZQQA 3BPXA 3K2ZA 3IOPA 3RPRA 4BCKA 3V7SA 1D0YA 2KT0A 3JRBA 4CFXA 4HV5A 3W2SA 2A6HF 2G7UA 4YJQA 3NR9A 3UQCA 3WTSC 1Y8GA 5DOSA 4BDJA 5JFSA 3UJGA 2QO2A 4CLIA 3HGKA 1IF1A 2HYGD 4OMZA 5DH3A 3CLOA 2KULA 4M3GA 4KBKA 4RBLA 4KN4X 4JYKA 2F4JA 3DXPA 4KIQA 3WYYA 4A4XA 2DU9A 1VQNI 4DG0E 3F21A 5BVDA 3NUXA 4IZZA 4LMNA 3BR5A 3W6JB 1P4WA 1TW2A 5C1QB 2UVZA 2CJMA 2XK3A 5BVWA 5BVFA 4FIHA 2GIZA 5M51A 1P2AA 4AZSA 2GS7A 3PXZA 1SMYF 4NFMA 3QQAA 2D1HA 2JA7J 2EJRA 4IQ6A 4Q9SA 3V7RA 3BU5A 4WXHA 5J8CA 2NVQJ 5IYCJ 3OTVA 3BQCA 4RFMA 1H8AC 3C3WA 3M2WA 1E17A 1TLHB 5AP4A 2XEZA 3HOYJ 2JSCA 1X3ZB 3FXOA 5FDXA 4R3RA 1IAWA 3P86A 4QMLA 1K6OA 4BDCA 1OMIA 2DCEA 4ZJIA 2OJ9A 2H8HA 3OXTA 3JY0A 1PP8F 4AG8A 4BIEA 3JAMZ 3ZQHA 4L43A 5LCKA 3ZGKA 3OL4A 3FHZA 2YSRA 3HL2A 3QD4A 3W32A 4I0RA 3QKMA 4O7NA 5HG5A 3DZQA 3C2GA 3EIDA 4G7ZF 4PNIA 5A6NA 3CD3A 3VYUB 4N4OB 2WB1N 2GM4A 5HU3A 3WTTC 1SFUA 2KTYA 2BXYA 3P1AA 1XG1A 4BTKA 2ZSHB 3B8QA 2G9WA 3GU5A 1PF8A 3VNTA 2EWAA 2SRCA 2PVLA 2WKMA 2GNLA 3AC4A 2HOSA 2PMZA 4C35A 4CH7A 4IJAA 4ARKA 2JD5A 4IRGA 5L3BA 2XGXA 4A3IJ 2GSFA 3BLQA 3QPLA 5AM7A 4G6OA 4XRSA 1D0ZA 4MXZA 2A5YB 3KULA 4MIMA 4QWQA 2ZCWA 2LKPA 4XNFA 2FU4A 1YW8A 4OMYA 3DKOA 2VJIA 4A6DA 1BYGA 5HE3A 2FOKA 3O7LD 5E1WA 2C6MA 1R7JA 3R61A 2R7UA 3FMMA 2XS0A 4FOCA 4MBJA 2QLQA 1BX6A 3OFMA 2PMIA 3HB9A 2W85A 1RQQA 5CEQA 5ILVA 1VZOA 2VWWA 4TW9A 3QTIA 1Z3XA 1T8IA 3LCOA 3TUCA 4MEYF 1MMSA 2KZGA 3T8TA 1RETA 2ZKZA 2OQGA 2EXCX 4IWQA 2C6IA 3E1SA 4X3FB 3PPJA 4BL0B 5LGNA 5B66C 3K10A 3HHHA 1E3PA 4UVBA 1PXKA 2XF7A 2QCOA 4B8LA 2WAFA 3W2OA 5F0HA 4F7JA 4C2VA 2UXXA 2ZSIB 2LREA 4E7JA 4FL3A 1QU3A 1RW8A 5CSXA 3DJ7A 3CJRB 3DAEA 4DN5A 1FOKA 5C26A 3DBQA 4ENMA 4U97A 3ZSGA 2BTSA 4KUJA 2EIKH 5EM5A 2OZ6A 2E9UA 1OKRA 3LW0A 4F55A 5B2MA 2STTA 1KE9A 1YW2A 4D1XA 1RI7A 3G9NA 3FK6A 2V6EA 2GHMA 4J7BA 2X0GA 1FZPB 5HS7A 5JQ8A 4WA9A 2M7BA 3G73A 3IH4A 4HZRA 3SXFA 5HG9A 2ITYA 4G3CA 3V01A 3WE2A 3EZVA 4ITIA 3NVKI 1TQPA 3H0YA 4AOIA 4RJ6A 1G8AA 1I50J 1YOVB 2JQ7A 1X4PA 3QX2A 3GXOA 2Y9ZA 4MKCA 1XSXA 4YIIA 1WCCA 