3TN0C

Structure of mouse va14vb8.2nkt tcr-mouse cd1d-a-c-galactosylceramide complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
205
structure length
203
Chain Sequence
b'TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title NKT TCR Recognition of CD1d-{alpha}-C-Galactosylceramide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 34
structure length 203
sequence length 205
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0C02
1FGNH 4ACPA 5JUEH 5B22A 1IBGH 1S7QB 1Z2KA 3IDGA 3UAJC 2I60H 5AD0B 1U91A 4X4XA 4J2XA 4XP4H 2VAJA 4R4FH 5MEOB 5JHLL 1N8ZA 2G75A 4YXHH 4JY4B 2X4TB 4XZUA 3FN9A 5FHAH 5HHOE 1F6FB 3D39A 3BAEL 3V95A 3WJLA 1AD0B 4K71C 4AH2B 1OTUC 3VG0L 2IBGA 1F4AA 3ZKNC 4ZYKA 4XC3H 5IMLB 5FYLL 4XGZA 2P5EE 4OZGE 5D2LE 1GJIA 3FRPA 3ALWA 2CUHA 2QSCH 5EU5B 4TVPL 3W11D 2HKFL 4Y4KC 5D7JC 3FMGL 3T77B 5HGDA 5JHDE 3ULUE 5HHNB 5ABDE 2ZPKL 3BISA 1JHKH 3PWPA 1IEBB 5EFIB 1C5CL 2GJ6E 1S7XA 2AV7A 3MRGA 5LXGL 3ZKMC 4PUBH 2E7CA 4XPTL 4PJFE 2J3SA 2VISB 2R2EA 3ELAT 1V3MA 3TZVC 2DAVA 4JKPH 4Y2DA 3FT4A 5AUMA 1W0VA 2D4DA 4IOFD 3I75B 1PX3A 4Y1AA 1L4IA 2IAMA 1GPOL 4DFHA 2PKDA 3C5JA 4CU6A 5HVHC 3ALPA 3CNKA 2AKRB 1ZGLM 3P11H 5IB1A 5D1QB 3V5KA 4MGXA 4GXUN 3MV9A 4OZHF 1H3TA 3L3KA 4NQEE 4I3GA 3LZFL 4H26A 43CAB 3WKNA 5HD8C 4H88L 5CMAA 4M5ZH 1M7DA 1A3LH 4MHHI 3LY6A 4LLQB 3NABL 3O3UN 3Q6GL 3T04D 3PWUB 3A6BH 4J8RB 5JZ7C 1RZFH 4Y5YC 2HN7A 5L88L 1IAMA 3F12B 2JK5A 3DURA 4U1LB 4JHZA 2IBZX 1FJ1B 1UM6L 4G6FB 2DQDH 1UJ3A 1U8LA 4NC1C 2J7LA 1JPSH 5BV7L 1U95A 2OL3B 4F33A 2QSTA 3DX8A 3IETA 4HJGA 4D9QD 2YC1A 4JQIH 5BOPA 4NDMA 3O4LE 1JNHB 2C3WA 1OWRM 4J6RH 4QGTA 3NTCL 1JZ8A 4RZCA 3DXAE 5DMGD 2AJSL 1T4KB 1HIML 4XNZB 2AAVA 2E9BA 2A6IA 4ZMAT 2D0GA 4WHCA 4LHUG 3NCCB 5EIIB 2IG2H 5JHLH 1FP5A 4WI7A 1WWWX 3F5WA 3HZKA 2VLJE 3DX6B 2YHGA 4NRXB 4Z7QF 5I1GH 3NZ8A 5MENE 5FYLH 3DVIA 1AE6H 1L9NA 5AEAA 3FMGH 3GMRA 4P4RB 3WNPA 5IB4A 1YMME 4J3XA 5E2WL 3LHPL 4JM2B 4UDUB 3D85A 2EEBA 2D31A 1HCVA 4KRNA 5LXGH 5E5MA 2FSEA 4HKBB 4OD3H 4XPTH 5IHUH 3CDGA 1KN2L 4NO3A 2DIBA 5CJBA 1WT5C 5DS8A 3NCYP 5C0FB 1TJGL 1XFPA 2QTEA 4OUOA 3QEHA 3QXTA 4JFHD 5GRWA 2D7NA 4M1CC 1A4JA 3BQUC 1XCQA 1J5OL 4ISVB 4R7NA 4YHZH 4UB0H 4MX7B 5DA0B 1CZ8L 2HJKB 3ULVD 3P9WB 1SY6H 1QPXA 1A6PA 3QQ4B 3VA6A 2EH7L 5CGMA 5DJCB 1Z0MA 3KHQA 2X1PA 1MHCB 1CFTB 3CFKA 4MLSA 4L4VE 2R29L 1M6OA 2HJLA 3C5ZA 3Q6GH 3S5LB 2F19L 1JGUH 1MCIA 1NJ9B 5L88H 2FYYB 1GYAA 4OFKA 1LP9F 2VDPL 5CSZA 1ZSDB 2B7DT 3S7GA 1I4FB 2E27H 4PJHB 3V8CA 5BV7H 3VXUE 2EECA 5JNYB 3SOBH 1YC8A 1JTPA 3U1SL 1TJHL 3MLSH 4PJ9C 3SKJL 3X3GL 1I85C 4TNVK 1WGOA 3GSXB 2ZOKB 5FECB 2C7UA 1AO7E 1HKLH 1HIMH 5J4MA 3L5WA 4LQFH 1PYWB 5K9KA 3BD4A 1MFNA 4K23H 1FLTX 4PJ5E 4K8RD 4LOUD 1BQSA 5CWSB 4PBXA 2ZCKL 3C2AH 1ACZA 1G7MB 4TTDC 1GOHA 3KXFD 2OZ4A 2XTJD 2ZCLL 2EIBA 3A0OA 3U9UA 4H1LG 5ECJE 3UTTD 3QNXB 1CS6A 2MWCA 1QSFA 2BFVL 3D25A 1LE5B 4OIAA 3U46B 4TSCL 2XXMB 4PJGF 5BOZG 2R23A 3CDCA 3GMOB 2NXYB 2DJ4A 3SDAB 5KZCD 1ZE3C 3FHQA 3TPUA 3GM0A 3SGDH 5IFJA 1FNLA 2XKUA 1JWSB 4RMVA 1S3KL 3UJIL 4KJYA 4ZUSB 4XWOC 2AVGA 4U6HB 4E41B 3ULVF 1LEIA 3FAXA 1INEH 5F9OL 1MFDL 1AY1H 4KKCD 1ODAA 4ODBD 3HZMB 3V52L 2BXYA 3CFEA 3MTRA 5JQ6L 1AQKH 4KRMB 4OLYH 4JPIA 4RA3A 1F6LL 3JUZA 2OQJB 5F7FA 2EIEA 4HKXB 5FYJL 3TO4C 1DBAL 1RURH 4YHKL 1CR9L 2F19H 5I71C 1JPFA 1L7TH 5F9WB 5FO9B 3BRFA 1EJOH 1UM4H 3WLWC 1DBBL 3LEXB 3QI9A 3VXTB 3I2CL 5CJQL 3QDGA 5EORL 3B9KB 5D70H 1CVRA 3V7AE 1AGBB 4K07A 3U1SH 4LVNC 4U6XA 5E94B 3QULB 4MCZB 1T04B 2DRUA 3SKJH 5EB9A 3IDYC 3T0ED 3EGSB 3H3BC 4XMLL 5GIRA 4AMKH 1S7UA 1NLBH 5FUCC 1YMHB 3WKML 1YQVL 2EYTA 1HILA 1LD9B 1FSKB 4LL9A 1CFSA 4HIJA 5CEZD 1KIPA 4YDLB 3MRQB 4C4KO 1UYWH 1MCRA 5JIIA 4HMDA 5SWSD 2L7JA 3GSNB 1EBPA 1AIFB 3H3KA 2BRRL 4LDLB 4P9ML 4HK0B 1IM9A 1OSZA 4LHUD 4NGHH 3LKOB 5HYQA 4KVNH 2WINB 4ELMB 1KELL 3ARFA 1FFNA 2KDGA 5EBWA 4U33A 1MQ8A 5F6HJ 5D7KD 4ELKB 2C4FU 5DVMA 4WW2C 3KPMB 1NUDA 1C5DB 1L0YA 1J1OL 1AGFB 3O8XC 3S36L 2M8XA 1V8HA 3MRDB 4NQVA 4X6BA 3E8UH 3ZKXB 3UJIH 5I8EB 4HLZG 1X3DA 5JA8B 4KRLB 3FO2A 4ERSH 3OAZH 1KLUA 1PG7X 3C5SA 1JVKA 5DK3A 5AZ2L 4Z7OF 4AENB 3VWJB 4N8PA 2B2XL 2EKSA 5LWYL 3MRNA 5BXFA 4PJBB 2Z93A 3TNMA 1Q9OA 2ESVA 5FYKH 5ESVB 4HXAL 3NA9H 1GZPB 1ROWA 3GMNA 3I9GL 3WXWL 2AXGA 4KTDL 4NBZB 4R97B 2X42A 3WIIH 3P4MA 1DBAH 4LBEA 5GRXG 1TPXB 1T6VN 1OTSD 3NIDF 1C12A 4IRJA 1R3JA 3P4LA 1QRNA 1KCRH 1I8IB 1ZTXL 2Y7QB 3GKZA 1BF2A 3I2CH 3ZDYF 2NY0D 4QY8B 4P2RB 5K93A 4KQ4L 3AREB 4R96A 3JTSB 1QYGH 4MDIA 1RIHH 1FL6A 1C5BL 3CC5B 4AJ0A 1VADA 4JO2H 1BJ1H 3CXHJ 4PTUA 3CVHL 2E9JA 3R06B 3RX7A 3RTQB 1REIA 4YHLL 4OCRH 2YMXH 3WKMH 1YQVH 1GOGA 1UC6A 1LDPL 1UZ8A 5JIKA 5DD5H 1NQBA 5ILTL 5E2TH 4M1GL 5AYUH 1IM3B 1P4LA 3QUXD 2BSTA 1WEJH 5F89B 1LO4L 2LFGA 3BGAA 4P9MH 1DN0B 2AJXH 1IL1B 5KN5A 3MCKA 4MMZC 2GYSA 2BVPB 3LKSB 4CNIA 3RWHB 4BFIB 15C8L 3JWNC 4GW1B 5FGCB 4DAGL 3QIWB 5B3NA 5F7NC 3KYNB 1YNLL 4XPAH 1NMAH 1BVLA 4NBXB 1CT8A 4I3SL 5HGBA 4LEOB 1NGQL 1BX2A 3BEVA 3GMLB 1RUML 3ZDXE 1AXIB 4NKOA 3ARDC 1OGAE 3GO1H 5TDOA 4NO2A 3PL6B 1T1YA 2Z4QA 4ODXA 5T1DL 4X4ZA 5IHBA 4RCAA 1NGXB 4X9IA 2IGFL 