3TN0D

Structure of mouse va14vb8.2nkt tcr-mouse cd1d-a-c-galactosylceramide complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
242
structure length
235
Chain Sequence
AVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGEQFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NKT TCR Recognition of CD1d-{alpha}-C-Galactosylceramide.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 50
structure length 235
sequence length 242
ec nomenclature
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3tn0D02
4YC2C 4EQ3A 4HV8A 1LO3H 3HFMH 5C3LD 1DFBH 1BHGA 4JRYA 1OB1A 3PXJA 5CSGA 4ZPTB 3PDOA 2FBJH 3WFHB 2YOCA 2XQBL 5E2UL 2QHRL 4APQA 3BZEB 3HR6A 4AY0A 3ESVF 5MP6L 1UYWH 4QT5B 2YC1A 3QUYB 2CDFA 1A4JA 2A9NH 2VQ1A 3MRLA 3DO3A 4L1HA 3SCMC 4FQ1L 1HI6B 1HI6A 5BOPA 15C8L 3T0VA 1RJLB 3UX9B 4N1EA 2EE9A 2DJUA 1UWGL 3KPSA 3WDJA 3BAEH 5C0DA 3ZTJG 4RGNB 1SBBA 3PGCB 4HPOL 1JGLH 3IXAB 3UJTL 2VKWA 1QBML 1EUUA 4NGHL 1NUDA 1AP2B 1G9NL 4G3YL 5EOCJ 4KI5D 2XWBA 3MRFB 3D0LA 4Y0GA 5BS0B 1O7SA 5MEQA 3T0EC 5F70A 1MHEB 3IDNA 2CUIA 1GJIA 4P9HL 4X6EA 1P9MA 4DN4L 2N56A 1NBYA 2EDDA 4POYA 4G9FE 5E6YA 1UKTA 1WTLA 4KI5F 4CU7A 3MLTB 3MLTA 4XWOC 2FJHA 4LCIH 4M3JA 4UV4H 5DHVH 1DLFL 3OKDB 4KK8C 3QIUB 4KU1A 3SO3B 3UROR 5HYQA 5I66A 4LSUL 2BY0A 4CU6A 2I60H 1HEZB 4O4YL 4ZO9A 4KVCL 1XGRA 3JWDH 4QHKJ 4RA3A 1RZFL 3PWVA 4NN5B 4Y5YB 4EXKA 3TN0A 4WNQB 2NY4B 7FABL 3RWHB 1U6AL 4P49A 3FZUD 3D39D 3RVVC 3VFUB 1N3NB 1F45A 1B6DA 5DI8B 5FYJD 2A2QT 1DVFB 1HH6A 1AGEB 2P8MB 4PLJC 3RU8L 4JPVH 4K3EH 3H9SD 5BZWA 3N1QC 5FUZL 1YEEH 1EIBA 1WITA 1GL4B 3H9SB 8FABA 1JNLH 4ZUUB 3CSPA 4KKCC 1X6LA 4EN3A 2CR3A 4OJFL 5I73B 4OCLC 4JFYA 5FO9A 3LOWA 4BM7A 1NBZA 3RIAK 1U41A 2IADB 3MPCA 2NY4D 2P5EE 2DMCA 3BP7B 4N0UB 1KSRA 1NBVH 5L2KE 3WFEL 2AI0H 3A6BH 1LQSR 2LTQC 1A0QH 4P57A 3VMPA 4TOYH 3TJEH 3HMXH 2I9TB 1OWWA 3OV6A 4HX1A 3Q5YA 1G9MC 5CJQL 3HAEA 1TVDA 4NQUA 3MNWA 5SWQB 5FOBB 3H7BB 5I1KH 4P2OB 3WSQH 2FHCA 3VFWA 5F89B 1J18A 1IGML 1IM3A 2C1OA 4PV9B 5F8QC 2QL1A 3K2UH 3VWKA 2Y07L 4NKQB 2VDPL 4FP8L 4PS4L 2H45A 4ACPA 3VXSB 4M1CC 4PB9L 1P7HL 2PTTA 3NN8A 3O11A 3QCVH 4FFVD 3WEXB 1AJ7H 1JMZA 3DRTB 3GSQA 4L8DA 1NDGA 4IOIA 5BQ7A 5BQ7B 2APTA 5DK3A 4YXKH 5ELIA 2CLZB 1CQYA 1E6OH 5C0BE 1MFNA 2DMKA 2AP2A 4YHOL 4NHUB 5BCAA 5K59F 4KZEH 4N90E 3UBXI 4MLIA 3UPRB 4GKZA 4NBYB 1HH9B 4PJGF 2XWTB 1DE4A 5E8PB 4U4BA 5DC4B 4KVNL 4KRNA 5CZVL 1UZ8B 3F8UB 4JE4B 1NFDF 5GGSY 1AGDA 3B9KB 4O9HH 2J88H 1V3JA 4FFWD 1TTFA 3QRGL 3IRZA 4PJFA 1CICA 5E03A 1UM6L 3LPFA 4NQTA 1IBGL 3EDDA 4GSDL 3MROB 3BE1L 1OP3H 3RTQC 2IWGA 1G7PB 2R23A 1G7PA 2R23B 2C4FU 5IMLB 5H2BA 2D31A 4XZUA 2APFA 2ADGA 4M48L 4XPTL 3QDJD 4HUMB 2NY5L 1B0WA 3EOBB 4X6CF 4C54A 1K6QL 4GUPA 5T1MA 3UPCA 3BPOC 3V79C 4XPGH 1J0JA 1QUNA 2HN7A 1I9IL 4OB5H 1LE5A 3CX2A 4W6WB 3BSZL 3KLAB 2KKQA 5HHME 3GI8L 4K94C 5I17B 1WGOA 1UB5B 1M7IB 4R3SB 4F9PC 2VSCA 5IMMB 3O81A 4CW1A 1UVQA 4ZYKA 3GSVB 2FSEB 2X4TB 3WE6A 1F90L 1GOFA 3NZHH 4J4PA 4JPWL 1A9BA 4YFEA 5F1KC 3P9MB 3BEWA 2FB4H 2AERT 4U6YA 3C5SB 3LIZH 4KKCD 2XZAH 4XP5L 4HF5L 3RVWD 3VGEA 3S37L 5DEFB 3E2HC 5HHNB 3WUWA 5DD0H 1NBVL 3RKPA 4F80A 5D7KD 2UZIL 3P0YL 2GTZA 3CSYA 4OBRA 3VA2C 4ONFL 1MJJB 5GGQH 3DX6A 4UDUB 4UDUA 3E6FB 2YD5A 3R1GH 4P2RB 3S35X 5C9JB 1FE8H 3QEGH 5EUOA 2R69L 2CLRA 4XPBH 2X9XA 2GKIA 1DUYB 4DGIH 4NRYB 3VFTA 3MBEB 1NGXB 4U3CA 4OQTH 5DC9B 2YXMA 2VKXA 1LGVA 4POUB 3EOAB 2ZG3A 3MRGA 4Z78B 3E3QC 4ODTH 5DTFA 1CTNA 1MWAL 4ALAH 5EOQH 2E5EA 4HEPG 1ERNA 4TPRL 2ZSWA 4ZUWB 2A9NL 4MXVE 4NNYB 3CFDB 1YEFH 1U8QB 2GT9B 5GS0D 5A2IH 2W0KA 3QWOB 3QWOA 4JFXB 1L7TL 4JFXA 2Y4SA 1HXYA 4TNWF 1Q94A 1TQBB 3VXPA 5F9OH 3X14A 1FYTD 5IGXL 2F58H 