3LWFA 1WH5A 2VGPA 5E8WA 2Z33A 1H8FA 4DFUA 5EEGA 5DN3A 4F6SA 4DGLC 3ZRKA 4IX5A 4XP3A 1FQ1B 1DM2A 5LWMA 4QTRA 4FE4A 4KS7A 3MVJA 4XKBA 3GU4A 3JXWA 3HOZJ 3EUHC 1YRNA 3JVSA 3E7LA 2EVAA 1UNGA 3R1NA 4RIWB 4D4SA 4A93J 4GDFA 2BRBA 5CEMA 3ROYA 1WBVA 4QP6A 3L00A 3RAHA 4QLCU 2ITTA 3LIJA 3MESA 4O2ZA 4S33A 1WJAA 4E73A 3FK7A 4ZYDA 3CY3A 1VQKI 4JBAA 3LFEA 3TN8A 3KK8A 4ZXTA 2M34A 3AT3A 2R3IA 1LPQA 3K4CA 5KMNA 1PVEA 1JPAA 1VR2A 4XNEA 5CALA 2P7VB 4AT3A 4EI4A 2LOOA 3AOXA 1RDQE 2A0CX 3NFFB 3GTMJ 5LHHA 4EZ7A 3HTSB 3TKYA 3P7CA 4AACA 2FA2A 4RWJA 5D5UB 4AIHA 4TYIA 4FV3A 5K7FA 2OTLI 3VUKA 3F3TA 1B9MA 2R5YA 3II5A 5I5ZA 1T6SA 2VL8A 1TKIA 3OYNA 1AU7A 5J5SA 3RPUD 3I59A 3HUCA 1T45A 2W5AA 4NJ3A 4Y83A 5AX9A 3FXRA 4NBQA 1WI9A 1KOBA 4UXLA 3VQUA 4Y72A 4L9JA 5K7ZA 1K78A 3FXKA 4BE0A 3VO3A 1MMNA 5M5WJ 3JUHA 1Y91A 3ZDUA 4CCNA 4IB5A 1JXSA 4YLKA 3PIYA 4O7RA 2GDOA 2I7QA 4AC0A 3LJ0A 4F09A 5A14A 2X6YA 4NIFB 2VKVA 4LI5A 2J2IB 4IX7A 3ZP5A 2R5ZB 3CD8A 4FT0A 5JLXA 4GV1A 1O3QA 2CGXA 2QKRA 4EQMA 3SEQA 4FSUA 2KIMA 1MKMA 2LDUA 4N9HA 2O3FA 3BYMA 2OJED 3CLYA 3WU1B 3QRUA 5HNGA 4WD5A 2EPFA 4IZ5A 1X4OA 1YWNA 5A4TA 4B3AA 4FKOA 1A04A 2GNHA 3BX5A 4MX9A 1TNSA 2VD5A 4DH3A 3F82A 1Q97A 4X0GA 3I5NA 4ZS0A 2ETHA 4BBFA 3PLAE 1GT0C 2WTDA 4HZFA 2LSOA 3UMXA 5ANJA 3B2WA 3BWGA 3FI4A 4WHZA 5IQDA 3AT4A 2FJ1A 3ZFMA 5FEQA 2ZM3A 4MXYA 4GT4A 1XDSA 4HAMA 4PSWA 5E90A 4G2FA 4XV1A 3QZIA 5AFVA 1V0BA 1GAGA 3PM1A 3RCDA 3PUFA 3L2QA 3ZLYA 5E3NA 2XCKA 1DPUA 4YBJA 3KLNA 4ZYEA 2A68F 5DRDA 3KF7A 3A99A 3S2PA 2LH9A 4AXFA 4ZLZA 4CKIA 4E4MA 4GT3A 3BI6A 1U6GA 2NOJB 1K4SA 4FTKA 2O9LA 4BZNA 4RB3C 2BOLA 4WWCA 3Q9VA 2V7OA 4HLYA 2BR1A 6PAXA 3Q6WA 1FMVA 4X2NA 2K5CA 3VIDA 5FXQA 3S1RJ 2ICWG 3FXLA 2Z9OA 2RAEA 4XG6A 4G3FA 2MFZA 4CV9A 4OOIA 1UU3A 5CZHA 3PO3J 5J1RA 4GK2A 2VT3A 2LLKA 3ID6C 3SXYA 2UV1A 3NUSA 4PL3A 1YDRE 3QTXA 1SMHA 1GLNA 1ON2A 4R5YA 2GLOA 1HDDC 1YHSA 3DFCB 3VS2A 4I92A 4I6FA 3FKOA 5HNHA 1Z0XA 2DDAA 2HZIA 3TCPA 1TQMA 3TWJA 5KX8A 4XIDA 2HELA 4BQNA 4G6TB 2DYRH 4XLHA 3MAJA 4FZDB 2K40A 3L2WA 1PUFB 