1FC2D 5KVGL 2FX8L 4WUKL 5J12B 2BVQA 3HE6B 2X4RB 5TGBA 2X5PA 1KJVB 4HWEH 5EZOH 4LGPB 4JHBA 3PGFL 5GGSA 4PRIE 3IXAA 2JCCB 5C0AB 1RZGB 1X5ZA 3WHE1 3VW3H 2XQBH 1N4XL 5LVEA 3D39D 3KPNB 2ITDA 4TVSa 1YECL 4TN9A 1N3NA 3OPZH 4YDIL 2Z31B 1T5XA 1VFOA 5C0GB 5TPWH 3FO9A 4KXZH 1ES0A 5D5ME 3FRUB 5JW4R 3DMMC 2DLFL 1G6RH 3LH2H 5C0BE 3PWPD 2X4OA 5KS9B 1BJMA 5FA3A 4LFHD 2DOCA 1P69B 3MV8E 1QSZA 1AGEA 1QFPA 3UYRL 3O9WC 3RY6A 2AXJA 4K94H 4PG2C 5IW3A 1RZJC 1K4DA 1LDPH 2E8ZA 4OTXH 4YH6A 3WFCL 5ILTH 4Z77A 4Y2DD 4M1GH 5ESQB 1YEJL 4IIQC 4Y1AD 3SKMB 2VLRA 5BJTA 1AQDB 3GNMH 2IAMD 2BVYA 4HUXA 1GAFH 3F62A 1EFXB 1XH3B 3RDTD 4EXPX 1HN1A 1YYMH 3VRLF 1EAPB 3I02A 4B0MM 4JKWA 3MV9D 1HSAB 4NO0A 1IC4H 5IVXA 5JMRA 5T5NG 2YPVH 4HBCH 4D9LH 2XG4A 2ORBH 3Q1SH 3MRLA 3S34L 5DUBB 4PJEA 1TZHB 5IHZB 5F71A 1FG2A 2MSPA 5IESH 2NY3C 4HDIA 1NCDH 2B4CL 3U4AA 4DAGH 5EU6A 1I7ZB 4R4NC 4HZAA 4I5BA 4I0PB 3VFUA 1URLA 2YBRA 4GBXC 3SDDB 3QXAB 4ODVL 1NGQH 4XNXL 1X5YA 3CDYA 1JI2A 1CXKA 4I18C 3MV01 5J6HB 4QEGA 2V5SA 3BX7C 3WE6A 4YAQA 3ET9F 2CO7B 4NJ9H 3ZTNL 5IOPA 4QO1A 1TZIB 1CBVL 4KKAC 4B50A 2FX8H 1QFWH 4WUKH 3RUGB 4FP8L 3OR7B 1JYVA 1G7QB 5F44A 3ZHLA 1T2JA 1NL0L 5D1XA 5JW5B 1A3QA 1FLRL 4Z6AT 1CL7I 3PGFH 3W5MA 4H25B 5I8KL 3ARGB 5KSUA 2VMFA 2XWTA 4ORZC 1WWAX 4DKAA 1JPTL 4HWZA 1YEFH 1YECH 1T1ZB 4XCFH 1U8HA 3T2PA 3H9ZA 2R0WL 2WW8A 4WW1A 1AXTH 4EI5B 1BD2A 1YDPB 4X0KA 4Z7WB 1I1FA 1VDGA 2DLFH 2DLHA 2HTKC 4RFOH 4EQ3A 5IW6B 3IRZA 3TJEH 5ADOH 2WBJA 2VDQH 3HC3H 4O2FB 5IJVA 3EYVB 4GLRI 1DANU 4U1GB 2BY3A 4NM8L 4JRXE 4XCEA 4PTTA 1XR8A 3WFCH 4OLUH 4YHNB 3FQWB 3T4YB 3U4EA 4OD1L 4DOHB 1YEJH 4PR5B 4KK8C 3L5IA 3ROLA 1FE8H 2P7TA 1OT1A 3C6SA 3HE7B 1S78D 1V7ML 1KJ2A 3EZ8A 4JVUA 2CPCA 3UTQA 4XCYB 5L2KE 2BC4B 1BQHB 2E6PA 3I6LD 1BGXL 1A6WH 4ZAKA 1DQQB 4U1IB 3C5ZD 2PXYB 2PYEA 2P46B 4WWID 4FQHA 1ZHNA 3R1GL 1FNGA 1R5IB 3MFGB 5GZOC 1PG7L 2J88L 1EV2E 4QXTB 3MLTA 3K1KC 5DWUL 1E4XL 4G8EA 4XNXH 4AM0A 1ZGLA 1KCSL 2DQTH 4L3CA 4UIMB 2NY2B 4JDVA 3TCXA 4G8GE 1K2DB 1RPQA 3UTZB 2CKNA 1XIWA 5FF6A 3ZTNH 5B39A 1S7TA 1A7QL 3WL9B 3QIBA 4DKFL 2X7LA 4M7JL 5DC4B 3ARSA 1F58H 3DARA 3FN0L 1DQMH 1ORQA 1YEIL 1BZQK 3QXUA 1U8NA 5INDA 1FLRH 1B6UA 1CGUA 3W9DA 1BM3H 5I8KH 1IAOA 1C1EL 3KPSA 1KSRA 3B6SA 4HULB 3MUZ1 3WUZA 3IDJA 4NKMA 4UV7L 4DWHA 1QSFD 4WJ5B 2R0WH 5FIEA 5IBUG 3T08A 5KG9B 1HCFX 4C55A 3MJ9L 3O6FA 4KK6C 5EC1B 5FO7A 5DJZB 1IILE 3LIZH 4EDXB 5L8KB 3ULSA 2BVEA 2VE6B 3M07A 3P9MA 1OPGL 3VRIB 4NQXB 1HYSC 4M61B 3MRFA 4CMMB 2JJTC 4NO5A 4GW5A 2HTLC 4WWKA 2FR4B 2W0PA 3ARBB 1KCVH 4L29A 1UJTA 4OD1H 3HZYA 5EBLB 2BVUA 3S96B 1W72B 1WFNA 3CXDH 2GFBA 3S3SA 4HFUL 1B90A 2V5RA 1N0LA 3IU4L 2R15A 4BZ2L 1NCWH 4Z7UE 4E0RB 5C8JB 5HGAB 3OAYH 4KI5F 4S11A 5I75B 1U9KA 5DEFA 3VXMA 2OI9B 4WY7L 3K7UA 5IKCA 4MD5B 3B5HA 4GXVH 2R9HC 2OJZH 3R1GH 1KPVA 1ADQA 2OL3L 3GRWA 1PG7H 2J88H 4BH7B 3IXTA 1H5BB 1E6OL 2HG5B 3FB7A 3ULVH 3QI9D 2ZNWA 4KJPD 4D8PA 1N2RB 5DQ9B 3QEQB 1IQWL 5GZNC 1N5AB 4KDTA 3QDGD 5IF0A 3VH8B 4EDWL 2VLLA 3RZWA 1KCSH 2B1HL 4H0HB 4KK5C 5I1HL 4Q0XH 1NBQA 4F57L 1WF5A 3BD3A 4X6FA 3LN5A 5KJRH 5T3ZD 2CKBB 4MNQA 1EEUA 1F90L 4XAKD 1OLZA 4NJAL 4M7JH 5EOCJ 1EZVY 3O2VL 1RHHA 3JXAA 3DGGA 1A2YB 2CMRH 2GJJA 2XA8H 1YEIH 3QT2A 2VZOA 4JGMA 3VXNB 3SCMA 1IMHC 3IB4A 4O5LL 2VQ1A 3SGKA 3OSKA 3T3ME 1Z9MA 4O4YL 4PREA 5I1KL 2CJUL 5BS0A 2NY4B 1G7IB 3EOTH 2F74B 4JO3H 4P59H 4G8IB 3L3JA 1FV1B 1X7QA 3CZFA 1IM9D 1KIUA 2AJ3B 2DQHL 4ZOEA 1CFVH 1KTKE 1P7KB 2H6PB 3X14A 2O5YL 3ARFD 2J2ZA 1JWUA 4N68A 1WSST 5CBEB 5CAYB 4PRHE 5DD3H 1AXSB 3RL2B 3P4OB 1X6NA 4N8VB 4U0QB 1I8LC 2J5LC 5CUSH 1NAMH 2VLKA 3AS0A 1MFEL 1ZK9A 2P47B 3RGVA 4XI5C 1KTLA 3NFSH 3P4NB 3EBAA 4XX1E 1ZLWH 2JJSC 1J9CT 2RFXA 3FCTB 3OR6A 2J6EH 5D8JL 4YX2L 3MROB 4N90E 3TNNB 4NOBA 1QKZH 2YS4A 4QHUA 3PDDA 1KENL 4EVNB 3PQYE 1FH5L 3GMMB 2WBWB 3D1MC 1LO2H 4HJ0C 1GC1L 2ERJC 3QXDA 5MEPB 1MRDH 1AHWC 2ESVD 1QHPA 5BMFL 3RQ3A 3REVB 1A7RL 4JN2B 5DTFA 5DYOB 3KJ6L 3AC0A 4WY7H 2AK1L 2CRMA 3GIZL 3R4DA 3U0PB 4IS6A 3S8WA 3C08L 1I3VA 5CEXA 4MD0A 2OL3H 5FO8B 4GRWF 5E1HB 4IRJD 2IF7A 4NWTH 3EYQD 4NPYB 1DQJA 3HHRB 4XPBL 3FQTA 2Y36L 1IQWH 1OAQL 2Y5TA 4EDWH 3B8SA 5SWZE 5I1HH 4EBQH 3P30H 3DBXA 5DR5H 4GJTB 5E95B 4OV5A 4UU9A 2P5WE 4LNRB 4M8VA 5EA0L 4YC2C 1MWAA 2WWKO 4PJAF 5M95B 4NRYA 1BJ8A 2DQJL 2KQNA 3CX5K 4JZJB 5CZXD 2HT3C 4WV1C 1U58A 4P49A 2CUIA 4LPXA 1F2XK 3DOSA 5TDNB 3GI8H 1NGYA 5M7QA 4O4YH 5I1KH 3TFKD 5T1MA 3PWJB 3OL2A 1NDGB 4QRRE 4NBYB 3CH8A 4NQCE 4QHMB 3JV4B 3WD5L 2EYSA 4XNYH 5DUML 4IRSC 5E8OA 4U1MA 4M7LT 1NCBL 1BVZA 4PJXF 1S5HB 5JW4M 5CD3B 4ZFFA 5FGBA 4D2NA 25C8H 4TRPL 1VGEL 1HZHL 3IFOB 2H2PD 1B0RA 5IG7A 2Y9RT 3KYMA 4H8WL 5B8CC 3MCLL 2F9BT 4R4BA 2D4FA 4D9RD 4J1UB 4N0UE 5EO0A 5B39G 4UQ2A 5GS0H 4XP1L 4OKVA 3MJGX 1BQLH 3O11A 5BZDA 1KCKA 3HS0A 3QUMB 3TIDA 5ANMA 4W70A 1KCUL 1BIIB 3MODH 1FO0B 1T21B 1WZMA 1QLRA 2A2QT 1ZT4A 3V4UH 3WNNA 1R0AL 2I9LA 1KB5B 1WLHA 1JZ4A 1PKQA 4RISL 2OXHA 3KJ6H 2NLJA 2AABL 1UA6H 4AG4H 1T7WA 35C8H 4LSTL 5CIPA 3QPXL 1OW0A 3EO9L 3FO0H 3GMPA 4TVPE 2K7QA 3SKOA 2HJFA 4ZNEE 3HMWH 4O2EA 5BO1L 3OKNB 4ZO7A 4G9DB 1I1YA 2Y36H 1BZ9B 1OAQH 