3TMOA

The catalytic domain of human deubiquitinase duba
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
141
Chain Sequence
AARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGACLFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYHGNHIEMQAMAEMYNRPVEVYQYSTGTSAVEPINTFHGIHQNEDEPIRVSYHRNIHYNSVVNPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Phosphorylation-dependent activity of the deubiquitinase DUBA.
pubmed doi rcsb
molecule keywords OTU domain-containing protein 5
source organism Homo sapiens
molecule tags Hydrolase
total genus 33
structure length 141
sequence length 158
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02338 OTU OTU-like cysteine protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1640 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3tmoA02
3.30.200.90 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tmoA01
3PFYA 3TMOA
chains in the Genus database with same CATH superfamily
3ZEPA 1W8CA 4L43A 4CCBA 4HQEA 4Y5HA 1QVTA 1IASA 3JCUC 4PQNA 1ZARA 4G7OF 1IDZA 4ZTJA 3SW4A 2E5ZA 5BYZA 4UV8A 3N9XA 4Q5SF 4EI4A 3L9PA 5B3SH 3WF9A 3O7LB 4F9CA 3CCRI 4B8XA 4KFCA 4F7SA 1PYXA 5L3DA 3E92A 3JVSA 1BI8A 4XKWA 3TUCA 5AX9A 1G3WA 5H6QA 4R7BA 4GFGA 3LSTA 4LV7A 4TPTA 2DO7A 4BDFA 4E70A 3S8PA 5JFSA 5AWMA 1HW1A 3KXMA 3GUDA 3UOJA 1IAJA 5CNOA 3I71A 4II2A 2EV5A 3SRVB 3A02A 4HZFA 1F1ZA 1WCCA 5CF6A 2XGXA 4N4SA 4O7WA 4AD9A 2B7AA 5L2IA 4BDDA 2BOLA 4DF3A 3UODA 4MAOA 2X6EA 4N0BA 3DDQA 1XSDA 4D4RA 1K79A 2K02A 2OV7A 2VBYA 5F95A 3HUGB 2MG4A 2L7ZA 2BRHA 2PYWA 3WZDA 3QHRA 2PZYA 4UN0C 2DPUA 3LM5A 3THBA 3CMMA 1TWCJ 3N4MA 4ESFA 2W1DA 5FUTA 4FVPA 1E2XA 5HIDA 1NW1A 5KK1A 4GU6A 2A68F 2CLXA 1UZCA 2MYSA 5HNIX 1Q5KA 2WEIA 1W0UA 5IH4A 2PEXA 1QQIA 4PDPA 4IQ4A 2JDOA 4E6DA 4TRLA 1W0TA 2YCFA 3IW5A 4BHCA 2DMUA 4QMLA 4AZFA 3VEPA 4RG0A 4ZSAA 1JSUA 4AT5A 1A31A 2DXIA 1UWJA 3P78A 4Y95A 3ASOH 3MAJA 3AOXA 2ISZA 1F36A 3K3IA 3CTJA 2VQCA 2M4KA 5JHFA 4Y15A 2AXLA 5DDGA 3QYFA 1ITYA 2ONLA 4F64A 4FYNA 4FSQA 4NJDA 1TNTA 2G9WA 1APME 4KRCA 5HX8A 1QPJA 3K4MA 2PSQA 1IUFA 1PMVA 3CSVA 5E79C 2DT5A 3T8RA 3G15A 1U8BA 1W83A 1T46A 4AA4A 3FZOA 1MBFA 3D5LA 5BV3A 5JRSA 3RAKA 3DZQA 5E8YA 4I93A 3OYDA 1G8XA 2WTVA 2QSFX 5CX9A 3GLXA 5M5WJ 5GNKA 4X1EA 1OECA 2CUEA 3WOWA 2DTRA 3DBDA 1R49A 3KMUA 3EH9A 4ZLOA 4EBVA 3Q32A 4O0VA 4F9AA 4WIHA 4AF3A 1F5QA 3QPHA 3SJMA 1OZ1A 1AA7A 3NCZA 3PJ3A 3HLLA 4GVJA 4AA0A 5EGOB 1ZREA 2XM9A 4FX3A 3DK7A 3SRVA 1X19A 3S2WA 3MW1A 3LSHA 3ESWB 2BVAA 4J95A 5C8NA 3KRRA 3JRFA 3G2BA 3A1YA 5AIQA 4LK0F 5IH6A 2QWWA 5B2MA 5GAGJ 5I4NA 2XV4S 4OIQF 2Z7QA 2M3AA 5HLPA 3HUGA 5GADJ 4XRFA 3F3ZA 3K2AA 4P55A 3GTLJ 4O6LA 5EKOA 2Q1ZB 4BQAA 4EV0A 4G5JA 1BX6A 3JUHA 3PVBA 3H5AA 4K2RA 2PWLA 4FBXA 3PNTA 3IKAA 3B73A 1YDTE 4DHIB 3ORZA 2HKOA 4C4JA 3ODZX 2IWIA 3I9V2 5CEQA 3EQFA 4L67A 1U54A 5F08A 5E90A 4CZCA 4K33A 5J40A 5CU4A 1WVXA 4E8AA 1NT2A 5IQHA 1LKXA 1FMVA 3DQVC 5CT0A 1PYEA 4UEUA 2G2FA 4OU0A 3R73A 1TZLA 4JBQA 1DP7P 2ITOA 4FMQA 4ORKA 3EKKA 3IDPA 2OIDA 2CSOA 3LFAA 4IDVA 2VTHA 4FSWA 4YJNA 2OBJA 4II5A 3QCSA 4BCHA 1OPCA 4BDGA 4PTCA 5CVUA 3VF9A 1PY5A 4BCQA 4NFNA 3TV7A 3NPCA 5HICA 2JWTA 3GXOA 1SANA 5L3FA 2WMSA 5KMLA 2LLKA 2PZPA 5KMKA 4J97A 4D1QA 4B3XA 2ZYBA 5K5OA 3D0EA 5EI8A 4EC9A 4RBLA 2GLOA 1D1AA 4GEOA 4DOZA 4A3FJ 5JVTA 4QP1A 1W84A 1V54H 1A48A 4MBIA 4OTDA 2DA6A 2F5DA 5M51A 3R9RA 2X51A 5EGOA 2HS5A 2VIXA 2RC4A 3CY3A 4HDVA 3I4BA 3D5RC 4ANJA 4DFUA 3GZ6A 1RC9A 2BVMA 5L3CA 4PDKA 2QONA 3EZRA 3G1LA 3RSNA 1GZOA 2XNPA 4L68A 5C9CA 4BHZA 1TWAJ 3JSPA 1JKTA 5KAIC 4BQNA 4H39A 2EB3A 4ZYHA 3QWKA 1H25A 3OYMA 3HYHA 1Q1VA 1MBEA 2C69A 2H6DA 3DPLC 3MY1A 5D41A 4A69C 3R2BA 4GMYA 3ZFXA 1OLTA 3PJ8A 5E8TA 4CA0A 3GUBA 2LNBA 1XGMA 4Y72A 4R78A 2HZNA 5KMNA 3U4UA 4RS8A 3F66A 3VODA 2Y6OA 4D1ZA 4DTKA 4UB7A 4F93B 5GP9A 1MQBA 2X6WA 3OY1A 2VC1A 4DITA 5A2QZ 2IT0A 3W0SA 1X3ZB 3F9KA 4GUBA 4E5BA 5BQ0A 4FIIA 4RT7A 3IW6A 4JRVA 3KXZA 2R7WA 5DT3A 5K4IA 4RJ7A 3BR3A 4AT4A 2QD9A 5LWNA 1XGNA 4RFZA 5FRIA 4BY9E 1TQMA 1HCRA 3LJ0A 1UU9A 2ZVAA 2Z7SA 2ZCWA 1IA9A 1OCOH 2BZIB 2R3JA 3OXTA 5KUPA 2QGUA 3FXUA 5J8CA 1YOLA 4RA4A 4USEA 1MRYA 2QQ9A 2DQLA 4HNTA 1R5ID 3WGHA 4FTMA 4C35A 1BM9A 3P7NA 3V6SA 3F3VA 1SD5A 3R21A 3ODYX 2DK5A 2ZO4A 1VEBA 5A4LA 2D1HA 5JRQA 4HG2A 4R1YA 4QMTA 4KNBA 4EQUA 5BVNA 3PRIA 5CEKA 3MGYA 4DNCA 4X2JA 3MZHA 2K9QA 4BXUA 4V01A 5LVMA 1WKMA 4FV0A 3FKIJ 5CZHA 2AS5F 2A0CX 3W1FA 2PL0A 2C6DA 2ITUA 4M6VA 3Q60A 5AP3A 5BVWA 2YEXA 2R3GA 4BIBA 3HL2A 2R7TA 4LD5A 1P92A 3AC1A 4BF2A 2L01A 3IWZA 4GO1A 4IX3A 3ZO2A 1H0VA 3KIOC 1FBQA 3V8LA 4UNOA 2A2AA 4KA4A 4YLLA 5HLGA 2OXDA 5KNLA 1FVTA 4L53A 1TNSA 2H9VA 2JPCA 1S9JA 1O9UA 4Z55A 3KPHA 1XCVA 4BBSJ 4BCKA 4EORA 3PIXA 2OKRA 4JT3A 3MB6A 1UKHA 2P4IA 1DI8A 5FLXZ 4IVAA 3JREA 3C0GA 3NMUF 3ORKA 1OPLA 3DBFA 3FM3A 4IZZA 3A99A 4RC4A 3HXLA 4AFEA 4J01A 1T38A 4HPTE 4L5JA 4YTCA 3ZBXA 5B66C 5AA8A 4ITIA 5HE3A 3OXIA 3ZRMA 2GS2A 4HF1A 4CGZA 3EN4A 4QYEA 4QPSA 5DM7F 1MMAA 4AIJA 3ZQGA 5LHHA 4NTTA 3W16A 3EYGA 4XRJA 1OYWA 1QNTA 4QPOA 3W2RA 2O3FA 4H05A 3BWFA 4AN2A 1RKWA 3LFKA 3FAAA 5AIPA 1G5SA 3T3VA 5EOBA 3MI9A 3ROCA 5F1JA 1SVMA 1OIUA 4TY1A 1PYVA 5CU2A 1MD0A 2G7UA 