3TN0C

Structure of mouse va14vb8.2nkt tcr-mouse cd1d-a-c-galactosylceramide complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
205
structure length
203
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title NKT TCR Recognition of CD1d-{alpha}-C-Galactosylceramide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 34
structure length 203
sequence length 205
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0C02
4HT1H 4PP1C 4KJWC 1MJUL 4Z7VB 1H8SA 2CLRB 1SYSA 2G75A 5FCUH 1KYOK 4RWYH 3VRIB 4UU9A 3D39B 1MVUA 5FV1L 1EAPA 1MPAH 3OKOB 1XGPB 2BVQB 2LFGA 1S7QA 5E4EC 1EEUA 4P2OB 4ODXA 5GGQH 4XP9L 3FB7A 5H2BA 1A1MA 1DFBH 4XNMB 1NFKA 4XMPH 4GAFB 1AD9A 3QDMD 1FLTX 4P23C 1HEZB 2I25N 3REWB 4LPXA 1PW3A 1DDHB 3QCTH 5DQJA 4BKLB 4L8SC 2Q87A 1I7RB 2PTUA 3B9VA 3RGVA 1FYTA 4X98B 3JTTA 2F15A 4X83A 2FEEI 3KJ6L 4FQJL 5LWYH 3MCLL 1CDBA 1JJUA 4BK5A 5E08L 3H3BC 4ZUSB 1QOKA 5JHDE 3GBNL 4XBEH 3L6FA 2NXZB 1W2KT 1PSKH 4YXLH 4YHNA 3RIFF 4MQXC 2IH1B 3TESA 4WFEE 1NKRA 2HVJB 4BQ8A 1B0RB 1FV1A 2Y6SD 5FDWB 1QLRB 1P84J 4HIJB 3M17A 4TOYH 2YPKB 5FM4A 2HLAB 3QEHB 5H35B 1A3LH 4HFWB 4UDTA 1OCWL 5J1TC 1TTGA 1P9MA 3KWWA 4BSWA 2BRRH 3IDXH 5F96L 3QPQC 3K1KC 4F15B 1S3KL 1LE9B 2WQ8A 4BQBA 4GKNA 1EERB 4X5WA 1S9KC 5MEQA 4O58L 4RGMC 4JFDB 4I48B 3F6LA 4JDVA 2BVEA 2ZJSH 5JR1H 3D85B 2DRUA 4L9DA 5HSFA 2CUIA 4DVRL 2R0WL 1RD6A 2IAMB 4JANB 4QWWC 4BSVA 3NZHL 3NPSC 4JLRB 5FEBA 4L4VB 4MQ7A 3VXNB 3NCJL 2VLJB 2VSCA 2RQ8A 3MLSL 1F4AA 4PJ5D 1S7UA 2PYEA 4YGVA 1ULVA 5DMGC 3QG6A 3WN5A 1CVSC 4XBGA 1S7VA 3VFPB 3VG0H 2WBKA 4JZJB 2V7HA 5IT2L 3P73B 1DBML 2YD4A 3RX8A 3D0VA 5HJ3B 1XF4B 1WV7T 3EYUL 1BREA 3A67L 1TCRB 1FAKT 3ARBB 4DK3A 1W72L 2ARWA 2BFVL 5F93C 4D0CB 3N50A 2QQKH 4U1SA 4NPYB 2IQ9H 2DLIA 1HKLL 5CEZH 2IADA 1RUAH 2AK1H 1AQDA 5HHOA 4AK1A 1YEJL 4OZFH 5FHBL 3W2DH 4PJ8A 3MLWL 3VI3F 2I60L 2ARJB 4LGSB 2VZ3A 3CH1B 1I7UA 1QHPA 1CICB 3GMPB 1C7TA 3MV01 1MCPH 2P1YA 2WSKA 5F7FA 1GOHA 3FJTA 2APBA 2NR6C 1I8KA 3K3QA 4KJPD 1MHHB 5IVXB 1LP9A 3S98A 4UQ3B 5E7FA 2COQA 2VDLH 3ZKNC 3OB8A 2EDWA 3WE6B 4P5MA 3FFCA 5E8DL 2BK8A 5DJXA 1S9VA 3QEQB 1QVOB 2CUMA 4C58B 3R1GH 1FCCA 3GSWB 1NEZG 3ARPA 3BKCH 3MBEB 5E5MB 5AZ2L 1XF5B 2O5XL 3T08A 3FAWA 3TO4C 1LK3L 3U46A 3IS1X 5KSBE 1NBZA 1EEZB 5E8EA 5IMMA 2VIRA 5DJ8A 2D4DA 4NO3A 4L3EA 4X4YA 4U1JA 3VI4F 2BY0A 2WUCL 4KDTA 5E70A 4B7IA 5H37H 1QEWB 2GUOA 2QL1A 5CJQH 5JUEH 2W9DL 3FB6A 1REIA 5SWQB 1CFVL 1A4KB 2ZP0T 1DEEA 3PWVA 4L8CA 1YC7A 2NXYB 3IXTA 3MRIB 3GHEH 1IARB 1FZMA 4YFLI 1KFAL 4JDZA 1UQSA 1YNKH 5DZNA 4PYGA 4YHOL 4DQOL 1JGUH 3ARFB 3O4OB 3RUGE 3QNYA 4BFEA 5L7XH 4AJ0A 2BNQD 1AGFA 1MH5B 3BPCB 1H5BC 2E9JA 3CPLB 3PABB 4H1LB 4PTUA 5KSUA 3HPLB 2OJZH 3EO9L 2OL3B 1QLFA 3MBXL 4ETQA 4XC1H 5FYKD 3OPZL 4OZIB 5BV7C 4YHML 2YBRA 3VXME 5LGJB 3S96A 1WBYB 2DIBA 2B4CC 5DD5H 5C07B 1CDYA 3ZKMD 4NWTH 3OZ9H 4OJFL 2CPCA 1HHHA 4XXCC 3UMTA 1RVFH 25C8H 5LXGL 5D7LB 4L3AA 1NFDA 2VDMH 2FLBT 1YNLH 3K8MA 1QSEB 4UINL 4MD5B 3VGGA 2EDQA 2WM0A 4EXPX 4F33B 1ZV5A 2ATKB 4HT1L 4YHYB 5BRZB 2DS4A 4LVHB 4RAHA 3UBXI 1WCBB 4XCCH 1UADC 5FCUL 4IDJL 1NC4D 1ORSB 4HLJA 3WLWD 1G7IA 1V8HA 5ANMB 1XIWB 3VU2A 5J3HD 3AAZB 3C60D 2EICA 1S7SB 5GRXG 2EDBA 4J3SA 1NCDH 3K46A 2FDBP 3O8XD 3BP7B 5GGQL 3P0YH 5IKCA 3RVWC 4Y1AB 1QZ1A 4XMPL 1OAXH 5JDJA 4MMZC 3NAAH 5HDOA 2V2WB 5EU7E 3DBXB 4D0DB 4R9HA 3BEVA 3O11A 1TQCB 1U0QA 3QCTL 3I3BA 4ZNEE 2FBOJ 2OSLA 4Q6IC 3MRCB 4HH8A 2DM2A 3MNZA 4MWFB 1Z9LA 1VACA 3GDBA 4Z7UF 4NQXA 3RHWF 3QDGE 2D7PA 3TGXA 5DQDH 4J6RH 1G7QA 4NCC1 3MRBB 3L5WA 4ZFZB 4ZPTA 5IFJA 3IU4H 4GOSA 5DJZA 4U0QB 1OT1A 5EO9B 4LNVA 3U0WH 1T7WA 5ADOH 4XBEL 3O3DB 5I8KL 1OQXA 2UWEF 1FZKB 3QULA 2EDEA 3VXUD 4PRPB 3BE1L 4X0KA 1AXSB 2X4NB 5IB1A 3CZFB 4TOYL 3ES6B 4JO1H 4JB9H 3B2VH 1A3LL 1T7XA 4HMEA 3HRPA 1U8OA 2CUHA 5C6PB 2BRRL 1UWXH 3IDXL 5C09E 2ADJB 4NZUL 3D2UD 3BP6B 3RIAF 3ZT7A 5ESAA 4FQIH 4JJ5A 3FHQA 5CIPA 2KH2B 3CFDA 1CDGA 3TZVA 3VXOA 2ZJSL 5JR1L 1EFXB 1NANI 1R3KB 5B39B 1AXTL 1ZVSB 2V7NA 4JY6B 3V0AC 2H32A 4EQ3A 1EXUB 1YPZF 1BMGA 4PRNA 4GS7C 4NQVA 4RMTA 1FL5B 2IPKB 2CIKA 3ARDB 4R3SA 5F7UA 4WI2A 2VLRE 4OF3A 5I71B 4HWNA 5D6DA 2UZXB 3VG0L 1FCGA 1KLUB 3RI5K 1OAZH 2DYPD 3JV4A 3TT1H 4KKAC 4QRTA 3CFBB 1DBKH 1TTUA 1PKQE 5EUOF 4JFYB 3B6SB 3X11A 1JNJA 2QQKL 4HKXA 2NY7H 3O41A 1KELL 4PJIB 4UNTA 2ATPA 5EIQA 5CEZL 1RUAL 3IFLL 5LCVL 2AK1L 3OB0K 4OI8A 3IDJA 4HC1L 3W2DL 3BZFB 1HXMB 1J88A 3L9RB 3WO4B 4NQDE 1NGXA 3ZT5A 5GHWH 3UTQA 3GM8A 1XF3A 4OIIH 3W9EB 4IIQC 1QPPA 2APWA 2WIIA 2BCKB 2EC9T 1NUGA 1MCPL 2OQJA 1EFQA 5K9OA 2BNUA 1BD2A 3UEZA 1NSNL 4LOUC 3LKOB 4C56D 5ID0B 4ZO7A 1BIHA 4JO2H 5JTWA 2GT9B 1JYXA 1JI1A 1KENL 5ISZB 5DXWA 1HKFA 3NCMA 2BHZA 3DX9A 4D9LH 5GZNC 3O6FC 3ARYA 1MFAH 1RAMA 1BECA 4MS8D 3KPSA 5IM7A 1KLGB 1P7QA 2XRAH 4YHPA 3P4NB 3V4PH 1NBVH 4D0BA 2HT4C 4WDIA 1A6UL 2GAZA 4MHHI 4Y5VA 5F3BB 4PRDA 1QSZA 1I85C 3BSZH 3IFOB 5IB2B 2DLHA 3RWCA 5DRNA 5CJQL 3BI9X 5JUEL 1CD8A 2AXJA 2YA0A 3PWPB 4RFOH 2NY5C 2FR4B 4Q97A 2H41A 2AJSH 3ARZA 5HGAB 4WGWB 3S8WA 4N68A 1YNKL 2A83B 4O02H 1JGUL 4P57B 4ONHB 5I74C 1KACB 3LPFA 2XKSA 1FZJB 5L7XL 4EDXB 1ONQB 