2QOIA 2JA2A 3C50A 4RZWA 1LDKB 2O7OA 5HVQC 4UUTA 3I6UA 3KGAA 4EHGA 3ULZA 4RIOA 4FT3A 5E17F 5CAQA 2GNFA 3IS5A 2PYWA 1BI2A 2BHHA 4E5BA 1YRPA 3CTHA 3HJEA 1ZMWA 5BVOA 2PZIA 4RX9A 5LHIA 1OCCH 4I5PA 4YLJA 2DQLA 3HX4A 3BCAA 4A2UA 1R71A 3OEFX 4MAOA 5M53A 2XIYA 2XVDA 4DBNA 5T6KA 1MH4A 3H3UA 4C58A 2DFFA 3H9FA 4HG2A 5TF9A 4KABA 4XSZF 2V9PA 5D4SA 3C13A 2FRHA 2JA5J 3RP9A 1V5EA 4UWYA 4CMOA 1SVEA 3F22A 5TRDA 3CCSI 3UPXA 5HTBA 4MD7E 2FMLA 3ZUTA 4ANQA 4L0YB 2RFNA 3A7GA 2A1AB 4LGWA 2Q2EA 4V2FA 3JREA 4IFCA 5BMZA 2YA9A 3UIXA 2HZ4A 2QLUA 2KFDA 4HX4A 1SANA 1HW5A 3ZQ7A 5HLNA 3KMWA 3DK3A 2ZO4A 1B6AA 3MWMA 3R9HA 3G6GA 2G1TA 4LYNA 1ZHFA 5KO1A 4YJOA 3HMIA 3VB2A 4LV5A 2AEGA 4FKSA 2O8YA 3I55I 1NH3A 4I76A 5HNBA 4DBQA 1ZAOA 2BAQA 2CMWA 4USDA 4HVGA 5HNIX 5IU2A 4XLEA 1UG2A 1TVOA 3ENMA 3BJOA 1V0OA 4ZTLA 2F6CA 4JBPA 3VC4A 2NAZA 4I20A 2JAVA 1BI7A 1W36C 2QUFA 4CDGA 2O8KA 1Q24A 1LEWA 3WIKA 1BOBA 1OIUA 5EW9A 3JW4A 4O7YA 4N4NB 4JXFA 3R63A 3UODA 2VWZA 4CFWA 5KCMA 4XMYA 3PJ1A 5LOHA 5HX8A 3P9CA 4LOQA 4M9ZA 3KXXA 2A05A 3K5UA 4KIOA 2F2EA 2ZOQA 4U42A 5H2UA 5BPIA 4ON0A 1ZOGA 5E1XA 1UA2A 4ASZA 2X7OA 5FKOA 2JMWA 5L8LA 3OY3A 5FKNA 2PJRA 3RPVA 3ZLXA 1MQ4A 3LXPA 3J80Z 3D2IA 3S16J 2HVQA 3CTAA 2EH3A 4AFJA 1JT6A 2M87A 2CDZA 2BYVE 4Z2YA 2NVYJ 4GK3A 2DTRA 3PXYA 1Z5MA 4J1RA 5CENA 5LCJA 2W1CA 4AW1A 1J59A 2OXDA 1XGOA 5FBNC 3ZS5A 4V0GA 4XLIA 5E8SA 2YM5A 5FLXZ 2F4IA 4HJOA 2HQNA 4C4HA 4C34A 4F08A 3DQWA 2OXXA 4XICA 1FSEA 1OZ1A 1S7AA 3GFIA 2YIRA 2CGPA 2VTTA 4WNMA 4U8ZA 2ME6A 3MVHA 1IRXA 3BPVA 4PDOA 1U0JA 4N9IA 4QDVA 4TYGA 2YPRA 1OCRH 3RPYA 3EFKA 3LFCA 1OVEA 5CZIA 4GSBA 2HIWA 4F70A 1XSVA 3FXWA 4P5ZA 1R6RA 1VYZA 4EH7A 5IH4A 4GRBA 4A3KJ 3K6GA 3JR1A 2V1XA 1VQPI 5EDPA 2VRXA 4QP1A 2VUWA 1FOTA 2QOLA 2EV6A 1ENHA 3K4MA 1TBXA 4YP8A 4LIUA 2FSMX 1QPMA 3RTRA 3RKQA 5E9EA 1IZ1A 3IECA 4I5CA 5LGTA 1ZQ3P 4FZAB 4IQ4A 2FB8A 4E7ZA 1GZNA 3EL7A 4II2A 3Q0UA 3TZ8A 4KWPA 1C0WA 3O8HA 4PMPA 4A3CJ 3UG1A 4EHZA 4R8HA 5IQHA 1JGSA 3A01A 4ZLYA 2BFYA 3MTLA 3SHEA 5IDNA 4RLFA 4E6CA 4MYGA 5DR2A 2YERA 