1A9EB 1T1YB 4M7LT 1MI5A 1D6VH 1QRNE 3KXFD 4H25A 3M45A 2R4SH 3CFJB 4PB9H 4PGBA 2K7PA 1MUJB 2VUYA 4QYOB 4HJJH 3D18A 4X9GA 3EYFB 3O3EB 4H26A 1YNLL 4PJXB 4MDJA 1YY9D 1N7MH 3BKCL 2BNRD 5F7FA 2I25N 3VXTA 4DKDC 4Y5YC 3PIQA 2ED8A 4P23A 4XC3L 3MXVL 1IKFH 2DL9A 1ACYH 4QXGH 5BV7C 1R3HA 2AXGB 2NX5B 2AXGA 2NX5A 4HAGA 3RPKA 4R97C 2W60A 2FEDD 1BD2E 3CFBA 2C9AA 2R8SL 5ICZA 1FZKB 4JKPH 1KTKE 4KV5F 3QG6A 1QSZA 1SY6H 2GAZA 1UZ6E 3GJFB 4N0UE 1BVLA 2A1WL 1HXMA 5L2KB 5CP3A 1WQVT 4JM2F 4P4RA 3GIVA 3AM8C 3FB5A 3OPZL 3RKDD 4F58L 4HMDA 3VFMB 1U2CA 1XGQA 3GSXA 4U7SA 2AABL 4WU5A 1WCQA 3OR7A 4RIRB 1QFWH 1IGTA 1F90H 1JWMB 1JF1A 1BD2D 2DIAA 5E4EC 2ICWI 2KZ1B 4Y5VA 4PJIA 5IW6B 4K9EC 2QKIA 3BIKB 4HS3A 3VWJA 4O58L 2IBZY 4DVBB 4WI9A 3FHAA 1JHKH 4HS6B 4HF5H 4OKVA 3P40A 4X8XA 2NY7H 1JFQL 2OL3H 4YFLF 4L3AA 3TH4T 3KVQA 4IDJH 3T8XB 2IPTH 3PHQB 1E4KA 3MLYL 4RBPK 1A6TA 3O3AB 4TUOB 1HYSD 4I3GA 1KUMA 2ESVA 3AS0A 1YPZB 2NTFB 1CGVA 4JHBA 2QADC 2YMXL 1WAAE 2GYSA 1K5NA 1LK2A 2ED9A 3GKWH 1E0OB 1QRKA 3TEUA 1JGDA 2VDLL 4XGZB 1IQDB 5BRZA 4YZFE 1BOGB 2BJML 2HJFA 4PJ7F 3B9EA 3I6LE 3FFDB 4HFWB 4L4VA 4LSRH 1DBAL 1WBYB 4ONFH 1BIIA 3C6LC 4R6UA 3H9YA 4X4ME 4WJ5B 5EPMB 2B2XH 2X9YA 4JCMA 3ETBF 4NO5A 2HKFL 3I3DA 1ZLVH 3MLWH 4HG4K 4LNRA 3P4OB 3TVMB 1UADC 2OJEB 3TVMC 5DUPL 1EK3A 1RK0A 4XC3H 1EFXA 2W07A 2NY6D 4Z7WE 4MS8C 1KNOB 4K3HA 3PGDA 4ZUSB 2B1HH 1P4BL 5GGRA 3TNNA 3MJ9L 4X6DE 2D0HA 5CBEA 3B6SA 4NP4L 4TN9A 2H6PA 1ZGLA 3H3PL 1GIGL 4WEBH 5F3BB 3DHMA 3D2UD 5DO2D 5T1LB 4DAGL 4NHCH 1IMHC 3VXMB 3I02A 4O5LL 4RNRB 1I7UA 1ZAGA 1KIQA 4HZLB 3HZVA 3BP6A 3NIDE 4BFBD 3BPCA 2DL2A 3GSNA 1K2DB 2NY5H 1EEQA 1UCBL 3U1SH 2FX9L 4AM0A 3WFBL 5IHUL 3BI9X 4ZSOA 3SGKC 3LDBC 3IDIB 3IJYB 2P5EB 4KHTL 5DJ6B 1IAIH 1DBJH 1TJHL 1TVBA 3VFSA 2FEDC 5INCA 1A7BA 3ROLA 1QKZL 1KYOJ 4UTAL 4L4JA 1K85A 1TQBC 2BHUA 3REVA 1H3UA 4JRWA 2ADFH 4XAWL 2X89D 1WWAX 1INQB 3F7YB 3MRDB 3LN4B 3PF2A 1GC1C 3V5HA 4MNGA 2ITDB 4ISVB 4CADB 4FQXA 3OG4B 4FQXB 2VLMD 4I2XB 4JG0H 4U6XB 2EE2A 3BPOB 3FN9A 5CWSB 5CWSA 3CFEB 4XMKL 4YFDB 3RWCB 3EYSL 3STZB 2PTVA 3QUXB 2UYLB 3RGVC 4ELME 5BJTB 1VACB 5TF1L 1JWSB 1NEZA 1XCTA 3VFPA 2EEAA 1AQKH 1JYWA 2NY1D 1N4XH 5I6XC 1F42A 3L3JB 4PTTA 5GGSB 4NZUL 4YE4L 1V3KA 2DQHH 5T3XD 3BWUC 1I9JL 3MZTA 5GQBA 1I9RL 3A0OA 2EYRB 5JXED 1YQVH 2NY2C 3TPUB 5FO7A 3UTTA 1DQLL 5ERWB 3VFRA 3DX8B 3SE9H 2AEQH 4RWHA 3MRKB 3MRKA 3HI1B 3RQ3A 3TBYB 1J88A 3DBXB 4OD1H 1KCUH 2Y7QB 2XN9A 1MHPH 1JWUB 5E7BA 3ARGC 3U9UA 3U9UB 1WVZA 5CLWA 3OJ2C 5EIIA 4YDVB 1WFTA 5D5MA 2APBA 3SQOH 3HG1B 5ESQA 4MD5A 4AT6B 1ZVHA 3IGAA 3MRNA 3MUZ1 5FUOL 5HVWA 2CD0A 1DBAH 1CFNA 1UB6A 1I3RA 5LG1A 2AEWA 1WZ1H 5DD5H 1KTLB 3H3BC 3OXRB 3ARTA 3B83A 5F9AC 2YSSB 3HTLX 1GGIH 1GGYA 1NGZA 3NPZB 2ICCA 2NY0B 3QG7L 5E2TH 5C0AA 4LBEB 1I3GL 4G42A 2XTJB 1I1AD 1TIUA 3ARBA 5JDJA 4R90L 1MCOL 2EDHA 1IQWH 3VXUB 3AGVA 2C4XA 2DKSA 3X13B 2PW2A 5D72H 4ODUB 2FJGA 4H0GA 1D5ZB 2E7CA 2X6MA 5FXCH 5GRUH 4P46A 4MAUH 3LRGA 3KAAA 1BFOA 1IAMA 4P59H 5GSRB 3BN9D 1DEEA 3MRPA 4WFFE 1ROWA 1UM5L 1P7KA 5ESAA 2LFGA 4P2RE 4XRCB 5EBMA 3WNLA 1K8IA 5IW3A 4ODWB 2X1OA 4S0TD 1VFAB 3PV6A 1NCDH 5CJ5A 1D5BB 4YHLH 2R4RL 5TE4L 4QHMA 4P46D 1CDYA 4QHUA 2Q8BH 2DDQL 4TRPH 3ARGD 4PJBF 2OJZH 3BH8B 3QEQB 3C9NB 1G9MH 2QJDA 1H0DA 2OQJA 5CP7A 3NZHL 3VFVA 4PJHE 1XR8A 4C58B 4KI5C 3TBVA 3OKLB 3U0PA 3O2DH 4XC1L 3G5VA 1AO7B 5JW3L 2YA0A 4QRUB 3HA0A 2DMBA 3BRGC 4R9HA 3PQYE 1P1ZB 1P1ZA 5E6ZA 3P2TA 2EKSB 1IM9D 1YEDA 4NQEE 4P3CL 4K3GA 4OJFH 1HHJB 4UTBL 1F4YL 3IS0X 4R4BA 1C1EH 4H1LG 4D0DA 25C8L 4IRSC 4ZXBB 4LLUB 1CN4A 4U6TA 2W0LA 3ULUE 1IAOA 1FCGA 4JHWL 4YEEA 3I9GH 4AEFA 5ILTH 2GJ6A 1T6WA 3QULB 4L3CA 5T1LD 4OD3H 3I84A 1S78C 1UWEL 