4E0RA 2BNRA 1HILB 2NW3B 4QOKD 2QADB 5J1AB 2R15A 2AJZA 3NCCB 3HZMB 4GRWE 4NRYB 4BZYA 2FIKB 4X5XA 5DMKA 2ICWA 5JMOC 3KPMB 2LU3A 3P77B 5F9DC 3TYFB 5KAQG 4M1DH 4NWTL 3OZ9L 1MI5D 3WDHA 3WIHA 1LO4H 4LPVA 2HJFB 4P3WA 4YK4B 5DDHB 4PRBB 2A6JB 1FP5A 3VMOA 1RVFL 4R90H 25C8L 4E42A 1EUTA 2VDML 3IGAB 4TNWK 4ZOCA 5T1KD 1YNLL 4GW5B 4N0UE 4L8BA 2NY2D 4HWBA 5IIEB 2BVYA 4YUEH 1WJ3A 4WTZA 3VFSB 3HE7B 4QTHA 1B3JA 4JO3L 3TCXA 1WT5A 2D7OA 2XKNB 3BXNB 1AGCB 1P4LB 1RU9L 3ULSA 3LQAC 1X5KA 1CFNB 4HFUL 1KIPB 4PJHB 3ULVH 1S7TA 3D3VB 1KPUA 3J7HA 3WL9A 4QHMB 1JWUA 1NFIA 2X1PA 2B5IC 4RMVA 1NCDL 5B38B 4OZGF 3OBAA 3SDCD 4B41A 4POZD 3P0YL 3QUYB 5CZVH 1UT9A 5D6CB 3ESUF 1OAXL 1EHXA 2WK2A 4HKBB 3CMGA 4P5TA 3FAXA 3RWFA 4A2MA 4KROB 4XZUB 2JELH 1SJEB 2WANA 1T21B 3DTXB 5TH2B 1A8JH 4K3EH 1AD0B 1C5BH 1MWAB 2O61B 2X4OB 2CLVB 3DUHA 1MQKH 2GJ6B 5DQDL 4FQLL 2Z31D 4JVUA 3THMH 4J6RL 5F72S 3T04D 3IU4L 12E8H 3U0WL 5DRXB 2CXGA 1EEYB 5ADOL 4QKXB 4Q9RH 5D7IE 1VERA 4GRMB 1UB6B 4GSDH 1QPXA 5JORA 1RK1A 3X3FH 3GI9H 2P49B 3ROLB 5JIHA 4ODBD 1II4E 3PHOA 4JO1L 5E6ID 5SWZD 4DFIA 4JB9L 2PCPA 3B2VL 4MXVE 5SV3A 1IGIH 3K1DA 5KS9A 1EHLL 1AH1A 1MCOH 3WNLA 4OF7A 1OGAD 2R2BA 4M61A 1HN1A 4Y19B 3QXVA 4U1LA 3AC0A 3TO2B 3OJMB 2O5YL 4LCWE 1JL8A 4NO5A 4FQIL 4R4BB 1CD1A 3HI6H 1BVZA 2XXCB 1I4FB 1AIFB 4YDJB 5JW4M 1IKFL 3V6FB 2HTKD 4CVXA 3WCYA 4UAOC 1ZKAA 4NKOA 4ZTOH 1YNTB 1U92A 2XNAA 4KUZL 4S11A 3C9NA 5EIIA 1Z6JT 5EUKB 4GAGL 5FV2A 4W70A 3D6GA 4XB7A 2HT2D 3MLTB 3TC9A 1DQDH 4YBLB 3HG1D 1OAZL 4Z76A 4KVCL 1JWMB 3TT1L 3OKDB 4JAMB 2QHRH 4YO0B 1ZS8B 1MCQA 1DBKL 3CH8A 3CXHK 1G7MB 4XI5D 3ZDXF 4Y16B 1CXLA 4Y8AA 5F7LB 5HBBA 4XH2B 3ZE1F 4XC3H 1D6EB 4OLWH 3ZDZE 4ZYKB 2NY7L 3OX8B 3QXWA 2YN3A 4G6MH 5CKAA 1CR9H 3BP4A 3G5XA 1MCDA 4HK3N 5F9OH 3CVIH 2B1HH 1LD9B 1AGEA 2J8UE 1BZ7B 4JY5H 5AG8A 3RTQB 3PV6A 3PL6A 3QUKA 4OUUB 4U05A 5GHWL 4OIIL 2UYLB 5I6XC 3TO4A 3DYMA 3F7YB 2Y36H 4RFEB 1F42A 3LV3A 1A7OL 4DW2H 4YHKH 4MAUL 3KLHC 3VRLF 5AG9A 1TTFA 5BXFB 2B20A 4JO2L 4BQCA 5BJTB 2MWCA 3QWRD 4GRLD 4LVOC 3RVVD 1MCCA 4MAYD 3P4LA 4D9LL 3FO9B 3SDXE 4KJPC 4P3CH 2VLME 3RJDA 4QCIB 3UTZA 4FFVC 1AO7B 4N90E 2XRAL 3MOAH 4EVNB 3FTGA 1OM3L 3V4PL 3QZWB 1NBVL 2GFBA 1NFDF 4R0LC 1A7PH 4KMLB 1NGYB 2W0LA 4CW1B 5D7JA 1UEMA 1P84K 3AMLA 1AHWB 5GIRA 3BSZL 1U3YA 3RPKA 4RNRB 4NOBA 2F74A 3OKNA 3MJ9A 5JPMB 1QBLH 4RFOL 4PRIA 5I8EA 5EFIB 1DL7H 5E9DA 2EEBA 5MENA 5EPMA 3DSFL 1O7SA 3B5TA 5C08B 3C5JB 3TA3D 4FXLA 4GW4B 4XXCA 3OJDA 4O02L 3FO1A 4NQUA 4K7PY 3UAJD 4WI7A 5C0DB 2O93L 3MJ7B 4F3FB 2Q7YA 4QXTA 1YEDA 3BPNC 1BZQK 1QRNB 2Y06L 3GSQA 1LK2B 3O6KH 4DGVH 3GNMH 3T3PE 2MKLC 4M5YL 2JIXA 5EU4A 4LKCB 3GJFH 1YPZB 1IEAB 4HS3A 1X6NA 4M1DL 5FUZH 3QUZB 1RUPH 3CCHA 2R39A 4LLQA 2FWOA 3UTTA 3VXSB 1W0WB 4R90L 4QF1B 1UXSA 1XF2A 3ZKMC 2K7PA 3G6AB 3MA9H 4RX4D 3UPRB 3U48A 4L4JA 4X7EC 3I6LD 4HXBH 3BGMA 3V5KB 3VFUA 4JFEB 4X7SH 4QRRE 5EUOB 4JRYB 2J12B 3TNNA 4MLSA 4M6OL 4H88L 1XGRB 4Q6IA 4XP1H 4HUNB 2XZCL 3T65B 1XGYH 3ULVL 4F7TB 5D9SA 3DUSB 3WLWC 3IXAB 4G8EA 1LEGB 1FFPA 3ZE2F 2DLFL 1HWHB 4RGNE 1MRFH 5J3HC 1OWWA 4MA8H 1QKZH 4GRWH 1J8KA 3C60C 1S7WA 1JI2A 3PP4H 3WS6C 2YA1A 1IAIH 5MI0C 3O8XC 1UJ3A 2JELL 4LEOB 4FQHB 1JGLH 4K3EL 1CGWA 3BH8A 4Y4FD 2H2PD 4ENEC 5GISH 2F19H 1C5BL 4I5BA 3JWOL 1J9CT 2AJVH 3MOQA 4J4PA 3ARSA 3FKUS 4JVPA 1MFEH 3E6HA 4OI9A 2MMXA 3THML 1J05A 3BO8A 3B43A 5J56B 12E8L 2F5BH 2FGZA 4I3SH 4L1HA 3BZDA 5B21A 3MV7E 5C86A 5I2IA 3MV9B 3V5HB 3F5WB 4XCFH 4Q9RL 1OSPH 4GBXA 3SQOH 4UOW0 4OLXH 4NN7C 3VDCA 1FGVH 2FB4L 5DRZB 4GSDL 5KW9H 3X3FL 3DWTA 5DJYA 2EYTB 4ZS7H 5L2JB 5ICYA 4KDVA 5ERWA 5FGCE 2OI9B 1QR1A 2AKRB 5KSAA 1IGIL 1DVFB 4JJHA 4DVBB 4WWKD 1NC2B 1MCOL 2C3GA 1JMZA 2X70A 1GZPA 3OKKB 4XP5H 2VDRH 4HG4J 5F97E 2WV3A 4YLQT 2VLKE 4ZOAA 4LSVL 3KXFB 3LN5B 4PGCA 5CBAA 4R2GD 4PJCE 2AGJH 2XZQH 1WFOA 4ELKB 4WI6A 5C2UB 2VXQH 4EI5D 2CDFB 3MOBH 5A2KH 5MERA 5IJKA 1MCJA 3GSNA 1OL0A 4JPVL 2OMBA 2VLLB 4MB5A 4N8VB 2NXZD 3SJVE 3PGDB 4JZOA 1H15B 4JM2F 2W0FB 2K7QA 3ABZA 3OJ2C 2ID5A 3B9KD 3C5ZB 2YD2A 5JA8B 4NOFA 2X4RB 1EO8L 3O2DA 2QHRL 3VFOA 1BJ1J 2F54B 2PTVA 5ILTL 4RA3A 4HKJB 4JY4B 3S35H 3ZKXB 2J4WH 5CD5D 5D7KE 1ED3A 4XC3L 1VSCA 1JUFB 4OGXH 2V2TB 4QHUB 1NH6A 1U8JA 1NDMA 2F8XC 2CDGA 2XA3A 1CR9L 5ITFA 4YHIA 5F9OL 1YMMD 3CVIL 2B1HL 3IETA 1TQBC 3LKQA 1DSFH 1IGCH 1WZLA 2FBJL 2LU4A 4JFDD 3O6FA 4OZGB 4Y2DB 3D85D 3LRSA 5CJ8A 5F71A 3MV8B 3LSOA 4HUUB 5JOPE 3KDMB 2IAMD 4PIRF 4NJAL 4QO1A 1J1OH 4WFGD 4BH8A 5DQ9B 4L4VD 5F9AC 4YHKL 5FK9A 5I75B 1PLGH 2VLJD 1T5WB 1I85A 1KXVC 3HZKA 4KUCF 3QUML 1VADB 5C0BA 2X05A 5K9KA 4K23L 4NYLB 5B39G 3F12B 5D5ME 4CMMB 2E9IA 3EAKA 3AY4A 1JGVL 4OKVA 2AI0L 5GGSY 2DLGA 3MOAL 3ARGA 4MNQD 3WFHA 4AT6A 1KIRA 3QA3A 1VFBB 4MS8C 2W07A 4P9HC 2C1OA 1UM6H 4QY8A 3ROOB 2C4FU 3EDDA 2DMCA 4TVPE 3WO3B 2HFFB 3DV4B 3BEWA 2Q7NA 2EXYD 3ECBA 1QBAA 2ESVA 2HJLB 2IGFL 2BJMH 1MVFA 5T5FH 1JHTA 2NYYC 5D1XA 2PO6B 1NGZA 3HC0B 4LHUD 3FO2B 4XCYB 1CICD 2B39A 5DHXB 5CEYB 3OF6A 4IMLA 1D5XA 2X40A 3PDDA 5BZDB 5DD3H 4YFDB 2QSQA 3B9DA 3IKCA 5C0AD 3O6KL 4DGVL 4MXQD 3GNML 1M6OA 3REVA 3RZWA 5E8NA 2DWDB 1ROWA 5CGTA 