3ARXA 1WCBA 3HUJB 2NY6B 4JPWH 1WFUA 3OXSB 1DLHB 5HI4C 3IDXL 4PB0H 2R1WB 4KHXL 1F11B 2NYYC 4CN4A 5E6ZA 4YJZL 2Z35A 4RGND 5EA0H 1MF2L 4WHTB 3BH9B 3GSNL 1OP5H 4Y4HA 1KXQE 3CFJA 3HRZB 1NCCH 2YPKA 4UBDD 2ATKB 2VLRD 3TIEB 1MRFL 3QO1B 4WTZA 1EO8H 1CD9B 1NBYB 4NNXA 2P8PA 4S0TD 4N0FB 3NN8B 4PRBA 1Q9WB 4NO0D 1HSBB 5DUMH 2COQA 4BSWB 4Y5XB 1I9IL 4QRPE 4O58H 2ZUYA 4TRPH 1T20A 3NZHH 2FX9L 2KUTA 4M8QB 1F4WL 3P73B 4H8WH 4C56A 5I8CB 3F8UB 5EU6D 4LHQB 3LRSB 3RWIA 2YD3A 5M94B 3PIQB 4GFTB 1UKTA 4WU7B 4YXKL 4PLJD 4P2QE 1WZLA 5C07E 1DL7L 1JIBA 3G5XB 2IWGA 2DI8A 4XP1H 5ALCH 1QQDA 1A6TA 4FFYL 2FEDD 3DSFL 4Z7VE 4GG6A 4YBHA 3RWFB 3BGMA 3RWEB 4K94C 4YZFF 4L8SB 4W4NA 4H1LH 2OR8A 5HHOB 2O61B 1CDIA 3L95A 1KIQA 3H9SE 1MI5E 1MCNA 3N1QC 2AJUL 2AABH 4Y4KA 1HHJA 5D7JA 5LAXA 2QV2A 3RIAK 3WFBL 5MP6L 4ZUTA 3G6JB 3QPXH 4BSVA 1JFQL 3PE9A 5D1XD 3TCLB 4KC3B 1MFAL 3IDNB 3BPOB 4POZD 2NW3B 5AYQA 3B8YA 4R2GC 3BP4B 1DEEB 4MNHB 2BSSB 1RMFL 3TZVA 2DWDB 3AAZA 4XRCA 4PJFB 1QEWB 3B4NA 3RPIA 2BMKA 3I6GB 5LBSL 1BD2D 3RVXD 3GUTA 1QUNA 2HVKB 3RVVD 4KHXH 1TQCC 1KC5H 2WBJD 1DVFC 3D87B 2FBJL 5DVNA 1RUQH 5FHBL 1A6AB 4M02A 1K8DA 2D9CA 3DUUA 3KXFB 2XTJB 2R1YA 3H7BB 4U0RB 3UTTB 5K59F 1FZMB 4Q7DA 1JNJA 1F4YL 4EQ2A 1HI6B 4Q6IB 1MEXL 4Z76A 5KVEL 5EOCL 1FNFA 3AFLA 1UXWB 1LO3H 3QQ9D 4Y4FC 2EH8L 4NFCA 4UILL 4PP1D 1MRFH 3EKCA 1OB1B 4JFEA 4EN3A 4NSKA 2NX5E 5CBAA 2CDFA 3G6DH 6CGTA 2LTQC 4FOMA 1C8PA 1FCGA 1YY9C 2VABA 3H9HA 2Y6SD 3F7RA 5TE6H 1I9IH 4HEPG 4OFDA 1CDHA 3FO1A 4IMKA 4ZAKD 3QWQB 5GRJL 2FX9H 2PYED 5E00B 2A6KB 3U0TA 5A40E 4P4KC 5E9DE 4YQXH 3TBVB 1X5KA 3FT2B 4OD2A 4PG9B 4RAUB 4HV8B 2VSDA 1W8NA 1RIUL 5ITBH 2YD5A 5F1IB 4FFYH 3DSFH 3BP7B 4NUJA 2UV3A 2F53E 3FFCA 4GMSL 1FNEA 2X9YA 2APFA 1T2QL 1XIWD 4WNQB 5F1NA 5JXEC 3QZWA 4TNWF 4NKIL 5BVPL 1IAII 1ZT1B 4FFVC 4UDTA 3QIBD 4WI2A 3T2NH 5ENWA 1UWXH 5JIHA 4ZFGH 1YNTA 3VG9C 2QL1A 4PJDF 4OT1L 3B9AA 3NPZB 3BOVA 4I13B 5J89A 4OZFB 4GAFB 2BOBA 5KSVB 1LNUA 4Y0GA 3KPSD 3T0EB 4MJ6B 3UJJH 2WK2A 1WT5A 3O45B 1UB6B 3BRGC 1OAUL 1ZHBA 1U3HC 3BD5A 5LBSH 3LMJL 2ATPB 5HPMA 1PD6A 1TVBA 2ILLA 4PLNC 4RFEA 3RP1A 3O6FD 3NCYS 5IVZA 3TVMC 1H9VA 3HI1B 1AGDB 1HHKB 3SDYH 1I9RL 1H8OA 3G08B 3BWAB 4IM8A 1F3JB 4X7CC 1DSFL 3D69B 5C70A 5FOBB 5SWSB 4PFEA 2N56A 4WWKD 4IOIA 5EBGA 5DT1H 1KB9J 5BQ7B 3OGCA 3WO3B 2D03L 1YJDL 5C2UB 5EOCH 1TIUA 4PGCB 1EMTL 5HHVH 3VD9A 2EXYC 3ZL4L 1JYNA 1T22B 4HJJL 5A1AA 1XF4B 2MJWA 3BKML 3U0WL 2FB4L 3IDMA 5AG9A 1OGTB 3KPLB 2VDNL 1J05A 4LKXB 2EDFA 2GAZA 3BGFB 3MRPA 5BW7C 1QBMH 2I25N 1QSEE 5F7HA 3CLFH 2YUWA 2UZYB 1T0MB 1ORSA 3VXMD 5F1KC 4MDJA 2PYFB 4PJ9A 4DZBB 3E2HB 2HFFA 1I85A 2ITCB 4X8JA 2I9TB 1JGVL 2WQ8A 4RMSA 1A3RL 5H37G 4MCYB 2IQAA 4G6AD 3QHFL 1BFSA 2OM5A 5CJXC 3GJFH 5B38A 3U7YL 3PWNB 3VFGH 3H0TB 3ESUF 1CICB 3HPJB 2AW2A 3L7EA 5LQBH 1PY4A 1VCAA 2CDEB 4L4JA 1UENA 1NFIB 1L7IH 5D71L 2DL9A 1SJHB 3T4AB 1D5BA 1ETZB 4GQPH 4MNQD 4NKIH 4QF1B 4K7PX 5BVPH 3SJVE 2APXA 4OZIE 4WTZG 4P2CG 4OI7A 4FFZL 4OAWB 4I77L 3VMOA 1GCFA 3VI4F 4HIHB 5I1EL 4ENED 3SCMD 2HFTA 2VL4A 4OCYL 4QRQA 3CK0H 3GGWB 4KTEH 5BS0D 4DGVH 5SX4H 1A1NA 2QQNL 3MGOA 5C08E 2A9MH 2VOTA 3UTSA 3ULVC 4GW4A 3NIFF 1FZOA 1WQVT 3QUXB 4LLVB 4C4KT 4EUPG 4S1RL 2VLKD 4JANA 1JZ6A 2XPGA 2ZUXA 4BKLA 3T8XB 3RJQB 1YYLH 2P48B 2HFEB 1MPAL 3KPRA 3DVNB 4NN5B 3KLAA 1CL7L 3TYGL 4HJJH 5GS1B 1C08A 4D0BB 1XF3A 3VD5A 4OZGF 5D2LF 4R0LA 3C60C 4OIBA 1FIGH 3GSQB 3RVWC 1MQKH 3PUCA 2NY5L 1INQA 5D96C 3BXNB 3ULUF 2FWOB 4PJCE 4JLRA 3GI9H 4LK4A 3L3OA 3DROB 3QDJA 4PP2B 1LEGB 5DVOA 4YBQD 1JGVH 2YWZA 4YIQA 5JR1H 1K8IB 1X5HA 3OXRB 3IKKA 2DIAA 1J8HE 1R24A 4S1QL 4K7FA 2ZOLA 3QWRA 4KUCF 5EU7C 5JIPA 3MUY1 4U1KA 4KK9C 1B88A 3MREB 4MS8C 5DHVH 1WUNT 1LMKA 5C9JA 1MLBB 3V6OC 1GGIL 1P5UA 1U91B 2VQTA 4X4XB 2FJHB 4OBRA 2DIJA 8CGTA 1N8ZB 2G75B 4N9GA 3MLVL 1JHLH 2NXZD 5MHSE 3D39B 1H0DA 4M7LH 2WLZA 4HBQA 1U42A 4UTBH 4LSPL 4NUGL 4OQTH 4ZYKB 4XGZB 1TXKA 4GKZA 3BP5B 5FA4A 4GRWH 1Y0LA 2FIKA 5I1EH 5F1SA 3CH1B 4QKXB 4WW2A 1CK0H 3VGAB 2ARJA 1YN7A 5HGDB 3MRRA 4WFED 5IMMA 2HKHH 1S7XB 2AV7B 3N1GC 2P8MA 3MRGB 3TESA 5T3ZH 3BIKA 1KNOA 2IFFL 2Q3AA 1G9MH 3DRTB 2R2EB 1JGDB 1UADC 4Y2DB 3FT4B 1W0VB 4X9HA 5GGUA 5I9QC 2G9HB 4Y1AB 3RRQA 1W72L 1H3PL 3C5JB 3RDTB 2D3VA 3V5KB 1U8KA 1WAAE 3MV9B 4G7VH 1T03H 3EYOA 3AM8C 1J11A 1IGJA 4U49A 4H26B 1JPGA 1MELA 3MYJA 3TYGH 1XGUA 4PGZA 5CMAB 4JRYE 2J8UA 3EYSH 4HHAA 2R0ZL 5GRVK 2R4SL 1S7VB 1SVZA 2DBLH 1M71B 4RGMC 4M6ML 1MAJA 2EDOA 4WFGE 5EUOE 3B2UC 2JK5B 4NC1E 1EHLL 4NZRL 4TULL 2UWEA 3INUH 1U6AL 1U8LB 5H94A 3MFFA 4WEBH 4PV8A 4F33B 1QLFA 4HJGB 1EHAA 5KW9H 2YC1B 2HP4A 3PHQA 4GLRH 4KY1H 4H5SA 4NDMB 5EOQH 4CL7A 1B0GB 4ALAH 3GKWH 2VKWA 3FOMA 3S35X 4RZCB 4OLXH 2CKBL 1QA9A 4MA3A 4X8XA 2A6IB 3D18B 1JF1A 3OX8A 3H42H 1JGEA 2MOVA 2G60H 3S98A 2RR3A 4RGOH 3F5WB 1SM3H 3MLVH 1BZ7A 1CE1L 5GS0C 3GB7A 3FFDA 5CJOH 4YDKL 3LKNA 2F54E 3T0AA 3U83A 4NUGH 1NSNL 2GHWB 3NZ8B 1G0YR 3O2DH 4Y4HD 4DK6A 2R69L 3VXQA 4PGEA 2ZJSH 2F5BH 3GMRB 1LWRA 2F15A 5IB4B 4HS3A 3MUGA 1GOFA 1ZEAL 3KWWA 2D31B 2XRAH 3MA7A 1YEDA 2B8OT 5E5MB 2FSEB 1TTGA 4MA7H 3K2UL 4L3AA 4RQQA 3CDGB 4UQ3A 