5J1YA 2RREA 2PX9A 2K4BA 3BR2A 3SQNA 4QIWN 2PE2A 1RRJA 1W0XC 4HNIA 4OTHA 2ZJWA 1ZRDA 4RIYA 4EVIA 5EI2A 1GZ8A 4IXAA 4I22A 1HCRA 4FTTA 4N4SA 2M3AA 2VC1A 3W2RA 1UNLA 1GXQA 2IGKA 1V54H 1Q8TA 3IO7A 4L5EA 4R77A 1KV1A 1UU7A 3MS9A 4DYMA 4O84A 4XYFA 5FUTA 3KVWA 4ZAUA 4LG4A 4QPQA 4BE1A 5H6RA 3EYYA 3NCZA 2KPMA 3S2DJ 4O0YA 2KJBA 3PXQA 3GGFA 3C2BA 4ITVA 5CWZA 1UJ8A 1JE8A 1JOWB 1XN7A 3A2KA 4IVCA 1HSJA 4EH9A 2WEVA 4O2PA 1RNLA 1M7QA 4FSYA 3BV2A 1OUYA 4LOPA 4S34A 4LOOA 2ZXHA 3U1KA 4QMWA 4NCTC 3UNGC 3LNQA 3D5VA 3GTJJ 5F6FA 3BE9A 3SYTA 3QX4A 3KRJA 4AVPA 4JMQA 4NHJA 3SW4A 3FZSA 2F57A 1U5RA 4YTHA 3ZONA 4GS6A 2LNBA 4QMSA 4DINA 3RKXA 3W0QA 5FDPA 3LOCA 2A3SA 3M42A 4B8MA 4HDUA 2B55A 3ODYX 4IB3A 4O96A 2LBFA 5DRBA 4CRLA 5E8XA 4ALUA 3A4PA 1OKZA 3CIKA 2EZIA 3T8OA 5J9LA 4GO1A 2GOMA 1SFEA 5AA8A 5EKOA 1FTZA 3VUDA 5GADJ 1O3TA 5M09A 3E3PA 1FYLA 3SRVA 2VTOA 5I9ZA 4QYYA 4P9FA 2A6TA 2RIOA 2W1EA 1U5TA 4JRVA 3WU2C 2EZKA 5DA3A 2YU9J 2V9VA 2NS7A 3FMJA 3Q9SA 1LDDA 2FE3A 4RG0A 4JAIA 4WOVA 4QMQA 3GC9A 2VASA 2GNGA 4E4LA 2I0HA 4GJ3A 2W4SA 4FIIA 4BCPA 1P4AA 2BRGA 4I94A 3LAUA 3DK7A 3NEUA 3V5TA 4IHWA 2W7XA 4FODA 4XBFA 5KK1A 1QPIA 4GRIA 4RRVA 4W4VA 3TXOA 5JFXA 3M8FA 1D1AA 4G17A 3AFHA 1FVVA 5GIPE 2WC2A 2W0JA 3IH2A 4FTUA 4AW2A 3KP2A 1P2FA 4B7TA 3PIOF 2DWBA 3I6WA 4ZZOA 2E7WA 5IQIA 3TIZA 4XN0A 3G33A 1OKWA 3FZOA 1RE8A 4ZSEA 4BGDA 3QP5A 3ABMH 2EUFB 4AP7A 4E6DA 2FUG2 4DEHA 1W5TA 2QNJA 1X3UA 4XLPF 2WQEA 3S8PA 3MB7A 2WTKB 3VS0A 3CUOA 4II3A 1FPQA 4IHXA 3LFKA 4JR7A 4IBMA 4IE9A 4QOXA 2E5NA 3M3YJ 2X4HA 3J7YJ 4LLGF 4AUAA 4PSXA 1W83A 3BCBA 3P23A 4D55A 2QOQA 2E1MC 3C4CA 4AZFA 1LNWA 4U79A 2WV0A 3I4NJ 4FNYA 4E4HA 5E8TA 1G3NA 1WCMJ 3RALA 1YW9A 2L01A 3NUNA 4DEIA 4FE7A 3K69A 1TQIA 3QKKA 2F5VA 1IG1A 3FLZA 2XRNA 3CJFA 3QCXA 2F48A 4FICA 3MIYA 3MJ1A 2KJCA 1YXVA 3T5XA 3D1NI 3QXOA 3EB0A 3ESWB 4D7MA 3ERKA 3E88A 1R39A 4AFEA 3GQIA 4FTAA 4E6QA 5CEKA 2OZAB 3G5DA 1S7EA 4C36A 2ITNA 1E3HA 3N4UA 4BAYA 2ZMEC 3NDMA 1MMGA 3BHUA 5GPCA 5C9CA 3H0ZA 1X19A 3SVVA 3O3KA 3FC1X 3QFVA 3GBGA 5I9VA 