4F7PA 5I1DB 2HFGH 3L3IB 4FQ1H 2IPUG 1U8HB 1TZGH 1IAMA 2YRLA 5EIVA 1TVBB 5TE6H 3QIBA 1ZA6A 1BOGB 4OGAD 3E2HC 4HXBL 4ZSOB 4WEBH 1HHJB 4RA0C 2UVEA 1A6TA 1WWAX 5C71A 4X7SL 3PQYB 1MEXH 4P9MH 2NY2C 1DBJH 4XPBH 4APQC 2E7CA 3HUJE 4XPGH 3VFNA 5DA4A 1MCIA 2EE6A 2NXYD 2ZOKA 1JN6A 3K7UA 4XP1L 3SKOA 4LLAA 1X5XA 3MRMB 4RQQA 4WUUB 4CNIB 1QSFE 3A6CH 4TTDD 1Q9OB 1AE6L 4P2RA 5SWSD 3LMJL 3CUPB 5I1GL 4LMQE 1QKZL 1BAFL 4HS6A 2BXZA 3C8DA 4ODUA 2FGWH 1ES0B 1IAIL 3TFKD 1YA5A 4HS8H 1JGLL 4POZC 5K59F 4L8DB 1IGFL 1HYSD 3HNVL 5GISL 3O3BB 2F19L 5C07D 4OZ4B 4U0RC 3VRJB 2AJVL 1HHGB 4DGIL 3I6GB 1MFEL 4HUWA 4EBQH 1T4KB 4ZFOA 5BMFH 4OLUH 5LG1A 4NZTH 4ZXBB 4TQEL 4QRPD 2FNBA 4I3SL 1QSED 2E3VA 2Z31C 3WNPA 5IHZB 4ZUVA 2ZNXA 3DGGB 3EZJB 1E4KC 2ZNWA 3SQOL 2PYFA 4OLXL 1G0XA 1FGVL 4OZFB 1TFHA 4G42B 4ZUTB 4XMKH 2CGRH 5KW9L 1IGJB 1Q9KA 4A6YL 4ZS7L 2CKNA 5ESQA 1TETH 2RFXA 1T5XB 2IQAB 2W60A 1T89C 4YDIH 1QRKA 2GK0B 1JPFB 5CD3B 1KCSL 2L4OA 3MRJB 3SE3C 3KPNA 3WUWG 5A16A 2UVFA 2N56A 3LKRB 5E6IC 4JN1H 4XP5L 2VDRL 3DURB 1EA9C 3K2UH 1IM9D 4WHCA 5INCB 3WS3B 3DV6B 3BX7C 5IWLC 5EBLB 2BNRE 4FTVB 5EU3A 1PDKA 4ZUUB 1Z3GH 1CFSA 2R2EA 5DFWH 5B38G 1SY6H 3SDDB 3GEWB 1K3ZA 2GSGA 2AGJL 3IDNB 4X6BB 2XZQL 5KN5A 1MRCH 3WFCH 4Q9QH 3OG4B 2VXQL 4K8RH 5BS0B 2HTKC 5GRZA 3LQZB 1PVHA 5DTFA 3UX9B 1RZJH 5FGRA 1Z0MA 3PDGA 5FO9B 3TBVB 3MFGB 4MJIB 1YDPB 1T04B 3SCMB 1LO5A 3ARTA 4PJAE 5D1ZD 2XWTA 4HUVB 1B9ZA 4NT6A 3RL1B 3VFTB 2HT2C 3GJEA 3TJEH 5HGBB 3QQ4B 3V52L 3WEXB 4LLMB 3QI9B 2NY0B 2CSPA 2J4WL 2WLYA 5E8PA 1WGOA 1RZFH 5D2NE 4UV7H 4OGXL 5IMOA 3PHQB 3KNBA 3T0ED 3MLXH 5K93A 2QKIB 5KVFH 3R06A 2AK4A 3JVGA 1EEQA 1HSAA 1KPVB 3RDTB 3OKMB 5GRWA 4N5EC 4I77L 3OKEB 4RMWA 1MRDL 3Q5OA 2R4SH 4XTRD 4JFHE 2Q3AA 1EFXD 1T83C 4GQPH 1JF5A 3EO1A 4FXKA 2O26U 1J5OL 4AMKH 1TMCB 4P4KA 3QFJD 3QXAA 3C6LB 5IB5B 1NUFA 1PLGL 1IGYA 3SBWA 2YK1H 1XGTB 5FYJD 3EOBB 3VJ6A 1NPUA 4X99A 3RIFK 4DFHA 1INQB 4HJ0D 4DCQB 3U4EA 1YY8B 3EYQD 4GRLC 3RVVC 4MAYC 1ADQH 3QJFB 1AKJD 2R0KL 1IBGH 2L7UA 5E5UB 3T4AA 5L2KA 4U1GC 5SX5K 1UM6L 5FYLE 1Y0LB 4P3DA 4OCXH 4YXKL 5FM5M 4CN1A 4UOW1 3KYMB 1OAKH 1U3HD 5I1JH 4NRXA 2BNQA 3ZL4H 4NKIH 4NZJA 2BJML 3RKDD 3I6KA 4G7YH 5T5FL 2XZAL 3I75B 32C2A 4DUVA 3HAEH 4LCCA 1S7RA 1NUDA 1D5MB 1UWGH 5BZWA 1U91B 3DRQA 1JTOA 2GW5A 5FXCH 4OCMC 5DD3L 4ELME 5F6IB 2LV4A 4LKXB 3TA3C 5LGKA 3UTSB 1T7YA 3BPOB 3M8OH 3ZE0E 3ME0A 5AUMA 3UAJC 3BQUB 3WYRA 1IFHL 3VW3L 2NQCA 1YC8A 2YSSA 2BHYA 2FH6A 1CCZA 1BVLA 2AXFA 2FL5B 1LGVA 4NJ9L 1GVIA 1G7HB 3O9WA 3Q1SH 3P4OA 4MA1B 2HFGL 5DHVA 5J6HA 3SHSA 1DANT 4NKMB 1JNLL 4IRJA 4FQ1L 1F45A 1ND0A 1TZGL 4JM2B 1NC4A 3CK0H 3MROA 4QHNB 5TE6L 3FCTA 1CT8B 1IMHC 4XAWH 1EGJA 4TVPH 4P46D 3GMLA 3ZHKA 1GGIH 4QNPE 2NX5D 5F89A 2JLLA 4IEFB 4WEBL 3BD5A 3PWPD 3WS6A 1DP0A 5C0ND 1K8DB 1MEXL 2BERA 4M93C 5CSGA 4JZNB 2HN7A 4P9ML 4U7SA 1DBJL 3QZWG 1L6XA 4XPGL 1I3VA 5EU5B 1D9KB 2VQ1A 3MCKA 3TN0B 5CIPH 1X4ZA 1CGVA 1KJ2B 3ZO0A 3A6CL 4KK8D 2R4RH 2VKWA 3IVKB 5J1SC 5JMRA 3G6JE 4PRHA 1TVHA 2ZUWA 1AC0A 3EYOA 1K2DA 2QADD 1EAJA 4D9QE 4LGRB 4Z78B 2XICA 5HHPA 5JHDB 1KJVA 1F3DH 2FGWL 4HS8L 4OT1H 3QRGH 4TSAH 1MCLA 4JFOA 3DVGB 4G8GE 5EC2B 1P1ZB 2P5EA 4S1RH 5GGTA 3VXUA 2HTLD 4PJFA 1CLZH 4IMKC 4Y4FC 5BMFL 2H2PC 2IMMA 3FQTA 4NC0B 1OHQA 2Z4QA 2R1WA 2P24A 3PJSA 5GGUB 4NZTL 3KYAA 3GIVB 1F58L 5CS7A 1MIMH 1UZ6F 4OZHA 5HXMA 1A22B 3RZCD 3WLBA 3UDWC 2GJZA 1T22A 4NO0B 3D2UA 3S37X 2C5DC 4TULH 4XMKL 3RPIA 2CRIA 2I9LA 1F6LL 3D3VD 5LKNA 2OTUA 1TETL 2H2SD 4PRIE 4HWZB 5DC9B 3QIWB 3PWLA 4YDIL 5I76A 1T1WA 4HGMA 2E6JA 1HQ4B 3HKFA 3OV6A 2CR3A 4JN1L 4M6MH 3ARED 5MEOB 1M7DA 4N0FB 1OSZB 4KROD 4K7FA 3MRLB 1Z3GL 4GG6A 1ZSDA 3VGAB 1VDGA 1SY6L 4F7CA 3KJ4B 1WAAE 3H9ZA 7FABH 4OM1L 5DJ0A 4MA3B 1MRCL 5CZXD 4YNYA 2I5YH 4Q9QL 4WW1A 3EYVB 3KPRA 4K8RL 3UTTE 1MELA 4R2GC 4MCYA 1I7TB 1O5DT 2MSPA 1A9EB 3FRUB 4PJ9B 4AYFA 4EI5C 3OKLB 1SEBB 4XMLH 4IRSB 3B5HA 2X10A 1HHKB 2NXZC 3BUYB 1JP5A 4GW1A 3VWJA 3TJEL 1XR9A 3UTPD 5C2BH 2AV1A 4OCRH 4WFHE 3B9KC 1RZFL 4UV7L 1P4BH 3MLXL 1KTDB 1T1YB 2W65A 5KVFL 1NEZA 5CD5C 4Y5YB 3L5XH 2APFA 4AIZA 2RHEA 1X4YA 3TIEA 1T3FA 4F15C 1S9WA 3LH2L 4GG8B 2R4SL 5TDOB 2GEEA 1R5VA 4J3UA 5T1MA 1XCQA 4R7NB 5C0CE 3TP4A 1D5BB 5IHBA 1MLCA 4Q58C 5KSBB 2MPAH 3WIHH 2ICWJ 2VSDA 1TPXC 3HMXA 2IAND 2LAGB 4RRPA 2R2HB 1D5IH 43CAB 2IAMC 1VB9A 1INEL 1RJZB 1KLFA 1TZHB 5CBEB 5DD0H 4TUKL 1EZVX 4QHLB 1U95A 3HE6B 3GSXA 2EZ0D 3VD4A 4Z7OE 1ZHBA 2YZ8A 4HF5H 4HWBH 5T1LA 5CZKA 1FJ1A 4X6DE 4MXVF 4KRPB 4DN3H 1V05A 4JFFD 2OZ4H 4HBCH 4BM7A 4OV5A 5IVZA 4XVUD 1ADQL 1QYGL 4JZJC 1WK0A 1FE8L 2VWEC 3NIDF 3U30C 5DEFB 1IZKA 4LLUA 3NFPB 3RUGB 5E7BA 4LRNH 2C3XA 4L4TA 1PG7H 4GT7A 3MA7A 1B2WH 3RIAK 4EN3A 3Q6FA 4PY7B 5I1JL 1JTTA 1BP3B 3EJZD 1LO2H 2W9LA 3ZL4L 3VXMB 1CTOA 5IQ9A 4U1NB 3I9GH 4UZGA 3ZYIA 4G7YL 4PJBE 1S9XA 5IW6A 4HG4K 2E6QA 2EXYC 1IC5H 2X9WA 1UWGL 4I18B 1MI5A 4LPUA 4JFZH 1CICC 4X4XA 1EBPA 1ZVYA 3WSQL 3M8OL 1MCRA 1GAFH 2B1AH 3V0VB 3BPLB 5EZJB 5HPMA 4HPOH 4UIMA 5HY9A 5ICXB 5T1KA 1HI6A 2FJGA 4U6XA 4U6YA 3N85H 4JDTH 4APQA 4ODWA 3ZDZF 2ED9A 3WUZA 3LN4A 2Z8SA 3Q1SL 2XWBA 5HGHB 4MXQC 3MRHA 2B8OT 