2EC9U 4UV7L 2W0FA 4U1SB 5D8JH 1VDGA 1D7FA 1N5AA 3EHBC 1BGXL 2WUCH 4YO0B 3IFOB 4Q9RH 4YHKL 2AJUH 3BPLB 1ORSB 1F58L 1OF2A 1FIGH 4LCYA 5K9OB 4L8BA 4NRZA 4HDIB 3BP5A 4HWUA 4CDHA 2RJMA 1AXSB 1G7MA 1RK1A 2ZCLL 2OK0L 2ADIA 1CD1B 3TA3B 3T09A 5IB1B 1OAYL 1MHPL 2AXFA 1Q9KA 3PWPD 3QJHB 3X3FL 4LGSB 2GJ6E 2RQ8A 2XY2A 3KPSD 1II4E 5L7XH 3W5NA 4G8EA 2HP4A 1CL7L 2VL5A 1CXFA 2GFBA 3WFDL 1UCBH 2I07B 4NKMB 4HIIB 4NKMA 5EFIA 1S7SB 1ZANH 1KV3A 4NM8L 3V5KA 3GMRB 3MLVH 4MB4A 3ZE1E 2P5WA 2Y23A 4FXGA 5FF6B 4POZC 4AL8H 2C7UB 1H15B 3P0VL 4UINH 2N7AA 4M1CD 5DMYA 2IPKB 4P59L 3V7MA 2I5YH 1IKNC 3T2NL 1RIVH 4YXLH 3V8OA 2AAVA 4L4TA 3ULVC 3SEPA 2RCSL 3WN5A 4RMWA 2IG2L 3GSUA 2A1WH 2ZUSA 4ZO8A 1KCSH 1OAKL 4NWTL 3RWFB 1OSZB 3UTSA 1JZ4A 1SEQH 3TM6A 4U7MA 4LDEB 1LO0L 5KG9A 1T04A 1AKJB 1LO2L 5EOTA 4BH8A 4PYGA 4GAYA 1GAFL 3I6LD 2NQCA 3LVEA 2F53E 3QUML 3QHFL 1IARB 1X9QA 3IAPA 3T77A 3V6OE 4F15B 1G7JA 6FABL 4JPKL 1ES0B 4GRLB 1I7ZB 1NGWB 3T4AB 4GXUN 2X09A 4NO3B 1BBJB 2P7TA 4X7DC 4D9LL 1CXLA 1RULH 5DT1H 3GBLA 4Z8FL 2L7JA 1VSCA 3HRZA 1YEHL 1P7QD 3CLEH 1CG9A 1I9RH 1NEZG 3IAQA 1MFCL 4PLOB 1NFDE 5F7LB 4CU8A 2IJ0C 4U1GC 2BVPB 2NTSP 1PG7H 4P2QD 4JLRA 1BM3H 1KCLA 4QXUH 2FO4B 1RIHL 3U6RA 3RWJB 4X6FA 1F4WL 1MIEL 3C6SA 3OAZK 4FMFA 2G75B 3PQYA 1EJ6A 1FSKB 1P84K 3GBNH 3PWUB 3WIHA 2VTFA 4GG6E 1I3UA 3I6GB 3QQ3B 5EWIH 5I1HH 1A47A 3SGDH 4D0CA 3M1BA 1KFAH 3SPVA 3FRUA 2WBJB 3PV7A 4NZRH 4K2UH 4M7ZB 5FKPA 1CXEA 3T4YA 1UG9A 1ADQL 4AH2A 4X4XB 5JXEA 3L6FA 1PLGH 4QY8B 1EVUA 4K7FA 3AREA 3BXNA 3NGBB 5IFJA 3KGRA 4X80H 3I6KA 3MV7B 1O0VA 4N5ED 4I48B 5C0BA 4E42B 1HHGB 3AVEA 1MY5A 2Q3ZA 3MRJA 5E8NB 2I9LB 1WT5C 12E8L 1XGUB 4ZFOL 2QTEA 2VXVH 1D6VL 3LPWA 2I26N 2JIXB 5IR1B 1N2RA 2NR6C 5HHPB 4LHUA 3T2OA 4R2GC 3QDGE 3VW3H 2ATKB 2APVA 3KLSA 4MXWH 5D1ZA 2PF6A 2CMRL 1NAML 2RFXA 1FNHA 4NBXB 3KLHC 1LWRA 1XGYH 2IH1A 4JO4L 4Y4KB 4GMSH 2W0PA 2JB5L 5BW7A 2Q8AL 3SBWA 2AXHA 3VDCA 5E99L 3JBG7 4ZMAT 4U6VH 3CGTA 1T4KA 3C08H 1MH5B 4HK3J 1HILA 4BKLB 2HKHH 1QQDA 1G1YA 4NNXB 3D3VB 5B8CC 1KXVC 5D93C 5I1DB 4HIJA 4PB0L 3DVNB 3H42H 5E6IC 3GMMB 1VEOA 1WEJH 3BD5A 3RZCD 2HT3C 2VR4A 3PP3K 5IBTL 4Y5XC 4AMKL 1NCBL 1PG7L 5D7KE 4LDLB 4I9WE 1AI1L 5CEZE 4LF3B 5DR5L 1HKLL 3ARDA 2NY3B 2CK2A 4IDJL 3OKOB 1TZGL 1CE1L 1JRHI 5HDQL 5FK9B 2P8PA 1NMAH 4PJ5B 1H3PL 4XBGB 5AG8A 2X4NB 3GNML 2K9UA 2HFFB 3VXRD 2QADB 4K3DH 3DMMC 4R4FL 4X6DA 1QBBA 3PL6C 3MMEB 3O6ML 1T89A 1OAUL 3S5LA 3FONA 3INUH 3GJFH 2R56H 1DBBH 4OZIF 3NIDF 1FIEA 4OLWH 2HRPH 4LVOB 1OM3L 3D25A 1SHMA 4L8SA 3TO4B 3K2MC 5GGVL 2VZTA 3MV7E 4XBPA 4C83B 2HTLC 3WIFA 4K3JH 2GCYB 4BK4A 2VISB 2ZOKB 3K7UA 4I0PA 5J0BA 4MX7B 5E08L 1J0KA 4U33A 4IRSD 5E5MB 1ZE3C 2V2WB 1OL0A 3G6AB 1E4KC 5IROA 1JZ2A 1EXUA 3MYJB 3MYJA 3RWDB 2CXKA 1KT2A 3HE6D 1YMHB 5SX5H 3W0WA 4RAHA 4PRHA 5DD6B 4HLZG 5F6HJ 1QFOA 3HUJA 3UYOD 3KPSB 4S1SH 5LXGH 3VWJC 4XCNA 3LS4L 1K4CA 4KKAC 4PD4K 3S4SB 3EYVB 1E4XI 4ZUUA 3QEHA 1F3DJ 2A6JB 2AJYL 3IJHB 5HHVL 5HHXL 5D7LB 3C09B 4KTEH 4JZJA 1CFTB 2V9QA 1JL8A 3QUZD 5IESL 4J3UA 4GRLC 1S7VB 1CICC 5GS0L 5KAQG 3EYUH 4XCEA 2GHWB 5BOZG 3KHOA 4NSKA 3BD3A 1PYWB 3KPQB 3L3HB 1FBIL 4OIAA 1I9JH 3LKQA 1A6ZB 2FX7L 3TIDA 3FB7A 1HDMA 4RX4A 5D4QA 3W39A 3WXVH 4H0IA 1TETH 4P2OA 1F4XL 1KENH 3MUGB 4Y8AA 5F71A 3SE9L 3ZT7A 2J5LC 5GIRA 1YN7A 3HCVA 2FYYB 5C86A 1Q0YL 3BP4B 3O41B 3VGBA 5D7IF 3ULSA 2ILLA 5GGTA 3V0WL 2XPGB 3RZCC 5I30H 5C0CB 2HLAB 4I4WA 3M8OH 1I8IA 3GHEL 1TDQA 3QR2A 2FBOJ 2VE6A 3T1WA 3MBXL 5FGBA 5SV4A 5EU7E 3TO4D 3WNKA 3NFPA 4MCZB 3SJVD 1WAAA 4O02H 2CIIB 1FGVL 4JJHA 3EO1B 3C60C 4GRWF 1A7NH 4GAFB 5IROC 1CCZA 1LO5A 5H37G 4KRMB 3N85L 3NCYP 2NW2B 1ZLWK 4D9RD 2XQBH 1OAXH 5EO0A 4HKXA 4OTXL 4PJEE 