4A5NA 5D7AA 3KRRA 2V79A 5HVJA 3R01A 4ZK5A 3LCKA 3F5GA 3OVVA 2Y75A 1OIYA 3NZ0A 3TEDA 4FK6A 1J7IA 3BGZA 5ED4A 2FH9A 3EQGA 3W33A 5D8KB 2XYUA 2K27A 2DMPA 3A0BC 3CDLA 4H58A 3DBHB 2MG4A 3LSTA 1W4MA 2HPIA 2OH0E 2LGCA 2COBA 4OR5A 1APME 4YRVA 3KCKA 1KV2A 3VUIA 1Y0NA 3NVMB 4JAJA 3IUOA 5FLXK 1G5SA 1ZRCA 5KUPA 5AJQA 3K9TA 1GZKA 3S3NA 3KP7A 4UALA 1KU9A 2VUMJ 5EDNA 2IRFG 2PMOX 4D5HA 1WGXA 3UO4A 2C6OA 3UZPA 4K6ZA 3VYRB 1HLVA 4ONAA 4V04A 3UGCA 4L3JA 2ZV7A 1PUEE 1ZYRF 1KE7A 2YIYA 4DW6A 3RKBA 2J5PA 1CM8A 1WBPA 1R1WA 4BZDA 2E71A 2F5FA 4YG2F 4CCMA 4DGNA 2CKOA 4RGXA 3TJDA 4DFXE 3QRFF 5HDNA 4A3FJ 3LMMA 1XH5A 2TCTA 2WQNA 4WNPA 4JDHA 5EOBA 4PDPA 3LSKA 2CGVA 1MRVA 3PZHA 3OR2C 3P08A 2BY0A 1HSTA 3P9JA 4W97A 4AGDA 2XBJA 2VIXA 3FBNB 4QMNA 3GEZA 3BYSA 3QYEA 4C30A 3CDHA 1WVXA 2YWPA 4EZ5A 5J8FA 1YO5C 4ZTNA 5ANKA 3I0QA 4DBRA 3N4TA 3DKFA 1CF7B 1ETKA 2DFHA 3ZM9A 1PMVA 3A8XA 4ITHA 2GBYA 2HXQA 3C4FA 3QTRA 2ZJ2A 3WODF 4IEBA 3K4LA 1IW7F 3EL8A 1KSWA 2BDWA 3GFLA 2HY81 3MBLA 3Q52A 3KC3A 3H0GJ 4MGRA 3W2CA 3I5UA 5ETFA 3W2WA 3DAJA 5L8KA 2E5ZA 2ELJA 3ZO4A 3VF9A 2IW6A 4M6YA 3CUQC 3L8VA 2GNJA 1STCE 5F0CA 2YM8A 4YHFA 2QG5A 5AIPA 2P0WA 3BPRA 4PUZA 4ENKA 4CG9A 3PG3A 1VQLI 4BQAA 3QP6A 3FXZA 1UHMA 4GKIA 2JN6A 1W0TA 3PWYA 2NS0A 2R9SA 3D15A 5B5EC 2XRWA 3DLZA 1FOWA 4UNOA 4ZTRA 5HI2A 2B9HA 3DLAA 4L9TA 1MZBA 3NCGA 4RJ5A 4FV0A 4FX0A 2BCJA 4L44A 1G8SA 1IEPA 3BQRA 2FSOX 1ACIA 3IW7A 2ESMA 4B1RA 3VWAA 2PULA 3RNYA 4IZYA 4RC3A 4IHTA 1IUYA 4QMMA 3GTGJ 3HXLA 3Q4TA 3AL0B 2P5LC 4IJPA 4C38A 3V3VA 4RGRA 2KDZA 3RM7A 2W1GA 4IANA 2W00A 1OCOH 2C0IA 5LJJA 2QKMB 1BR1A 4GUEA 3MZ8A 1QMZA 2CGWA 5FFXA 2X1DA 1ST4A 3LA3A 1MDMA 5EQEA 2PQ8A 3QD2B 2BEOA 2E2BA 2RV8A 4B3XA 4MXAA 3POZA 1FYMA 4UV9A 3R1SA 1PKGA 4F9YA 4I0TA 2C5XA 4Q4ZF 5F1ZA 1XMAA 2NYAA 5L3DA 3ORTA 3H9JA 4N6YA 4NM3A 5TR6A 4TZRA 3LSPA 4YZ9A 3C1DA 4ZY6A 3IKVA 5E8IA 4YJVA 3TQNA 1QCFA 2XAMA 1ST0A 3DWLE 4AOJA 1E9HA 3MMYB 3NARA 5FBOA 1PDNC 3VBVA 4F9AA 3D0SA 1T33A 3F8BA 1RKTA 2AO9A 2B7EA 2Y6MA 4RS8A 2B1PA 4HF2A 4MHAA 2L9RA 4ZSJA 3LQQA 