4NO3B 3H2WA 5DS8B 5B38G 1IC5L 2V7NA 3QHTC 2NY1C 1D6VL 3QEHB 4BZYA 4HXBL 3TO2A 2APWA 5GGVL 2P8LA 4GOSA 1XCQB 2IH3A 2PF6A 4FQ2H 5IB2A 2QHRL 4IMLA 3QDMA 4ZXBC 3LDBB 4V1DE 1FVDA 3UAJD 5E7FA 4ONHA 1L0XA 4P46C 3FZUC 5C3TA 2EE2A 4G6JH 4CU7A 5IGXH 3CFKB 4FABL 2QBWA 1BREA 4LLDB 4Y19E 1PLGH 2HJLB 2R0ZH 5IBTL 3C5ZB 4NIKB 2ICES 5DGQA 2NY0C 3ZKND 4M6MH 2P1YA 2UYLA 1QFWM 5GRUL 4MMXC 4NZRH 4PD4J 5HYJE 3DMMA 4Y4KD 1WC7A 5D7JD 1A7NH 4X6CE 3SDAC 2MKWA 4LCCC 5C0BB 3ZO0A 3ZKMD 1ND0A 4OCNC 3U4BH 4PG2A 4YNYA 3TZVD 2X70A 4LMQI 2C7UB 5DK2A 1MCKA 4H8WC 3RHWK 3L5WB 4IIQA 3MGTA 5K9KB 1VKXB 5F9JA 2DLIA 1KJ3H 3MMEA 2JE8A 1CE1H 4YDKH 3KPTA 3U9UB 3VXSE 1B4JL 1YNKL 5HD8D 2YOCA 1DBKL 1G9EA 1QSFB 3THMH 1VA9A 1M7IA 5SX5K 1T5WB 4R8WH 5JW3L 5HHME 5I30L 4G42A 5JZ7D 3QB7C 2R23B 2I07A 4ONFH 4GAJL 2ZUQC 4GQ9L 4X99A 4TOYL 4UIKL 4HPYH 3OZ9L 5FCUL 4PV9A 4BQ6A 1YPZE 1CIUA 4JFED 4OF6A 5DUPH 2CSPA 1CLZL 2KL6A 4GBXA 3TPUB 1SQ2N 4HH8A 1AP2A 5IFJB 4MSWA 1CIDA 3BPLC 4I18A 3AMLA 1IC5H 2QQLL 1X6LA 3S37X 4MJ5A 1PQZA 2MHAA 1OAZH 4LASH 4ODTL 1KYOK 3DI2B 4Z0XA 3QUML 4XCCL 2IALB 1FO0L 2ZKHH 3RJDA 3CFEB 4D0DA 3ZKSD 4OB5H 2Y25A 4JFXA 5FGSA 3BPNB 4JFDA 4P2OC 4OFYA 3WIHL 3V4PH 4QTIH 5IBTH 5TQ2L 2BNRE 3IJHA 3FFCD 4MAYC 3SN6N 1JPFB 4PJ7A 1AH1A 2IEPA 2V9QA 1UH3A 3IJSA 4HIXL 2V2XB 4NNPH 1IGMH 5DFTA 3M1BB 2EDXA 3QI9B 5L7XH 1HHGA 3QDGB 5HDQH 1VACA 1UACH 4PRDB 4U6XB 3QRGL 4BZ1L 4KJQC 2FHCA 1G7LA 3B2VH 4HWBL 5GIRB 3DYOA 4Q9RH 5D6DC 2EYTB 4M1CD 2IAMC 4K7PH 1WBZA 3M17B 1G9NL 1CFSB 1RSFA 4HIJB 2NTSP 1MHEA 2FX7H 1KIPB 4G3YH 1MH5A 5MEQB 4WI9A 3IGAA 3HMXH 1SMAA 4X4MA 5L2KB 1YNKH 4NP4L 2GW5A 3DUHA 5HYQB 1JNLL 3DUSA 1FFQA 4N0YL 3M45A 1PKOA 5I30H 4NYLB 3ARFB 3NGBC 2BNUA 3OZ9H 2ICEA 2VDML 4GS7B 3MBEC 4OCWL 2CUMA 1IGIL 2EKJA 1BAFH 4NQVB 4X6BB 1ZHKA 5JDJA 3REWA 3FO2B 4PJ9D 3DYMA 1KLUB 4HUMB 3C5SB 3KNBA 3B43A 4XP6L 1NANI 3MNZA 4XCCH 4YFLI 3SE9L 5BXFB 4C54A 2GSGA 2NY7L 5C0EB 4LVHB 1Q9OB 5GSRB 4WI8A 1SY6A 3GMNB 4JEGB 3HI5H 3WIHH 2AXGB 2FGWH 3N1MC 4TTDD 1R3IH 2XOTA 2V7HA 4P3DB 4LBEB 4XBEH 3F7QA 5T1KA 3GZKA 3TV3L 4G6ML 1U8IA 4S1SL 3ULUL 1JGLL 1C12B 3FL7A 1R3JB 4IRJB 4Y16C 2VN4A 1B2WL 5E03A 1J0ZA 3EOBA 3F58L 3GHBL 4LCIL 2JB5L 5DJAA 3SGEI 3BSZH 3BW9A 4XPFH 3SDXE 4F37K 4R96B 2H41A 4MDIB 4JHAH 5DMKB 4JFFA 1FL6B 3Q0HA 4KHTH 2N7AA 4XVTL 1VADB 5GJSH 1MUJA 1TMCB 4BZ1H 4K8RL 4PTUB 2JJTA 1R3LA 4XWOD 3ZDXF 4ZPVB 2HVJA 3EHBC 4XVUD 1UZ8B 2JB6A 4XVJL 3QO0A 1SHMA 1T66C 3UTSD 3X13B 4Q74A 3UBXA 1P4LB 4ZTPH 4HCRL 2VIRB 3N9GL 3W0WA 1QLEH 7FABL 2VDRL 4F2MA 5EUKB 1A8JH 4QXWA 4HT1H 3KPRD 1NBVH 5JW4N 4KI5C 2HT2C 1N6UA 2WV3A 4N0YH 3D2UB 5D7IE 1AC0A 4OFIA 3MCKB 5J7CC 3ARQA 2EO9A 4M3JA 1M7XA 3OAUH 4P0DA 5JDSB 5IT2H 3NCEB 3G9AB 4PJHE 3WLWD 2YRZA 4MNGE 1D5MA 3DPBA 1MCPL 1IGIH 5EH1A 3FONB 2F8OA 5D5MF 3CCHB 4YR6B 4YHOH 2CXKA 5HGBB 4HKZA 1BX2B 3QDJD 3BEVB 4NKOB 3CLEH 3BEWA 1QBBA 3PP4H 1A7PL 3QXVA 5TDOB 4NO2B 4LSRL 3SE9H 3KVQA 5F6IC 3QWRD 3RIAF 4WCYL 3ZYZA 2BNQA 3GSUA 2BVQB 3UROR 3L3GA 3T2OA 3LEYH 1MOEA 4E5XA 4F58L 5HGHB 1N5YH 3CSBA 3PHOA 4QRTA 3TV3H 3A6CH 3IXAB 5ISZA 5CZVL 3ULUH 3BN3B 2OR9H 1ADQH 5D2NC 3BRDA 2ITDB 5HDBE 3F58H 3DV6A 2ADGB 4LCIH 3GHEL 1N3NB 1CLOL 4IJ3C 4YE4L 1H15A 2AXFB 2IFGA 3F6LA 3IFLL 5D93B 3FO9B 1JRHH 3S35H 1XF2A 1F97A 2WBKA 1I8LA 4PS4H 5E8DL 3S4SA 5HTSA 1BOGB 4YK4B 4XVTH 4HQQH 2YK1H 2X4OB 4XVSH 4E41E 5F8RC 5FK9A 4XP9L 4DUXA 1AGEB 4RGNB 2MQCA 4NQSB 4Y89A 1QNZL 1GGCH 4M43H 1K4DB 5JTWA 4I1NB 2WWKT 5I1DA 2G2RA 4I3RL 1A7OL 1NFDE 5T3XD 4Z77B 5E2UH 2Q7YB 5BJTB 1TITA 4UT6L 1AHWA 3SE8L 4HUXB 4F7CB 1NMBL 2VDRH 3CU1A 2GJZA 1L9MA 1IAIL 3TN0C 5JPMB 1I1RA 1H3VA 3I02B 4RNRA 3ROOB 2VDOH 2C3VB 4NO0B 3WN5B 5IVXB 2Y23A 4Y5VC 3CVIL 4XCNA 3MRLB 2V17H 4PJEB 5BCAA 1ZLVH 5JOPE 1FG2B 3C9NA 4Q2ZA 5CILL 5JLZB 1H3UA 3OB0H 1RU9L 1MCPH 4UUJB 3P77B 3O3DA 1N6QH 4I5BB 2CO6B 4X5WA 5FCSH 1MNUH 1GXEA 1NC2B 3W9EA 1ACYL 5KTEH 4OI9A 5SWZB 1FL3A 2GY7B 2CK0L 5F88A 5A2IH 5IW1A 1Q72L 1MCJA 1G9MC 5DJXA 4OLVL 4LSRH 4CKVX 3WE6B 1WK0A 5DJ8A 4ZSOA 3H3PL 4WCYH 5IOPB 1HKFA 2BSED 1RK0A 4WV1A 3QG7L 1J8KA 5D1ZB 3HN3A 1LDSA 4F58H 1CU4H 1T0NB 3BUYA 3ILQC 4WI4A 1AI1L 3DYPA 3IFPA 5CZVH 3B9EA 4XXDA 4ELME 5KSUB 4Q6YA 1T7ZA 4X5XA 4ZO6A 3CFDA 3DV4A 4HWZB 4IRSA 4QRRB 1PSKH 2H26A 1OSPH 4DW2L 4LLMA 4QCIA 4YE4H 2V2WA 3O6MH 1A6UH 3MXWH 2XN9A 5E8EA 2DDQH 1BD2B 4X0KB 3NCFB 1I1FB 5B8CA 3FB5B 4LPVA 4OIIL 5TH2A 5L0QC 2WBJB 1Z3GL 4JN1L 4XP9H 2ZCHL 4W6XB 4JQVA 4OF7A 2AJZB 4OCXL 2IBZY 4NQUA 4N0UB 3VXPA 1JV5A 4XCEB 1AJ7H 5I73B 2EZ0D 2VYRE 3E3QC 2AQ1A 1VB9A 3ARDD 4PTTB 2A74A 1A7OH 5C6WH 3U4EB 3RU8L 5CGTA 3ROLB 1NMBH 2P7TB 3C6SB 1KJ2B 3QDMD 1D5IH 3UTQB 5DJDB 1OM3H 1IGYA 2J8UF 3SJVA 2Z8RA 2WLYA 4JKMA 2CIKA 5GGRB 5E2VL 5E08H 5DJ6A 4FTVE 3V6FA 3GBML 1T83A 3WUWG 4ZAKB 3WV0A 1D3CA 1N64H 2PYEB 5CILH 1D6EA 4MZ2A 4FQHB 1ZHNB 3S37H 4X6DA 2I5YL 2UWEF 5I1CH 1CGWA 4FQJH 4X9FA 3ALXA 3LS5H 4WI6A 2VLMD 3L3IA 1NGPL 4FXGA 4A2MA 2AJYL 3B5GA 3DMMD 5ICYA 1T89C 4G8EB 1IE5A 2ICWA 1VPOL 4QYOB 2FD6L 1ZGLB 4OV6F 5C6PB 5DLMH 4ZPTA 4JDVB 4LLUB 4YHML 1U8OA 3WFEL 4KAQL 1XIWB 3H9YA 5FF6B 3BDYH 4LP5A 1S7TB 3DJ9A 