4ZFFA 2FJHA 1YY9D 4B7LA 4NN6B 1JVKA 4YJZL 3CK0L 2EDRA 3EDJA 4GAYB 1F11B 1KT2A 4HGWA 1G7LB 5FECB 1GGIL 1K4DB 4F58H 1YN6A 5CP7A 4XP6H 3P3YA 4HWEH 5HYIA 1I3RB 4OGAC 5K9JH 3QFDB 2AV7B 4LLVB 3PWUB 4P2QD 5IJVA 2R1XA 1RK0B 2ADFH 2R4RL 3FMGH 3QDGB 3V7AE 2NXYC 1M71A 4IDLA 3VG9B 4EUPH 3SDXF 4UIKH 2F53B 1CBVH 4WU7A 4TTDC 5DUBB 3B9AA 1DE4A 3T3ME 3MYJA 2R56H 1CGSH 4XNYH 4NQSB 1E4KA 2P7TB 4OT1L 3QRGL 4TSAL 3ZSTA 3F7QA 1B4RA 1GRWA 1WZ1H 1VENA 4XAKE 2NY3D 4S1RL 3TFKC 4OIAA 3B2UD 5KZCD 1CLZL 1HYSC 4JHWL 5IW3A 1T89A 4NQCE 1K6QH 2ITCA 5EU6E 5HHME 2DI7A 4OCYH 4WU5B 4Y4KD 3ARXA 5C09B 5JW3H 2E7BA 4G9DB 2X4TB 2CKBA 4AH2B 4WV1A 5GGRY 2VC2L 5DD1L 1T7ZA 4E41E 5IWLA 4Z95L 2A38A 1I1YA 2F8VA 4YHYC 1JNHB 3DXAE 2C3WA 2J6EH 4WHYH 2Y72A 1F4HA 2YD6A 2CDEB 3T3PF 4ZO6A 4KK6D 4K71C 5I8CB 4HH9B 1FVDA 1CN4A 4M6ML 2PW1A 3E6FA 1S9YA 4WHTA 3U36A 4IM8A 2VLRB 4ZAKB 2HA1A 3UJTH 2R8SH 1MHCA 4HKZB 3WHXB 3LEXB 4I9WE 5HYJD 3JXAA 1S5HB 1TQCC 2QV2A 5E2TH 1NCBH 3HG1A 2K3TA 3N1PC 1PKQB 3SDAD 3QNZA 1RIVH 1BJ8A 3GSRA 4Z7NE 1KN4L 4G8FB 1NMCB 5DJ6A 3FOLA 5D72H 2LABA 5DYOA 5JIPA 1T20A 3P9MA 2D7MA 3VDAA 1SHMA 2WBJB 2GITB 1Q0XH 4XMLL 3D87B 2APTA 3B8SA 3LKNB 4R26H 1UYWL 4NQDB 3MJ9H 2EO9A 1Q9WA 3T0AA 5BV7H 5C2BL 2A6KA 2H3NB 2IALA 1K9TA 3KS0J 2B4CH 5D1ZC 4OLYH 2GY5A 3QDME 5JA9A 4DOHE 4UMGA 1TVDA 5ALBH 3V95A 1LNUB 1P4BL 3CVHA 1J8HA 1NLBL 1AR1D 4UT7L 3L5XL 1NQBA 2I27N 3GK8H 3V2AR 4EI6A 1EO5A 3GJFB 3QWRA 1MY5A 4GRLA 1R5IB 5F21B 5TDNA 1CFQA 3KR3H 3FB8B 3L3OB 2BSSB 1A6AA 2MPAL 1NDGB 2R69H 4XTRC 3WIHL 3U79A 1FYTD 2AJ3B 4H25B 1B0GA 1KC5H 4NGHH 3RNKB 4HD9A 5HHXH 3IDIA 4NRZA 3QCUH 1WVZA 5DC0A 4HF5L 2G60H 4HWBL 4OCNC 4RFNB 1IQWH 3WFBH 4UUJB 3QJHA 5E8OB 4DN3L 2C7UB 4R7DA 4CJ0A 4WO4A 4HBCL 4LHQB 2XKUA 3QG7H 4HJ0C 1A2YB 4ZD3H 3LIZH 5H37G 5JOFA 4LRNL 3PDOA 5E4IA 1PG7L 2RIKA 2JB6B 2C1PB 1OY3B 5GS1B 3FO0H 4PR5B 4WI8A 4F57H 4PJCF 3JUZA 4GRWB 1CTNA 3TH4T 4Y5XB 3C8KB 5HVHC 2EE2A 3ZYJA 3I9GL 4GMTH 3RU8H 5E2JA 1CZ8H 4M9PA 1MJJA 1U3HC 3FQXB 3FQRA 5ADPL 5TE4H 1IC5L 2L7JA 4Z77B 1VKXA 2FZ3A 4PJ5E 5KANI 3RKDC 1K8IA 3GGWA 1KJ3H 1L0YA 2D7TH 3TBWB 1AJ7H 5DHYB 3QH3A 4JFZL 3WKNA 2EC8A 4N0UB 5F1SA 4MDIB 5GS0D 8FABB 3TH2T 2XY2A 1GAFL 1OTTC 2B1AL 5JNYB 4HPOL 2WAHA 1HQRB 1BBJA 2HYMA 1V7MH 1G6RH 3N85L 4JDTL 4U6HB 3AROA 2PYED 1WC7B 1ODAA 4PJFF 2C4FT 4S2SA 2ICCA 4PTTA 1XGQB 2E6PA 1U8LB 5DA0B 1JZ3A 2JK5A 3CFEB 5HYQB 5DJCA 2W92A 3AXLA 5AAMA 2AQ3A 1UH3A 3MJ8B 5HD8D 4F58L 4OZHF 4D94A 3NIFE 2H26A 4KFZC 3RWEB 4OCWH 4YH6A 5DT1H 4P46C 1UKTA 4WW2B 5CINH 4HWEL 4NNYA 1ZLWH 3SGJC 3FQUA 3MLVL 2PO6D 4PGJA 5ACZA 5C0NC 1VCAA 4JREC 2ADFL 4X9HA 1KEMH 3LOWA 3O4LA 3PWJA 3BW9B 1WZKA 4ODVH 4BFIA 2VXVH 5D5MF 3PIQA 4AL8H 5KG9B 3GKWH 4KK8C 5DS8B 4DTGH 3WXWL 3DMMA 3MRKB 5FF6A 3QXDB 1KNOA 1CGSL 1INDH 5C1MB 4LASH 4HPYH 4UDUB 1S5IL 2QADC 2V5TA 3P9LA 3EJYD 1WZ1L 1ZT7B 1Q8MA 4J3XA 1TJGH 4Z7VA 2CLRA 4S1DD 3FFCD 3C08H 4G7VH 1P5UA 1Q94B 5JQHC 4PG2C 2BVPB 1K6QL 3VRIA 1CU4H 3HLAB 4YK4C 3D39A 2HTLC 5F1NB 5DR5H 3OKOA 4E5XB 1XGPA 2BVQA 1RULH 4LCWB 1GH7A 2P45B 5IR1B 4EJ1C 4L3ED 4XNMA 4NUJB 1HEZA 4LF3B 1UEYA 5I30H 3REWA 5EOCH 1DDHA 3RZCC 4BKLA 2J6EL 1I7RA 4WUKL 3GBMH 3S3JA 4X98A 4PJ7E 5FYKE 2HKFH 2H2SC 3KPLB 4J8RB 3IDYB 2W9EH 3QUYC 4IJ3B 3UJTL 5FFLA 4R97C 4ZUSA 1KPRB 4Q2ZB 2R8SL 3AREC 5CUSL 1TCMA 4NHCH 3RQ3A 1RZ7H 4KROC 2NY5H 5E2TL 5LAXB 2HVJA 1B0RA 5FDWA 3OAYK 1QLRA 1RIVL 4HIJA 2K9UA 2YPKA 4V2BA 3STLB 3UP1A 2RR3A 3QEHA 3ELAT 1Q0YH 5H35A 5KJRL 2RCSH 1XR8B 4HFWA 3ULUF 5CZXC 5IEHB 3FFDB 3AS0A 4OFVA 1Q0XL 2J8UB 1KSRA 1LE9A 3C09B 3IJSB 1X6LA 4R26L 1FC2D 1UACH 3MJ9L 4F2MB 2A9MH 5BV7L 1AQKH 4TRPL 3N1MC 4JFDA 4I48A 2B4CL 3OGCB 2P4AB 4OLYL 4YPJA 4UI2A 2RAMA 3D85A 4IOIB 5ALBL 4EQ2A 2IAMA 4ORGB 4JANA 4NBZB 4JLRA 3ZKSD 5B3NA 4L4VA 3VXNA 1N3NB 4WTZG 1HINH 3GK8L 2VLJA 2YPLE 3MODH 4RGOH 3WNNA 3SDXB 1EJ6A 1JHLL 1IC4L 2GCYB 3VFPA 3AS1A 1ZT4B 4JZJA 3P73A 3LQAH 2R69L 5DVMA 5HJ3A 1XF4A 1TCRA 4XVSH 3VXUE 3U6RB 3ARBA 1KC5L 3IFPB 4NGHL 4H8WL 1IAKB 2ZUUA 4FQQB 4HJJH 4D0CA 3QCUL 4FP8H 4MJID 4N1CA 2G60L 4NPYA 4WENB 1IQWL 3WFBL 1CGYA 3RGHA 3BDYH 4PREB 2EZ0C 3T1FB 4YFLF 5TF1H 2ZKHH 3QG7L 5MEQB 2HWZH 4ZD3L 3T1WA 2ARJA 3V0WH 35C8H 2BVUA 4PUBH 3CH1A 4XVUC 1CICA 2H1PH 4DKEH 3TF7C 3ZTJG 2OJEB 3GMPA 4WCYH 4Y16C 5IROC 3FO0L 3D0LB 4F57L 3RDTD 2DQEH 2UUDH 5I66B 1MHHA 5IVXA 4UQ3A 4GMTL 3RU8L 1CZ8L 3WN5B 1SBBA 3WE6A 5JDSB 3CFKB 3EJZC 3QEQA 1QVOA 4YXHL 1L9MA 2MKWA 3GSWA 3MBEA 5E5MA 1KJ3L 1XF5A 2D7TL 4FQXB 3TZVD 4GG6E 3TVMB 4RIRB 1EEZA 2ICES 5GGSB 1VFOA 2ZG1A 2HRLA 2F5AH 3QDJB 1T03H 3BKMH 4QRRB 1V7ML 1QEWA 3QIUB 5M95B 1QR4A 4FG6D 5SWQA 1JZ7A 1A4KA 3LRHA 2CMRH 3MNVB 1XH3B 1ZEAH 3STZB 4C57C 4X80H 2YZ1A 5GS2D 1R6VA 5LBSH 1Y18B 1NJ9B 3R0MA 3MRIA 5A1AA 1F02I 5BVJB 4K3DH 4RGNB 3IDMB 2E7HA 1YY9C 4M7JH 3ARFA 1AHWC 1SMOA 3T8XB 5DT1L 1G9NH 5TGBB 1O7VA 3CPLA 1MH5A 3BPCA 5JW4R 4H1LA 3PABA 3M07A 5CINL 3HPLA 1LWRA 2Q8AH 2OL3A 3RWGB 4OZIA 4MJ2A 5LGJA 3MPCA 4C56E 1KEML 2XN9E 1MREH 1WBYA 1KXQE 5C07A 2PR4H 1UWEH 2VXVL 1J0HA 4LGPB 4ODSL 4AL8L 5JZ7D 3GKWL 1A7NH 1N5AB 1WIUA 3MV7B 1ZGLB 5D7LA 4KTDH 5D2LF 