3BL9A 4TPTA 2LF8A 1RPWA 4JX5A 3E0JB 1JKSA 2HTJA 5FTGA 3RINA 3WBLA 2AXTC 2DMTA 4BDFA 2O5RA 1H00A 3ORNA 1UU9A 3CP9A 2EU9A 4G34A 1TTYA 4N0BA 4GIIA 4QQCA 4YELA 4I6LA 2ZB0A 2EV5A 5DEWA 4R7HA 2M45A 3W16A 4FNZA 3TDVA 4H4KC 3AT2A 2R3KA 4FZFB 3SW7A 4PF4A 4RVMA 2C3KA 1EF4A 1IA8A 4AAAA 4FYOA 4LB5A 3GCMA 4DH7A 2BROA 2YJRA 2EWNA 3Q3BA 3OMYA 5KAFC 5FQDC 4MXXA 4ZZNA 2R3QA 4A3BJ 3LSHA 5FXSA 5E1SA 3KIOC 3DJ6A 4U6RA 3LSJA 2ITWA 4CQEA 2E1OA 1GUUA 5L8JA 4LG3A 4IPAA 1IRZA 3OIPA 2OJIA 1FGIA 5DVRA 3CCVI 2H9VA 4H39A 4PUSA 3PDTA 4EHVA 3FWQA 5DCMB 3QPHA 5F1RA 2VTRA 4O7ZA 2E19A 4PL5A 4EOSA 3KY2A 3QRIA 3CF2A 4CT2A 4S05A 3LOKA 2MD5A 1B8IA 2VTHA 4BDKA 2YAKA 1V55H 3Q9WA 2PK9A 2KIQA 3U6HA 3L8XA 4XJ0A 4FKVA 4OBQA 4FUXA 3I4PA 2VOPA 3OROA 2IN6A 5BUEA 2ZJRF 2QHNA 4C02A 2YIXA 3QLGA 2ITUA 2IEKA 1URWA 1XH9A 3L9LA 2XK6A 1OMWA 4Y8DA 3I3LA 2ZNYA 5CU0A 2XHKA 4W4XA 3ZMDA 2BW3B 2XM9A 1ODDA 5HD4A 1T38A 3E6MA 3L9MA 4C3RA 2R3NA 2R3FA 1BIAA 4NC8A 1W7PA 2JA6J 4I0SA 2M8EA 4DFYA 2OBPA 2XRLA 2FXAA 4M3FA 3EQIA 5BNJA 2WAQA 2PSQA 2BMCA 2OFUA 3ABUA 1Y57A 3QQUA 4E4XA 2XB5A 2YITA 2O6GE 3H1CA 5GP9A 3GNIB 3LM0A 3MY0A 1FLIA 2C68A 5E7RA 5HE1A 3R30A 5DPVA 2PVNA 5LHGA 2X1CA 3VRYA 2WTWA 4HVHA 4X2GA 5F4NA 3NS9A 4LRKA 4ZC3A 1ZMUA 3ZRMA 3OYJA 4JVGA 2WMSA 3O8PA 3UDBA 3O2PE 3AG3H 1OQYA 1M52A 2RL5A 4FV9A 3QQGA 3I7CA 5ANOA 4UB7A 4M72A 2BZIB 4HNFA 3LJ2A 2FYSA 1IAJA 3H5RA 2KISA 2OIDA 1WBOA 1JUMA 2PMNX 3CXWA 3V8WA 1TP4A 2RVCA 2GHLA 5A4EA 2XGCA 3CMEI 1I27A 2BY2A 4PK4A 3E7VA 4BDEA 3E64A 3UYTA 4CD0A 4FYNA 3NQOA 3RK5A 1JJ6C 4Y46A 3D5XA 4EK4A 2ZFUA 4P55A 4RGSA 5KBQA 3JSOA 4FJVA 2XK4A 3TTIA 2CQXA 4QTAA 4WNKA 3NEWA 5CTPA 2XZSA 3RAWA 2WWYA 3BEGA 3L8SA 2HYJA 2XROA 3TP3A 3JRCA 4KD1A 2BV6A 5B0XA 4BC6A 3U4UA 2X51A 2X48A 4MEXF 1ZYSA 2GAUA 4ZTSA 2MA3A 3KP5A 2K3PA 3DNDA 5IY5H 1EV7A 3VS5A 4BIDA 2BKKA 2XIZA 3S14J 5HIEA 3IGOA 1CDKA 4FISA 3GTPJ 1HW1A 3ZXTA 4XG7A 4NUSA 4O7TA 2LVSA 4B09A 4BXFA 3T1BA 3GYHX 4FKIA 5D7VA 5DUIA 5ANEA 4BJTA 1QPCA 3EQPA 2HXIA 2KRFA 3E3BX 3RYPA 2UW9A 3HTUA 1ETXA 3ZO1A 