4R6VA 4BIEA 2XJ0A 4XNEA 4ZYEA 5A14A 1RETA 5BX0A 3I5NA 4OBOA 4YC8A 5HLIA 3TJCA 3GTPJ 2PFBA 2GNIA 4S04A 4S31A 3MVPA 3LFSA 2M7AA 4MIMA 4FUYA 2X9DA 2UZEA 5CXZA 1KQ8A 2WMVA 3FWEA 2WZJA 4U7ZA 5D6FA 4IM0A 1A06A 2JEDA 2IVMA 3ZZWA 2WTKC 1Y8RB 2XIZA 3HRFA 2L0KA 4XORA 2CHLA 5ICPA 2OXXA 3C4WA 1AHDP 2F4JA 2JD5A 2OQRA 2YAAA 1HKTA 3I54A 3L2QA 4ZSJA 1E3HA 2XRWA 2I6LA 2HOAA 4TWPA 3VS0A 4O7VA 4GW8A 5A4TA 5BPDA 1KU2A 4FTNA 4M6XA 1QCFA 4YZ9A 3UVPA 1RUNA 1OCTC 3MFTA 3OY3A 2XK3A 3KC3A 3AQVA 3JRIA 5AA9A 4JQFA 2GWRA 4HNIA 3R22A 3QWJA 4KS8A 2C6LA 3L2WA 3D14A 2V9VA 2NPQA 3E6DA 3SG9A 1TWHJ 3NAXA 2WOTA 1JKPC 1ZZ2A 1PXIA 3P5KA 2WMUA 1YOVB 1GXQA 5AIKA 3OEZA 3PFQA 5CSPA 3QXPA 1MNDA 1XPXA 4FTTA 4CXFA 3SHFA 3AD4A 2XVCA 4LB5A 3TEDA 2YIXA 3FC1X 4L3PA 5HNGA 4IZ7A 1Q8UA 2Y0SN 2FMLA 3FDNA 4FKJA 3D4QA 3FQEA 4A3IJ 3F61A 2LREA 2GM4A 1FPUA 4JK1X 3LMHA 5E1SA 4F99A 3R1NA 5H8GA 3ZO4A 2QKLB 3W3CA 1Z7LA 3REPA 3LFUA 3DLAA 1Y1VJ 4ACHA 5ED4A 3NEWA 4MXZA 3H3ZA 4MNEA 1W5TA 2R7QA 5B2KA 3RIRA 4Q48A 5IQDA 1REJA 4UVAA 3CJRB 3GFEA 3IW8A 4QIWN 2KISA 5E1XA 4AXCA 2YDKA 4LGGA 4IC8A 1GLNA 2VTQA 1RE8A 1T6SA 4XG8A 2PQ8A 4ZTRA 3KRJA 4AE6A 3LWFA 2DW4A 3K4CA 1A9UA 1FOKA 3NVKI 2E7WA 4IFCA 5AAEA 3HHGA 4RM2A 2QEXI 3CCLI 1AWCA 3WTYC 1OVEA 3QTRA 4LIVA 4I94A 3A8XA 1RDQE 3GLLA 3QYEA 4A93J 3FQHA 1Y1WJ 3CJQB 1S7OA 1OMWA 5B0XA 1SFUA 3KREA 5CTPA 4LOOA 4EOKA 2O0YA 1JPAA 4DEBA 4RFMA 4LB6B 2JSCA 2OJIA 3MN2A 4HVIA 3AMYA 5C4KA 3QGYA 2R3LA 4BQOA 4JXFA 1BR4A 3RKXA 1KQ9A 4CCNA 5EM5A 3W6VA 4IJPA 4QEBA 2OZAB 4JX5A 5L8JA 4F65A 1IEPA 2QHNA 3DQXA 2K27A 5L6PA 3T8OA 4L52A 1MH4A 4E6AA 3K7AJ 4OINF 5EKNA 3OOUA 4I6HA 4JBAA 2W1CA 3HMNA 3BROA 3CCEI 3WBLA 4WCGA 4BGDA 2CJJA 3Q9SA 2WPAA 2B55A 3S00A 5AV4A 4JX4A 2XJ2A 3GEQA 3QQUA 2R3NA 1BL0A 1VNDA 4ZP5A 5DYMA 3WTSC 1FX7A 2X1CA 5FQDC 3U8WA 1Q3DA 2VWIA 4IWOA 4KKHA 3AD5A 5I9XA 4D5FA 2OCCH 4AN3A 2FQ3A 2HGCA 1LVKA 4GRIA 3BEGA 1SAUA 4QOXA 5EM8A 3BT9A 4ANLA 1H1PA 5IA3A 5L8KA 1BKXA 4CZZA 1BI7A 3F5UA 3FBNB 2H6CA 4A9RA 4U6RA 3KZIC 3M7GA 4OMZA 3WIKA 4P5QA 1U6GA 3UMWA 3IC7A 3K5UA 3MKYB 5EDPA 1M7QA 1P4OA 2BYVE 2WMTA 4BAYA 2X1NA 4EWHA 1M52A 1BBYA 2X2LA 2H94A 1HLVA 4M71A 2GNFA 4XSZF 4LV5A 4OR5A 4QO9A 2DFFA 1Q8TA 3PSIA 4G1WA 1FBNA 1Z57A 5IDNA 1UNGA 3EQCA 4HYIA 4C7TA 4O2PA 4QMYA 3AT3A 3Q2JA 5AV0A 4XLIA 4RX8A 3A0HC 2UZUE 1HQCA 3ZM4A 1P4FA 3CDIA 3REOA 4XLNF 1I5ZA 3CUOA 1H9GA 4EL9A 3O51A 4USDA 1NY3A 1T0FA 1U5TC 4GIIA 3AKZA 2R7BA 4BCOA 1EH8A 3L9NA 4IB1A 3WGIA 4E4LA 4O2ZA 2HPMA 1K83J 2A27A 3M07A 2ZAZA 4RVKA 3S3OA 3DPUA 3QC4A 1NHAA 4TWNA 2OZAA 3UO4A 3HKOA 3PUPA 2WTCA 1MNEA 4ZDLA 3BOQA 2B1PA 3I7CA 5D1JA 1JUSA 3GF2A 2IAIA 4DFZE 2M0CA 4UXNA 4ZJJA 3BJOA 1VQLI 4ZOGA 1G8SA 4BJTA 4K11A 3RI4A 1IRZA 1GZNA 2R5TA 3NYVA 4FZDB 3J7AY 2J0LA 1LEBA 4BCNA 1PRYA 4YJTA 3F7ZA 4IHVA 2Z02A 1WH5A 4BEHB 2X1DA 3FSKA 2E19A 3PZEA 3ZSGA 3BR5A 4ZJZA 3QAHA 4Y8DA 1B38A 5EHOA 3DPTA 1XGSA 1DP3A 2JFLA 2NAZA 3W6JB 2GOMA 3RTPA 1H28A 5KKRB 1OM1A 2VKEA 1Y8GA 2UVYA 4MQ9F 4EH4A 1JKOC 3PNYA 4D0WA 2NVUB 2ACJA 4CV8A 3IUOA 2YWPA 2F7ZE 4ZAUA 1SD4A 3HRTA 4AW2A 3DTIA 2HDDA 5E3NA 5CY3A 3MPAA 3WIGA 5CWZA 4YLKA 2QM3A 3KXHA 3JAMZ 2H6BA 2VKVA 4CFUA 1Z9XA 2J5EA 4LRJA 3DOGA 1RJBA 3GU5A 3WF5A 1B6AA 4YJQA 3ZQHA 1YIJI 1R4NB 2VT3A 3T1BA 1OCRH 2O65A 3M8JA 2E1MC 3EQHA 1Z6RA 4JDHA 3HHHA 4E4MA 3U6IA 5JZJA 4GCVA 1B39A 2W5BA 1WBTA 3PUFA 3LCDA 3DA6A 3ZXZA 1K61A 1VZOA 4E6CA 1OL2A 4OUCA 1ENHA 2ONLC 3PQJA 5IQEA 1KSWA 3I59B 3MD2A 4DH5A 3LSKA 3FJQE 1YJNI 4KT6A 3SQQA 1Q3WA 4I20A 1W5CC 3E8EA 4EJOA 3QU3A 1Q61A 3MH0A 2BZHB 3WG9A 4G9CA 2OG8A 4WKQA 2Y9ZA 3QRJA 1WJ5A 3BU6A 3E8CA 3VUDA 4U87A 5D5XB 3ATTA 5AV3A 1DPRA 3L9FA 1OL1A 2ME0A 3OYFA 3PPJA 3WTVC 5FP6A 5D8KB 1O3QA 2NO3A 3NUSA 5HNHA 3I81A 2R0UA 2AC5A 1R23A 1QA6A 4NCTA 3W0PA 4ACMA 1NXKA 4U5JA 3BTCA 2Z3YA 3J80K 3ORNA 1IRFA 4FOCA 2O2UA 4XN0A 4XOTA 4EM1A 3ERKA 4BEHA 3LA2A 1WFCA 1IR3A 4L7SA 4WNOA 3SXRA 3CY2A 4AGWA 5ICFA 2QSGX 1YXXA 2A1AB 5D6EA 5EG0B 2YWVA 4IX5A 2B9SA 1YX3A 2XARA 2HW6A 4JR3A 3I6WA 5DVRA 3EMGA 3MFRA 3S3NA 2VGPA 3KZYA 3I5ZA 4DGLC 1QRYA 4HDUA 2CNQA 3UQGA 1MMSA 3V8JA 1W82A 3PPKA 2BFXA 4XS2A 4X6AJ 4TW9A 1E3PA 4M67A 1HSJA 2R7DA 1O3RA 1C0WA 1X3WB 4CGAA 3WU2C 1FYLA 4C58A 3WI6A 3LSJA 3OWLA 4LLNA 3W0MA 3ZSHA 1H4LA 4ZYDA 1PUFA 3KB7A 3G1OA 3GQIA 3FXJA 3ZOSA 3K2ZA 1Z5MA 2ZJPF 2A61A 2RQPA 5L3AA 4MXOA 3QZGA 4M72A 5JLWA 2P5KA 1BL6A 3I59A 4F63A 1GIJA 5IT3A 4S32A 3CQUA 2UUEA 5LOHA 3HKZN 1ULYA 3DAJA 3ITZA 1OFCX 5GJGA 4V19K 3RK5A 1DQUA 4GKIA 3U1DA 4W97A 2F7XE 4FTJA 3BWGA 3W18A 2XEYA 3OBGA 4JQ8A 3M1SA 5HD7A 3KP7A 4FASD 1OITA 4FKQA 3GTKJ 1XD7A 2EPFA 1FOYA 3GBGA 4HLXA 1FEXA 4FIFA 4JDIA 5EHLA 3UIBA 3BQRA 2Z5UA 1BC7C 3K1MA 4R79A 3BGZA 3J7AO 4G5PA 1PXOA 2W1ZA 4GYIA 5EQPA 5M53A 2XYNA 2WTJA 2JA6J 2M4GA 1ERDA 3IECA 4HNUA 2RKHA 4DEIA 1J7KA 4NWMA 4OTHA 3KE2A 4I92A 4S2ZA 1U3EM 4E20A 3EQGA 4B6LA 2GZWA 5EG0A 2VWYA 3ZQ7A 4IZYA 2PTKA 2MD5A 3EYIA 5E3LA 4QMXA 3L2UA 1GZKA 5D7VA 4AA5A 3KFWX 4IVNA 2BZTA 3OD6X 3RZDJ 4AWXB 2QF7A 3D2IA 4NW6A 1I44A 1B72B 4JAIA 3ZXSA 3CP9A 3RJCA 4L44A 3ZN0A 2CQXA 2E71A 3GB2A 2UVZA 2L9SA 1A6IA 4X7QA 5CKTA 3TKHA 5LGTA 3BBTB 3AC5A 4GVAA 4OWRB 4KAOA 2B0LA 4WRSA 4F1MA 1YJ9I 4OOIA 