5DJ8B 5J11C 1INDL 2QQNH 4K94C 1BD2D 1QSEA 4HIIB 4MD5A 1KCVH 4CU6A 4F33A 4OD2B 3RNQB 2ATKA 3MFFB 4JEGB 5BRZA 1TJGL 1ZHNB 1WCBA 3C08L 4G7VL 2QLVB 5FGCB 1ORSA 3QB7C 4OD1H 2FX8H 1CU4L 2NY3C 5ANMA 1XIWA 3B2UC 5E5RB 3GUTB 3AAZA 4JG1H 4TUJB 5C0EB 1S7SA 1RULL 1FO0H 3BP7A 5K9QG 4Y4KC 2FATL 2VLKB 3Q48A 4Y1AA 5IG7B 3GM0A 2V2WA 3DHMA 3DBXA 4D0DA 5I30L 3NACH 5EOCL 4LP4A 4LARH 3KPQB 4PJCB 4QOKE 3MRCA 3GBML 3LN9A 4MWFA 4X7CC 3O3AB 2HKFL 3G5YB 2D9CA 2VH5H 2VXSL 3SJVB 3T77B 3MRBA 5F9WB 4ZFZA 2W9EL 3I85A 4LCUB 3IU3B 2VITB 4KK6C 5EO9A 3EJJX 4PJDE 1U8QB 3B4NA 1KB5H 4M03A 1W8NA 5TQ0H 4NHCL 3O3DA 4BELD 4U4BA 4WNQB 2W59A 1FZKA 5DZLA 1QFWH 2NY5L 5D70H 4PRPA 3QUXB 1G1YA 2X4NA 5DRWB 3CZFA 3ES6A 3CDGB 2HAZA 4URTB 1L0XA 1VEMA 5B3JF 4OD3H 3DGCR 3SDAC 1FC1A 4YAQB 4S0TD 3PGCB 3SDYH 1PJ9A 2ADJA 4NO0D 4CJ1A 2ZG2A 5B8CB 4X9IA 3V4UH 2MQCA 4MJ6B 3BP6A 1GIGH 1UACL 2A9ML 1GGBL 5I1HH 1AQKL 3VGEA 4BZ1H 1F8TL 5BW7A 3HAEB 4PGEB 3GMMB 3QAZC 4OB5H 5FYKH 1UCTA 1EFXA 1R3KA 5B39A 1T2QH 4YDLC 4LSPH 1ZVSA 3N1GC 2OI9C 3K0WA 4JY6A 2X09A 2I24N 3HFML 4OFIA 3RWHB 1EXUA 2QR0B 1HINL 1FL5A 1I9IH 1XMWA 2IPKA 4RGOL 1FNAA 3ARDA 5D5MB 2UZYB 5F1IB 1AR1C 3PGFH 3N06B 4MJ5B 3LEYL 3S4SB 1YQVH 1FN4B 4U3CA 3CMOH 3RKPA 1EHAA 4P5TD 5EB9A 1ZOXA 1KLUA 4ZOBA 3LQAL 3RWJB 4KRNA 4P5KB 3BOVA 1OTUD 4XVSL 3CFBA 2VZVA 1X5ZA 4HJJL 3B6SA 4JFYA 5DGQA 4FP8L 1EGJH 2FH8A 4PJ9D 4IRSD 1JPGB 3BMWA 4PJIA 5SWZE 2Y7QB 4M6AA 3BDYL 3D1MC 1OW0A 5TF1L 3EZ8A 1OGAE 3BZFA 2HWZL 5CIPB 1HXMA 5DURD 3L9RA 3WFEH 3C5ZC 1QUNA 2Y23A 3V0WL 1HSBB 35C8L 5D93B 4PUBL 6FABL 3W9EA 4CAGA 5GSVB 2WP3O 3WIIH 5IFHH 4LCIL 2H1PL 4DKEL 2BCKA 3ZKXC 4WCYL 2V7NB 4JRXB 1NMBH 4Y0GA 3O6LH 2ZOLB 4JQIH 4G6FB 2DQEL 3LKOA 4FXGB 5ID0A 5IOPB 3GFUA 3RRQA 2GT9A 3V6ZB 1SBSH 3JV0A 3Q3GB 1XEDA 3JUYA 1A4JB 2GJJA 1P9MC 2JE8A 4HK0B 1IAII 2P8MB 2R1YB 5GGTH 2EC9U 1KLGA 4LCYB 3S35X 2OTPA 3DARA 3U7WH 3P4NA 3HG1E 4H20L 4LPWA 3TCLB 5F3BA 2F5AL 4CVUA 1T03L 3BKML 3VFVB 4I0PB 3IFOA 5IB2A 5GS0C 3IRZA 4PJXE 3HUJB 3AM8C 3SGJA 3L3KB 5IMKB 5DK2B 3FQNB 3PWPA 2E9WA 2F9BT 2FR4A 2KBGA 1QSFB 3HS0B 3OR6B 2C4XA 2CMRL 4JHZA 4X80L 1CF8H 3MLZH 3N1QC 3FN9A 5HGAA 1OP5H 4N9GB 1LDPH 3BZ4B 2A83A 2VZUA 4M7JL 4P57A 4ONHA 2DQDH 1FZJA 1T80A 4EDXA 1ONQA 3UYPA 1HILA 2NW3A 1F00I 5ICZA 1OAUH 5HD8C 5J1AA 3QQ3B 2Q8AL 3HZMA 4NRYA 1AC6A 1DLFH 2IMNA 1I8IB 1BQHB 5HPOA 3MXVH 2FIKA 3KPMA 3DX9B 3P77A 4JFXB 2DTSA 3TYFA 1PY4A 3AS3A 2A9NH 2PR4L 1UWEL 3PL6D 4PG2A 2PO6C 2HJFA 3EGSB 5DDHA 4PRBA 1A7NL 2A6JA 4ZTPL 5ACLA 3MUHL 1EBAA 2EDYA 5CP3H 4KTDL 3IGAA 4GW5A 5CJOH 4UBDD 2QQNL 3A6OA 2OLDA 1H8NA 3ZTNL 5IIEA 3MRNB 1A7RL 3QQNA 1KCVL 3VFSA 3HE7A 4WJ5A 4PV8B 5DJAB 2XKNA 3BXNA 1AGCA 3NCBB 1P4LA 4J3TA 3DO7B 3MYZA 4LQ1A 3EJYC 4OD1L 1D3CA 1KIPA 2FX8L 2XQBH 4PJHA 3D3VA 2WINB 3VD3A 1FFOB 2Z9TA 3CXDH 3LS4H 3CAFA 4S1DC 2HJKB 3GRWH 3ALXA 4QHMA 4K2UH 2Q8BH 4JG1L 4J3WA 5JO5B 2DD8H 5B38A 1H9VA 5D7JD 3V5DB 1FO0L 3QUYA 4NQEE 4OF6A 5D6CA 2BNRB 3VFWB 4KJYB 4HKBA 4XZUA 1SJEA 3HRZB 3NACL 1T21A 3DTXA 5DFVD 5TH2A 5ENWB 5FM8A 3R8QA 1K4CB 4KU1A 1P4IH 4M7ZB 1JZ8A 3SGEI 1AD0A 1VPOH 5E9DD 2F53D 1MWAA 4N5UA 2I26N 5DEZA 3NFSH 5MEND 2O61A 2X4OA 4S10A 2CLVA 4MNGE 2E8YA 1MCEA 2VH5L 3TT3H 2GJ6A 4P2YA 3U0TB 3FZUD 4P9HH 5C9JA 3DX8B 1FDLH 1QBMH 1G6VK 2FX7H 5DRXA 1OGTA 1U6AH 1KB5L 1EEYA 3RWIB 4PJAB 5TQ0L 2DQFB 2CD0A 4Y7MA 1QFWL 1FIEA 5D70L 2N7BA 3QO1B 4P23B 2JJTA 3S6CA 3RP1A 4GRMA 5IW1B 4L8SB 1UB6A 3VA2C 2JIXD 3UBXB 4XX1E 3ARRA 3I6LE 1N0LA 3TPUB 4FMFA 3ROLA 5D2NB 2R9HC 3H9HB 1J1PH 4M1GL 1MJUH 4OD3L 3RVUD 1TITA 4M7LT 4HEPG 3OB0H 4CBPA 5IBUG 1U8IB 4W4OA 5F6HJ 3V4UL 4Y19A 3TO2A 1GIGL 2AABL 4R4BA 5I1HL 5T3ZD 4BZ1L 3T3MF 4Z7WE 4HZAA 1U41A 1I4FA 3SGKC 4F9LA 1AIFA 5I17B 2X4UB 1EX0A 4OB5L 4OAWB 5FYKL 4YDJA 3V6FA 5CJBA 4AEEA 1T2QL 4LSPL 1BVKB 4G6AD 1F6AB 1YNTA 1JZ6A 1BQLL 4M3JA 1SEQH 2VLRD 3W39B 3VMPA 2XV6B 1I9IL 5IVXF 3HPJB 5EUKA 3WJLC 1BWWA 2D03H 3PGFL 3MLTA 1H3XA 1JZ2A 5D2LB 4X4ZA 4RCAA 1JWMA 4R4FH 3OKDA 4JAMA 3MUGB 4S0SD 4YO0A 5HHNB 1WWWX 1ZS8A 3OGOE 4X7FC 4J4PD 4YR6B 1U8PB 2A73B 3PHOB 1G7MA 1IAOB 4DAGH 3C2SA 4Y16A 3INUL 5IROA 4XH2A 3NPSB 1RHHB 1D6EA 1EGJL 1N59B 4ZYKA 3OX8A 1PKOA 4YC2C 1MY7A 1LD9A 4F8TA 2Y07L 3RX5A 2E5EA 1BZ7A 4GBXD 3RTQA 3WFEL 4C54A 4OUUA 2ZSVB 1JHKH 2IFFH 2UYLA 2VYRE 3WIIL 4ELMB 1ZAGA 5CEZE 3H9SE 4EUPB 3F7YA 4RFEA 1OOAA 5LQBH 5KSAD 1U92B 1U36A 5EOTB 1YJDC 4UILH 5BXFA 5CMAB 3U2SB 5BJTA 1I9EA 1SBSL 3NZHH 3RDTC 4G9FE 4LSDA 3PNWB 3FO9A 4Z5RB 5F1OB 1NAKH 4QCIA 3QO0B 5GGTL 1W0VB 1AO7A 1C5DB 3U7WL 4EVNA 3QZWA 4JE4B 2UWEA 3WBDA 4CW1A 1NGYA 2YMXH 4ZG1A 3C6LC 1AHWA 3TZVC 3SGDH 3EYUH 3A67H 3TWCH 4X6EB 2EDOA 3SE4C 4D3CH 2CKBH 2EEAA 2P46B 1W72H 4RNRA 1KUMA 2XT1B 5JPMA 1I1AB 5EFIA 4HIEB 4CVZB 3VXPB 1A6PA 1RURH 1CF8L 3MLZL 4FG6C 5CWSB 1HE7A 2K1MA 3G6JB 3FT2B 5C08A 1YMME 4Z18A 3C5JA 1YEJH 1LDPL 4PG9B 2VQTA 4GW4A 1I1RA 5C0DA 2DQDL 3MJ7A 4F3FA 4J2XA 1H3VA 3BRDA 1GYAA 4WFGE 1QRNA 3NA4A 1DLFL 1LK2A 4G8GB 1G7PB 3MXVL 3T09A 5J06A 4LKCA 1YPZA 1IEAA 2KQNA 1IRAY 2A9NL 3QUZA 2W0PA 5GGVL 2CK0H 3VXSA 1W0WA 4KJQD 2GFBB 4QF1A 1N4XH 3G6AA 3PUCA 2JB5H 5CJOL 