3N97A 1AKHB 2QONA 2YS9A 5CNNA 3HP2A 5FO5A 3BDDA 1WQ2A 3V5JA 5AMNA 4MNEB 5EH0A 2GTNA 3ZEPA 4KA4A 3F3ZA 3R9NA 4PTGA 4XONA 3RKYA 3LQ5A 1GY3A 5D10A 1V5FA 1GIHA 3OT8A 1F4KA 3U51A 3AD6A 3HVCA 3CESA 1A5JA 2Z99A 3W1FA 4F92B 3W2QA 2KDOA 4FTLA 3KPHA 4ASDA 2J5FA 2C4GA 3H9OA 3EN9A 3O50A 3I79A 3CQUA 5E3LA 5HIDA 5ICEA 3FKNA 4AU7A 2A61A 2QD9A 4FETA 4HF0A 5DCFA 1MBHA 5HBJA 4PNKA 5DS9A 4JP0A 3LXKA 4EH5A 3UOHA 2VKDA 3X2QH 3ZMMA 3PJ2A 5LWNA 4HV6A 1FJLA 4U87A 3H35A 4EQQA 4WG5A 4RJ3A 3OWLA 4LLLA 2VO7A 3FMEA 3GWZA 4GK4A 1W0UA 5M4CA 4EGZA 3WG7H 1A35A 3CMMA 2FUMA 1VQMI 1GNGA 4GFOA 3ZTXA 5C44J 3VUHA 4W8EA 5L6OA 3BYOA 1MNDA 4PFOA 3VJOA 1QHHD 3F61A 3GU8A 5ACKA 3D5UA 4I99C 3WTVC 3KZZA 3M07A 2IS6A 3GO5A 2OBJA 2IT0A 3PUBA 3K3JA 4LD5A 4Q47A 2Y6OA 3S1NJ 5EG0B 4CZCA 2ITPA 4CFVA 3T9TA 2QQAA 2Z7QA 1S8NA 2DW4A 4FR4A 1ON1A 3E5UA 5IOYA 4EQUA 2WY8Q 1H07A 1JT0A 3BWJA 4DGGA 4YZDA 4IHSA 3HGGA 4FSWA 4IMYA 1UWHA 3SHFA 3UDZA 4Y3OA 3HV4A 2WQBA 2XAFA 5DIAA 2IPQX 1Q99A 4U5JA 1Q8YA 4F9WA 4X3FA 3UIMA 5FRIA 2V1DA 1J0RA 3F88A 3UPZA 2QOFA 4DG2E 5DFPA 4JX4A 4X2FA 3KMMA 3AG2H 4YJTA 2GU8A 3SJMA 1QA6A 3RI1A 2GQGA 1LFBA 4DC2A 4DF3A 4NDLA 4NW5A 5E4HA 4CXFA 3R8UA 2I0VA 1POGA 2XNOA 4QTBA 3P9KA 2VN9A 1T46A 3QKLA 2BALA 3UO6A 2A27A 5JGDA 4RLKA 4AYBA 2WMXA 2PL0A 4Y17A 5GAHJ 3CE3A 5D5WB 4Q2AA 2X81A 4M67A 3LXLA 3CCEI 4OIPF 1B9NA 3HG9A 3PY3A 1IRGA 5H2FC 5FLMJ 5A3XA 5DM6F 3ZFYA 4BEHB 4OT6A 4ASEA 4YSMA 2P6SA 2JRTA 4L18B 3PUFC 3WYXA 3IDCA 3UIUA 4FUYA 4F1TA 2YCRA 4YFNF 4CCUA 4ESFA 1UELB 4PJMA 2WFYA 4GCVA 4U88A 2UZOA 1ONVA 2WY7Q 2XNMA 1UHWA 2W7NA 4FIFA 4QPSA 4KNBA 3EPZA 4O38A 4Z7HA 4TWOA 3UIBA 4DE4A 4F91B 4MD8E 3VBYA 2XIRA 3HV7A 5JSMA 4IHPA 3BT9A 1I39A 1G3YA 1Z6RA 2KL4A 4FEVA 3L1SA 3AG9A 3QC4A 4DTKA 4UX9A 1KWPA 3PA4A 4RIWA 4M69B 1MJAA 5E8GA 4FEWA 5CY3A 3FXJA 1DS5A 3RPOA 1ZY4A 4UVAA 3QWJA 3FF5A 5IT3A 1ETYA 4DBXA 2GQQA 2UZUE 1LE8B 1FVTA 3UMWA 2ZV8A 5EEHA 2QVOA 3MFRA 2CRGA 1XKKA 4ZLOA 5IG1A 3HOSA 3HLLA 4Y13A 3HEFA 5L3GA 1IASA 5JHFA 2EIJH 2QQ7A 5F1JA 5TOZA 3WZDA 1X58A 2XM8A 