3F2NA 4EOPA 3KN6A 4MNUA 3DY7A 2YN8A 3GP0A 2M8EA 2W57A 2V79A 3R8PA 4U9AA 4E4HA 5B5EC 3AT4A 3WGGA 3JRCA 4BBRJ 2VV9A 2E60A 4FSMA 2WMRA 3U9GA 2KP6A 4HPUE 5K5XA 2H1KA 4JLCA 2VQLA 3T5XA 3ZMSA 5CI6A 3TIYA 4HX7A 4I4FA 5JSMA 2UW6A 5HDNA 2ITQA 4AYBN 3UDZA 1FVRA 4ZDOA 3FF5A 3F5PA 1MKMA 1Z9CA 4WX9A 3RZBA 4E6QA 3FKJA 3BHHA 3E5AA 3O7LD 5AUXA 5EFQA 2VPLA 2R9SA 4EYJA 2L4MA 3V01A 2HTJA 3PJCA 3NFFB 3R71A 2XAMA 3PO3J 3ZONA 1PP8F 2K3PA 3B2TA 4EC8A 5LHGA 3W2SA 4ZS4A 3OSFA 2QURA 4G8XA 2F5EA 2FXAA 1KV2A 4N4OB 4TXCA 2XB0X 3BHVA 4UXQA 4I99C 4QNYA 2V6EA 3LXPA 5HESA 4GK2A 3M2WA 3DKXA 5L3EA 2ZXWH 1W7HA 3V5LA 3WF8A 2V9PA 2UW7A 3AG2H 1G6NA 3Q5ZA 3MTLA 1Z3YA 2NS7A 2VWBA 1YI3A 5IYDJ 1RUOA 2FF4A 3O6BB 2V7FA 1LPQA 1GNGA 3HOVJ 1URWA 3SAYA 1WSUA 4RGRA 3MZYA 4ZLYA 1B72A 4ESBA 1I09A 3PQKA 2YS9A 4EH9A 4BHBA 5K4JA 5H8EA 2YISA 3AGMA 4NIFB 3EPZA 3PJ2A 1GV5A 2PX9A 2XAQA 3OYCA 3ZXTA 2O63A 2CQKA 2R5ZB 4QPQA 1PDNC 2E35A 1P9QC 2BHYA 2E36A 4D9UA 3O8GA 2XF0A 4FV1A 4JG8A 2DOAA 3R7YA 4F0FA 4HGSA 4IFGA 4AP7A 3UP2A 2ZOQA 4JDJA 4Q9ZA 3JPVA 3L09A 5FBOA 3IDBA 3KP6A 1P14A 4DYMA 1IXRC 2LY9A 2AXTC 3F8BA 3LSIA 1J7UA 4C36A 4I4EA 5FP5A 4RIXB 3R8MA 4BVUA 2WTDA 3C1DA 3FWQA 3QHWA 2NOGA 4FEVA 2X0LA 2W00A 1S7EA 3OUKA 4PDSA 1ETYA 4XKVA 1K4SA 3GXLA 3ABLH 1BI2A 3VHEA 5FKOA 2KIMA 5IPAA 4BYYA 5HGIA 2O5KA 3ZFMA 4XQFA 2KMUA 4D5CA 5E18F 3ZMUA 4FTCA 3ZPLA 5C4XJ 4PSWA 1P2FA 3R8ZA 4I41A 4PFPA 4JJRA 1ZGJA 5HVKA 5FD2A 3ELKA 3R6XA 2C5NA 2OA4A 2KFDA 2YZLA 4DGOA 4FKTA 2LF7A 3PDTA 4M14A 3KEXA 4M74A 1LNWA 1L3RE 2W0JA 2F2UA 2UW9A 4FETA 3TMOA 3LIJA 4YJSA 4EKLA 3MBLA 3KKVA 3F6VA 3DK6A 4I23A 1IG7A 4IIRA 4XV9A 2LK2A 4Z3VA 5GTHC 2BZKB 3QPLA 3A8WA 4MXYA 5C03A 4BC6A 3OWTA 3QA0A 3KXNA 4X3FB 2XF5A 5BUJA 3RPSA 3LHJA 4IC7A 2JA2A 1X1BA 3I0TA 4AAYA 4YFXF 4X21A 5ILUA 2R5ZA 4IM3A 2KJBA 2WTWA 4ACGA 1YG2A 1Q41A 4B3AA 4RWKA 4D58A 2EA2A 1ON2A 2QG5A 3I53A 3VBWA 2W05A 4M7IA 2P4WA 1YLFA 3WG7H 5B7VA 3ZLSA 4ANQA 3BLQA 1WBVA 1ETOA 2MLKA 4G3DA 2I5UA 4B8LA 4KUJA 3W2VA 4F7LA 4ZY6A 4LUDA 3RWQA 4CMTA 2KRHA 4RIXA 4EGYA 1WJFA 1UHWA 2NS8A 5E8UA 2E1CA 3BTIA 4GYGA 3S2HJ 2FMYA 3U6JA 3F8MA 4CKIA 1KE7A 3G6GA 5J1WA 4FT7A 1ZYDA 1ZMWA 5HE0A 2P81A 4I98B 1ZRFA 5DR9A 3EQRA 4QMWA 3DLLF 3TUBA 5CVHA 2QKWB 4CCKA 1WBWA 1OYIA 2ACXA 4YJRA 4UVCA 5FBNC 3GFMA 2UZOA 2V9KA 2BGCA 5LXMA 3V8SA 3RNIA 3CKXA 3RPQA 3DF8A 4M3GA 4BCMA 3PO2J 1S9IA 5M4FA 3OR1C 2CH0A 1O7FA 3ISPA 1S9HA 5K3YA 5KCMA 3IH2A 4WRGA 5CAUA 2VL8A 3E6CC 1PMNA 2ZM4A 2OLCA 3R2YA 4I0AA 4GK3A 5J1RA 4ZS0A 5L3BA 4D9TA 5F0CA 3FMEA 1B59A 1UMQA 2BHHA 4A0YA 3ROUA 4LG4A 3E63A 3L9LA 5BPIA 5E7RA 2WIPA 1ZR4A 3H3CA 4ASZA 2QOFA 2QOOA 1MJBA 4KRDA 3RZOJ 2BZJA 4USFA 2QUFA 4LG0B 3W8LA 4X3FA 3QUPA 1QU3A 1DDNA 3DCVA 3NUNA 3PG3A 3CQZJ 4IOAF 2XBJA 3LOCA 3DCFA 1FZPB 3L8XA 5DD8A 4J53A 3HSEA 4WF2A 4X2GA 2VTMA 1U0JA 3AC3A 4LRKA 3NCGA 2DA3A 3UBDA 2LF8A 4Q5EA 1Z77A 4KMUX 4M13A 1IAHA 2C0TA 3RGFA 4KIBA 2HPIA 4F3QA 2ZV7A 3Q4ZA 3R30A 4S33A 2OU2A 2YDJA 3GC0A 4AW5A 1SM2A 1J91A 4DEDA 2ETRA 4IQJA 4AGCA 3ANQA 4R7HA 2XUUA 2K9LA 1ZLJA 3H5NA 2NVTJ 4U88A 2EU9A 4FVQA 2XKOA 3CP8A 4OTGA 5LARA 2MD0A 5HOOA 3OCSA 3UOLA 2CV1A 3PE1A 4Y85A 4JOAA 1HF0A 1CF7A 1R4MB 4BTKA 3H0GJ 2UZDA 2H09A 3J81K 1LFPA 2P3GX 1BMKA 1XBAA 2Z2SB 2VTLA 1PJRA 3F2RA 3QFVA 2VRXA 3P9CA 5DT0A 2KIQA 5CYVA 2ZMEA 2OFUA 4LDTA 4JQEA 3PXZA 3NWTA 4YJVA 4C59A 1HBXG 3EZVA 1YIOA 2GIZA 3T9IA 1WZ2A 3LQ8A 3WE3A 4XK4A 1Q8ZA 1JVPP 3GU6A 4O86A 4ESJA 4F7ZA 4I02A 4YIFA 1HCLA 2K3FA 3T8TA 3MFSA 3NUAA 1S72I 1DU0A 2PVFA 4YBKA 5HBJA 3HL7A 4LLGF 3TWJA 3GO5A 1YRNB 2C6YA 3ULQB 4FYOA 3AC4A 2B7EA 3OYGA 4TNDA 3LSGA 5L6WL 4BDJA 2CDZA 2V1XA 3ZMTA 4GJ2A 4KKEA 2YUSA 4D5HA 3WZKA 4BUPA 4ZSGA 1QL6A 4XR6A 5IP7J 1JWHA 2O6GE 4N0SA 4MKCA 1D3YA 3NNVA 4K18A 3FXQA 3K9TA 2JMWA 1J3HA 3A0BC 2WELA 5IA5A 5IQIA 1Y6IA 3CO7C 1UWHA 1SFXA 2HYGD 1X1CA 3D5SC 4HYSA 3EOCA 3VDXA 4B99A 5JH6A 1H1WA 3UTOA 4YEJA 3LVPA 1R22A 3V7RA 1I39A 4GDFA 1DS5A 2CCHA 1WRJA 4XRSG 1GXPA 3SV0A 2HW7A 2F4IA 3RKWA 4RVLA 1UJ8A 2JITA 1F5TA 5M07A 3RALA 5KHWA 4M3DA 4R7IA 5DE2A 3V8TA 2NNWB 3DS6A 1DPUA 3NW6A 2YDIA 5AP4A 4RIYB 9ANTA 2EV0A 4NBQA 1KU9A 4IEBA 3D9VA 4QTEA 3D2KA 4X0GA 2ZC2A 2ZJQF 3EJ1A 4C3IJ 5IOZA 1NG6A 3G9NA 4QTDA 5IEYA 1O6LA 1G3YA 3PA5A 2FSLX 5KZ0A 4RB2C 4XMOA 2HZ0A 2UW5A 4YO4A 1GT0C 2BXYA 2VWWA 2VASA 4MH7A 3C18A 4WXDA 2R7SA 3DFGA 1NH3A 2C5VA 4DFYA 3HM5A 4A9SA 1Q97A 5E8ZA 4CFMA 1Z21A 1H88C 4KT5C 2UV1A 3QKKA 4JIKA 4ZY4A 4FZ7A 3HV3A 5HU3A 2V7AA 3W0OA 1VQ7I 2O5RA 3JRHA 5C01A 2TDXA 1YRNA 1SVHA 4ACCA 4QTCA 4CUGA 5JFVA 2FA2A 1UCRA 4Y4RA 4NKSA 1SEUA 1ZMVA 5ETFA 2LSOA 1KZHA 3E88A 4DG3E 3VBQA 4C3RA 1LDJA 2VTAA 2TCTA 3BZ6A 1F43A 4YTFA 3OIPA 1WMKA 2HQ5A 4IVCA 4AXFA 5L2SA 4M12A 1BW6A 5E91A 3O96A 1QHHD 1FOTA 3N51A 4IHWA 3WTUC 2VOOA 3ALOA 4DGWB 2WV1A 5DIAA 4ZTMA 4IX7A 4JBPA 4KJZA 1LUFA 4RX5A 3JY9A 2REIA 5LFAA 1YHWA 1BL7A 3DKFA 4LUEA 2FE3A 2HY0A 2KT0A 4ZSLA 3MVMA 5C8MA 1R7JA 1IRKA 2IS2A 2WB8A 5FG8A 3TZ7A 3U9NA 3MV5A 4QTRA 3JXWA 2IPXA 2OW3A 3PUFC 4CZTA 3OHTA 1JI8A 1IN5A 3B8RA 3SZGA 3KFAA 5CALA 3I64A 3ZN1A 4FTAA 4AQKA 3QD2B 1UNLA 4M3QA 1ZOEA 4ZJIA 3BEAA 3FEGA 5LLQA 3VQHA 1NVSA 2BBYA 2VWVA 3R8LA 4DFXE 2C6EA 1XBBA 2ECBA 1BN5A 2HDWA 