3UPRA 4YE4H 3BPOC 4MNQE 3WDJA 1H5BB 4MA7L 3V5KA 5HI5D 3UXFA 5EUOA 4JRYA 3KYNB 3SO5A 4Z0BH 4PRIB 2J8HA 5CSBA 1XGRA 2WUCH 3RBSA 2Q86B 1ZVHA 4LLWB 4MA1C 3SO3B 3T65A 3QCVH 3H6JA 3LS4L 3CXDL 4F7TA 4PB0H 5IESH 4JM2C 3GRWL 3ARGD 3DUSA 1RUKH 4K2UL 4KKBD 2Q8BL 3IXAA 2YD5A 1LEGA 3VFRB 2DD8L 4BSJA 4PJEE 1ZLUK 3NPZB 1EZVY 3MGTB 1UFUA 4XCEB 5EO1B 3S34H 4FZEH 4YHOH 4DQOH 4G5ZH 4LEOA 4FQHA 1UB5B 3FRPA 1Q1JL 1V3KA 2M2DA 2ESVD 1ZHKB 1IM3B 4Z7QE 1VPOL 5EN2B 5C0AE 2W38A 1Z9SA 3NFSL 2G9HB 4LLQB 4PY8I 3MBXH 5D1XD 3BUTA 5TDPB 4NM4L 3PWNB 2R0LH 4YHMH 3TT3L 3HMXL 1HXYB 5EBGA 3DJ9A 1HOCB 4M3KB 4P9HL 2YD8A 3LDBB 1KULA 2HH0H 1FDLL 3GHBH 3VH8B 1QBML 3V79C 4PJGE 2E7MA 3CDCA 3MV9A 3V5HA 1BFVH 3F5WA 2AJXH 4MCZB 3X14B 4MD0B 2V6HA 1Z2KA 4MQTB 1K3IA 1F13A 3NIFF 2SEBB 5DRZA 1IAIM 3EBAA 4PGDB 2EDTA 2EYTA 5L2JA 4YPGB 1ZXQA 2XPGB 4LDLB 1DBAL 1J1PL 3DO3A 2AKRA 4GJTB 4IDJH 4DVBA 1DVFA 1NC2A 1KIQB 2X2YA 4PJIF 5IP4A 3OKKA 1N2RB 3QIBD 5SWSE 1EJOH 1KJMB 2Z8RA 1HYRC 5I0ZA 5C0CB 2NW2B 3KXFA 3LN5A 2YXFA 4P49A 1WT5C 4HBQA 4JCMA 3QIWC 3X12B 4P2RD 4ELKA 1SEQL 2Z8VC 2CDFA 4AM0B 4ODHH 2AAVA 2AXGB 1UM5H 4X6DB 1G1CA 3RL2B 2VLLA 2D03L 4N8VA 1G6RB 5IGXH 3PGDA 1H15A 2VUOA 2W0FA 5C8JB 1S78D 4QRPE 3MR9B 4MZ2A 1L7TL 3C5ZA 3VXRE 3RX7A 2QJDA 3MRFB 2X4RA 2Y4SA 4R4FL 5F7MC 1YUHB 3VGAC 4U2ZA 2F54A 5I8KH 3KJ4C 4P5TC 4HKJA 4JY4A 4DAGL 1CFTB 3BE1H 1GZQB 1ZA3B 2V2TA 4QHUA 1OTUC 2GQHA 4GS7B 1CDUA 4LSRH 4PJ7F 1J1XH 4KI5F 4J3OC 1PY9A 4PJ9C 1JCKA 4PJBB 4IRSC 3NCEB 1JWSB 4IOFD 1I9RH 1JPTL 4OZGA 1XFPA 4Y2DA 3NBNA 1JHKL 1F4XH 3KYOB 4NZUH 3MV8A 5I8OH 4HUUA 2I9TB 2IFFL 3KDMA 2A74B 1Y6MR 2MHAB 4XHJC 4G3YH 2DMBA 5DQ9A 3F58H 5LQBL 3VE0B 1A6WH 4CVWA 1T5WA 2DQGH 4UILL 4ZOEA 2C3VB 4U1IB 1DUYB 1VADA 1AXTH 3NIGE 3AM8A 3S9DB 5EZLB 4NYLA 2BMKB 3F12A 3L3JB 3I3EA 1IQDB 3QQ9D 1FVEB 2NLJB 1DLHB 5F9JA 3DYPA 4CMMA 3S88H 3H0TB 3U4AA 1NAKL 5L8KB 1XCTB 3MTRA 3FT3B 4CN6A 4IIQB 3O6ML 1GJIA 4KKNA 2YMXL 1VFBA 3FN0H 5HYSB 3I50H 5I0DA 1OP3K 3ROOA 3BMVA 1NDMB 3TWCL 4X5LA 4YBHA 3HE6C 2HFFA 4D3CL 2CKBL 4GLRH 3DV4A 4KRLB 2X4QB 3T0EE 1H3PL 5I1AB 2HJLA 2DM7A 1RURL 1KELH 4PJHF 1TZIB 1BEYH 2PO6A 3HC0A 3IFLH 5LCVH 3FO2A 4XCYA 1J12A 5FKAB 5CEYA 2YD3A 4HC1H 1KCLA 1SJHB 1SYVB 3MACH 2JCCE 3L95B 3ZMRA 1YN7B 2VXTL 5BZDA 1D6VL 2HRPH 2BC4B 3GKZA 3KLHD 1EO7A 4LMQI 3HCVB 4AEHH 3QFJE 1X5IA 2AK4D 5K9KB 2ZUQC 5CHNB 5FGBA 2DWDA 1NSNH 2EYRB 5FYJE 1BHGA 5I1DA 2DQHL 4NQCB 1KENH 2DWEB 3N0PB 5EU6B 5HHMB 2R0ZH 2CK0L 4FFVD 2DJSA 4X6CE 5DLML 1N4XL 3QDJD 1TVBA 4R8WH 3PL6C 1PG7X 4P4KD 2JB5L 1RZKL 2NY1B 4QRRD 5I74B 4YE4L 2P48B 4E41B 1BOGA 5T3XL 4ZSOA 1JBJA 1DQJB 2PUQT 1HHJA 3GMQB 1R5WB 1A6UH 3PQYA 2ZZUT 4UBDC 4QXUH 3ZDYE 5DVLA 4Z0BL 3DXAB 3T0XA 3FT4B 3MJ6A 3AUVA 2BDNL 5ELIA 3QCVL 3MRMA 4WUUA 4CADB 4CNIA 3RBGA 4RGND 2QSCH 4PB0L 4RRPG 3GB7B 2X4SB 3IDGB 3NA9H 5IESL 1RUKL 4POUB 3KHQA 3CUPA 4RISL 3PXHA 5L2KD 3K4ZA 2L0DA 4G43B 2DLTA 3ULVE 3EYFB 4WTXA 2Z92B 3S34L 4FZEL 1ES0A 4G5ZL 5D7JC 1JYVA 4J23A 4L8DA 4IHOB 3NN8B 1RIHH 3O3BA 3MZTA 4OZ4A 3VRJA 2WIMA 1IKNC 1M7IB 1HHGA 1PAMA 1GGCH 3I6GA 5DFVC 1SM3H 1T4KA 2ICWI 2R0LL 1CE6B 4LFHG 4MXWL 3P30H 4AIXA 2HH0L 4ZXBA 3GHBL 4RAUB 1BQHG 3VXQB 2B5IB 2YRPA 4YHZH 4PLOB 1BFVL 2AJXL 5HGGS 5IHZA 3FZUC 4P4RB 3DGGA 2DDQL 1KBGH 4G8IB 2VUYA 5J9PB 1U8KB 4K9EC 5C0RL 4OZFA 5I1EH 4PD4J 4G42A 2NX5E 4ZUTA 3SGKA 4MVBD 1R24B 1IGJA 3QDMB 4QHKI 3PWPE 4DOHB 5D96C 3O9WD 4JO3H 3AVEA 3ET9F 3QNXB 2VJXA 5DSCB 1T5XA 2IQAA 4IRJD 1RU9H 2IH3B 1C8PA 5EH1A 5CD3A 2GK0A 1JPFA 4HIHB 3MRJA 2GYSA 5FYKU 4HFUH 2OK0H 3X3GH 3LKRA 4GQ9L 3WJLA 1EJOL 3RVUC 3DURA 4H8WC 5INCA 3WS3A 1OP5K 2ZSWB 3DV6A 5EBLA 1TJIH 2W1NA 4FTVA 3WXVH 4ZUUA 1T66D 4ENED 2J2ZA 3SDDA 3IDNA 4X6BA 2WNGA 2VDNH 3FN3A 3G08B 3ZHLA 3LPGA 2EH8L 4PRHD 3QDAA 4F7MB 2CLZB 5BS0A 4ODHL 4ZDHB 4EIZC 3LQZA 1UM5L 3RFZC 4G6AC 5FO9A 4ONOA 3TBVA 5IGXL 4FQLH 1WICA 4MJIA 1YDPA 1T04A 2JTDA 3QUXD 4ODTH 3SCMA 3K80A 1BF8A 5D7KD 4HUVA 3OR7B 3QDHA 4KDWA 3D48R 1Z5LB 3VFTA 1CVRA 4DZBB 5HGBA 2IEPA 3QQ4A 2A1WL 2APVA 2P5ED 1FVCB 3WEXA 4LLMA 1UJ3C 4LSSL 3TM6A 4UAOB 5ETUB 3CIQA 5CKGA 3D3VE 3PHQA 4C83B 4J4PC 4LSRL 2QKIA 3MREB 3IB4A 3UJJH 1J1XL 1WF5A 3VI3E 1ZGLM 1KPVA 2G5BB 3RDTA 3K4DA 5GSRB 3OKMA 1EHLH 2YD7A 1I9RL 2OL3H 3OKEA 4PJ5B 1F4XL 3P11H 5I8OL 1F2XK 4HX1B 1WBZB 2O5YH 5DUPH 3O45B 4GBXC 2P47B 3T2PA 3DVNB 1MFDL 4G3YL 3BVNB 3ARWA 3F58L 2DOCA 2EO1A 1A6WL 1DQQB 3C6LA 5IB5A 2DQGL 1IKFH 3HZVB 4KGJA 1XGTA 2KPNA 3EOBA 3SE4A 3L3DB 1NUNB 4KC3B 5KSAC 2DQIH 1H0DB 3L3GB 4KUZH 1YQ2A 1INQA 1XZ0B 2HG5B 3S88L 4TTGA 4DCQA 3G9AB 5MHSD 1YY8A 4GAGH 5I9QB 2EE9A 3QJFA 5C0FB 3TH3T 4WY7L 2EIZB 2V5MA 5DK0B 2YKLH 2P5WB 1X44A 3FN0L 4IRZH 5A3ID 3I50L 4KVCH 3UTPE 1Y0LA 4EIGB 3KPRD 1FO0B 5DJ2B 3R06B 2BVOB 3KYMA 2V2XB 4G6JH 4LVOB 2VB5A 4HZLB 5CLWA 3SKMB 3AFLA 5IJKC 4QT5B 4PLNC 4I2XA 1RZ8B 3H3PL 1BEYL 3I75A 3VWJD 4HSQA 4FXKB 3PV7A 5FA3B 1D5MA 3MACL 1YMHB 1LEKB 1YECH 1U91A 2X4PB 4JRXD 4R0LB 2HRPL 4LKXA 1X5GA 3R0NA 1NCUA 3UTSA 3MLUH 1ZLVK 4PS4H 5GS1C 4AEHL 4M48H 3QXUA 4J7RA 1U42A 3VGBA 3BQUA 1KB5B 3G5ZB 2IANE 1JK8B 3HR6A 1A7OH 4TNWF 2HFTA 1N7ML 4MAUH 