4QRPE 1Q9WB 4OFYA 3R0MA 4KQ4H 1CLYH 3CVHL 4AJ0A 4NC1E 5C0GB 4DJMA 1G6VK 2DLFL 4N0FB 3TV3H 4PY7A 5GJTL 3WHXA 4GFTB 5KVDL 3D69B 4RFNC 4LIQH 1YPZE 4Y2DB 2BVEA 5KSAA 4LPCA 4Q0XH 4PY8I 3TPKA 2AGJH 4YGAB 2DM3A 4KK8D 4CDGC 1U8MA 2HN7B 4POZD 2GK0A 1U3HC 4M4PA 3RZCB 3O8XA 4HT1L 3ULVL 3ZE1F 4NYLB 2XICA 3CLFL 1CVRA 2H3NB 4HZAA 1JI2A 2HFEA 4W6YB 1OLLA 4C56B 5F9WC 3LH2H 3VGAC 2FR4A 2O5XL 1BD2A 5D2LA 1QPPA 3UTSE 1VADB 2CUMA 3RA7H 4BH7A 1I1YB 3S88L 3WE6B 5I0DA 3QZWG 5GGTL 3ES6A 1INDL 1FRGL 4MWFA 4UDTA 1VESA 5BMFL 3O9WC 2E9IA 2ZPKH 5DEFA 4PGJA 4KV5E 3L5HA 3TN0D 2IG2H 3DLQR 5C92A 1VEMA 3LSOA 4Z0XA 4Z0XB 5DSCA 4JGJA 1S9KC 3N1PC 3GBML 4F7MB 4Z6AT 2OR7A 1ZT4A 1QRNB 4XNQA 4JJ5A 3DOSA 4P2OC 4LASL 4WW1B 4NQSB 3EOBA 3RHWK 3NMEA 4E9LA 3LKNA 3ILPA 5J1AB 1F00I 4YHZL 1CR9H 1JHTA 2VABA 4Z7NF 3U4AA 5D71H 3LEVH 3VG9C 4UU9B 4ODVH 3OGOE 4XXCA 4BFIB 2IPTL 3WIIH 1YPZF 4TVPH 4GS7C 3MJ8A 4X9HA 5DFWH 1SMOA 4GRMA 3MV8E 3TT1H 3QQ9C 3I85A 3MCKA 2P8LB 4MXVF 1U3HD 2IQ9H 4N0YH 3K74B 1R0AL 3C5JB 1ETZA 2VZVA 3C5JA 4GRWH 4KK6C 2EXWC 5JNYA 4NCDA 4YQXL 2HKFH 5AZEH 4QT5A 2HWZH 5J56B 3STLA 3D0VB 5IVNA 3IVKA 2CKBA 1ZOXA 2UUDK 3MA9L 3PWJB 4UNVA 3CH1B 4PV8A 4EI6B 5HDOA 5I1JH 4PJFE 2E6PA 5I74B 2WUBH 2X1PA 4NT6B 1KACB 5EOCL 1NLDL 3CSGA 1LK3L 4HK0B 2XG4A 2J4WH 4XBEL 2WIIA 4M02A 4P46C 3RDTB 2O5YL 5LCVH 4PGEA 4Z76A 3LV3A 3TYGH 3P11H 4ZDHB 1OAZL 3WS3B 1RJZA 1RJZB 5FUCC 1NANH 2QSCL 1QR1B 3MACH 1PX4A 4R7DB 2E7HA 3VFTB 1J1OL 1MCWM 3WJJA 1XR9A 5I1HL 1D5XA 4EVNB 3PGFH 2RHEA 1QSEE 4HIEB 3ME0A 2YUVA 3QEUA 1MCCA 5A1AA 5DVLA 4U31A 2YK1L 4NDMB 4OCRH 1GIGH 1QR4A 3HE7A 5DUBA 4OLYL 1NJ9B 1J9CT 5I66B 2RCSH 3SOBL 1RUQL 1F02I 3KPMA 1BVLB 1NFKA 1JYNA 2VN4A 4FFVC 1S5HA 5KSUB 1JPST 4U7KA 1KULA 3RWHA 3RNKB 4E41E 2CSPA 2DQTH 2X4UA 5F96L 4M3KB 3ZE2E 2FX8H 1XGQB 3OR7B 4RIRA 5KS9B 5KS9A 2NY6C 3GBMH 4MS8D 4V1DE 4JM2D 1XF3B 1XF3A 2QSTA 3ZDZE 1CDUA 5ENWA 4CNIB 4YDLB 1RZGA 4LPUA 3RDTC 5HHOE 2IALA 1CDHA 4MDJB 3PE9A 2X1QA 2EDOA 2PYEA 3EHBD 5FHBH 2F15A 2JB6A 1JPGA 1HWHB 1I3VA 2IANB 4PJCB 5FYLD 3LKOB 3LKOA 1N6QL 2BNUB 1MAKA 2WM0A 3GJFK 4CJ1A 3T2QA 4NJ9H 1XF4A 4JG1L 1MWAB 1I1FA 1PZ5B 1A3LH 3JZ7A 3IKCB 1X5ZA 4XVSL 2HYMA 1Q72H 1L7TH 3QG6B 3ZL4L 5AZEL 3H7BA 5ACLA 5L2KA 4OZFA 1LO3L 1KB5L 1WFNA 4HMEA 1IM3B 3W11C 4UAOB 3WN5C 4LSSL 3IDJB 3FAXA 3VWJD 2CK0H 3NZ8A 3QNYB 3QNYA 4YBHA 5EPMA 1SYVA 2VDNL 3G6JE 3TH2T 1T7ZA 2O5ZL 3BKJH 2DI7A 4ZFGH 4K55A 1FQ9C 4GXVH 4RFEB 4OQTL 1RZJL 2FD6L 3BVNA 3KYOB 4HG4J 1M4KA 2MWCA 2M1KA 3LEVL 1OSPL 1MRDH 4MJ5A 1E4WH 2R2BA 1NMAL 4QXTA 5BVJA 3ULUC 4JKMA 3VDBA 3JTSB 4GKZB 1JZ7A 1AD0B 4UBDD 4OI7A 5J11B 4JM2B 4HGMA 5HHQB 4BQ9A 2DQEL 2R0ZL 5IHZB 2V5YA 2PYFB 5JXEC 1J12A 1Z0NA 4DN3L 5HVHC 2HWZL 2FECL 4JHZA 3OKNB 4FOMA 1J0ZA 3OKNA 4MVBD 4EDXB 1NH6A 5F9JB 1FVEA 1TCMA 3AU1B 2MPAH 4O51B 3BPCB 1I8MB 4ELMA 4ELMB 2FL5B 5TE6H 5H2BB 3GSNH 5JW4Q 4AIZA 5FV1L 1CGWA 1JF6A 4ZQKA 1BX2A 1U92B 5CEXB 1ZHNA 2J8UA 4J8RA 4XBEH 3S8WA 2O61A 4K3JL 2OLDA 4YWGL 1BWMA 1CLOH 1EEUA 2DJSA 5FGRA 1EH9A 2ORBH 3BYYA 3RIFF 3V6ZA 1NGYB 1NMBH 5DD3H 7FABH 3W11D 4M9PA 3TVMA 3C60D 1PY4A 3TZVC 1W8NA 3RVUC 4D9QE 3MV9E 4QF1A 4X5LA 1RJYB 3HR5B 2CDEB 1RK0B 4JN2B 4MJIE 1DN0B 3T08A 5M95B 1YEKH 5DJAB 1MRFH 3QEQD 1V7MH 4XCYB 3OB0H 5HVGB 3RDTD 4I3SH 2ZUQC 1BLNB 1RUQH 2ZSVB 1C16B 2AJYH 1TZIA 3JV5A 3PABA 1D3CA 5FGCE 5EN2B 1DR9A 1LDPL 3B2UD 3PNWB 4JRYE 1EERB 3SGJA 4EQ2A 5TDNB 1C5DB 4P23D 3ECBB 2JJSA 2J6EH 5KVFL 4WUKL 3WFEH 3TJEL 2FGZA 4AEIL 5CD3A 2PR4H 4FQ1H 1LILA 3C8KB 3DO7B 3VH8A 3VH8B 4DKFL 4F3FB 1WFOA 4OZHA 3UP1A 3D6GA 4U49A 1VB9A 4YZFF 4YC2B 2ICWB 4J7RA 1TCRB 4A2MA 2VLLA 4K7PY 1G7HB 3IB4A 1U8NB 4Q6YA 4U1MA 4QRRB 3N1GC 3FQUB 5K9JH 