5IQGA 4DEHA 2R3FA 4HF0A 2CGPA 5IY5H 4GT5A 3DV8A 3O2PE 5HDGA 2ELHA 1PW2A 4ID7A 4XLCA 4XV1A 2FNPA 3GI3A 2W4SA 4XBUA 4ABZA 1OCPA 1PXJA 3ULIA 2ZFWA 1ERKA 2F48A 2M1BA 2XAJA 3KEOA 3VONA 2E9VA 3EUKL 4O81A 3U87A 2GFSA 1MH3A 4FGRA 1FGIA 2JA7J 3R02A 4NCTC 2ZMDA 3PY3A 2XIRA 3G90X 2OTLI 4CICA 3LL7A 4IHTA 4MEYF 2QQBA 3K0LA 5CQUA 5D4SA 3WU1B 5E8IA 1NK3P 1WH7A 1CDKA 3V7CA 4N57A 2XASA 5CEMA 3BP8A 3IPHA 2WQEA 1K6YA 2QKMB 1J7LA 3AD6A 4FSNA 2NRAC 4LM5A 3QQGA 5J8IA 3EL8A 3EN6A 5KKRC 3VC4A 5AP1A 1XJDA 1IV8A 4P7EA 2A3SA 4DDIA 5BMMA 1JUMA 3LAUA 3LZBA 3W2CA 2CQ7A 5J95A 3KCFA 3N4VA 3HAVA 1SFKA 4ENJA 4RB3C 5C8KA 2X1EA 3CD6I 1Y57A 3KCKA 2J9MA 1SVLA 4X6QC 4FTLA 3I60A 3UC3A 5ANOA 2P2HA 2EFQA 1OKRA 1XCBA 3A7HA 3WF7A 4FTKA 3BPVA 2XROA 3NNWA 5F0FA 4FG9A 1B8IB 2PE0A 2JVHA 5FFZA 4QQCA 4C4GA 3BG7A 4DTAA 3DU6A 4E7IA 2L02A 3GC7A 2ETHA 3TACA 5A4QA 3QTZA 3R7VA 5JR3A 4JQ7A 1MZBA 3QKLA 4A7CA 2LVSA 1JKLA 3ZUTA 2VO6A 4EOMA 1DU6A 3C13A 3H1CA 1ZKGA 3FI8A 2M5WA 2PMUA 3KK8A 4RWJA 4PNKA 3I4NJ 4RJ5A 3TOBA 2BROA 2Y48A 2R64A 2KZVA 3TNHA 4YZMA 1MNMC 4A2UA 4R5YA 3OS1A 3COHA 3HVCA 4BDHA 3VF8A 5JQ8A 1QPMA 4IB0A 3MA3A 3BZ3A 4UVBA 3ZC5A 4IAKA 3QA8A 4KD1A 4XG6A 4NKAA 4OTQA 1GUUA 4PUSA 1YI2I 3L9MA 2XF7A 4FKRA 5IEVA 4UB8C 3OF0A 4KN7X 3GCQA 1MJ9A 1FBUA 3L1PA 3UG1A 3A2CA 1EJ9A 3MVJA 1ZAOA 5FKKA 1YE9A 1LR4A 4W4YA 3RYPA 2PPQA 4PV0A 5JKGA 4F7NA 4UWBA 3ECOA 4O0SA 2G01A 3OW4A 4GU9A 4YLJA 4D1SA 3E5QA 5J3LA 4XLEA 2I7QA 4YUQA 4PSXA 5ANDA 4BRXA 4PP9A 5IT9K 4RGXA 2R0IA 3HNGA 1J59A 2IA2A 4FV8A 3CMYA 4A3EJ 4TV7A 4MTAA 4J8NA 4O82A 1E17A 4APPA 1XH9A 2V6CA 3DFCB 4AU8A 3UVQA 1AD5A 4J96A 3WE8A 2QBYB 3M42A 5EDRA 4EM0B 1R0PA 5GAHJ 3F22A 2YM3A 1HW5A 4ZZLA 3F3UA 3OP5A 4ZDPA 5GIPE 1TLHB 3FQSA 2G2HA 5DEQA 1UB9A 2GQGA 3ERMA 1B8IA 3HUCA 3EYHA 2HR3A 3HRSA 1STZA 1RIOH 2J51A 2EZLA 4BGGA 2A07F 1RPWA 4AYBA 5KNJA 2EIJH 4B09A 3S16J 4UYAA 4ZK5A 3AG1H 1IXCA 3LXNA 1BI0A 2I0YA 5HD4A 5ANEA 5LVNA 4FKUA 2QO9A 2M0MA 4CTBA 2J6MA 5FLMJ 1WGXA 2VTRA 3IAS2 4A12A 5LMBA 2L54A 2HEOA 4IM2A 5KMIA 1ZLKA 4RB0A 3OTUA 4ITHA 2EINH 4YHTA 2ZV8A 3FMDA 4CG8A 1RI7A 3Q0VA 2QZ8A 2WHBA 4YRVA 4FKWA 1VTNC 3FZPA 3QTIA 4FNXA 2CWEA 1W1WE 4ERKA 1UKIA 2CMPA 3K10A 3OYJA 3MY5A 2BR1A 2IW8A 3D1NI 2R4BA 4QMNA 4ETSA 3RAHA 1OQYA 1W7PB 3E62A 2KJCA 4CCOA 3A60A 5C4JJ 5BYLA 4Y73A 3PXFA 3WZJA 5AADA 3OT3A 3CMEI 4GJ3A 4K9YA 5HLTA 3KXXA 2B0QA 2DBBA 1EA3A 4L9VA 1IJWC 4HVDA 3ABUA 1ST0A 2VD5A 5IU2A 1LEWA 4PJJA 2MC4A 5E92A 2QOIA 3ZS5A 4TKSA 2LBFB 2L7KA 3WTXC 4H1MA 4I0RA 1HW2A 2GA2A 3O8PA 2QBYA 4BICA 4KISA 5TR6A 4H3PA 3FHIA 2VJIA 2FOWA 3W32A 3ABMH 5E1ZB 3RKYA 2QOLA 3TEIA 4B43A 2O9LA 1RQQA 3CESA 2BHEA 3S4QA 1VQNI 3FBIB 1IN6A 1S3JA 4Y33A 1YDSE 2RN7A 2L7FP 1JQHA 2WMXA 4DTBA 2PVLA 3VS3A 4NZWB 4FV2A 2QOQA 4DG0E 4D4YA 4E73A 4O7NA 2I0EA 3RDIA 3I56I 4GCJA 3E97A 4FG7A 3V42A 5D5VB 3M11A 5AM6A 4XEYA 2OI4X 3NWWA 4C61A 1ZRCA 1SAXA 1KA8A 1WVYA 1WBNA 1J0RA 3ZLYA 4BDBA 5CAQA 2X85A 3PVWA 4CXAA 4JR7A 4IHSA 3OMVA 5E9EA 1GZ8A 4EOJA 5IUIA 3IK3A 1P4WA 5BUIA 1BI1A 3K54A 4FNWA 3SOCA 1Z91A 5CASA 4TYHB 5G6VA 4QTBA 3BWJA 4HCTA 3QWLA 3NRMA 3F88A 2LP0A 1W7PA 3ZUUA 5K5QA 3GFJA 2LGCA 4QMQA 4D28A 1GIHA 5HLHA 3X2QH 2FX0A 2NRYA 2M30A 3QPTA 4GRBA 3SW7A 4FK3A 5HQ0A 3A7IA 3QL8A 2DK8A 4IHYA 2VBWA 2DOEA 2ZXIA 1I1GA 3MWUA 1V4RA 5LVOA 4FE4A 4OAZA 2P6TA 5LWMA 5E8SA 2R7UA 3LMGA 4FV5A 3PIPF 2GQRA 2LBFA 5CQWA 2UV2A 4AAAA 4EJ7A 4RA5A 3UNJA 3DLZA 3TNIA 3WARA 1T56A 4RGJA 2XHKA 3H30A 2J50A 3EUHA 2L9NA 4DCAA 3BKBA 5CPRB 4XG9A 3GU7A 5AAGA 1XDSA 3VS4A 2ITYA 4GT3A 1ACIA 4L46A 5EK7A 4G3CA 2W82A 4M8TA 2O64A 3IS5A 3Q04A 3R9DA 5FM2A 3RPRA 1HDPA 3S1RJ 3V5JA 1X1AA 1LVAA 1ZG3A 4U43A 5ACBC 2IA1A 3MYGA 4H1JA 1F9NA 2FBIA 5E8VA 3ACJA 4Q5HA 5BNJA 3RCOA 4I5HA 1S6LA 2XH5A 2X9EA 4ZMFA 4AVZA 1LE8B 4WG5A 1Y0UA 2VB6A 1WI3A 1UFMA 3C4ZA 1ZHFA 4Y83A 4BS9A 1CGPA 2P55A 1AGWA 5FXRA 5IH5A 4MF1A 4XN3A 4F4PA 2ITTA 2ZSHB 4IO9F 3TDUC 5HHWA 3LMMA 4XLVA 4FEWA 3FZVA 2BHZA 1WJAA 5GPAA 2YR2A 2ITVA 2M2EA 4I3ZA 3J7ZI 3CC6A 2LKXA 4TYHA 4GSBA 5LRRA 2ETMA 3OCTA 1FOWA 4JP0A 1U59A 4AS0A 2NOJB 2CG4A 4CSWA 2R7OA 3IWFA 1GHCA 3RCJA 2XPUA 4MUQA 2J5PA 4CCUA 4XYFA 3FHRA 2ZM3A 1FYMA 3VS5A 3K1NA 5DUIA 4IRGA 4RC3A 3DZOA 2EV6A 5BNGA 4WUNA 5IF1A 4RIWA 2JKOA 2KPMA 2K4JA 4HCVA 3BYMA 3SZTA 4PX6A 3QC9A 3C7QA 4Q9SA 4CNHA 3MJ2A 3HP5A 3RNYA 4PGHA 1H0WA 2JDRA 1JNKA 4X3FC 2V62A 2AQEA 2XGDA 2ID6A 2ZBKA 1RRJA 5EW8A 1YYVA 2J5OA 3CLQA 3C7JA 2BUJA 3P23A 2N8GA 2A5YB 4UUSB 4G2FA 4Y52J 4QT1A 4RVMA 4PL5A 2OJGA 3R7EA 3TOAA 5H2FC 2FQ4A 2HKXA 1JKQC 4LMNA 4CVAA 4PTEA 3ORPA 4JYKA 2R2PA 3DU8A 1QMZA 4FKOA 1OBDA 2IZRA 3PL8A 5DCMB 5E3MA 3LFQA 3ID6C 3W2OA 2X9FA 3QQAA 3R63A 3QUDA 3MA6A 2KRCA 3PXRA 1Q4LA 3AAFA 1PMEA 4EZ5A 1ZR2A 5LQFA 5AP0A 3UNZA 1LE8A 3U21A 2WGJA 3BYVA 4U7DA 4QP6A 5H2UA 2YM8A 4U79A 3ZGKA 4C4HA 4IH8A 4ENNA 1OPJA 3DP7A 3MFUA 3VYRB 3OS3A 3A7FA 3NAYA 3SVVA 3CC7I 5I9VA 3BRBA 4EEVA 3BJAA 3BHYA 3W2PA 2DTZA 1H0MA 3OUNB 1YW9A 3C1XA 3IW4A 3GTGJ 4L8MA 4XSXF 1IRGA 1SYKA 5CSHA 5TKDA 4M68A 2VN9A 4QSHA 2PLYA 4LFUA 4HLYA 1DGWY 3LJ1A 4EQCA 2PMHA 3O3KA 3Q4UA 3TT0A 5K9IA 2J7TA 4G34A 4FQGA 3QTXA 4R1HA 2CGVA 2DMQA 3QGWA 1A35A 3PM1A 3V8KA 4Y13A 1BUHA 2XCKA 5FEEA 