3EJZC 5KSBA 1DFBH 4YFLF 3QIBB 1XZ0B 5ID0A 1WFTA 4KMLB 1ORQB 3EO1B 4FXLA 4CDGC 4Z7UF 5INDB 4MB3A 4KQ3H 4YGVA 5EU4A 2VXUH 1MLCB 3O4OC 4PJ8C 3KPSB 4PJIE 5LGHH 1UWGH 5E8PA 4FQLH 5I75C 2L4OA 1BOYA 2A0LD 3B6SB 3OJMB 4NKMB 2AK4A 2AI0L 1BFVH 2CRZA 5AWNL 2NY3D 3NVQA 4XB8A 4GRLB 1P6AB 4EOWL 3O6FB 4R4ND 2A9NH 4JN1H 2OTUB 1G6RA 1RULL 3PGCA 3W39B 4XNMA 1V05A 4LF3A 3ULSB 1J86A 1NMCC 1CYGA 3GIVB 4GBXD 4OCXH 4DVRH 2VERN 5F3HB 3MRFB 4ZD3L 4P2QB 5CKAA 3BVNA 4NT6A 3CUPA 3QEUA 4WWKB 5C07B 4WENB 3STZA 4O51A 2UZXB 4L29B 2MCPL 3HZYB 2WUBH 4WGWB 4ZQKB 5TE7L 4KPHL 2GFBB 3O0RL 4UT7H 2Q6WB 1OD7A 2AEQL 4B53A 1YEEL 4P5TC 4KKAD 2LE9A 3EZJB 4LAQH 4OLWL 5FDWA 3KR3L 2JCCE 1EGJH 5C0AE 1MI5B 3DX9A 1JN6A 2YSSA 2LV4A 5DEFB 2DM3A 4JFDD 4OFYD 5EZIL 3VXMB 3T3MF 4YGAB 5E24E 3L9RA 5IKCB 4MJIA 2NTFA 2FGZA 1KPVB 3S4SG 1Q0XL 4NM4L 3IXTB 1IC7L 4WUUA 1FAIH 3FB7B 2AJYH 3OAYK 4D8PB 1HYRC 1XGRA 1R5WA 2HTKD 3WSQL 2CLRA 3QIUC 3JWOL 4PRPA 4MQXC 3LKRA 4NHUA 5IF0B 4BYHA 1DVFA 4CGTA 5IFAH 2AQ3A 4BH8B 2Z8WC 4EUPH 4YHMH 4PPTA 4ZO9A 3D5OF 1MHHA 2H32B 3MRBB 4OGXH 4OCSH 3PG2A 4C58B 2FEEI 4X6FB 4YUEH 3LN5B 3BPCB 6FABL 1DLFL 2QADC 2W60A 4MNQB 3L3HA 4JVPA 4XXCC 4GAGH 2VUOA 5ITFA 4X7FC 1RHHB 4KK8D 3DGGB 1EVTC 4Y4FA 4XH2B 1MJJA 3SCMB 3UC0H 5KOVC 1F6AA 1CTOA 2GTZA 2NPLX 2VQ1B 4F15C 3W2DL 5IEKA 3ZHDA 4PREB 2A1WH 5BS0B 3ZE1E 3W81A 4JAMB 2NX5B 3BT2H 3L3JB 1EHNA 1ZT7A 4TUKL 4LPWA 4MJ2A 5AWNH 4DKEH 2DL2A 1Q9LA 5FYLD 3QQ3A 3X14B 5GZOD 4EOWH 4CADB 1JWUB 4P4KA 3VFOA 5C0DA 5I18L 2GEEA 5CP7B 3GSRA 5I74C 2L7UA 3MOBH 1F13A 1H8SA 1FPTH 4ZTOL 1BVKA 5J1TC 4ZD3H 1ZA3B 1KTLB 4BK4A 1EEZA 1ZANH 3TBSA 2RFXB 4ZFOL 3OR6B 1OARL 5EU3B 3T2QA 2GT9A 4CRPA 3AROA 1Y6MR 4QHUB 3NOIA 2ZUWA 4D0CA 4DVBA 4P3CL 4R26L 2VITA 5ERWA 2NNAA 3RUGE 5FYKU 5JXEA 1JYWA 1J7VR 3ZE0E 2VH5L 2YD7A 3QXDB 1GGUA 3BJLA 3CGTA 4JR9L 5D1XC 3CXHK 3SY0B 2DI7A 1ZLWK 3EO0A 2EDLA 2XWJB 3NAAL 5DTFB 4Z78A 1OHQA 1RIVL 1WISA 2OX5A 2EDBA 4MQTB 2EIDA 5CEXB 4MD0B 1OP9A 1Q0XH 1QR1B 3PWLA 4NZUH 3ARWA 5FUZH 1DQJB 1P9MA 2OK0L 3EUUA 3FQTB 3RVVC 5I16A 1P4IH 1WBXA 2Y5TB 3RWJA 3TVMA 3UTOA 3CD4A 4M1DH 4YEEA 3A67L 1U93A 2CGRH 5L2JA 4JFFD 3ARPA 1HYSD 1DUZA 3DBXB 4DOHE 4HLJA 2HTLD 1Q94A 4OGYL 1KPUB 1KEGL 2NXZB 1NAKL 1EEYA 2I26N 1MWAB 3GMQA 2FIRT 5KANI 2VXQL 3GBNL 3UO1L 3M8OH 2C26A 4X80H 1U58B 1SJEA 3I3DA 1NGYB 3W0WD 2VDLH 5T1MB 3QUZB 2YUVA 1LP9A 4O9HL 2PUQT 1D5ZA 2YKLL 4TUKH 2AV1B 1A21A 2EYSB 4RWYL 1A1OA 2R9HD 2CDGA 4U1MB 1YEKH 1NDMA 2FL5A 4FS0A 4R3SA 1V3LA 2BDNL 4DQOL 2W91A 1EEQA 3QH3B 3EW3B 4QHLA 4DEPB 5CJXA 1B0RB 5IG7B 1A6ZA 3KYMB 2NY6C 2O5ZH 5GZND 2X4SA 1V3KA 1JPST 4R4BB 4KK5D 5EO0B 1AFVL 1NEZA 1OARH 1XR9B 2C1OA 5DD0H 1ZS8A 2EYRA 3UZQA 4OKVB 1ZLSL 4RFNB 3O11B 3HS0B 4UOW0 3AY4C 4L9LC 5C7XH 5ANMB 1A9BA 3D3VE 4RWHA 4G9FA 1ZT4B 4JR9H 5MI0C 1PKQB 4JZOA 1TETH 4HX1A 4TUOB 4NRZA 5KSAC 2BNQD 4PJGA 3TBYA 2Q76A 1PGRB 1RIVH 4OFVA 2DLTA 2R1XA 3GMPB 3SKOB 3FKUS 2HJFB 3QCTH 5ISZD 1BQUA 3D0LA 1HDMB 5C08B 3WDJA 3RHWF 1I1YB 5E99L 1TCRB 1WCBB 3CFBA 4JFQA 5DD1L 1FFPA 3A67H 4L8BA 1ONQA 1DJSA 5T5FH 2R4RL 1IRAY 1S7QA 5KBNC 4I48A 1KEGH 5KVMC 2Z35B 5FUOL 1NAKH 2RB8A 5EWIH 3U7WL 4Z7VF 5MEOA 1UEMA 5FKPA 2X4TA 2X10A 5CINL 1S9VA 2N7BA 4TQEL 4Y4HB 3GBNH 3UO1H 1IGCL 4AH2A 4HJ0D 3WXVL 5B3JE 4PRNB 5C0NC 2PW1A 2YPKB 3QXWA 5TF1L 3C60A 2ED9A 4ZG1A 3IRPX 5EU5A 2D7TL 5DMIH 3IF1B 2LVCA 5I6XB 3QRFM 4U6VL 1C7SA 4LPYA 4O9HH 3MLWL 3FOLA 2YKLH 3V5HA 3X12A 2DM4A 2AGJL 4K2UL 4X6EA 1DBJL 4QTHA 5KVDH 4PRBB 4RWYH 1FYTE 3ULUC 4GT7A 1OP5K 3STLA 3EFDL 2DKSA 3RNQA 3FQRB 3NH7L 4L1DA 4C57C 4G6AC 4DQOH 1T20B 1VFAA 2K3TA 1IKFH 1UH4A 1S7SA 2RJMA 1J8HB 3C8KA 1D9KC 2VDKH 3RWIB 3I75A 5FFLA 1NAMA 2BVOA 1MJ7L 3QNYA 3WHXA 3P0VL 1NLDH 2AKRA 1QQDB 1A6TB 3T3PE 2Y5EA 4GG6B 3BGMB 1BP3B 4K71B 3SE4C 5KVFH 4K3DH 3C2SA 5CEYA 3BKYL 1PY9A 2HT3D 1KIQB 3L95B 4J8RA 5B21A 5A3IC 5LAXB 4P9HL 4Y4KB 5D7JB 5FYKD 1E6JH 1P7HL 3F12A 4ZUTB 2VXVH 4L8DA 4BSVB 3L5XL 3PF2A 4MXWL 1FJ1A 4KVCH 5FYJD 1MCCA 4QGYA 1WWCA 5FOJA 4CAGA 3F7VA 2HFGH 2OL3A 1DUYA 4IRSD 3QEGH 3TZVB 3HC0A 4LPUA 4CDHA 3E6FB 5CP3H 4LCWA 3RPIB 2AEIT 5IK3A 2XN9D 2CIIA 2BP3A 1BWWA 3GUTB 4S2SA 1T4KA 4X7TA 3RGVC 5HVHB 4LEXH 3LQAH 1TNNA 4M62L 3KYKL 4JPKL 5FUOH 4RIRA 1K8DB 3DUUB 3U7WH 3DTXA 4P23C 4OZHE 2R1YB 3AM8A 3MLXL 3HCVA 4TSAL 1T7XA 4G8FB 1IGCH 5LJYH 4XMKH 4TUJB 4KMTL 4NRXA 4Z76B 3GJEA 3WXVH 4Y5YB 3VD3A 4KU1A 3AUVA 4ZS6C 1OF2A 3KPQA 4AEFA 2ENSA 5EC2A 1IGTB 4JFEB 3MLWH 4FMKA 2DQGL 4O2CA 4NSKB 4K2UH 5CBAB 2CDFB 3MZGB 4YDJA 3HNVH 3H9HB 3MRJA 3EFDH 5FAAA 4HKBA 2ZSWB 1XCTA 4I9WD 2LU3A 4OCMC 2QKIA 2W9EL 1WICA 3MJ8A 5C0FA 4JO1L 3U0TB 4R90H 1FL5A 2BZDA 1UVQA 1RJLB 3OHXB 1MJ8H 4OD2B 5HI4D 4MAUL 3BMWA 1FAKT 2WM0A 4WEUD 2NYYD 4NUJB 5GS2H 4WEMB 4LIQE 1QSVA 2AJVL 3FFCB 4YXLL 1FNEB 4N5EC 4HMCA 3T1WA 1ZLUK 3NPSC 5F1NB 2HT4C 1G7HB 3QZWB 3O3EA 3GSVA 3S5LA 4UDTB 5ENWB 4M6NH 1FN4A 2CLVA 3QA3A 5D72L 4HPOL 1YNTB 3LAFA 3RNKA 1NGZB 5CJ5A 3IDUA 5TFSL 4YLQT 4MXWH 4GKOA 3BGFC 1R3KA 2BOBB 1LNUB 2FO4B 2AXHA 1I4FA 1INDL 3Q5OA 1JWMB 3HI6L 3V0VA 4ZOCA 2BK8A 5J13C 2AK4D 3FQUB 5DRZA 1ZHBB 1SEBB 1UWXK 5HPMB 3BQUB 