2QHRH 2J3SA 5FA3A 3WDHA 2YR3A 5FA3B 2Y7QA 3QIUC 3LKPA 2A6DA 3EJZC 5FECB 4GKNB 4GG6F 1GYAA 2KDGA 5E56A 2BMKB 5D8JL 2VLJE 3EDFA 1MCRA 5E95B 3DI2B 4JY6A 4OZHF 2DI9A 3T0EA 2W9EL 1OCWL 5CBAA 2A83A 3NFNA 5GRJL 3ULUD 1KB5H 3FB6B 4LSUH 4KVCH 4RGNC 4YAQB 4P99A 5GGSA 5IEHB 2DWDB 2DWDA 5SWZE 4Z7VE 1A7OL 1CFVL 1KEGH 4Z7WF 4ORGB 1UACH 3PWPA 3O3EA 4LLWB 4WFGE 4UTAH 3O2DA 3KNBB 3A6OA 2V2XB 1SVZA 4LEXL 4D3CH 3X13A 1FFOA 5DJCB 4F33B 3MZGB 1IAKA 4HUNB 4UT9H 2NXZD 3VFUA 2ZUUA 2F8XC 3QDJB 1A8JH 2R29L 3TBSA 1FZKA 3OKKA 2F8VA 3NPSB 3MV9B 4PJCE 5HGDA 1TENA 4PLNC 4H5SA 3H9SA 3F7VB 4Y19B 4ODWA 4EN3B 4PRIE 1AGFA 3LEYH 2CDGA 4PRAB 3QQ4B 5IHBA 2E7MA 2MFNA 2G5RA 5KANG 5ESQB 4KDTA 1IKNA 1CDJA 3C5ZC 5ISZE 2IADA 3PL6D 1YJDH 1RIVL 2AQ1A 4YXLL 4LLVA 3RL2A 5ID0B 3DMMD 1DQDL 1DQQA 1IVLA 1DQQB 2BP3A 2DF3A 2R2HB 3MLSL 2YPLD 4NQDB 2VAAB 2AJXH 3V4UL 1HNFA 1ZT1B 2NX5E 3M17A 4HX1B 2MOVA 4FTVB 2Y07H 4PJAA 4LPVA 3B2UC 2HVKB 1RIUH 1P84J 5DVOA 1ZMYA 2HVJB 5CGMA 5KW9L 3LS4H 3GMPA 3G6JB 1AGCA 1MCDA 2VITB 1BJ1J 1EGJH 1HHJA 2G60L 5CJQH 4KDVA 3CVIL 4XPBL 1CK0H 4CVXA 5FOJA 3C5ZA 4X0KB 4FABH 1NKRA 1J86A 1FL6B 5JW5A 4KTDL 1RIHH 2FIKA 4TOYL 4RISL 4H8WC 2ZNXA 4OQ1A 2OTWB 2BSRA 5TE7L 3MLXH 1S7QA 4NHUA 3VGFA 5DEZA 4OZ4A 4O9HL 4KAQH 2MKWA 4J23A 2PETA 1DSFL 3MXWL 4Y5XA 2L0DA 3ROOA 4FQPA 1N5YL 4PJ9B 2H26B 1EFXD 3HNVL 3RGVB 4JKLA 5IFHL 3OJDA 3SE8H 3MNVA 3VFOA 1JPTH 1YEIH 3QCTL 3GRWH 1V7NL 2D7TH 4ODHL 5K9QI 1O5DT 1V05A 4EJ1C 4PJDB 2BOCB 1OF2B 3K8MA 1T7WA 1OT1A 3QUZB 5B8CA 4NP4H 5I30L 3RHWF 5I1JL 3SDAC 1CDIA 4Z7QE 5E1HB 1RAMA 4OF7A 2R1WB 2R1WA 4LQFL 4Z0BH 1QD0A 3KS0J 5CSBA 5DJXA 1IEBB 4K71C 5F7DB 1FPTL 3UAJD 4MA7L 5D1XC 5EU6D 1PKQE 4NZRL 4TUKL 4LVEA 5C08A 5CZXC 1A6VH 1RUPH 5CEYA 4F7CB 3AMLA 1KXTB 4YR6A 5F1SA 4HIIA 4OIIH 3RTQB 3RTQA 1EEZB 2PUQT 1WICA 5DF0A 5MI0C 2W91A 2X4QA 1Y0LB 4FXGB 4LK4A 3RVVD 4J3TA 4Z7UF 1CLOL 4F2MA 3N50A 4MA3B 2YK1H 3MRCB 2ESVD 1KIRB 1KIRA 3CVHA 2EDKA 5DK2B 4Y7MA 1Z5LB 3ZKND 4I18C 4DOHE 5C0JB 3QB7C 4U2YA 5C0ND 1S9XA 3VRIA 2VH5H 4HCRL 3SY0B 4CVZA 5IVXA 4M48H 4G6KL 4J3OC 1U3YA 3GUTB 1RZ8B 5LWYL 3BGMB 1S7WA 3MJ7B 4LMQE 4QNPE 1OGTA 5B39B 3F7YA 4GAYB 4K8RC 3LKRA 2GQHA 4WEMB 3BIBX 2ADIB 5T5NF 1W2KT 3O45B 2OR9L 5HPMB 3VCLB 5F7MC 2QADD 1T21B 3DUSA 5D70L 2C4FT 3GSRB 1LEIB 3DUUB 2EDWA 1I7ZA 3OAZH 4L1DA 3TT1L 1N4XL 3P77A 5EH1A 1YUHA 4PGZA 4M6NH 3VFNB 5ILTL 1QYGH 5IVXF 2R4RH 4G8GB 5C0AD 1Y6NR 1FZMA 1CTOA 1BWWA 4JO2H 3EO0B 4LLQA 4NRXA 3O0RH 1YJDL 1NBQA 1FNAA 5I16A 3ORJA 4PGCA 3DVGA 3VD7A 1DQDH 3GK8H 5LGKA 3MA7B 1P4LA 3G5ZA 3G5YB 2Z8SA 3OR6B 4DZ8A 5IVXE 1J05B 3MJ9A 5C71A 1UXWB 2AV7A 3MODL 2YPVL 3MO1B 5IB3B 4W81A 2DQCL 4XC1H 3P73B 4IRZL 2BX5A 5GZND 3L5WB 1X5XA 1KJ2B 1ONQB 1S9WA 5SWSB 2D4FA 4V2BA 4YHYC 2EYSB 2EYSA 4Y2OA 2FH6A 3CPLA 3O3DB 2OK0H 4P3CH 4J6RL 5F1NB 2B2XL 5FHAL 4CBPA 3MXVH 4Y4KC 3OG6B 3QXUA 4LSPL 3FQTA 1BAFH 1KBGH 3S96B 4CN6A 1SYSA 3BUYA 3RWGA 3ZTJH 3FB8B 5ICXB 3K8KA 1VKXB 4LL9A 4P23C 1MHHB 3ZO0A 4N0YL 4NKOA 2BNRA 3GSWB 2PW1B 4M6MH 5JHDA 4EEEA 4ONGH 2FATH 1MCWW 3JWDL 1RU9L 3E6HB 3MA9H 2RIKA 5E08H 3MJGX 3O4OC 2GSIA 1SJXA 1VHPA 2DIBA 5T1KD 4JKKA 4YNYB 1BREA 4Z77A 2JCCB 3OHXA 4L9DA 1S7XA 4N8PA 4D2NA 1OAKH 1UEMA 2EDLA 2GAZB 4L3EA 5C0CE 1W0VA 2OXHA 2A73A 1BVKA 1MAJA 4LCWA 1F6AB 3QPQC 4M5YH 3VE0B 4WUUE 5KJRH 1A2YA 3MCLH 1GPOL 5EU6E 4FTVE 4WU5B 4K23L 5ADPH 1S78D 4ESKA 5D7SL 3KPRA 5L7XL 3TZVA 5TGBB 1I8LC 1T0MB 3LEYL 1IFHL 1XZ0A 2ZUYA 3FT3A 4BZYA 3CC5A 2QKIB 5K9QG 1NDMB 4PRPB 3T04D 3SGEI 5EUOF 3TBWB 3JTTA 1AY1L 1JNLL 3IETB 4LRNL 5C0BD 3ZYIA 5EZIL 1OAQH 3AROA 5ACZA 5L88L 2IBZX 3PP4H 4G7YL 4KTEL 4JDVB 4NKDA 4XHQA 3BHBB 5CP7B 1C5BH 1Q9LB 1KLUA 4G8GE 5IM7B 