4FC0A 3A7JA 4AXAA 5J1YA 3DKCA 2DLLA 4O0RA 3CXWA 2G7HA 3TKIA 1VQMI 5KBQA 4FGBA 4O6JA 1MUOA 2XAFA 1U54B 3F3TA 1G8AA 4G12A 4DG2E 3BQZA 3P7AA 3PIZA 2W5AA 3BR1A 4ALVA 1GVDA 1UA2A 2YJRA 4CCJA 1VLRA 3DJ5A 5H3QA 3WTTC 3H9FA 5DYJA 4HBLA 3H10A 5HIEA 1HXDA 3ULZA 4WOVA 3U4WA 4F0IA 2XP2A 5T3QA 1R6RA 4S34A 5DFPA 4R77A 3PWDA 1XBCA 4UUSA 5EYMA 4R8HA 5CF4A 1OISA 3EIDA 4J1RA 1WBSA 5A2QK 4L9IA 4UZDA 1VYWA 2D2WA 4RWLA 1X3UA 2XM8A 5F9EA 1IXSB 5K7HA 1R58A 4JX3A 5DCMA 3F7WA 5AONA 4FG8A 3R9NA 4UY8I 3DJ6A 1SVGA 2W1FA 2DA7A 4BI2A 2GCDA 4EK3A 2NVYJ 3BG9A 3BYUA 3JS2A 1HKQA 4IB3A 4E7KA 1VQ9I 4NU1A 5E1EA 4OTRA 4EJUA 4PMSA 3FY2A 3KN5A 3TZMA 3L2RA 5FD5A 4IQ6A 2K85A 1MSFC 2F7EE 4D2SA 4GFMA 3LSPA 1HDDC 3MMYB 4FSTA 5JT2A 2CV0A 2EB7A 1YWRA 4IWPA 4AN9A 4C2WA 1EKEA 4DN5A 3GYHX 3CCSI 3H0DA 3J7YJ 4QNAA 1VQ4I 3O2MA 4YBJA 4IADA 2VT2A 1NTCA 2EZHA 3EQPA 4RJ8A 1HA8A 4K6ZA 1XQZA 2R3OA 1JT6A 1IGNA 4WT6A 1ZXEA 3VS1A 4BCIA 3V8WA 2VODA 4Z2YA 2IG7A 5FKNA 3IONA 3CGOA 4D5KA 3R0TA 4APCA 3GZ5A 4OTIA 3ZRKA 4MGRA 2R93J 2GTNA 2X6OA 3Q3SA 4D4SA 2FUG2 4OW8A 1OCCH 2JUGA 3DKWA 3KX2A 4BU2A 3IKTA 2WU6A 3DB8A 3DBQA 2RNJA 4PMPA 4F09A 3BLRA 3LCTA 1UHSA 3HJEA 4PDOA 3MS9A 1T2KA 3OV8A 4FT5A 2AHQA 1TFFA 3AL0B 4MK0A 3SDJA 2K9SA 4YTHA 3HOSA 4Z7HA 1KE9A 3E3PA 4QLCU 5FLXK 4KSQA 1MGTA 5AIRA 2XS0A 3ACKA 2QQ8A 3LCSA 3F2AA 2OF4A 5AUTA 2JRTA 2OAZA 2W24A 2QOKA 3PG1A 1LFBA 4XRMA 3P9IA 4WNKA 3E8DA 2WEVA 3BBWA 1R5HA 1GIIA 4IRHA 2WMWA 3CLOA 2YPRA 3N4UA 2UVXA 2C1BA 3MIYA 2NVXJ 2CKQA 3T0YA 3HV6A 2LAVA 3H4JA 4RMZA 4V0GB 4AOIA 1L3LA 3IOKA 5EHYA 4HVSA 2IVSA 2PZRA 4HAMA 3OYLA 5F94A 1UVRA 3TCPA 2X8IA 4CDGA 3SOAA 1N25A 2VNWA 3P1AA 3O23A 1M2QA 5E1WA 4O7RA 2FRHA 4AZEA 4I5MA 5CANA 3R61A 3ENHA 4NQWB 2HELA 5LMKA 4XG4A 5J1UA 4WSYA 5FJ8J 3PIOF 2DPDA 5GAEJ 2WQOA 4AOTA 4FTQA 3C3WA 3OWKA 2UZVA 4Z7GA 2ID3A 4BE0A 2OFVA 3A01A 4KIQA 2VAGA 3KA0A 3TO6A 3WTWC 2ERZE 2Z33A 1K9AA 2P8TA 3VB2A 4QP3A 4J19A 5AEPA 4RLQA 3PA3A 2Y0AA 3N4TA 1XN7A 3VUIA 3AC2A 3RI1A 4RLKA 4FT0A 3OL4A 3VYSB 3HMOA 4BIDA 4FTRA 4RA2A 1LJ9A 1BLXA 1K6OA 1TQIA 1YITI 5HO8A 3NR9A 5BQTA 3B8QA 2V1DA 4NNJA 5J9YA 2OQGA 3DU5A 4C3HJ 1F0QA 3VW6A 2QVOA 3S32A 3QRUA 2YJSA 3Q9VA 2IPQX 3LFBA 3LFFA 2LY1A 5HBEA 1H01A 2JC6A 4ASEA 1LDDA 4EJWA 3OYKA 2UW3A 1P4AA 4U80A 4RRVA 2VTTA 3FMQA 4LOCA 2E34A 5E8GA 3H92A 4L0YB 1VFCA 2WFYA 4DLIA 2R7ZJ 4Z9LA 3KRLA 4BCJA 1JBPE 3FX3A 4O27B 2E2JJ 4W8EA 3M8EA 3BELA 1NG7A 3IRQA 3D83A 4DINA 3KQ7A 1S7AA 3W6KB 2F5FA 3K4LA 4RJ3A 3AG9A 5KVRA 4BYJA 5AJQA 4V0GA 3BL9A 5CI7A 3NUXA 4NFMA 3O5AA 3KEYA 4A5NA 3ASNH 4WUAA 3VBTA 1MBKA 5DT4A 3JR1A 2F9GA 4DA5A 1R3CA 3BG5A 4OIRF 3JW4A 4CQEA 5HODA 5EH0A 4EHGA 4NQWA 3HSFA 4GFOA 1YXUA 1FMWA 1IDYA 2YU3A 4FEQA 3L2CA 4XG3A 5LHIA 3I0OA 3HGKA 4I76A 2R7IA 2XAGA 1WJDA 4AXEA 3TW7A 3FZRA 1ZN2A 3FMSA 4W1UA 1Q8YA 3NSZA 2K5CA 4AZSA 5GHVA 5EEGA 5FRNA 5TF9A 4RZWA 3FK6A 4LLLA 1FMOE 1TC3C 4MXAA 1PF8A 2GXGA 2PI0A 1D5VA 3V3VA 3VRYA 4X3JA 3GW2A 2HYFA 5DPVA 3DBEA 4LMUA 3FK7A 4XBRA 3V7SA 3QQJA 2BEOA 4BI1A 2NS0A 3ZSIA 3COMA 4U0IA 4P1WA 2COMA 4B4LA 3HGGA 4XV2A 2LC2A 2P2IA 2OUMA 3FIWA 3NQOA 3CCMI 2C68A 3KYLA 3CF5F 1VQ6I 4UUVA 4RQKA 3ZQFA 2EB2A 2R7RA 2QC6A 2X39A 3UG2A 4C4EA 4DQ2A 1WZYA 5TT7A 2L3DA 3CJTB 5K7ZA 2F49A 2Z9OA 2BILB 5HG5A 3D7ZA 3RKQA 1V0PA 1WJBA 1QPDA 1GVJA 5AP2A 2ESNA 3OEFX 3FI3A 2A05A 2XAUA 4UB6C 3KMMA 2XC7A 1JSVA 1G8KA 1FP2A 3G33A 4FV6A 4MNEB 2QHMA 4M3EA 3M9AA 3HV5A 2OZUA 3S17J 5KO1A 5IQAA 3LCOA 3UE4A 2BFYA 3POOA 1JJ6C 2MGQA 4KABA 4LL0A 3UR3C 4IAZA 4MXXA 3P7CA 4D2RA 3FLWA 1HKSA 5JGBA 4RLLA 4HSRA 3PFYA 2EJRA 2NYAA 4CD0A 4BY7J 2OGVA 2VTPA 5TO8A 1RR8C 3S14J 3HECA 4HQMA 1JTXA 2IW6A 4FV4A 2ITWA 4ASXA 1Y56A 2ZB0A 3SX9A 3PSBA 3PXKA 2MW8A 2BY0A 2EQRA 3CCYA 2GHLA 3ZDUA 2YCQA 1D5YA 1PXNA 1E1VA 1XWSA 5EQYA 4ASNA 3DNEA 4BGHA 1WQ2A 4AGUA 2JIVA 2V0DA 5IP9J 3CQEA 2YZAA 4KN4X 2J2IB 3UOKA 1UV5A 3TGNA 3U2RA 3E1SA 2BAQA 4M9SA 3AG4H 3TL8A 4WG4A 1TP4A 3S93A 5AX3A 2ZFYA 1W98A 4FE7A 3FMMA 4HPQA 3JTHA 3IP4B 5LMAA 3G4SI 4QMVA 5CSXA 3NW7A 4IEJA 3QD4A 2H8HA 3UNKA 3P4KA 5FTQA 3GTOJ 3GT8A 2HIWA 4XH6A 1ETQA 4ONAA 3ENMA 4EK4A 3H9JA 4YSMA 3K4JA 2XKFA 4MWIA 4FOBA 5LGNA 5D10A 3POZA 4B0GA 3NWSA 1Z7UA 4XUFA 4BDCA 2Y69H 1P7IA 3BR2A 3IDCA 2QLZA 3MKWB 2BTSA 2WV0A 3PSDA 3OS2A 1OL7A 5KBRA 2J5FA 3Q0UA 1JKKA 1KV1A 3BV2A 4ZJVA 4RQVA 1Q8WA 1I1SA 4CKRA 2LOOA 3DBCA 4BDIA 2DA2A 3DEUA 4M97A 5IISA 5DNRA 3TV4A 1GOLA 3RCDA 4ARKA 1YOMA 2PK9A 1BR2A 2FOKA 3TNPC 2HK5A 2YIWA 4XBFA 3VSKA 3CJFA 2RVCA 4H36A 2E2HJ 1H07A 3ML6A 2UZLA 4BH9A 5KMOA 3DKGA 2BCJA 3DAEA 5F20A 4G6DA 5KMJA 2GNLA 3E93A 2WOUA 4L3LA 3TKYA 2JVGA 4HW0A 5HG9A 2V7OA 3II5A 4TTHB 3PP0A 5J47A 3ANRA 1ONVA 3VQUA 3DGKA 5HDKA 5HIBA 3Q96A 2K4BA 4DBXA 2Y7JA 3LA3A 4ON0A 2IBDA 4EYMA 2Y9YA 5HS7A 1V5FA 1PXPA 5DI1A 5M08A 2IN6A 5CVJA 2VNYA 2DA5A 4ZIMA 3WZEA 3JAMK 2HXIA 3G5DA 4KB8A 1YW8A 3NEUA 3COIA 5CT7A 2W1HA 4BZOA 3SC1A 1RR7A 3EUHC 4KBKA 5BVDA 4GFBA 2C3JA 3FXWA 1FMKA 3UGCA 3EFWA 1XMKA 2O8YA 4ENKA 4KITB 3QAME 5BS6A 3ZCLA 3EWHA 4IX6A 1BR1A 4OMYA 4F9YA 4N6YA 3KEQA 1IN8A 2VPRA 2Q8KA 3BQCA 1PHKA 3UZPA 4XG7A 5F1RA 2E1NA 2C3LA 5HCYA 1SMHA 3NGAA 2ESHA 4IAAA 5C1QB 2BRMA 1Q62A 1TW3A 3CQWA 2DYRH 3ORXA 2MH2A 