1CQYA 1DQDL 1TQBC 4Y88A 3QUKA 4M7KL 1NEZG 4LSSH 4RFEB 5DD6B 2XACC 5IVZB 2BSRA 4ZXBA 3FN3A 4M62H 1P5VA 1K3ZA 1CICC 1N26A 2HLAB 3MLXH 4U4BA 2R39A 4IOIB 2H3NA 1N0XH 5EDXA 1MFCL 5DFVD 3OGCB 4WU5A 4M9PA 4U7KA 5D7SL 3QNXA 5H2BA 1T7YA 2B20A 2EDYA 3O2WH 4OZIF 1QP1A 3IDMB 5I1AB 5TJWK 1YEHH 3MRPB 4D9QE 3GMOA 1X5AA 4FA8A 3Q48A 3SDAA 3MV7A 4LCCA 1V3JA 2Z8SA 5FV2A 1ORSB 4MDJB 4PJ9B 3HUJE 1SJXA 4MJID 1E4XI 1JWSA 3BYYA 4DGIH 2FATL 2W9EH 4EIZC 2X1XR 4JO4L 3LEVH 1GVIA 2E5EA 4WUUD 2IQAB 3VXOB 3IU3A 4ZODA 5B38B 5EBMA 3L7EB 2HLFC 1UCBL 4PRPD 1DVFD 5GS3A 4O00A 3VA2C 3ZT5A 1AR1C 1OQXA 2HWZL 2J4WL 5LCVH 3OKKB 3TWCL 4HK3J 5DQJA 3DECA 5EPMA 2R56H 1CE6A 12E8H 4C83A 4HKXA 3VXSB 2HRPH 4FQQA 3GJFK 4IRZH 1DQLH 5IBLC 5GS1C 4Y4FD 1J1PL 5T33H 2R0KL 3RWGA 1EPFA 2AQ2A 4GSDL 4W4OC 5JXAH 4QRQB 1YPZB 3UZEA 1UWEH 4PJCF 2MQ0A 4JFHE 1YY9D 1AGBA 2DM7A 1A1MA 4HUNB 1A1NB 3MGOB 5E94A 5IR1A 1T04A 3EGSA 3HG1A 3MJ6A 3MLZL 1KUMA 3ULVE 1CF8H 32C2A 2QLVB 3CPLA 2ZNXA 3B3IB 4P4KD 3UTSB 3OJ2C 1FZOB 3UYPA 1OD9A 1WV7T 5A2LH 1S9YA 3MLRH 4M5YL 4N8CH 3V6ZA 3MRQA 4JB9H 4BKLB 4P2OA 1KJ2L 3B83A 4MA1C 1MFCH 2QQKL 2A83A 3TO4B 5IB5A 4OM0H 5D7SH 4MAYA 2DKMA 3KLAB 3O3BA 5I71B 1Q0YH 1KJMA 4HK0A 2BNRB 3G6JE 5JXED 1OAXL 3CSYB 1RI8A 1X5IA 2DTML 4FFVD 3CJJA 3KPPA 4Y8DC 1XF3B 1RZ7H 4LPTA 2W0FA 1S8DB 2W65A 3VDBA 3RZCC 4KZDH 3HNSL 4TSBH 3L3OB 4LVNB 1K6QH 4ZFZA 1MFBL 3IDYB 1J18A 2FATH 1CGSL 2YA2A 1A0QL 2GUOA 4YIQB 1OCWH 4JO4H 4KKNA 5D6DA 1U3HD 4E42A 4K7FB 3S36X 1E4WL 2ZOLB 4U1KB 3P0YH 4OZ4A 3V6OE 3VFMA 3O3AA 3MLYL 4U1SA 3KXFE 4PJBA 2XTJE 3TVMD 1LILA 4LKCB 3UTTE 2R2HA 5ESVA 1GZPA 1A64A 2IPTH 2J4WH 1MCSA 5KAQG 1WAAF 4N9GB 1MIEL 1KN4L 3AS3A 4F7TA 4RBPK 4MHHG 1H0DB 4DN4H 3WDHA 3L6FB 5EOTA 1QPPA 2EXYD 1EA9C 3QP3A 4GKZB 4UT9H 1A6VH 5FA4B 1Y0LB 2FIKB 3MBEA 4K3JH 4EN3C 5I1IH 4WW2B 1RV6X 2ARJB 1YN7B 5EUOF 4P2RA 2NW2A 3ZMRA 5IMMB 3O8XB 4GAYB 2P8MB 2UVEA 2JKXA 3CC5A 1MAMH 3BIKB 1KNOB 4IMKC 5ADPH 2IPKA 1J0HA 2O5XH 2EDJA 5E4EC 1ZA6A 4LSVL 1OAYH 3E1F1 3RTQA 2DTSA 4Z7OE 1I3RA 3VI3E 5GGUB 5HI5C 4APQB 1I7TA 4AQ1B 4JDZB 5E4IA 3O81A 3VE0A 1KFAL 1KEML 4KROB 3IKCB 3EIFA 1T80A 2UZIL 4WFHD 3BAEH 1U8KB 3LB6C 4I2XE 3VG0H 5K9QI 3S5LG 3EYOB 5DGRA 1DN0A 3MYJB 1XGUB 1IL1A 4TVPH 4Y16A 1F42A 1XGQA 1RAMA 3UEZA 1F8TL 2HKFH 1PEWA 4G9FD 4LPCA 3MBXL 2YPLA 2ZPKH 3RWHA 4QXGL 1C5CH 2XZZA 1MCOL 5L8JB 1AD9A 2PETA 3T0EE 1MVFA 1R5VA 5C0JA 3FQNB 4LNVA 4U1NA 2EIZB 3SDXB 1MFBH 5H94B 3IFNL 4F7PB 2PR4L 1CGSH 2KPNA 1QLFB 5I0ZA 5FB8A 4HG4J 2YD6A 3GMLA 3PHQB 3U36A 5CEZE 4H5SB 1GPOH 4H20L 3OJVC 1QA9B 4MA3B 5SWSE 3GJFA 1JJUA 5DHYB 2C4XA 2XZQL 1NGXA 1JF1B 2ZUSA 1JGEB 3LZFH 1DN2A 4H88H 3HE6A 1MIEH 1KJVA 3FFDB 5I76A 3LKNB 3NABH 2DYPA 3BZ4A 4IOSD 5D7KE 3TP4A 4LDOB 3UPAA 1NBZA 5HBBA 4NKDA 3KPNA 3PV7A 5D7IB 4WFFD 4PGEB 2M2DA 3I3BA 1UM6H 3LRGA 1LK3L 2VC2L 2Z31A 5BRZA 2DF3A 3C60D 5C0GA 3RVWD 3MUGB 4MNGB 3FRUA 3KWWB 4X6CF 5IQ9B 4JG1L 1YEDB 3MA7B 2QSQA 4GRMA 4IDLA 4RDQF 1LHZA 5KS9A 4RQQB 1T1WA 4LSVH 4UQ3B 3RL1A 3SE3A 3NTCH 3L3DA 3S3PA 3ARDB 2DQCL 1WVZA 2AJSH 4HMEA 1CGVA 3MRCA 5SX5H 1SEQL 1FG9C 3DETC 1SYVA 2P8LB 4NN7C 2IH3B 2Q1EA 4KK9D 1E27A 2FEEL 5IB2B 5D9SA 4MS8D 5ESQA 4K3GA 4FZ8L 3QDMB 4IMLB 3LKQA 3SKMA 3SO3C 3HZVB 1FVDB 3IDIA 2VSCA 3GM8A 1EFXA 1XH3A 4ONHB 1JI1A 3R8QA 2CH8A 4CVXA 3G04A 3ZYIA 3MSPA 1IJ9A 5D2NA 3HNTL 4R7DB 1F8TH 1S7RA 4N0CC 3K74B 2YUXA 3P0GB 1H3XA 2JJUA 1J1XL 5E2WH 1TZHA 2FBOJ 3LHPH 2UYLB 4M6AA 4CMHC 2KZWA 3DMMB 3BO8A 1BECA 1KN2H 2WIIB 4HS8L 1MJUL 1AKJA 4J23A 1TJGH 4PY8I 3QXAA 3SQOL 4JFZL 5IV2B 2OSLA 2APBA 3O9WB 4LDEB 4XVUC 1J5OH 3DNKA 1CZ8H 5DK2B 4G43A 4LCWD 1FNHA 1Z5LA 1MWAL 4IIQB 2XZQH 5L6YL 5DHVA 1NFDB 2EH7H 2WP3O 3QWOB 3UJTL 2OS7A 1G7QA 2R29H 3TN0A 1UZ6F 1ZWIB 5GHWL 1RZKL 4X7SL 1I1CA 3LQZB 1IZKA 3HR5A 4Y5VA 1CG9B 4P57B 5E56A 4I0CC 4OQTA 2VWEC 2VDPH 2NY3B 4R0LC 4G42B 2GK0A 2I07B 4QT5B 4YDVA 3ZT7A 4DN3L 1IAIM 3B2UD 4Z7WA 1TJHH 1WZ1L 3BZFA 1A14L 4GBXB 4KRPB 3V8OA 5IFHL 3X3GH 1AP2B 4MSWB 4NN6C 4O2FA 3EYVA 3J7HA 4I18B 4R6UA 3ARTA 2DQCH 5HY9A 5TE4L 4MJ5B 2YUZA 3MA9L 1PQZB 2MHAB 1P84K 1VENA 4ESKA 3WJJC 3BH8B 3OTTA 3T4YA 4OF0A 5ETUB 1Q38A 4Z0XB 4PR5A 4PJAA 3GDBA 1OAKL 2ZCKH 4EKXA 3PP3H 3MNWB 1B0WA 3U82B 2R2CA 2ZCLH 3LQAC 4JFXB 3D39E 5I2IA 4FQCL 2BFVH 3HA0A 2FH6A 1BBJA 4J3WA 5GS0D 3TT3L 4TSCH 3IJHB 2OMNA 1RFDL 4QOKA 5HHPA 4PJ7B 2DICA 3ZHKA 1RUKL 4XWGL 3BMVA 3IJSB 3PWPE 4PJXA 4JG0L 1HHGB 5D7LA 5CGYC 1VACB 1S3KH 2FJGA 1KB9K 5CSGA 1GH7A 3SQOH 1JHTA 3NCJL 2D7QA 4UIMA 5F9OH 5IB3A 1MFDH 1JBJA 5C0RL 1CLYL 5LGKA 1G7LB 3NFNA 2AEPL 4Y1AE 4LRNL 1K2DA 3S3JA 3MRKB 3VDAA 2NY1D 3I50L 3V52H 1H3GA 1KGCD 5HHXL 3NFPA 5JQ6H 2MKLC 5HYFA 3UXFA 5JORA 1WBZB 4L8CA 4M4RA 4PGDA 4DUVA 3MV9E 1MHEB 4Z8FL 4ZXBD 1MH5B 3PABA 5FYJH 4YPJA 5GHWH 4YHKH 4OSUL 3V2AR 1CR9H 4P46D 3WCYA 3FZUD 5KAQF 2DQEL 3PGDA 2IANA 3G5VA 1DBBH 4FTVB 3Q3GA 2MPAL 3O2DA 5CJQH 5I1JL 1J0JA 4TNWK 5EORH 2BNUB 3W5NA 4JM2F 2ICEB 5C0CA 3HAEB 4AL8L 4RSVA 1WZ1H 1T89A 5KOMC 4EDXA 3SDAD 3MV7D 4XMLH 5GGSY 2IH1A 2BJML 1ZHKB 4LVEA 5J1SC 1KXVC 2Y06L 2IMNA 2Q86A 3MA9H 4CMMA 3KNBB 4KGLA 2FR4A 2DD8L 3ZSSA 3BESR 