1YY9C 1XF2B 2ARJQ 3TBVB 4PY8J 4G8IA 1E28A 5JZ7D 3LKSA 5AEAA 5GXBB 4ZPTA 3ZKQD 4XWGH 3GJEB 2XRAH 5J3HC 1LK2B 2OI9C 1EO8H 5IW1A 4YDIH 1WSST 5GGUA 2OCFD 1FG2B 4OFDA 5H8DA 2CJUL 3REWB 1T3FB 1FNGA 1B0RB 1JTOA 3P9WB 4FFZL 4JO3H 4PYHA 2VQ1B 3K4AA 4KK5C 3EJZD 5EB9A 4C57C 5TFSH 4HWEL 1NFIB 3UMTA 5E94B 4RGNE 1IC5H 2W38A 4LLDB 2DQCH 4ZXBA 4Z7VB 5GS0C 4KZEL 1JUFB 5FDWB 5E2UH 5HI4C 1KC5L 4J4PD 2C1PA 4PREB 2C1PB 4GRLD 4UIKH 1UQSA 3F7QA 1E27B 4P4KA 5J12C 1CGSL 3THML 5GZNC 1WZMA 4DKEL 3QDMA 4QHKI 2CGRL 1JNNL 1PW3A 5J7CC 1T22A 1OTTC 1Q72L 3H3KA 1RU9H 3FQXB 5KSAD 1X4ZA 1A7RH 5MHSD 3DROA 3KPNA 4L4VD 2GY5A 4NQEB 1OGAA 4XXCC 3A67H 2XNAB 3QPXL 3LQZB 1EVTC 4F7TB 1YZZA 4L4TD 1OAYH 5J6HA 4XH2B 2IQAA 4Y19E 1I7TA 1UA6H 3S36H 4ZXBC 3SGDI 3IRPX 5J4MA 4ZUTA 4LDOB 1QKZH 3KXFE 3L1OL 3FQNB 1GPOH 2Q20A 3MREA 3HE7C 3QJHA 3QDAA 1NAKH 3AC0A 1NSNL 2CKBL 4JZOB 4ZAKA 1TVBB 4XCFL 3VFSB 3VXME 2VAJA 3QDMD 5GRVL 1AR2A 1MLBB 3DYPA 5EU6B 2GJ6D 5C0DB 1JCKA 2V5MA 1JZ8A 4NO0A 1AIFB 2Z31A 1AIFA 2Z31B 2A6IB 3IXAA 1VFBB 3MGTA 4R2GD 4M4RA 2DD8H 4XX1G 2MHAB 3W5MA 1Z9SA 5I19L 3WIHL 3S36X 4JHAH 5ALBL 2R9HD 4NO0D 4ODBD 1WBXB 3HPLA 3DX7B 2IAND 5F88B 5BRZD 5C8JA 4L8SB 4M1GH 1ZSDA 5D2NA 3UO1H 4LLAA 4B50A 2JJTA 5EC1A 3WIFB 1EJOL 1I8LA 4RZCB 5E2VL 5FCUH 1HDMB 3QH3A 5I76A 1GGCH 4MA8L 1ZS8B 1XGRB 4WTZA 5HXMA 4YHZH 2CMRH 5B38B 5B38A 4EUPH 3B9VA 5E5MA 4Z8FH 4H8WL 4HD9A 4JEGB 3KDMA 4F7EB 4XP1L 3CLEL 1PDKA 2DS4A 5IF0B 1M6OB 5E6ID 1KCUL 4ZXBD 1HNGA 3O9WA 5IJKA 3W9DA 2F5AH 3ZT6A 5IT2H 1X5GA 4CUCA 2B1AH 2Z31C 3Q6GH 5MEOA 3N1FC 3PP4L 4LFHD 4QGYA 5EA0H 5FKAA 3W0WD 4PUBH 5C0FB 5T3XE 3FFCA 5DD1H 3FFCB 5DHYB 2V5RA 2C3VA 2WUBL 5FA4A 4BSVB 1DE4B 4FXKB 3CMOH 5IGXH 3U6RB 4GMTL 1RHFA 4G9FB 2YPLB 4UIMA 1MCSA 2EE3A 4R0LC 1JNJA 5ANMA 2J6EA 5ANMB 1NCCH 5ESVA 2WWMD 3PQYB 4YHOH 4L29B 2R0WL 4PJ8B 1PEZA 1U3HA 3ARGB 3HHRB 4LPXA 5E2TL 5K33A 4OCMC 2X4SB 4YPGB 1UWXK 1T0NB 2A77H 1HKLH 5JDSA 1FV1B 2V7HA 4FXLA 4N0CC 1P69B 5I8EB 3SQBA 5JHLH 5KSAC 3NABH 2F58L 5DJYA 4PJBB 3VWKB 2OSLB 3WHE1 4P0DA 1RI8A 4MJID 4S1SL 4WFFD 2Z93A 3U0WH 2VC2L 2F54E 4JPIA 5F8RC 2H8PA 5H94B 1KG0A 3SE3C 3AREB 3SE3A 5EU5B 1J1OH 5DRWB 4DWHA 4QHNA 4X4ZA 4OI9A 4ODUA 3WNPA 1I1AB 4GH7B 1S7RA 4Y1AE 3EO1A 2DLIA 4OIIL 3TO2B 4OV5A 2OP4H 1K8IB 3HE6C 3CX5J 4UQ3A 4PRDB 4QOKE 1R3LA 1LHZA 2VLRB 1SBSH 5ADPL 5E2VH 4LCWE 5IK3A 5D1ZB 1BFVL 1CICB 1AD9A 1WCBA 2EKJA 3HG1D 3U2SA 5I71C 4PD4J 3Q5TA 2Q87A 5KW9H 4TULH 3P4LA 1CICD 1LO0H 4U6VL 5HYSA 1PZUB 1JV5B 4U1LB 5JHDE 2AK4A 4HXAH 4M7LH 1C12A 3W2DL 1ZV5A 1TZHB 1CI5A 4ZTPL 1H8NA 3O6LL 5L2JB 4ZPVA 3NAAL 3B5TA 3IFNH 5CHNA 5CS7A 2OTPA 4JKWA 2NY7L 3QQNA 3VD5A 1UM4L 3GHBH 3EOAA 3QDGB 4U0RC 3MJ8B 1IRAY 3EFDL 4QNPF 1P4IL 2YPKB 3UTTD 4L3EE 1G7QA 2B39A 4NNXA 5IMMA 4PP2A 4V1DD 4X4YB 1VADA 2D4DA 4LSRL 2DRUA 2EC9T 4WW2A 5GRYA 1UVQB 4FFZH 2NXZC 3LQAL 3MNZA 4NNYA 3SDCB 2J8OA 2GTWB 1LMKA 3HAEH 3UJIL 4PLJD 2Q7YA 4TQEL 3IJSA 3KYKH 4MNQE 2XN9D 3K80A 1HWGB 4D0BA 2VDLH 4L3ED 3S35L 1A5FH 2VWEE 1FGNL 4YXHH 1LEKB 1YEGH 4EUPG 1F5WA 5AYUH 2ID5A 4PG2A 2BVOB 3TNMB 5TH2A 5JOPD 2H32B 4PJXE 4HIXL 2X4NA 4HWNA 4U0QB 3FT2A 1X5FA 3CVIH 2FCBA 2YRZA 4PJ8D 4I9WD 1ZA3B 5HGHB 1BGXH 4YXKL 1CZ8H 3N06B 5D1QD 5E9DE 4MNQA 5IKCB 1ND0A 3L3OB 4EVNA 2AQ3A 2OTUB 1CDBA 4ELKA 4HLZH 1B0GB 3IAGC 4FG6C 5ECJE 3RA7L 3VGGA 1P9MC 3SCMB 2YD9A 2XT1B 4LARL 3GO1H 4HC1H 3OKDA 4S1RL 4WHCA 2P5ED 4ZUWA 3DV6B 4M8QB 2WW8A 2V17H 4U1IB 5DMKA 5FV2A 3CVHH 3L3IB 4I0PC 1DL7H 3BJ91 5E7FA 5EULV 1RZJC 5INDA 4F7PB 4BZ1L 4NQVA 1K3IA 4JREC 2CDFB 2XQYK 4R4ND 3SDYH 1ZA6B 1QTYT 3ULUL 2ADFL 4XAWH 2VXQL 2RBLA 1EXUB 3JUYA 4YDJB 5E00B 4L8CB 4B7LA 5ICYB 1CGTA 1T6VN 3QCUH 1YMHA 4Z5RA 1TQCB 