4DT9A 2IXSA 5J87A 3W2WA 3MCZA 3HUBA 3ZCOA 2HU9A 2KQRA 4DW6A 5JHUA 4XRSA 1NA7A 4FJVA 5BUEA 2PVKA 2G9XA 5CU6A 3CUQB 1REKA 4A9TA 3ET7A 5KCVA 4K77A 4ZYAA 2VQGA 2UZTA 3ELJA 2ZDUA 4KWPA 5IPJA 4G94A 4FODA 1G59A 2J0MB 4I01A 3E7VA 4CSVA 4BBEA 4C3PA 2LKPA 4XP3A 3P5JA 2HZTA 5AFVA 1CTPE 2B9JA 3FM5A 5H6RA 4QQTA 2CJMA 4KIGA 3L00A 3KCCA 2VONA 3VYTB 3C50A 2AQFA 3V5WA 2XANA 1ZK8A 3S3IA 4IX4A 1T95A 3KLNA 2MH9A 3LFEA 4V05A 3DEWA 5ANKA 4BQQA 4JX7A 4RX9A 4UYNA 3PNVA 3MVHA 3DPKA 2KULA 3IGOA 1LDKB 4B47A 3C4CA 3S95A 1UELB 3K6GA 2BW3B 4P4CA 3GFLA 3ZFYA 5TRDA 2WADA 5EEAA 3EUAA 4MXCA 5JQ5A 4FSUA 3E64A 4RDUA 1QBJA 3KL8A 5CF5A 1SMYF 4RBOA 2QO2A 1ORKA 4ZTNA 5G1XA 2W7XA 1XTAA 3ZO3A 5FO5A 4ANMA 3FBVA 4P9FA 5F04A 2VOPA 4FT8A 1U4DA 3NARA 2WQBA 5ITAA 3ZC6A 4FEUA 4U7BA 4Y3OA 1KQ0A 1CM8A 1D1CA 2CNVA 1YHQI 4J52A 4F6UA 3PY1A 4E5AX 3B2WA 2PVNA 2CW8A 1N75A 2HOGA 2COBA 3OCGA 3M1EA 4EH6A 3F69A 2AEGA 2KLOA 3U9CA 1JGSA 2NNYA 4QQJA 3E7LA 5E4HA 5LCKA 3BG3A 2I8DA 1AQ1A 5FXSA 3UO6A 5IOYA 2Z7LA 3G1MA 3EDPA 4M15A 3TKUA 1O6YA 3R28A 2W1IA 3WZUA 2FU4A 1VQ5I 1DAYA 1MP8A 4EH3A 3R9OA 1QZYA 2OH0E 3SFZA 2RFDA 3KLOA 4JNWA 5HBHA 4MQ2A 3CUQA 4RSSA 2ISYA 2QCOA 2PZ5A 3WILA 5D9HA 4Y46A 3VJNA 1O3SA 1V55H 3ZUVA 1MBGA 4QPAA 1PUEE 3CCNA 1W7PD 5IMXA 1YDRE 2UW8A 4UY9A 4EOLA 4YU2A 1TWFJ 2Z16A 4KICA 4TNBA 1XB4A 3FLZA 4U41A 3ALNA 3F9NA 5JLXA 4XX9A 3ZO1A 3CKWA 4RGSA 1GJOA 2GNGA 3FUPA 2QI8A 2GNJA 4QYYA 4R3RA 4KSPA 2NYXA 4GK4A 2P5LC 3BTLA 3ZU7A 5JMSA 5CSWA 1HOMA 4KMFA 4G3GA 5CLPA 2DA4A 4G3FA 1BOBA 4OT6A 2BW3A 4HV6A 2X7OA 3LKMA 2RG6A 3PZHA 4FIGA 5EYDA 1TW2A 3NRVA 1SNUA 4RX7A 2F57A 3HTUA 3WE4A 2ZXHA 1JE8A 3O8TA 5DH3A 4EK8A 5I9ZA 4MO7A 4B8MA 1STCE 4E4XA 2BKZA 3M8FA 4EH8A 5DHJA 1BJAA 1PUFB 5LEJA 4QP9A 3HMMA 2FVDA 4XP0A 4NT4A 2JBOA 3FMRA 2QLUA 3OOMA 1R5GA 1WBPA 4IANA 3BU5A 3QOPA 4A9YA 3EQDA 2WBMA 1ND4A 4O0TA 3D5UA 4X2FA 2EXCX 2DA1A 1OGUA 3GVUA 1OPKA 3OBJA 4YC3A 5BVFA 4E5WA 4FISA 2WB1N 3FYKX 4NHJA 4LFIA 1I3QJ 4I5CA 3D0SA 2DFHA 3E0JB 2MFZA 4I6QA 2EBIA 4C30A 4FZ6A 1AOYA 2VTIA 3HRUA 2GS6A 2OTJI 4M69B 4B9DA 3GCUA 3HMIA 3U54A 1W4MA 1FT9A 2GNHA 5B1BH 2DYLA 1KE5A 2WNTA 5IYCJ 5EEHA 4YMJA 3QRFF 4WXHA 1XR1A 3KRWA 3LQRA 2CUJA 5IA2A 3NYXA 6PAXA 4BBFA 4CHUA 1X4PA 4CMOA 2R3HA 4F55A 3FISA 4U0WA 2HENA 5L8LA 3UPXA 2IA0A 5EJCA 2BV6A 2O0UA 2YIQA 2OJJA 2W4KA 2YFXA 5C4LA 4PL4A 3CR0A 1BIBA 4I1ZA 3GEZA 4FV9A 4KIOA 2V1UA 4P5ZA 4NUBA 5GTIC 2PJPA 4L9JA 3S0OA 3Q5IA 2HZ4A 4DH1A 4QP8A 4XOYA 4E7HA 4O7TA 3F6OA 2VGOA 4MQVA 1F4KA 3SEQA 3BLHA 3I5UA 2W9ZB 1TL8A 5DBXA 2PUNA 1V0BA 3GX4X 4JRNA 4J98A 1OUKA 5I9WA 3L8VA 3N97A 1CMKE 1P6RA 4KINA 2X8EA 3O8HA 4CFWA 3GQLA 1YJWI 2YITA 4U42A 5CS6A 3R7UA 3ZOBA 4E7ZA 4L5IA 1XS9A 3UP7A 2DUVA 2M7BA 5K5RA 2I10A 3SZPA 3F0CA 4P9UA 4P2KA 1HSTA 1A04A 4CEGA 4EONA 4XRLA 4AVPA 4V04A 3V51A 5JZNA 4NM7A 3WYYA 3GBZA 4AM3A 1MJAA 3PVUA 5EM7A 4DH8A 4I2OA 3UDSA 5L6OA 2WIHA 5J1VA 1I6HJ 1GY3A 2EFPA 4G6QA 3CJNA 3VO3A 4PJMA 3DTEA 3GU8A 5J8FA 3RHXA 2QENA 5F27A 2IRFG 2XK8A 3Q53A 3B02A 3RTRA 3FPQA 3UYTA 1OR7A 4II3A 2DN0A 4AWIA 2BXZA 4FTHA 5M5XJ 1X8BA 4BE2A 3V5QA 2GMXA 4CO8A 2CW0F 3QYWA 3Q3BA 5HORA 5EW3A 2FEZA 1S5LC 3HPHA 4F1OA 3ZLWA 1J5YA 1OCZH 2DJIA 2Z2WA 2UXXA 3VFZA 3AXWA 1MBHA 5F6FA 5A4CA 4ASDA 1X58A 4MHGA 4CT2A 3UMXA 2K40A 4BR3A 3MH3A 5LMKC 4PMMA 4HRIA 4AC0A 3QTQA 5HE1A 2PBIA 4YPDA 4O7YA 1FTZA 5EQEA 3GENA 3IG7A 3ML1A 3BZCA 4ZC3A 2XPWA 4IAFA 3BJ6A 3VVHA 5JGDA 3AFHA 2ECCA 1KWPA 3W55A 2O8KA 3FHZA 4IHPA 3VUKA 2JSPA 1ZGWA 2FH9A 4BGQA 1J2XA 3VULA 3W0QA 4JOMA 4JG7A 2PVHA 2DCEA 2K7LA 3FDYA 2P0CA 2X4FA 4MFDA 4FICA 4PUZA 3EN5A 2ELJA 5M5YJ 1WI9A 5IQCA 5HEZA 3D5XA 2CQNA 4RM3A 4Q2AA 4TL0A 4HX8A 1G3TA 2ZFUA 2YERA 3QX4A 2C5YA 2KL4A 4LQMA 2JQ7A 3E6BA 2R5YB 3AL0C 3RP9A 3BLAA 1OKVA 2C30A 2ZKZA 2XCHA 4UALA 4YPSA 4W4XA 5B1AH 3NVMB 3ATSA 5GIOE 1SC7A 1D8KA 2WAFA 1H8AC 2BY2A 3HMPA 3KGAA 3SXYA 4I6ZA 2HYJA 3Q9ZA 1OL5A 2C6OA 1TBXA 1BJZA 4ACDA 5K5NA 1MIJA 3VS6A 3QQFA 4BACA 3NLBA 2R7VA 2ITZA 1BYGA 1XH8A 3VWBA 3QCYA 2CGWA 2A6HF 5IQBA 4IZAA 1DI9A 1G3SA 3TIZA 2W5HA 5LJJA 2I40A 4C4IA 2Q0BA 1E3OC 2UXNA 5CSVA 2E9NA 3GMEA 4UBAA 3VS7A 5FLFA 4HOBA 5M44A 1Y39A 2JGZA 1J9IA 3ZQQA 2RF9A 1N77A 2UWMA 3KP5A 1OL6A 4QYGA 1MW7A 4DHFA 1X2MA 4AU7A 4L18B 4EHVA 4I22A 2X4ZA 3E5XA 1DUXC 4C33A 4EOIA 3W0NA 4BN1A 3LQ5A 3FXRA 3VS2A 4AW0A 1U46A 2DODA 3HRMA 4DFLA 4LI5A 2W1OA 2J0KA 3EYYA 1JUPA 3TXOA 3G2FA 3FXKA 4YJOA 5FTGA 3PWYA 4OBQA 4A6DA 4QWQA 2PULA 4QDEA 1SVEA 4L45A 1POGA 3CJGA 1PKGA 5D8LB 2EH3A 4XLAA 2IW9A 4E93A 2RFEA 4EKKA 4C0TA 2L9RA 4YTIA 4UV0A 5ETIA 4E7SA 3WE2A 3TO7A 5FKLA 4YZDA 4G6LA 4BHPA 2TRTA 3SXSA 4FK6A 3HV4A 3MH1A 1RKTA 3H9RA 2XGCA 5DOSA 3SEZA 4EZ7A 2YM7A 4XCUA 2VE9A 2LRDA 4Z16A 2YACA 4U81A 2WKMA 3TG1A 3Q4CA 2R5YA 4N9HA 1VQKI 2GDOA 4O38A 4EJNA 2HQNA 4DDGA 3G3ZA 3PE2A 4MD7E 1OBGA 3OL3A 4GXOA 3Q52A 4KIPA 2I1MA 1JAMA 2WMAA 4M0YA 3HEFA 2BDWA 1IN7A 3G51A 4TWOA 5HCZA 4E7JA 2VBXA 3GFWA 3Q9XA 3F21A 4V2GA 3OYEA 5L2TA 2XKDA 5BVKA 1OMIA 2XIXA 5CF8A 5IQFA 4LYNA 4FX4A 2B52A 4GG7A 3FKOA 1YVJA 3KETA 3TUDA 1MRVA 4O96A 3NAUA 3U55A 3P86A 1OUYA 5C3EJ 4HVHA 2GIVA 4RJ6A 2X6XA 4C9YA 4A5MA 3D7TB 2Z1DA 3DJ7A 4I0SA 5E3OA 3ERED 5I9YA 2HZIA 3BV3A 