1O7FA 2DFEA 1G3SA 5AUTA 4FA2A 1XCBA 4ID7A 3G3ZA 1W7PD 3TBIA 5CEPA 1IO2A 1IR3A 5D8LB 3GC0A 4DFNA 3UDSA 3G2FA 4WIHA 4F7ZA 4G12A 3I5ZA 3RJCA 5ANIA 5G6VA 5IH5A 5KMMA 3UO5A 3MN2A 5DE2A 3G0EA 1HKTA 4RLLA 3BLAA 4U7ZA 2DFIA 2BZKB 3GVUA 3R7UA 5B2KA 3DTWA 1IUFA 4CO8A 2W4JA 5ILUA 3LE6A 1FOXA 4ZYHA 3S32A 4RB1A 3NYOA 2H6DA 5HTCA 5AIRA 2W1OA 2BRMA 3NWSA 3VULA 2L2OA 3KYLA 1SC7A 2PUIA 3ANRA 4U7BA 2VXZA 4AVZA 4AZEA 4OTGA 5IT9K 3E62A 2E9OA 4I24A 3EN5A 1TWFJ 4E7WA 5BYYA 2R5ZA 2UW4A 4DG3E 2CV1A 4EL9A 5C8NA 2HWOA 3ZSIA 4D2RA 2OFVA 3JSPA 4IADA 4TWNA 3PNYA 3FPQA 2LFBA 3EYGA 1Z1DA 3SD0A 1JNKA 3ACKA 1JSTA 3EHAA 2XKDA 4YJUA 3ORMA 4BBEA 2K86A 2Z8CA 2FNPA 1KU7A 5CPRB 4FX4A 1HKSA 3DXQA 1Z7LA 2G2HA 4PRJA 3SZPA 3ABTA 1XO2B 3E6BA 4C3HJ 4RFZA 4EOIA 4YTFA 4DA5A 2H27A 3GCSA 3OW4A 3LM5A 2QLZA 5CKTA 1XCVA 1J75A 3GFMA 1SNUA 3VSLA 5CQWA 4WBOA 3CTJA 4EV0A 5EYKA 4AT4A 2L3DA 3GCUA 5A9UA 2Z7RA 3M1SA 1YYVA 3KE2A 4KIPA 3WU0A 4AZWA 4KN7X 4O82A 3U9GA 2C0OA 2WPAA 3TP0A 4ZSLA 2YX4A 1FX7A 2F5CA 2JLDA 1H1PA 3DBLB 3TUDA 2DA1A 3VHKA 4K2EA 1ZY5A 5H20A 3W55A 3LSMA 1S9JA 5H8BA 4NCTA 4RM2A 3MFUA 1LQ1A 5IA1A 4DTBA 3F8FA 4CYCB 3EQBA 4UZDA 2IP2A 1G6NA 3MFTA 5F94A 1KGSA 1GJOA 4ZTQA 1QNTA 2OJGA 5LBQA 2G2IA 2QR8A 4CHUA 1WVRA 1IV6A 4DAWA 4O0SA 1MNMC 4TN6A 2H09A 4ZY4A 4CKJA 3PIPF 3FQSA 3NNWA 4EK3A 4KIBA 2VTMA 1YXSA 2M0MA 1G8XA 4U80A 5DNRA 2ZDTA 4IHVA 2Z60A 1UB9A 1QO0D 3BTCA 5CF8A 3RQ4A 3R2YA 3CGOA 2E7XA 4X6RA 4V2GA 3K0LA 2UZLA 2ITOA 3W18A 2J0MB 2GOXB 5LLQA 4BCNA 1W8CA 1PMEA 4NK9A 4XLFA 5CSWA 1GIIA 4XS2A 2B52A 3BOQA 2NNWB 3ZR8X 4TTHB 4GJ2A 1LP4A 4X6QC 1BL6A 1OISA 2MLGA 1SVHA 3Q9ZA 4KITB 3QGWA 3CQZJ 2Z3YA 1PKDA 3P5JC 4XN3A 1M17A 5FGKA 2VJ4A 4MD9E 1PUFA 3GZ6A 1OJLA 2HZNA 2V1UA 5TKDA 4IVNA 4AIDA 4FSQA 3QYBA 4AN3A 2UZNA 3JRDA 1YW7A 4R6VA 4YHJA 4YNEA 1MJ9A 3TDUC 3D5WA 5EYDA 4XL9A 3HMPA 1HW2A 2C5OA 4DEDA 1ETWA 5LMKC 1BC7C 3E5QA 1OGUA 3E8DA 4UBAA 3ZH8A 1HOMA 3W2VA 3Q6UA 3QUDA 3ENHA 5A4QA 4WT6A 2DYLA 3B8RA 3HV3A 3LMHA 2QOKA 3FV8A 4C4GA 4D0XA 4BKXA 1UWJA 5KMOA 1I5ZA 4NM0A