5MERB 4Z7OF 3P9LA 4LLMA 1K6QH 1TJGL 1BQHB 4LASH 3H0TA 4UBDC 3RVTD 5E8EA 3ARSA 1EO7A 3HS0B 3HS0A 5BZDA 3VXTB 4KGLA 5BS0A 5I9QC 2EECA 3DGGA 5ALCL 1DJSA 5F21B 1EFQA 3TN0C 2FX9H 4YK4B 3P0VH 3DNKA 5KVFH 4WHTB 1RZFH 3LQMA 1MF2L 1U42A 2Q8AH 2M2DA 2GSGB 3GI9L 1I85A 4DK3A 1JF5A 2P49B 3HAEB 2BOBB 4G6JH 4OCYL 4QRTB 1OP5K 4G6FD 3GDBA 3UAJC 5F89A 2A6KA 2A6KB 2B4CL 2CR6A 2Q7NA 3GIVB 3HE6B 4WNQA 1MCEA 1QVOB 2C1OB 1PG7X 1J87A 4L9LB 4TULL 3QUMB 2EIBA 2YD4A 1DQML 5IVZB 3QFJA 3RUGF 4XB8A 1HH6B 1Q9OB 4X7SL 5A2FA 4S0SD 1T7VA 5J1SC 3AXLA 1WBZA 2WBWB 4R8WH 3FL7A 3G04A 4HUKB 1WC7A 5D2LE 1KBGL 1FP5A 1KCKA 4OF0A 4NQCB 3VRLF 3PGFL 1QYGL 4TTDD 4RMQA 2BVYA 4IS6A 5ISZB 4OBSA 1A6TB 4KJYA 4KJQD 3T3MF 5B39G 3L5XH 2R0KL 2X4RB 3T4YB 1UZ8A 5ABDE 4M00A 2EDXA 1A7PL 4MXQD 3MUHL 1KJ3L 2HAZA 3L6FB 4HUXA 3EFFB 2YPVH 4HUXB 4CMHC 4IRJC 1HHIA 3BGAA 3VXRB 1CLZH 4KJPD 2VXTL 2CRZA 4N0FA 1PSKL 1H8SA 1RUML 3UYRL 4JVWA 1K2DA 1KB9K 4OZFB 4LEXH 1MFAH 4HUUB 2HRLA 1AJ7L 2GITB 2BCKA 2J8UB 3FOMA 3BKYH 1ORQA 5GRUL 2XWJB 4FQCH 1TQCC 1R3KA 1QSFD 3B2VH 3IU3A 2PTTB 3UC0L 4LHUB 4XMLL 5CINH 2VNCA 5F9DC 4OUUB 4OF8A 3SN6N 3LD8C 1OPGL 5E8DL 2X4OA 3ARFB 4HQQH 2JB5H 1GGTA 5DWUH 4OLXH 1OQOA 3MFGB 1MFBL 1N26A 4U6HA 1TJIL 3SGJC 5DRNB 4RMSA 3QISA 2WWMC 3CX5K 1HH9A 4OCRL 3ZMRA 4I2XA 2FSEA 1WZ1L 2X4TA 4HPYL 4WENB 4JVUA 5F3BA 1NC4D 2ZSVA 4FZ8L 3G08A 2VLJB 5ITBL 3WCYA 5IMOB 2HMID 3MRBA 5BJTA 3EDKA 4N0CD 4FA8A 5H35A 1XCTB 4Y4KD 3ULVE 3TJHC 2SEBA 4O2CB 1KB5A 4KROC 5E4IA 5C09E 4ZFZB 5SWZA 3FFCE 1SQ2N 3X12A 3SJVE 4BQ6A 3ARUA 3E6FA 5C9JA 2EDNA 3VFGL 4WRLA 5CJXC 5DJ6A 3FT4A 2YUXA 5JPMB 2QQQA 1X5JA 3D2UA 1GGCL 4MA8H 1Z9OA 1U91B 3V6ZB 3U7YL 5CKGA 2WANA 4KTDH 4GQ9L 1A1MB 1I7RA 4FS0A 4NO2A 1WEJL 4U1HB 4U1MB 4KKNA 3CNKA 1GGUA 1BP3B 1F4YH 2ZNWA 2XA8L 4APQD 1CYGA 3SGEH 1CK0L 2LU3A 3MV7D 1LNUA 2LE9A 3EYOB 4JR9H 4JM2C 1B4RA 2P43B 3Q6FB 1BJMA 4PR5A 4JY6B 4TTDC 4IHOB 3VWKC 3STZA 5JIHA 4OZHE 1SY6A 4HIHA 5T1KA 1QEWA 1QEWB 5AD0B 4RGMB 4PJ5E 1DLHB 5E5UB 4OZFH 5HHNA 4NIKB 4I18A 1NCAL 3N85H 4BQBA 2ZUVA 3B8SA 3VXRE 1MUJA 3VXOA 3BGFB 3VXOB 4KQ4L 4GJTB 3PDOB 1VCAA 2WMPA 1FVCA 6CGTA 3L9RA 2AJUL 1FO0H 4ZDHA 1IKFL 4U05A 1DBMH 2VISA 1BF8A 4ODHH 2LV4A 5E1AA 2J12B 2FRGP 5E2JA 3CFKA 3KR3H 4PRNA 5F1IA 5I1CH 2IGFH 1W0WA 2W59A 3QXDA 3QXDB 2J8UE 4S1QH 4H20L 3B5GA 1HZHL 4OLXL 4NCC2 4NGHH 4F33A 2Y25A 4ZS7L 1GCFA 1J1XL 1GH7A 1IGIH 4JFEA 5BXFB 3FHQA 2K3TA 3OZ9H 3N9GH 4KK5D 4MJIA 3U4EA 3NA4A 1A7RL 1U8IA 2HT3D 1I1CA 3FMGH 4JY4A 3MV9A 2XZCH 1T20B 3HI6L 4J3VA 4H1LB 4R90H 1LEGA 1P7QB 5D9SB 3IYLW 2OBGA 4G8GD 4Y19A 1OD9A 3O9WD 5HI4D 4Q74A 3ET9F 1MNUL 3PWLA 3QFDA 3BISA 2DKMA 3KJ6H 2A9MH 3SKMA 3BWAA 2WINA 1Q94B 4K7PL 5IMKB 2C3XA 4IRSA 3U7WL 5A3IC 4LVHB 1PQZA 5FIEA 4YAQA 1N59A 5JLZB 4GBXC 1DTUA 1LP9B 1KTLA 4IOSD 2HJKB 3HC4H 3TP4A 3BQUD 2ATPA 3ZDXE 4FTVA 4TSCL 4E41D 5LWYH 4G80A 1HEZA 4ZOCA 3VFWB 3S6CA 1LVEA 2FH8A 1FNEA 1QSVA 4XXDB 4PV9A 5K9JL 3O41A 1M05A 1SY6L 2EO1A 3VFGH 1R3HB 1MCLA 5SWZD 5HD8C 5IB2B 1J0YA 2OZ4L 2W60B 3EOYG 3SKJL 4MQTB 1MJUL 3LB6C 1O7VA 3WUZA 3CK0H 4JFHD 4J1UB 3UEZA 5I9QB 4KUCF 5C1MB 3JV4A 3V52L 1H3TA 1AGFB 4L3CB 1QLEH 4X98B 2KH2B 2Q86B 4WO4A 4CVUA 1S9VA 4CGTA 3RVUD 2ZUQB 4JQIH 5TQ0L 5JPNA 1R0AH 2UWEF 2D7MA 1JWMA 3C2SA 3K1DA 3T65B 3T2PA 5DZOA 3ZDZF 1Q0YH 1W72B 4R0LA 3VXQA 4PRPE 4LNRB 2R0LL 4X8JB 3DJ9A 1P5VA 2AJVL 1AO7A 1NCWH 1SJHA 3MNWB 1QLRB 3CDGB 3RGVD 4WHDA 2G5BB 4JGMA 2Z4QA 1YJDC 2AKRA 1WISA 4YBLC 2IPUG 3O3BA 5C2BH 3TWCH 5DVNA 2YHGA 1XGPA 5SX4I 5FM5M 3U36B 4CVWA 1HQRB 4MJ6B 2GK0B 3RZCA 1NAMA 1ZHBB 3DXAA 4UB0L 5IJVB 5EFIB 2ICES 4N8VG 4BSJA 4HC1A 3D39B 5D93B 5ID1B 1OAXL 3I50L 3VW3L 3LHPH 5CSZA 3N9GL 1NCAH 4OLUL 