1CSNA 3MWMA 2PMIA 4YFNF 1IA8A 3ZH8A 2JZYA 3MVLA 2CYYA 1ZYSA 4NUSA 1FYKA 2AC3A 4HYEA 4IMYA 3FXLA 4FV7A 4IRIA 4QTAA 3GGFA 1ETVA 1K4TA 4AZVA 4TZRA 3KVWA 5LGUA 1T08B 2JIIA 1UAAA 1IF1A 2IO6A 4YFKF 3CP2A 2B9FA 2ZJWA 3OYHA 1ZY5A 4XOPA 1YX5A 2WA0A 3R7IA 4IXAA 3MIAA 4ANSA 2PY3A 1TTYA 1K3AA 4W8DA 2ZM1A 2L4AA 1Z05A 1VR2A 3BU3A 3S1HA 2NXNB 5K1YA 4OGRA 3K4NA 3TYKA 4DYQA 3HRBA 5F64A 4BTMA 2C3KA 2W06A 2JDSA 5IUHA 4EH7A 3JRAA 4M9ZA 3H9GA 2V1NA 4F6SA 3OTVA 5GPCA 5AUVA 4EK6A 2ICWG 2W25A 2YSRA 3NS9A 4IPAA 2KRFA 5E8WA 4AT3A 5EM6A 1LB2A 4EEFG 3PA4A 1WPKA 2PJRB 3O0GA 2FJ1A 2Z99A 2ZDTA 3OY9A 1Q99A 2R7FA 2AO9A 2X2MA 5CZIA 4N4NB 2AYPA 3PY0A 3R4KA 4M3BA 4D7NA 2WO6A 2W17A 1CF7B 4UV9A 2A4LA 3R01A 1QZZA 1JTYA 2W99B 4BNCA 2QLQA 4GV1A 4TYGA 1G4DA 3R1QA 2F5CA 5AUZA 4EOQA 2ZMEB 2C6IA 4CRLA 4DEAA 2XIYA 2VJJA 2CUZA 4BXFA 3D7TA 2OF7A 1USTA 4B48A 4ZZNA 3CDHA 3H9OA 1JOWB 2QCSA 2RGVA 1MMDA 1CKPA 3E7OA 4O0XA 4HZRA 4FKLA 1Z67A 3SXFA 2Y31A 1K2PA 2R3RA 2HQRA 1OIYA 3DBHB 2Q0OA 1WVRA 2VWXA 3JSOA 3S1NJ 4HCUA 2EFNA 4O91A 3QODA 4M73A 2QSHX 3C51A 4FIEA 1ZTRA 3OFMA 3BX5A 4YJPA 4CLIA 3PSFA 4NC7A 4QMUA 1WVWA 1QZEA 4J7BA 2JK3A 3VJOA 3QF9A 3LQQA 2KIUA 3BGQA 1VYZA 4IZ5A 4LGHA 5LVPA 3NX8A 1UHMA 3RAWA 2PMZN 5FROA 3RYRA 2QA4I 4DEEA 2OBPA 5DEYA 1BC8C 1XHAA 2XK9A 4HZSA 5LVLA 2VO3A 2KTYA 4FL2A 3RPOA 1E9HA 4DC2A 2XUBA 1IC8A 4TYJA 4XP2A 1ZY4A 4F9WA 2IP2A 4E4NA 1EH6A 5A9UA 5IYBJ 3CDLA 3I4MJ 3L1SA 4FV3A 1OKZA 1D1BA 4FSRA 2BDJA 3OIQA 2JA8J 3AKJA 4S0HB 5KAFC 3CBLA 2RAEA 3BY6A 3NYOA 4QYFA 5JN2A 2PJRA 3EKNA 4MTDA 4G9RA 2WAJA 3GCSA 4BB4A 2RV8A 4ZH4F 4ENMA 5C27A 2Y75A 1TWGJ 5J9ZA 2WY8Q 2E1OA 3F6XA 2JAMA 3HOXJ 3IGGA 2JKKA 3VYUB 1JT0A 3LJ2A 1VZ0A 2YAKA 3TDWA 2JTVA 1ZG1A 3NUYA 3F3XA 4XLPF 2JUCA 3SHEA 3KP2A 2VWUA 1LUJB 3LA7A 4WNPA 4IHXA 3ZMZA 3HZTA 3R8VA 2VI6A 1FTTA 2ZJRF 3JRDA 2GOXB 1XH4A 2XEZA 3PJRA 2W84A 2HXQA 1O6KA 3MEXA 4EJVA 3QCQA 2OJFE 3B6CA 2HVRA 5ILVA 3G73A 2VUMJ 4BDKA 2F4OB 1J09A 3P5JC 3BG6A 4X2NA 2VJ5A 5I5ZA 4FUXA 2DQ7X 3A4CA 3NUPA 4ZZMA 3DKYA 3FL4A 2DQRA 1MMGA 2QVSE 1KYWA 3GWZA 3MQ0A 1UU7A 3I0QA 4QRCA 1T8IA 2XB7A 2OICA 4OT5A 5C44J 3TO9A 1X2NA 1K78B 3MESA 1V3FA 2XK7A 3QCXA 4DLJA 3NYNA 3RPYA 4JBOA 3RQ4A 4D0XA 3C9WA 3O8UA 3ORLA 5DRDA 3NW5A 3UC4A 2CKPA 3OYIA 1B6CB 1VQPI 3UIXA 3S15J 2ESMA 1JLUE 2QG7A 2B63J 1ZMUA 1Z3XA 3TZ9A 3OWJA 4ZTLA 3K5VA 5CVFA 4ZY5A 1T0FC 3M4OJ 3P7BA 2LY2A 4O84A 2WXVA 2P7VB 4I6FA 1QPIA 4BXXJ 5IEXA 4HX4A 4QMSA 3D5WA 3TV6A 3S2DJ 4ZEGA 2PUUA 2B9IA 3MN3A 3R1SA 3IHUA 3PVGA 3HA8A 4FZAB 5FDPA 2E9OA 4ZYGA 4XMYA 2CCIA 3IV5A 4OIOF 1ZOHA 3OG7A 3HOWJ 3S3MA 4A3LJ 3HRCA 1O3TA 3LQ3A 2YA9A 3H0YA 3P9KA 2PMOX 1M2RA 4M3FA 1XH7A 3QZFA 2L7MP 4LK1F 3OXZA 2YIYA 1TKIA 3OROA 5HKMA 4A9UA 2KDOA 4QP7A 2HDCA 3CUQC 4O22A 4YIRX 4DGNA 4MD8E 4EM2A 2FD5A 4TWCA 2YABA 1M17A 5D12A 5AV1A 1FP1D 2GHGA 2WD1A 4JDKA 2VWZA 3UNGC 5AP6A 3Q9WA 5HG7A 2F5VA 5HTCA 3LE6A 5JGAA 5ICGA 1NVRA 2DT6A 4DH3A 3HDNA 4FZFB 3VIDA 5FB2A 3C4EA 4PL3A 1RESA 4CRSA 4FVRA 4M6YA 3R0AA 2P33A 3DXPA 3JVRA 2E9UA 3DXNA 1W0XC 5DWRA 5CYIA 3BHTA 2X7FA 2CLQA 4AGDA 3ZQCA 5J6XA 1L0OC 1TVOA 1K78A 2IVVA 4IE9A 1ODDA 3I58A 3ORMA 2O61A 3K4BA 3BHUA 4FNZA 3GCVA 3C2GA 2EA4A 2PU8A 4HYHA 4QQ5A 2ZV2A 3CEKA 2STTA 3LW0A 4YJUA 4E7WA 1YW7A 2Z8CA 2DDBA 2IZSA 3RPUA 3C2BA 4JAJA 4AXDA 5H20A 1HCKA 1IV6A 4L42A 2P5VA 1FGKA 1LQ1A 1J1BA 2HOSA 3EN7A 1IW7F 3HX4A 4BDEA 1XMXA 3AC8A 3DBLB 4CFFA 1H1QA 2RFNA 2KDZA 4H3BA 3BR0A 2W4OA 4YO6A 5BOXA 4QMMA 5CAOA 2C5XA 5CVVA 4BJ5C 4RJ4A 2WB1A 3H5RA 4OTWA 4XM3A 5M06A 2VU3A 4HV5A 3UDBA 1DM2A 2YU9J 2X48A 4L3JA 2IZTA 2CN8A 3IQ7A 5D7AA 2XKEA 2IGOA 2OU7A 3QZHA 3RHKA 2IS4A 1BA5A 1Y0NA 2W48A 2RQQA 3LSRA 3VUGA 3I6UA 5IA4A 1X1PA 3UOHA 3HB9A 1Y8QB 5CXHA 3OT8A 4LL5A 2IW5A 2K9NA 2WC2A 1U5RA 3L8SA 3ECHA 4AE9A 5HLNA 3WTZA 1YW2A 4I0TA 3UO5A 2Y0MA 4RWIA 5GJDA 4ITJA 2FGIA 2DFEA 4DJAA 2Y4IB 4RIOA 2OSCA 5HS9A 4BCGA 3CTHA 4UXLA 1GAGA 3LFNA 3SD0A 3PLAE 3LFCA 2VTJA 5IMEA 5BVEA 4HEA2 4PCQA 4I5PA 1X1DA 1GV2A 5DM6F 3HIFA 4IJ9A 2SRCA 3A2KA 1FINA 1XSXA 1KE8A 4CFXA 1G3NA 4EOOA 4PWNA 1U8RA 5DEWA 4EHZA 1T33A 2QNJA 2HWOA 2KIFA 3K69A 5M55A 4CKJA 4DE4A 4EH5A 4A3DJ 1XMAA 2ITNA 2IS1A 2VXZA 4AOJA 5IA0A 1S8NA 1PKDA 2K86A 2D1VA 2OPTA 4CCLA 1FJLA 4WWCA 4OAYA 1YXSA 2BPMA 4ANBA 3OVVA 1SD6A 3A61A 1YFHA 2X6DA 3DB6A 1OGYA 4DBQA 5ICCA 4NJ3A 2DJNA 3F8FA 3ZMVA 3KRXA 3IOPA 5HG8A 3FLNC 5H9BA 1XG1A 5L2WA 3CCQI 1YS6A 2XSJC 1OJLA 2GQQA 2PMLX 5DR2A 1V5GA 3HOZJ 5B2LA 5D11A 3HAMA 1R36A 3D5VA 2XAHA 2CN5A 3MPMA 2QQ7A 4U8ZA 4J00A 5JFWA 1WAKA 1R9TJ 2XKCA 2HZDA 3ZR8X 1OR7C 4FX0A 5HE2A 5BVOA 3DEEA 4AW1A 3QQLA 1IG1A 1OIRA 4CLJA 2JT1A 3QYBA 1ZYLA 4DHZA 3SFIA 2YX7A 5F1ZA 4HNFA 5LEKA 3QX2A 1U9NA 3HPGA 4L5EA 1L8TA 3KK9A 2EWAA 2OIQA 2OH4A 1ETXA 3VBXA 3GFIA 5TOZA 1YRPA 1KOAA 4PTGA 2RNGA 1XMMA 2H8WA 4MBJA 2F2CB 4PMTA 4A6EA 5M09A 5M4CA 1PXLA 1KUTA 3QBNA 2OK1A 1XO2B 2G0EA 1IRXA 3EQBA 4LOPA 4RGUA 2W85A 3NUUA 2CW7A 4KS7A 3QOEA 2STWA 1D0XA 2YIRA 2VTNA 3BZKA 2PUPA 1OKWA 4O5VA 4MX9A 5FFXA 3C2HA 5FKMA 2YHVA 3SDBA 5CVIA 5DA3A 2WMBA 4G6OA 3SDGA 5FM3A 4FHTA 2XBAA 3LFDA 1XKKA 2DU9A 3PIYA 5CU3A 5AM7A 4O7ZA 4I24A 4AG8A 4D4VA 4J71A 3PLSA 3CS9A 3QTSA 4ZMEA 3GZNB 4CYCB 4X0MA 2VKHA 