3MNZB 4JREC 4ONGL 3S96A 3UBXI 1K5NA 4ZUVA 3MPCA 1GHFL 4UOJA 3OKOA 3I84A 1JTOA 5A2FA 2Q3ZA 4HS6A 3VWKB 1NC4A 4E0RA 2BRRH 1EVUA 1F4XL 1P4BL 4PJ8A 3U9PL 1G84A 2V7HB 1EH9A 4L3ED 1KELH 4PJIB 3KLDA 1LK2B 1U8IB 4XWGH 1QBAA 4NFBA 1RK1B 4S0SD 2QJDA 4BQBA 3EOBB 4BH7A 1J1OH 2BX5A 1H5BA 4PJHF 3S36H 4HIIA 2HG5A 3BW9B 3ZZ1A 1OOAA 5DEGA 5DQ9A 1S5IL 3QEQA 4UINL 3SGDI 1N5AA 4JFFB 3LS4L 3VH8A 3NCJH 5AZ2H 2EZ0C 2VR4A 1I3GL 2B2XH 2A6JB 4OM1L 5F7EL 5LWYH 1P53A 3UX9B 1HH6B 3AS1A 3HG1D 4XC1L 2HVJB 5C2BL 1F3RB 4PRAA 4HXAH 1I1AC 2JB6B 3QO0B 1BFTA 2CLZA 5FDYA 3I9GH 5J3HC 3WXWH 4OGAC 4KTDH 4P5TA 3UBXB 3I6LE 2RCSL 4HIEA 4CVZA 1FFOA 3W0WB 4F2MB 2XTLA 4XBPA 3GSWB 2DQEH 4P2OD 4M00A 2E7LC 4OLEA 4HAFA 1W8OA 2PTUA 1U8JA 3NCMA 4MAYD 1ZTXH 4G8IA 4RAHA 5I1JH 1FV1A 3HC4L 3KS0J 5HDBF 1NKRA 1BF8A 3N06B 3Q6FA 4KQ4H 4X9BA 2W1NA 2H6PA 5HYSA 4K7PY 1D5MB 1JF5A 4XB7A 1C5BH 2YZ1A 4AIZA 3QIUA 4AT6B 4OLZL 3CVHH 5HJ3A 3RWDB 3RL2A 3P4OA 2VN7A 5CS7A 4YHLH 5ELIA 4RAVA 2Y07L 3PV6A 5ICXA 4HKZB 2NCMA 4KJQD 3TNNA 3I6KA 1BLNA 2DD8H 2Z91A 1A9EA 4XPHL 1JK8B 5H8DA 3FB6A 4XXCA 3GMMA 3MO1A 3P3YA 1LO4H 2BNQB 5MERA 1T1XA 3GSUB 5MEPA 5C09A 2YRLA 3L3GB 3OKEB 1QSFE 2A0LC 3U9PH 4E5XB 1JTTA 3NBNA 5ACMA 3F7PC 3PHOB 4QRTB 3I3EA 5ISZB 4JY5L 3QDAA 3U0PA 5F93C 1XGPB 15C8H 3X11A 4NQDA 3TBWA 3DV6B 4XNQA 5I1LA 5ALBL 4BA8A 4QRUB 1H15B 5J11C 5DXWA 1YNLH 2E7HA 3MBED 3QFDB 5ESAB 3QG6A 4I3SH 2J5LB 4TTGA 1IGFL 2NR6C 4P2RD 1RUMH 5FK9B 4MXVE 4P99A 3BI9X 5E2JA 4L4TA 4KTYA 4LMQE 2ZG1A 4FQ1L 5EO1B 1CGYA 5T1DH 3MJ7B 4LNRA 2FHFA 2IGFH 5DJYA 5KVGH 1HQ4A 4IDJL 5IWLC 5C0IB 3HR6A 1AHWB 4PLKD 4QRSA 5F7MC 2GJZB 3HMXA 2JELL 1N4XH 1P1ZA 4RNRB 4PJDA 4ELMF 2ADJB 4YDIH 4U31A 3HC4H 4QHMA 1F4HA 4XCNB 3QDGE 4Y16D 4HUKB 3C9NB 1FQ9C 1YQ2A 4JE4B 4QXUL 1S5HA 1G6VK 2YPLD 4UTAL 4IBLT 3O3DB 1MCWW 2EDEA 1F5WA 3D85D 3IFOA 4JHWL 4F7EB 2BHZA 3W9EB 4DTGL 2Y07H 5T3ZE 3UYRH 4XAKE 3SKNA 3WFDL 2G5BB 1CDYA 1ZLVK 3BE1L 5IW1B 5GRZA 4PJBF 4YC2B 2IQ9L 3OB0K 2YA0A 3WFHA 2F5AL 3EHBD 3SPVA 1WTGT 4ETYA 1FVCA 1BIIA 1T66D 1RK0B 1T21A 4WV1B 5JPNA 1Z6JT 4A6YL 5JOFA 3RI5F 3WIHA 1HHIA 3BUYB 4OKDA 2DQIL 3VFNB 4JY5H 3IFPB 3S34H 3HE6D 2DI9A 3JSSA 4XXDB 5HVGB 1OT2A 3LN4A 4KI5D 4DKDC 2HT2D 4BUHA 1ITCA 4N1CA 2B5IC 2DYPD 3DV4B 2EDQA 4IRSB 2B4CH 3FB8A 3W82A 2H26B 3EOAB 3PWVB 4LLMB 4QCIB 2V2WB 2XYCA 4PY8J 5L9DL 1I7RA 1IAKA 1GIGL 4P5MA 2Z31D 5BRZD 2ZUUA 3U30B 4ODVH 5B8CB 5IMOB 5TH2B 2V9RA 5F7YC 4D3CL 1I8KA 1KLGA 1XGYL 1F11A 1ITBB 2HRLA 2A74B 2ESVE 3AY4A 4L9LA 4XHQA 4F8TA 1CBVH 4PD4K 3BH9A 3VXRA 4FP8H 3HFML 3QFJA 2R2BA 1NL0H 3MOAL 4LCYA 5ICZA 1A5FL 3D3VB 5KSAA 4ODHL 1NPUA 1MHPL 3A6OA 1F3DJ 1IGYB 5FM4A 3TIEA 2QR0B 2C5DC 1JPTH 4J12A 1EFXD 2CIKB 3QO1A 1C16A 1NBYA 4PJIF 1QRNE 3V6FB 3CDFA 4FQXC 5IJKC 4U7SA 1HSBA 4Z9KB 3BIAX 1D6EB 3CFIC 3P2TA 4QXUH 2CRIA 4X6DB 1XF5A 4UTAH 4KXZI 5J6GA 3VH8G 4M8QA 4JHWH 4FXGB 5JOEA 4KV5E 4GRLC 4FNLL 5I8CA 5ICYB 5BV7C 2XV6B 4QHNA 4NM8H 2ICWB 1MCFA 5DQDL 1N7ML 1AKJD 3WNOA 1VEOA 1PDKA 1U8OB 1MCHA 4X7DC 1YN6A 2OJEB 3LKPA 3TH4T 2B1AL 5KSBB 2QQQA 2VKXA 1V7MH 1VFMA 5HHOA 1QFUL 5GJTL 4A6YH 5GGTL 4F7MA 1I9JL 1H8NA 1PZ5B 2DQIH 2JCCF 2Y1VA 1BGXH 4YGVB 2P5EA 4OZGA 5D2LA 1M4KA 4PBVC 3TN0D 3C6LC 4JZNB 1LO0L 3TCLA 5E8PB 3VCLA 2EO1A 5JHDA 3DI3B 1PAMA 5HYSG 2AK4B 2GJ6A 5L9DH 1FYTB 3QCVL 4NFDA 2D7OA 5DWUH 2BERA 2I27N 4GKNA 1E4XH 2VL5A 4D9RE 4PJFA 1QEWA 1EAJA 3I6GA 5KS9F 1D9KA 3HTLX 5T3XL 1G6RB 2HVKA 4NWUL 5ID1A 1X5JA 5FM8A 2PO6C 4ZO8A 4NT6B 3MC0A 3QEUB 5CD5C 1FZKB 1A7QH 4DKFH 3STZB 4O51B 1G0XA 3FQXB 2VAAA 4MQSB 3HFMH 3SE4A 3FN0H 4NQEA 5F3BA 4KUZL 4KKLC 1A5FH 5EIVA 1UXWA 5FDWB 4FRWA 1OQOA 1C1EH 3MNVA 3DX9B 1JN6B 3MUHL 2YSSB 3CIQA 3ILQD 4UV7H 3MLPA 2DS4A 3FT3A 1WBYB 5DDHB 5H35B 3ZE1F 4MJIB 3P9LA 4R2GB 1YUHA 3CFCL 4QOKD 1Q1JL 3MJ9H 1PBYA 2X2YA 3KYAA 5CLTA 4WUUB 3MLUL 2BY1A 4J4PC 3O4LA 1OPGH 3CMOL 1FNSL 1T3FA 4QWWC 4RGNE 1U8MA 5D7LD 3FT2A 4PRPB 1TQCB 3LKRB 4NHUB 3AB0C 1DVFB 3DXAA 3G5ZA 4FXKA 4P23A 1MHHB 1FFRA 2X89A 2NY2D 3HPLA 1WCQA 2H1PL 1T0PB 4HFUH 4OZHB 3O41A 2VLRE 3IU4H 4BZ2H 2BCKA 3L3HB 3RUGF 2VLJA 3K0WA 3MV11 5GGTH 5ITFB 2JIXA 1F00I 3FAWA 4Y4FB 5DF0A 5J1AB 1N59B 2DQUL 1ZT1A 5J57B 1MJJB 5MENA 5IVXE 4WHYH 4QNPF 2V2TB 1UGNA 1F6AB 5E6IC 1G1YA 3SDCC 5GGQL 1KTRL 2OCFD 5IEKB 4PJEE 2LTQB 3ZE2F 3MRHA 3WO4B 1MCDA 1JZ2A 4OZFA 1YMMA 2FCBA 1ZT7B 3QAZC 1E6OH 2IAND 5EU6E 3RGHA 4Z7WF 1QRND 2CR3A 1HOCB 3GK8L 3QQ3B 1Z0NA 3VFOB 5C0DB 4OUUA 2ATPA 2VB5A 2B1HH 3GSRB 5C0CD 4HKJB 4WIQA 5I8OL 5AZEL 4F57H 2OTPA 4L1HA 1BVKB 1AGDA 3BWAA 3G08A 4KWUA 4KZEL 3O6LL 1F90H 3D69A 4PY7A 4NJAH 3TT1L 3DO7B 2XKNA 3DIFA 3O2VH 5HDOA 4WHDA 4D0CB 4KUZH 5BQ7A 3EJZD 4L4VA 4PGCA 4O5LH 1LE9B 2I24N 3VG9B 4BQ9A 2CJUH 3ZDZF 1OGTA 1O0VA 3KPLA 1QBLL 2B0SL 1NC4D 3ZSTA 3T0WA 3WNLA 1CGTA 1NCUA 2DQHH 4PJ8D 1T0MA 1Q1JH 1BD2E 2O5YH 3KS0H 3VXUA 1YY8A 1U3HB 2ITCA 4HF5L 1M05B 3ORJA 5I16B 1RZJL 1MFEH 4MCYA 4ZS7L 3TVMB 1JNNL 4JQVC 5D8JH 1AO7A 4YX2H 1L6ZA 2K9UA 3QEQD 5L2JB 1GZQB 5LG1A 3TA3C 1CICA 4LP4A 2VZSA 1FGNL 5JUEL 1KENH 3SEPA 1FH5H 1IBGL 1X5FA 4ZUUA 2CDEA 4NOFA 4PJ5A 4WO4C 2I60L 5HPOA 3WIFB 1NFIA 2BHYA 