4Y5XC 2AW2A 3IJYB 4Z8FH 2FL5A 4W4NA 2V9RA 1G7HA 2EIEA 2R0ZL 2YD9A 3OAUH 1FSKB 4JM2A 4JFFE 4QHNA 4R8WL 2VL5B 1CT8A 3JWNC 3OXRB 1KEGH 3LS5H 3JTSB 4KJQC 1OM3H 5JQ6H 1BJMA 1K8DA 5FDYA 4JZNA 3T4YB 3ULUD 4QXUL 5T1LD 1YZZA 5EU5A 3IF1B 1D9KA 1T2XA 4KMTH 1DANU 2VRAA 3TN0A 1PZ5B 5IV2B 4R96B 1T1ZB 5HI5C 3EW3B 3SEPA 1KJ2A 3W9DA 4PJ7B 3DLQR 2NYYD 2QSCL 1S7RB 1MJ8H 3NA9L 3IVKA 3EDFA 4HW6A 4NWUL 3AY4C 3NFNA 5JLZB 3EDEA 3DSFH 2CIIB 4LFHD 4L4TD 1NEUA 2AS5M 3ARGC 4Z78A 4WI4A 4KKBC 5JHDA 3EFFB 4BFBD 5DI8B 2YUXA 4EN3D 3KYKH 3F6IA 5FYJH 5INDB 1RIHL 3V6OE 4Z7UE 3DVGA 1P1ZA 2ICEB 2Y06H 1GGCL 4PJXF 2FYYB 4GH7B 1SM3L 1VFMA 4MJ4A 4BH7B 4M5YH 2XA8H 4RZCB 3P30L 5GGUA 4KKLC 3QEUB 3GIVA 5E2UH 5D1XC 4Q0XH 4YHZL 2UWEE 1JF6A 3ZSSA 3C60B 1KBGL 1FNGB 2PTTB 5MI0B 3O8XB 2BZDA 2HN7B 1S7XB 4NO0A 5I1EL 5BVPH 4RMSA 4APQD 3GIZL 5DVKA 4MHHG 4HWZA 3QIWA 4OUOA 4M6OH 1C12B 1NCAL 4H88H 1IEBB 2OK0L 1HQ4A 3X3GL 4NC2B 4P2QE 1T0NB 2XZCH 2YPLB 2LVCA 5CGYD 5MEOA 1UM4H 2OM5A 1XT5A 4N0FA 1OSZA 5E2VL 2DLFH 3DI3B 1TJIL 4P59H 3QIBC 3MRLA 4NN7B 5IVNA 3WXVL 1H3WM 1F3RB 2VDNL 2IF7A 4MA3A 5C0IB 3EYVA 3R8BB 3JWOH 3P0GB 1KOAA 1KGCD 3BJ91 2YOCA 1I7TA 5DZOA 3IDYC 5FM5O 1T1XB 3PG2A 2DQTH 3FRUA 4PJ9A 4OSUH 1U93B 4ODTL 3OKLA 1SEBA 1FFNA 4IRSA 3NMEA 1HHKA 3BUYA 5KOVC 1CG9B 3ILQC 1HH6B 2XG5A 1S78C 2GIYA 5E2WH 3CX5J 5SX5H 4PP2B 2BSTB 2H6PB 3H7BB 2FB4H 3BZEB 5HYFA 4XBPB 3PXJA 4NO2B 1KTDA 1T1YA 2ZCLH 4FABH 4Y5YA 3UJJL 1F90H 5BOZG 4I8DA 2PF6A 4OCLC 3CSGA 5L6YH 4HEME 1F4WH 2EKSB 4YEEA 2OL3L 4GG8A 2IG2H 4EZMA 2EECA 3P11L 5TDOA 5DUPL 1WLHA 2DL2A 4R7NA 2FHCA 1D5BA 1R3LB 4IOFC 5KSBA 2DYPB 2R2HA 4LSVH 2QSTA 5HYJE 1LMKA 1ZANH 43CAA 5HHQB 1TZHA 1RJZA 5CBEA 5ACMA 4QHLA 4U1MB 3HE6A 4OGZA 4LSTL 2DQIL 5DD6B 2M8XA 4KRMB 4K07A 3BKYH 1G9MC 2J7LA 1FL3B 4JPVH 4JN2B 4WRLA 5E00B 2X7LB 3QQ9C 5FYLD 2FRGP 2J1KA 3LD8B 2YKLL 1GC1C 5DEFA 3A6BH 4IRZL 3NFPA 3UROR 3RUGA 4C55A 3NH7H 5JPNB 4Z7WF 4DN4L 1EO8H 15C8H 3CLEH 5GJTH 1JRHI 5ILTH 4ERSH 4NCC2 3S5LB 3ARQA 4LNRB 4PY7A 4G6JL 4KAQL 5T3XD 3VXMA 4U1NA 4C56B 5B22A 2XN9B 4N5ED 3HZYA 3G5VB 4QRSB 2EH7L 2DQCH 4X9FA 3BESR 5C0GB 3DPBA 1HH9B 2FBJH 1MWAH 4I18A 1YECL 4YZFF 4NFDA 3HB3D 1EVUA 3MLUL 1J0KA 4XGZB 4PS4L 3LB6D 4NJAH 1J8HD 3V0VA 2FLRT 1IGTB 4M48L 5EZJA 5ICXA 5IB4B 4XXDB 1FYTE 1I7ZB 5IVOA 4X4MA 1ZHLB 2Z93B 5F1KC 4Z8FL 1KTLB 3QUMH 3JVGC 5HGHA 4ZS6D 3BDBA 3OAUL 4K23H 5L0QC 2ED8A 1L6ZA 4GAYA 3VMNA 1F11A 1JGVH 1CDHA 2AI0H 1KEGL 3LS5L 1G7LA 5FECA 1K4DA 1RQ5A 5EZOH 5HDBF 5JQ6L 1FNHA 1N8ZB 3BWAB 4P4KC 1I1AD 2MTPA 4XB8A 5FUCC 4WHDA 3SBWC 2EKJA 4ZNEA 3BIKB 4JKKA 4KMTL 4QOKB 5HI3D 5HYSG 3QFDA 4WO4D 2AV7A 1IKNA 4LLVA 3PWUA 2OX5A 1M05B 3X17A 1RK0A 1MJ8L 3QDGA 4OKDA 5A2JH 2OR9H 2IGFH 4P2CG 2LAAA 2F53A 4XVTH 3LAFA 4RGNC 5DUBA 3RVTD 3SKNB 4PJDB 5IB3B 3F7PC 2BOBB 4X7DC 3V7AG 3BH9B 4JM4L 3OJVC 3KYKL 1RZGB 4NQSA 2P7TA 2ADGB 4AY0A 5FYJL 2NY2B 1BIIB 5F7YC 3TNMB 4KV5F 2KZ1B 2D4FA 2NCMA 2XA8L 2PYEE 4FQCL 3GSUB 3BYTA 5E2UL 1YEGH 2O5ZH 4WU5A 4Q0XL 4LCCC 1ZT1B 5C09A 1YEHL 4G9DA 2W0KA 1RZJC 2X4TA 4XP4L 4FFZL 1QQDB 4M8QB 4DEPC 4KTYA 1EUUA 4OLZH 4O2CB 3SDCB 1TNNA 9CGTA 5BVPL 1KCUH 2F58H 2P43B 3WFDH 3E1F1 3VCLB 1CGXA 1JNHA 4NDMB 1FHGA 1XF1A 3MCG1 4NN5B 2CDEA 1EVTC 4Z9KB 1IL1B 4MVBC 4ZO8A 1NL0H 1SQ2N 5I8CA 5HHOE 2AQ1A 3O9WC 4HH9A 1RJLB 1RUQL 1VEPA 4L29B 7CGTA 5DVOA 1UM4L 4IRJC 2G2RB 2EDLA 1AE6H 5D71H 2Z31B 2VLRA 4ZAKA 3LMJH 1VGKB 3L7EB 1RIUH 5FIEA 4MZ3A 2XTJD 4P59L 5I1GH 1MHPH 3TEUA 2YXMA 2XI9A 4HKZA 3KLDA 3WHXA 3LEXA 1TDQA 1S5HA 1BAFH 1MJ7H 1GSMA 1PKQA 1NGPL 3O4LD 1IGFH 4EDWH 1LP9E 1T66C 3HNVH 3FHAA 4O00A 2GTZB 4G8FA 3QR2A 4NHUB 4HUKB 3FFCE 4DGIH 5E6IB 2FJFB 3GMRA 5SWZB 3DMMD 4H1LG 5F9WC 1BFOB 2DQTL 2WBJA 2DI9A 4OSUL 1W72B 5D4QA 2GITA 4HUMB 3U9UB 4TQEH 1OGAB 1N6QL 5J8OA 3LKNA 4NQDA 4MNHB 3QUXC 2VAAB 2H3NA 3ZE1E 5E2WL 3B5GA 4L3EE 1P7KB 2V5YA 3HTLX 4V1DB 5AAWA 2H9GB 1FH5H 2HVKB 4C4KO 3O3EB 1LNUA 3D39D 4A6YH 5FB8B 2ZCLL 4Y4HB 4FABL 5EDXA 1JGDB 1F90L 4ETYA 5GPRA 5L6YL 4K94H 1F4WL 4LDOB 1EIBA 5ECJE 1KCSH 4P2OD 3DROB 4IBLT 3ZHDA 3SOBL 2IG2L 2DBLH 3GJFA 1MF2H 1R5IA 2DM3A 3KPOB 4M7LH 3FB8A 3L3OA 2BSSA 1NDGA 3VRLE 2AJ3A 4H25A 1ZANL 1Y6KR 3RNKA 1BZ9B 2BSED 1PYWB 1NCTA 4X9GA 3C5SB 3F7VB 4PJXB 5E94B 1AFVL 3ARVA 1GGUA 1MHEB 1DQMH 4UUJA 5F7DB 1NGWB 2C7UA 3BKYL 3SKUD 4TUOB 3RWDB 3TBYB 1NFDE 4G80B 4MD4B 1Z9OA 5IFAH 4LL9A 1A2YA 2LQRA 2V9TA 3A6BL 1BJ1H 3KPPB 1A5FH 4PD4K 1E4XI 3NH7L 1CGTA 15C8L 3CLEL 3MO1B 5GJTL 5AYUL 2JB6A 2C1PA 3V52H 4ERSL 1I8MB 5GS1A 5F8RC 4BUHA 4PR5A 5A3IC 2P8PB 4Y5XA 3KGRA 3C8KA 3WKML 1MCNA 4FOMA 4ZFGH 2UZIL 3FQXA 4MAYB 1BX2B 2DQCL 4RMRA 4Z77A 2EDFA 3SGEH 1MWAL 4PPTA 1N5YH 4FNLL 4I77H 4JKPH 3TBWA 1MRDH 1PQZB 2P8LB 4U1GB 5DHYA 3VWJC 4DWHA 4N0UA 1N64L 3D69B 4MDIA 5IMLB 8FABA 3QWQB 5JNYA 2CRZA 1J5OH 1HQRA 5I1IH 3LPWA 2ZUXA 1S8DB 1WQVT 2PXYB 4FFWD 4FQ2H 3BN9D 4CU7A 3DOSA 1Z0NA 1WC7A 1A1OA 2HKHH 1QFWI 1XGQA 5JW5B 1U8LA 43C9B 5SX4I 2DAVA 2EDKA 3CFEA 5HYQA 3B3IB 3EO0B 4OFYD 4X6FB 3BDXA 3TA3B 4BA8A 3ARBD 4NQEB 2R0KH 3MJ8A 4JR9H 5EZOL 2EEDA 3RWEA 1EMTH 4LLYB 1JYNA 4Y2OA 4MB4A 4ZQKB 1WFUA 1H3UA 