2OD5A 4KYWA 3CPCA 2FSOX 4P90A 4JBVA 4LGWA 2BKKA 2X4HA 4A4OA 2C47A 3A4PA 1ZOGA 2A6EF 3SKCA 5EOLA 5HTBA 4FA2A 4ERWA 2R4GA 3EQIA 3P0MA 2LR8A 4JI9A 3G6HA 2LMDA 2YCSA 5EI2A 4ZSEA 5M56A 2XZSA 4YZNA 2OC6A 3RK7A 3VBYA 3KZZA 2IGKA 4KIFA 2R3SA 2C3IB 2QYOA 1A36A 3RVGA 2W4JA 4BCFA 4Q4ZF 4C02A 1FY7A 5F0HA 1PMUA 3G6EI 4A4XA 1M1EB 1H00A 4BTJA 5CNNA 2Y4PA 4MEXF 1QVUA 2J90A 4EUUA 4BJ6C 4C38A 2DDAA 4IF4A 2VX1A 5JEBA 1WJEA 2BAJA 3GC9A 3L2VA 2CMWA 2BRNA 2BIKB 3ZRLA 1P5EA 2WWYA 1B9MA 2V4JC 4UHTA 4EH2A 5EYKA 4Y17A 2JKQA 4ZTQA 3VRZA 3L8PA 2J0IA 5A6NA 4D1XA 3VWAA 5LBQA 1ZRDA 3O17A 5DS9A 2VQHA 1E1XA 4C2MJ 4NM0A 2QO7A 2BRBA 5CAVA 3D94A 2JDVA 2OXYA 4PK4A 3TL4X 3IH3A 2Y8OA 5I9UA 4D55A 4U45A 4BZDA 2XNEA 4JX6A 3FE3A 4MCVA 1UG2A 2VE8A 1H89C 1W5SA 2X6YA 1QPEA 1J75A 3OS0A 5FLVA 2IEKA 4MVFA 1BIAA 4BDYA 2KHMA 2EWNA 3EETA 4A0ZA 2C6KA 3CZ6A 4GH2A 3FXOA 3R8UA 1KE6A 2CKOA 4CZUA 1QPCA 4L6QA 4CT1A 3OSGA 3EFLA 4CYCA 5HS8A 2ERKA 5KX8A 2OZ6A 2HWVA 3S2PA 4M0ZA 2LYCA 3F23A 2HOEA 1XH5A 3J80Z 4MBLA 2R3QA 3OYBA 3JRBA 3QD3A 3ZQLA 3QRTA 4AQCA 4KNYA 3MH2A 3QUEA 3M3YJ 4OIPF 3LSMA 4EVIA 3TDVA 2VJ4A 4C2VA 2E2IJ 1U5QA 3ZQIA 3FV8A 4E26A 4ZTHA 3OYNA 4DGMA 2BVLA 4G31A 4WHZA 4O21A 3GCPA 2JRMA 3Q0WA 4YR8A 3AT2A 2UZWE 2W9FB 2XNGA 4YSJA 2W96B 5D5WB 2M87A 5CVRA 3OZ6A 3LXKA 4F6WA 3VOEA 1V0OA 4DZPA 4F9BA 5FD6A 5TJJA 3PUBA 4HJOA 4EK5A 2RKUA 4RMNA 1PXMA 2QU6A 3BPRA 4RFYA 1XC5A 1WCMJ 1B9NA 4AIHA 2H1LA 3HEGA 4C34A 2FNAA 2GSFA 2CU7A 5A46A 3TNQB 3MKLA 5DUKA 2XSDC 3LAJA 1YS7A 5M3MJ 3SLSA 2CS3A 1MBJA 1JJ8C 4RIWB 4F78A 2C0OA 2HVQA 2L9VA 5EDQA 4RAYA 1F3MC 4H4KC 1T39A 1FVVA 3CC2I 2M45A 4L00A 3E3VA 3HSRA 3BYSA 3G71I 1MRUA 2C4GA 2R3IA 4UWCA 3DK3A 1XSVA 3FPMA 3Q5FA 3HC7A 4BKXA 3VAPA 4UWYA 2W1EA 3HA6A 2XDVA 3SYTA 2H34A 1KGSA 1ON1A 3WHCA 3FXXA 3GNIB 3RPVA 4A07A 1LPUA 1W36C 3E87A 1YI6A 3QKMA 2MABA 2GS7A 3T9TA 4JS8A 2Y30A 4IVDA 4AACA 3QLFA 2R92J 1USSA 2UUZA 3DWLE 4PJ0C 3F82A 2X2KA 3OC1A 1J7IA 1FSHA 4PF4A 1VQOI 1YWVA 3OWPA 3FMKA 3R00A 1U2WA 4XOZA 5A54A 4DZJA 5DLSA 1YI4A 4F7JA 4HYUA 2OJ9A 2WQNA 4EUTA 2VX3A 4YZBA 2VUWA 3L7WA 4RC2A 3R1YA 2K9MA 2HYYA 2EZIA 5IP6A 1SFOJ 1N78A 4W4VA 1KOBA 1JXSA 4HNVA 2DAOA 2D5VA 2OF2A 3CGFA 5BMZA 2MA3A 3IRRA 5TGTA 3GCMA 3KMWA 3DTCA 5L3GA 2M34A 1ZRZA 3BE2A 4G16A 4DGGA 2NRUA 2BY1A 3FI4A 2QR7A 1FWZA 4EMSA 1ZLTA 5I0BA 2GHMA 4L7FA 4AUAA 2H8RA 4YHJA 1YQAA 4F52A 5ICEA 5CU0A 5BYYA 1EV7A 4CG9A 4DFNA 1CKIA 4WXCA 2V22A 3Q9YA 5DGZA 4ZLZA 3GTMJ 2JIUA 3D15A 3TNWA 3BC8A 4G6TB 4U40A 4PGGA 2J4ZA 2PN6A 4G9YA 2OJED 2VLAA 5LRSA 3DT1A 4F1TA 2PMZA 2BTRA 3U6HA 4JG6A 3QP5A 4RZVA 2A69F 2LFBA 5ANIA 3OOGA 4WNMA 2EFWA 3FLQA 2WU7A 3FXZA 2KKOA 3P08A 3DXJF 4YNOA 2X7GA 3QTWA 4AIKA 2PVJA 4AZWA 2BAKA 2F6CA 4DAWA 5AP5A 3W33A 4DBRA 1R1TA 3I55I 1RZ4A 3JRGA 2XKPA 2Y0SA 2XIGA 3DNDA 5CEIA 4A3KJ 3FZ1A 3E6MA 5JFXA 2HAKA 5DCFA 3BLYA 3Q4TA 3IL2A 2B53A 2AUHA 3WHBA 1LEZA 5T68A 2XF6A 4BKJA 2Q0NA 1FBSA 4FKPA 4F91B 4BDAA 2UZBA 2HVSA 3E8NA 3NDMA 2F2EA 3QZIA 4JMQA 1UU8A 2I0VA 3H35A 2UW0A 2OZOA 3G9LX 1YHVA 2GBYA 3F3WA 4F0GA 4FCYA 3ZZEA 4EHEA 4U3ZA 5HVQC 4A3GJ 5HVYA 4U0YA 2ZMEC 4PRJA 1I50J 4I0BA 3RQIA 5E20A 3HZJA 4DCEA 2YM5A 4BZNA 4IB5A 2XALA 2XK6A 3UZRA 3HP2A 2HTSA 2F4MB 1MMNA 4FE2A 4KBCA 5EG3A 2WQMA 1O7LA 2Y6MA 1GDTA 3CIKA 1Y91A 2G15A 3A4OX 3U1KA 3HYIA 4DBNA 3MTFA 3CF2A 3JR9A 4FSYA 3FL5A 3VSLA 4IWDA 2H27A 4F08A 3FHNA 3I1AA 2ZB1A 4YP8A 2WAQN 3VHKA 4FTIA 1ZYRF 5FDXA 2V26A 5FEQA 4L01A 1X4OA 4XLFA 3VNTA 5J4YA 2PVYA 1FSEA 1PJKA 3ZMMA 1WHUA 4C4FA 3QXOA 2CSNA 4WG3A 4FKSA 2XNNA 1M14A 3QP6A 4FIHA 3CTQA 3TN8A 2XA4A 2RL5A 1VI0A 1FLIA 3BPXA 1W36D 1EF4A 3OW3A 2IJLA 2JA5J 5IA1A 5CQEA 4A06A 2DT7B 1WBOA 3RM6A 4XKCA 4JIAA 4YHFA 5HZNA 4PDYA 2LD5A 3AKLA 4QMPA 1FQ1B 2JPBA 4N9IA 4FIJA 3EQLF 2NVQJ 5HI2A 4OBPA 3CC4I 2M8GX 5K7FA 4DYRA 1ZQ3P 2DMTA 5ETCA 4E6KG 1QHGA 3FMNA 5EDNA 3RKBA 5AAFA 1V1KA 4B7TA 5DV5A 4LV8A 2WAEA 2GXAA 3UIUA 4H3QA 2OCEA 4AFJA 2FB8A 3A7GA 2CRGA 4WO5A 2XAOA 1YTYA 3CCJI 4A0XA 3LPBA 1ATPE 4DYCA 3E5UA 2PZIA 4QYHA 3CCUI 3NIZA 4NDLA 1FPQA 5IUGA 2FUMA 4DT8A 2HXOA 2JAVA 3R60A 2HFHA 2QODA 4PJNA 3GC8A 3CD8A 4FT9A 4GS6A 4RAZA 2GPHA 2BIYA 2MSYA 3KU2A 5AUYA 3HV7A 4P96A 3QU0A 1OYYA 2X8DA 4A3CJ 3ZP5A 3PSCA 2VKDA 4LJZF 1YWNA 3C4FA 4YG2F 3WYXA 4AX8A 3A01B 3PYYA 4R3CA 3UJGA 5M3FJ 2JN6A 3F8NA 3KVXA 3ZMDA 4JVGA 4LG0A 4AUXA 3OCBA 2OO8X 3ONQA 3R6SA 3ZEWA 5TISC 1WJCA 4D7MA 4C2TA 3DTKA 2QOBA 3BCBA 5H8BA 3R9HA 3WU0A 2GXBA 2OWBA 5IZFA 3KF4A 5AV2A 1U78A 2FYSA 3I79A 4KDPA 4KA3A 4C37A 2R7XA 2UZNA 2EUFB 2XRLA 3HOTA 4GT4A 3LAPA 4M9XA 4PNIA 5E8XA 4HGLA 4QMOA 3F5XA 4YGAA 1IZ1A 2PG4A 4N6ZA 4I6BA 4FSZA 2JDTA 5ERIA 3ZLXA 2CKEA 2DYSH 2P7CB 1ZG5A 3TTIA 3DTWA 3QPSA 1TQPA 3OYAA 4EOSA 3H9QA 3ZTXA 5FGMA 3G0FA 2XRNA 4RLFA 2XNBA 3ORTA 3V6RA 5JK3A 3FKNA 2DWBA 3EL7A 3RINA 3N05A 3W2AA 4NTSA 2XJ1A 4GL9A 1FIAA 1ZYCA 4UUTA 2ZXJA 1OI9A 4RAGA 4FR4A 1DGRM 2VBZA 2GTMA 3DFAA 1EH4A 3QRIA 4WK8F 3FKLA 4HGTA 2VC0A 4BY1J 5KE0A 5M4UA 4XONA 1UU3A 4XHKB 3FSFA 3O50A 4NL0A 1R78A 4ZTFA 2PVRA 1H9TA 3DDPA 4Z6YA 5IDPA 2HXLA 3F5GA 2RREA 3QU6A 3KYCB 4Y5QA 3BDDA 4A3BJ 1I27A 1H1RA 2FSWA 3TW6A 3GOKA 5AMNA 2LKSA 1IN4A 2XB5A 1HOWA 1YKRA 1SMTA 5FGKA 4RPVA 4ALWA