1EEYB 1GC1H 4XP4L 4LSQL 4R4FL 4YXHL 2EXWC 5BMFH 5FHAL 1ETZA 5EG6C 4QF1A 1A7RH 5DO2C 2GY5A 4P5TD 2AK1H 1TENA 3GIZH 4XC3L 5ACZA 5GGQH 2QSCL 3C08H 4RRPG 1LP9B 2PYEE 4LU5L 1T83C 1U2CA 4XPBH 2CDGB 2DWEA 4PUBL 1NDMB 3JWDL 4G80A 3OB8A 4R3SB 2MQ3A 1HEZB 3LOWA 1DQTA 4DGYL 3AXLB 1XGTA 2E3VA 5I8OH 1ED3A 3RVUC 5AZEH 4JKPL 2GSIA 2X4SB 3QIUD 1QZ1A 4MQXD 5E5RB 5GRVL 4JKKA 2PCPA 3MQIA 3H6JA 3TT1H 2C1OB 3VFVB 4UAOC 3P11L 2DQJH 1P2CA 1HHHA 1DE4B 2QADD 1ZVSB 3N85L 1VEPA 3JV6A 1QD0A 1A9BB 1VFBB 4G9FB 1JMXA 4M5ZL 5GS1A 1A3LL 4D0BA 5J9PA 3WLBA 3KPSE 3RIFF 5B3JF 3U6RB 4HX1B 1RHFA 4CW1A 3TBYB 2Q76B 1A7BA 1EGJA 3A6BL 5FXCH 3VI4E 1RZFL 1MCLA 5C09D 4W4OA 3WD5H 1UT9A 2R1XB 1NCBH 2FWOA 4Y8AA 3HB3C 2DQDL 3DROA 3D0LB 1BJ1J 1JPSL 4X9GA 1VGEH 1HZHH 4QHKI 1LEGA 1TVHA 4DFIA 2OTWA 4NQDD 5F7DB 3OXRA 3MCLH 4JQIL 3KHOA 4FQPA 3RA7L 3K8MA 3CFBB 3PHSA 4JFQB 3ZTJG 4L8BB 3MREA 1ONQB 2WQRA 1S9XB 1MLBA 5EZLA 4EUPA 4I48B 3U2SA 2XZCL 3S88L 5DFVC 1KCUH 2FJHA 3T3PF 3MCG1 4L4TD 2X44D 4LSQH 2IG2L 5FKPB 1WZKA 1R0AH 2F8XC 1S9VB 4RISH 4J3TA 3C8HA 3TC9A 5LGJA 5I1GL 4LSTH 1U92A 1RZIA 2PW1B 2EC9T 3VXME 3C60B 4ODUA 3BP5A 3RKPA 3EO9H 1WIPA 4YFDB 3CH1A 1AE6L 5D96B 1LEKB 4MQ7A 3RZCA 4LU5H 5BO1H 3FOLB 3V5HB 3X12B 1U0QA 4X6EB 3G5YB 1NEUA 4QTHB 2GIYA 1AR2A 2ICWJ 3MRMB 4MD4B 3STLB 3KPOA 3JWDH 4OD3L 1Q8MA 3RNQB 5IHUL 4V2BA 3DRTA 5DVKA 4DGYH 1VFAB 3IDXH 4Z5RA 1JGDA 1S7SB 3C8KB 4X7EC 2G9HA 5F7LB 1NAMB 2BVOB 4YHZL 4UB0L 2ZG3A 1CWVA 3QNYB 3RDTA 1MF2H 1D5XB 4MNQE 3WHXB 4J7RA 1DTUA 3TF7C 4LVOC 1SY6L 5EN2B 3GSNH 4CBPA 3VFTB 1VEMA 1KPRA 2NZ9C 3N85H 4JY6A 1RJZA 1EK3A 5CEYB 5KZCB 1S7VA 5BS0E 4OZFG 1JGUL 1M71A 1F3DH 4N1HB 4NCDA 4YHPA 4L8DB 1E4KC 3OV6A 2E27L 1FYHB 1JF6A 1U3ZA 2DB8A 2GITA 3F7VB 4V2CB 1F4WH 1DUYB 3SOBL 3HC0B 1IKNC 3MLSL 1ZLUH 2X09A 2VQUA 2VLKE 4LCWB 3RA7H 1B0GA 4YXKH 5IK3B 1CCZA 2CIIB 5I9QB 1DL7H 4S2SB 2NY6D 1HKLL 4X7TB 3OWEA 4LQFL 2XZCH 2D2OA 4K23L 3RKDC 4A2LA 3D18A 4B41A 3S88H 1KT2A 4RIRB 3V5DB 3DTXB 3UPRB 2F58L 3HCVB 4S1DC 1Q9KA 3C2AL 5F8QC 4LARL 4I2XB 3FTGA 2R0LL 2AJUH 3GJEB 3WFBH 3VXRD 5MP6H 3QFJD 2YEZA 4RGMB 1JFQH 3PXHA 2ZSVA 3F7YA 1OF2B 2FNBA 3KPQB 5KSAD 1MFAH 5EC2B 4X5LA 5C86A 2P44B 1ZOXA 2W38A 3HAEH 4O2CB 3KJ4C 1HXYA 3QUYC 2D7PA 3KLHD 2FZ3A 3VDCA 4YDJB 3UZVB 1RMFH 4YHYC 4P48A 3MRJB 2XQYG 3K80A 3DX7A 3V0AC 1XCTB 2IADA 4U3HA 2B4CC 5DZLA 1P9MC 2VUYA 2QKIB 3WS3A 3BYTA 5BVJB 1Y6KR 3MJ8B 4GG8A 5AAWA 4FMFA 1FL5B 2FBJH 1UVQB 1OGAA 1INEL 4HH9A 4UNVA 5FHBH 1AY1L 4CN1A 1X5GA 4M7ZC 4ZFOA 2QHLA 4K9EL 1F4YH 1AQKL 1JUFA 4OLYL 4LHJB 4LHUB 1ZHLA 3G6AA 1MEXH 2YWYA 5E70A 2BHUA 4LRIC 5KVEH 3ZKQD 3VU2A 2EH8H 4LLDA 4X98A 4UILH 4PRIA 3O3EB 1RURL 2X4PA 3GSVB 4WFEE 4WI5A 5HHQA 3JZ7A 1L7TL 5HHOD 5C0ND 2WNGA 1FN4B 4CVUA 2CLVB 3QA3B 1UKQA 3UYOD 3RNKB 1EJOL 1UM4L 4PGBB 2L0DA 2P5ED 1R3KB 5EO9A 2FLBT 2HAZA 5GRJH 5D5MA 5D70L 3D9AL 3C09C 5JHDD 3ULUD 3V0VB 5C0BA 1FBIL 3HUJF 1A4KA 2GJ6D 3V6BR 5DRZB 2NY1B 3MV8A 1T6WA 4OF3A 1KG0A 4NHCL 4YO0A 1RIUH 3QUKB 4AMKL 2XWBB 2PW2A 1NLBL 1D9KD 4RMUA 2BSRB 2WP3T 4ZXBB 4KUCD 1VKXA 5IP4A 3RBGA 4GMSH 4HC1L 2ADFL 1OY3B 4P46B 1T2QH 5ANME 5IM7A 2F58H 1UYWL 4F3FA 1J10A 4LARH 4AQOA 5JO5A 2V9TA 2X4QA 2H3NB 2H45A 2R0LH 5DSCA 4WU5B 1PKQE 3KGRA 5H2BB 5A2JH 2NY0B 2XKSA 4NQED 4NGHL 1T5WA 4OT1H 4KVNL 5A3ID 3V7AG 1CGXA 1WFOA 3MV7B 4LCCB 3KYOA 1E0OB 1OAUH 3LD8C 4NZTL 3LMJH 3E8UL 4BFEA 4JDTL 4ERSL 2Q20A 5I66B 1I9RH 5J0BA 3BFOA 1S7WA 3IU3B 4KROC 1DSFH 3O4LD 5EBMB 2XICA 2H9GB 3RGVD 2IALA 2M26A 2XFXA 1EXUA 4K9EH 5FKAA 2GQHA 2OXGA 3DXAD 5FYKL 2YD9A 3NA9L 2D03H 1YJDH 1Z9LA 4P23D 1EMTH 4L3EB 2A38A 1UKSA 3ZL4H 2X89D 5E8NA 3U79A 5DQJB 3WIIL 3BKMH 5EPMB 2FB4H 3U0WH 1CE6B 4C83B 4MLIA 4ETQA 3FRPG 2VDNH 4H1LB 4FQQB 1SYSA 5CCKL 2VLJD 2GI7A 3G6JF 2JIXD 2ZUQB 2V2XA 4JGJA 4ZS6D 1OP3H 3M1BA 3IAGC 4LFHG 1KCRL 5MEND 3EFFA 3RWGB 3VMNA 3D9AH 5IMKB 1QYGL 1EHXA 1A1MB 3BPLB 1A3RH 1FBIH 1YMMD 4PJFF 4PRDA 1RIHL 4ZDHA 3HLAA 4HUVA 5IR1B 4C56E 3SGJC 4JO2L 3EDDA 4RBPH 3HG1B 3QHFH 4NHCH 3U7YH 5CP3A 3WJJA 32C2B 3QJFA 4JRXA 3CPLB 1IT9L 4OCRL 2YMXL 3IDGB 3M17A 3VMPA 4GG6E 3EJJX 4HC1H 5DD5L 1XEDA 4EIGB 2ADFH 1S9YB 5E2TL 4GMTL 4UMGA 5D71H 5D1QC 5AYUL 3V6ZB 4P2OB 4XZUB 5LKNA 5MEQA 4PGJA 2XIDA 1WEJL 3ETBF 2A83B 5IB5B 5L2KA 4MAYB 4FFZH 4N5ED 3O3BB 1I7UA 1KJMB 4M6OL 4I77H 2HT4D 2AJXL 3D48R 1CFQA 4L4VD 3KPPB 4NYLA 1KACB 4OCYH 3KDMA 3PWPB 8FABA 4ODSL 2W0FB 3T65A 1UCTA 2W65B 2QQNH 1QACA 3ZLQC 4NZTH 1QFHA 4ZFZB 5CZKA 4XPAL 3WNMA 1NMAL 2YN3A 3MRIA 2GUOB 4JDTH 2ZZUT 1Y18A 5AUMB 1SBSL 2QEJA 3VXUD 3WHE0 4E42B 4G8GA 5DJ0A 2IAMB 3GO1L 4S1RH 4OZ4B 3F65A 3VFMB 4NZJA 4XNZC 3O3AB 3VI3F 4U1SB 1MPAH 5IB1B 5C0EA 2DKUA 1AO7D 2R2HB 2W92A 4RX4A 5GSRA 4APQC 3L3KB 1CICD 1DDHA 1CL7H 4EJ1C 1M7DB 4PJ5D 3VFRA 1I3UA 4F7TB 4HWEL 5EZOL 4P3DA 1VGKA 5CCKH 1HNFA 2KBGA 3T1FA 5EOTB 2HN7B 4JFEE 3NGBB 3VW3L 2G5RA 2XQBL 3OKLA 4EZMA 2NY5H 3DURB 5IEHA 2OLDA 4QLRA 3MBEB 4QHKJ 4URTB 3OPZL 1EUTA 1UJ3B 2NW2B 5TPWL 4JM2C 1PZUB 4NNYA 1TZGL 1U95B 3DX8B 3IETB 5DMKA 5SWQA 1G6RL 3BIBX 3LH2L 3CSGA 2IPKB 2X1QA 4S1QH 3MYZA 1ZA6B 1X44A 3VFWA 4F9PA 1IT9H 1I3RB 4OQ1A 1K4CA