4WW2A 4XNQB 5T33H 4YXKH 2C9AA 3ULUC 4N9OB 4MNGB 3ZE2E 3BW9A 2OR9L 2DIAA 4JQVC 4XVTL 5KG9A 2XZAH 5CSZB 5DS8A 1QO3B 1G9EA 3MRKA 1SMAA 1NGQH 2EXWD 3MRGB 5FA4B 3QXDA 5BQ7B 3NCYS 3VWKB 3BD4A 2FEDD 4UDUA 4WI5A 3QXTA 4X7TB 2E7LC 2WP3T 4M93B 5HGDB 1R3IL 1ZT7A 4JPIB 4NQCD 3AU1B 4EN3C 1J0ZA 1IFHH 3VW3H 3QEQD 1Q94A 1WIPA 2BVPA 3MBED 4I3RH 3HLAA 4LDEB 3SE8H 1U8MB 1T0MB 4NJ9H 1YEGL 2O5ZL 4L9LB 1PGRB 5F1NA 2BOCB 5FO7A 1IC1A 4E5XA 4XPHH 1JTPA 1JNLH 3FQWB 4LCWA 1X5JA 3TBSB 3DVFA 4OLZL 5IR1A 3C8HA 3W0WB 1MCWW 4YBQD 2EDDA 3V4VH 1KCUL 4Z7WB 2DL9A 4NUJA 5E6YA 1MLBB 2F58L 2ITDB 3WFDL 5FKPB 2NZ9D 4LF3A 3LRGA 1G7JB 2J5LC 4K3HA 4LSUH 3LKSB 3Q5YA 4PV9B 4KZEH 2IBBA 4Y4FB 4UOJA 4I2XE 1NL0L 5F88B 3P4MB 1T2JA 3KPLA 1TENA 1MCKA 5TJWK 4J8RA 3U9PL 2WWMD 3EUUA 5D71L 1FQ9C 3U7AA 5BCAA 4I9WD 3WV0A 3MRQB 3ARFD 5GS0H 1WBXB 1RIUL 1KPRA 1MHPL 4Q2ZA 4RAVB 5CGYC 2IJ0C 4V2CB 3I84A 1SJVA 3H9YA 5ID1B 1MJ7L 4ZPVB 3CXHJ 5KSBF 5LAXA 2Y9RT 1BD2E 4M7ZC 1IILE 3CFJB 4EDWL 3ZDYF 4AZ8A 1BBDL 5IK3B 4I4WB 3STLA 1RJYB 3DVIA 1XR8A 4FRWA 2VABB 5IEHA 3FFDA 5D7LD 5EBMB 4WWKB 5KTEL 3KPSE 2J8UA 5D1QB 3U7YL 4JHAH 2XWJB 4TN9A 3IJSA 5J7CC 1F58H 4F2MA 1QLEH 3LKPB 5CJ5A 5I1CL 3ULVF 3IKKA 1U8NB 1CYGA 2MNUA 3H9SB 5BRZD 4DZ8B 3OGCA 3RUGF 3MXWL 5H8DA 5D2NC 4JPWH 1FH5L 4IOIA 1XIWD 4ORGA 3L3HB 4R2GB 1PX4A 1WFNA 4J1UB 1FZOB 1KG0B 2VZSA 1N3NA 3CU7A 4K94L 5EOQH 4KK9D 4G9FB 4EI5B 3VXTB 3SDXA 5FGSA 3HI1B 4Y1AD 3WD5H 3O2VH 2DBLL 1MF2L 2GCYA 2VE6B 1ZT4A 2VZ1A 1F4YL 4WV1C 4M7LL 3UO1H 1Q38A 1UKQA 1NAMA 3B9KB 3MC0A 1B0WA 3U6RA 1AI1L 3IFPA 4M1CC 1MCHA 4NKDB 5IEKB 1IAKA 4FQQA 2DBJA 1L0QA 1MFNA 5T1DH 4O5LL 4OM1H 1IC7L 1A6ZB 3Q5TA 1DQML 1X5FA 4PREA 2Z8WC 2X1QA 3BGFC 3T1FA 5AD0B 1YMMB 3LEVH 4XCNB 5IFAL 4PRPD 4JFQB 1A5FL 1MAMH 5E1AB 1X7QB 3TIDB 1TPXB 1UVQB 2OJEA 1VEOA 3D0LA 1MSPA 3GMOB 1M7XA 3VGHA 1YYMH 4M43L 5I66A 2NY4B 4GMSH 4LVEA 1RZKC 2ORBL 3H7LA 4ZFGL 1ACZA 5E0QA 5JDSA 2FCBA 2J3SA 3CFKA 4NSKB 3V7MA 1NMAL 1FG2B 3U30B 1ORQB 1N5YL 3LH2H 3BJLA 4FQXA 4JKPL 2IPUK 5AYQA 3TVMA 4RIRA 4OGYL 5GGSA 4MNQB 2MOVA 3QDJA 3HB3C 1KTRL 1FNFA 4XPFH 5I1IL 4QRRA 1A7QL 3QIUA 1INEH 3LB6C 2X5PA 3MGOB 3K81A 4FQ2L 3ARDD 3HN3A 3T2OA 4TUKH 1W0YT 3NGBB 5JXED 4PBXA 2HKHL 3MNVA 1GPOH 1XH3A 2P5WD 3STZA 4XHQA 4MX7B 3D9AH 4MLIA 1Y18A 5EC1A 2H8PB 1NJ9A 3QP3A 5AWNH 1P6AB 1RMFH 5BVJA 4ZS6C 3RAJL 4LHUB 4PJEB 3IDMA 1QYGH 4NM8H 3CX5K 1FE8H 4JR9L 1EMTL 3T8XA 5F6HI 4AQ1B 5TGBA 1RHFA 5DO2D 1FFQA 5FOBB 2X1OA 5T33L 3RWGA 1CL7H 3CC5B 4UT9H 4XPTH 5C0AB 1I1AC 4KZDH 5BO1H 5KS9E 4L3CB 3EOAB 1CWVA 4N0YH 1SY6A 3S3PA 5FYJU 5HI4D 3BHBB 5HI3C 3S5LG 3WHE0 1R3JB 4WO4C 4OFPA 4PJGB 1N5AA 1RFDH 3MV7A 1NGQL 1ZGLA 1G0YR 1P2CB 5K59E 1OTTD 5ESVB 3RVTC 4HIIA 1E6JH 1XAUA 3NABH 2VQUA 3WSQH 4OD2A 3OAYH 3RNQA 3MFFA 5ISZD 4W81A 1ZHNA 4Z0XB 5DEGB 1X5AA 4I3RL 4MGXA 4XT1C 3SE8L 1KTKE 3DUUB 3DX6B 4NNXB 3FB5B 1Q9LB 4DUWA 2YD1A 4XPHL 3SY0B 3GUTA 4TUJA 5C0EA 5SWSB 1YJDH 1QFHA 1JGEB 1C5CH 1URLA 2VLKA 4WWID 5IG7A 3GSOB 3V4VL 2I07B 3MRDB 4HLZG 4PRAB 1CIDA 3WDIA 3S37L 4KI5D 3MX0A 2M1KA 3KPQA 4LSUL 4PJCA 4KZEL 3SQBA 2CO7B 4GKZB 3SO3C 4LLDB 5KSVB 1YEKH 3O3AA 3G5YA 4W6YB 1BLNB 3VFGL 5JIKA 3SJVA 3T77A 1NCNA 4LCUA 3IU3A 2VITA 3K2MC 5GS0L 1U8QA 1NCWH 1NKOA 2DQJH 4QRPB 2H32H 3VXRB 4WNQA 4HGKC 2R23B 3DNKA 3QUXA 1FL6B 4X4ME 3CJJA 2XTJC 1ADQA 1BF2A 5DRWA 1ERNA 1OQOA 4MSWB 1IJ9A 2HT3D 4RWYL 3PHSA 3CDGA 3UYOD 1JMXA 1DN0B 4K71B 3NZ8B 5GS2H 1MPAL 4HHAB 4YAQA 1Q72H 3LDBC 3TJHC 3QHTC 3PGCA 4JHWH 2XFXB 3MRRB 5MEPB 4JHAL 1UZ8B 3SGDI 1DFBL 5B8CA 2UY6A 4MJ6A 4XNUH 3DMMC 3JV6B 4O2EA 4QYOB 2NTSP 1QLEL 3HE7D 2RJMA 1IM9B 1I3GH 3ALPA 2VC2H 5DD1H 4GUPB 3HAEA 4OQTA 4OTXH 2BY3A 3GMMA 4PGEA 1QFWM 4D9RD 4LVNB 3JBG7 4UQ2B 5I73B 4Z95H 4JPWL 4Q9CA 3U83A 2YPLD 3GO1H 1DUZB 5GRJH 5LWYL 4J12A 4GRWF 2R2CA 3RWHA 5E9DE 2F53E 2QR0A 5MENE 1A47A 5EOQL 2ADIB 1EHNA 1WISA 2APXA 5D5MA 4GO6B 4X8JB 3QUYD 5F1IA 3WD5L 4MJ5A 3O2VL 3S4SA 4N0RA 1OPGH 1MAJA 1FN4A 4YXLL 1PSKL 4Q9BA 5I18H 4BK4A 4YDVB 1UG9A 1MNUH 3ILPB 4P2OC 3BGAA 4LBEB 3UO1L 3RWJA 4EOWH 4P5KA 5D1ZB 2JJWA 2VISB 4HDIB 3ZYZA 4QRQB 2GJ6D 1OD9A 5T1DL 2A0LD 1JPGA 3OQ3B 3T0EB 1KN4H 2Y7QA 3FRPG 1AGDB 1MCSA 3R4DA 2A6DB 3LEVL 4XRCB 1F6FB 1XGUB 2XTLA 1HSBA 1MAML 2JCCB 1KJ2H 2AERT 1AP2B 4LSQH 3E8UH 5GSVA 1UYWH 5T3ZE 2Z35B 5EO0B 5EBWB 4ZUWB 5L8JB 2LVEA 4JRXA 2EDHA 2GSIB 1OB1B 1IVLA 3QFJB 2ZOLA 4WW2F 5C0JB 1YYML 4FXGA 5DJDB 5IOPA 4HMDA 4GMSL 3V6ZA 4Y19D 1NLBH 3C6SB 3Q3GA 1A4JA 3I02B 4UT7H 4HK0A 3UCRA 2P8MA 4X6CB 2R1YA 4D8PB 1EV2E 4LCYA 3SPVB 2BSRB 2G5RA 1AKJB 4HV8B 3RHWK 2YS4A 3TCLA 2YEZB 1FG9C 1ETZB 3G04B 4XPFL 4I0PA 5D7IF 3VFVA 2IQ9L 3FONB 3HUJA 5HVHB 4JFPB 1KF9B 3L3KA 5IMKA 5DK2A 3FQNA 3TBTB 1U3HB 1QSFA 3HS0A 3OR6A 1GPOL 4NIKB 4FFWC 1H3GA 3D9AL 5DMYA 3BN9C 2X1WL 5AWNL 5FHAH 1RMFL 1LEIB 4JQVA 4N9GA 3C2AH 3BZ4A 5DK3A 5C3TA 4NM8L 1HWGB 3OXSB 4Y16D 1JV5B 2Q76B 4N8VG 4L1DA 3ZT6A 2EIBA 2E7LA 3ARBC 2XN9D 4XNXH 3QQ3A 2EE3A 1CL7L 2VDLL 1I8IA 1BQHA 4U6VH 4UT9L 4XPTL 2GY7B 2CRMA 4KZDL 5BO1L 4B5EA 1LQSR 4JFXA 4N0YL 3R1GL 2JJUA 3RTQD 2LE9A 3BKCL 3GBLA 4JKLA 3EGSA 4U1KB 1JZ5A 5ADPH 1X5LA