2QQLH 5DHVA 1RHHA 4Y4HB 1BIIB 43C9B 3ROOB 3QIUD 2NLJA 4QTHA 3TFKD 4YJZL 2P47B 1DL7L 1FJ1A 3V8CA 1G6RB 3BPNB 3QUXC 2NY3C 4CVZB 5IVXB 3BEWB 4QLRA 5HDBF 1RIUL 3BQUA 3V6FA 4M62L 3JWOL 5ADOH 3CFCH 3H3PH 4WEBL 4O2FB 4P3WA 4HWZA 5I1GH 5I1IL 5F3HA 4HT1H 4JFFB 1DN0A 4HKJA 1ZHKB 4HKJB 4ODXA 4EI5B 5IB1A 3OX8B 4MXQC 3GHBL 3GMNB 1KLGB 4FQHB 4GBXD 1VFMA 2XA3A 4XT1C 4RGND 3BN3B 3ESUF 4Q2ZA 4V1DA 3S3SA 2ZUTA 3GIZL 3P77B 1C16A 3E2HB 2V6HA 1IEHA 2NYYC 2UYLA 2GJZA 5ALCH 3EGSB 4E41A 3EGSA 4E41B 4BZ2H 3VMOA 4KUZL 3BT2L 5JW4N 4YDLC 2ZCHH 4QO1A 4HCRA 4AM0B 3QPQD 2WSKA 5I16B 1A6AB 1F4HA 3MCKB 3PL6A 4CW1B 4RGOL 3DO7A 4ZUVB 5HHOB 4ZUVA 5IFHH 2UZIH 1TITA 4APQB 3LB6D 4L4TE 1BVZA 2VR5A 3REVB 3HI1A 3C5SA 5L8KB 3GGWB 1NC2B 3TYGL 1G7HA 1NCBH 1ZGLM 2ERJB 1OGTB 3WLBB 3WL9A 2YD6A 3X14B 1IT9H 5JR1L 4Z9KB 3RY6A 3K1KC 2BRRH 1RURL 4PGBB 3T3ME 2OZ4H 5F7HA 3S37X 1HHKB 5HHMB 2BHZA 1DP0A 3S96A 4I77H 3A67L 1OSPH 1HE7A 4KJPC 4KROD 5KZCD 1IC4H 3VFNA 1D5XB 1PGRB 1X7QA 2WWKO 5EZJB 3BZDA 2GY7B 3MRGB 4Z78A 3B9KC 1YQVL 2DLGA 3VD9A 5EO1B 3O4LB 5IG7A 3ARBD 4HHAA 5F96H 1MAMH 1HQ4A 4OLZL 4WDIA 4XX1E 4YNYA 1YA5A 4OCWH 1IGCL 4MCYA 3O6FA 4OFYD 4WTZG 2AV7B 1DQJB 4A2LA 4LBEA 1W0VB 3KNBA 4XNXH 1J1XH 2ENYA 1A1OA 4HJGA 5CMAB 3TZVD 2X41A 2G75A 3VE0A 4S2SB 1OY3B 2X4UB 4LRIA 4XB7A 5KSBE 3TBYA 1KPVB 1RZIB 4U1KA 1D5ZA 4BSWA 1KN4L 2Z9TA 5FHBL 1BZ9A 4MD0A 2DBJA 5GJSH 5BZWB 3FRUB 3BZFA 2DDQH 4TRPL 5CKAA 3VXNA 1YYLH 4KTYA 4DVBA 4HBCH 4JFPA 4B53A 1A0QL 4P2QA 5EIVA 3QQ4A 4N8VB 4M6OH 4KKLD 4K8RD 4RMVA 5CEZD 3O3AA 2BXYA 5I19H 1GXEA 1KIUA 1AR1D 1YPZA 4PJ8C 4BKLA 2EDQA 1Q9LA 4LP5A 1G6RL 5J9PA 5DURD 1DANT 3K3QA 4M93C 5E9DA 5JQHC 2VLJD 4ZAKC 4QRPA 4OZGF 3Q3GA 1CU4H 5M7QA 2VZUA 1F4XH 1OARH 3HZMA 4JQVA 3VFMA 2ERJC 3PWPE 1RUAH 2MQ0A 4CN1A 4Z7VA 3AS3A 2EXWD 1H8OA 1CE6A 4OCNC 1P7KB 3SKOB 1N64H 4I77L 4FZEH 3DRQA 1T1WA 4PP1C 4M7ZC 1FL3B 2BK8A 5JA8B 1VFAA 3NCYS 4NZTL 4QRQA 3WO3B 4LHUD 3RIFK 3C6LA 1REIA 3MRFA 5MENB 4QHUB 1D6EA 5HPOA 1CE1H 3K8LA 4HH9B 4U1SA 3MLRL 1RUKH 1R24A 2NY6B 1TNMA 3DXAE 3O4OB 3UJTH 4OCWL 4M1DH 4L5FL 4LSQL 3GM8A 1E28B 2VWEC 3FO1B 2W92A 2IQAB 1R3JB 4I0CC 1R3JA 1VFUA 4QRUA 4XGZA 1AXSA 1G7MB 4NQXB 4OLWL 4XMLH 5CINL 4MAYA 2FL5A 4YH6A 1ZT7B 3SKNA 5I8CB 3VGDA 2DM4A 3IJYA 4K23H 1YN6A 1YN6B 3MR9A 3L5IA 5C07A 4WI2A 5CLTA 4G8EB 3I75A 5FUCE 5K59E 1DCLA 1T2QL 3UTZA 2PYED 3OJVC 5CCKH 1D9KB 1YEJL 5IHUH 1EEZA 3QWQB 4Y5VC 1UQSB 1XIWB 3WFCL 3P4OA 2ZP0T 4M9OA 1E27A 1L6ZA 2YEZB 3C5ZD 1BJ8A 3IF1A 1Z3GH 4IOFC 2UZYB 4I5BA 5AG9A 5KTEL 5A16B 4QOKA 2D2OA 5LGHH 3TLRA 1K4DB 5MEQB 1HHHA 3F5WA 1XH3B 3L3KB 2W0FB 3WNMA 4JFDB 5CD5D 4PFEA 4UI2A 2F8OA 4MD4A 1ITCA 4Q58C 3ARZA 4K71B 3L3DB 2F74B 3X3FH 1P6AB 1JWSA 2DIJA 4LSTL 4WUUD 2F54A 2EDBA 1KIQB 3AAZA 3RX7A 4FNLL 3BP5B 5IP4A 1WLHA 1JZ6A 5D1QB 3PWVB 4JFED 2AI0L 4XPHH 1S9YA 2PXYC 3DUSB 4XMPL 5IOPB 1HIMH 3MGAA 4F7EA 4I8DA 5CIPH 4X6CB 5J3HD 4F3FA 4LAQL 1J8KA 2J6EL 3IXTB 4B41A 5JZ7C 4NNPL 3UBXG 1FFRA 1ED3B 4NZTH 3WEXA 3WV0A 1W0YT 4ZS6C 3O6LH 5DJZB 3W9EA 1IM9B 4QRPD 3C6LD 5MEND 3HZKA 1IAII 2A6DB 3NFSL 5CJXA 1MIEH 1P4IH 1N0XL 2VL4A 1HYRC 5DHYA 1J05A 1J5OH 2P48B 4JDZA 4U6XA 1T7YA 2BNQA 1KELH 4JFOB 5E5RB 5KOMC 3OGCA 1U36A 3VJ6B 1SJEB 4XP9H 5F44A 3HUJF 3ZKMC 2Z0BA 1A6ZA 3HMXA 3KPOB 5FHAH 2ICEA 3NACL 1U8OB 1U8OA 2VDMH 2VRAA 3Q5OA 3IDMA 1KIPB 1P2CB 3FAWA 1J1PL 3WHXB 5TPWL 4M93B 5E8OB 3ARDD 4ORZC 4KDWA 3WBDA 5CZXD 1A64A 4XCFH 4P3DA 5EO9A 4DUWA 2QQNH 4WWKC 4LLWA 2FHBA 4FZEL 3GZKA 1M6OA 3OB0K 4KRPC 3UYPA 5FO7B 1PEWA 4M61A 3QIBB 4KHXH 2IBBA 1AE6L 1QBMH 5TF0A 1T89C 1TVHB 3DX8A 4RA0C 1G9NH 1X44A 3MACL 5JHDB 1FFOB 3IDYB 3HE7D 2YA1A 4QHNB 4UOW1 1IGYA 5JOPE 3RNQB 3VXUD 4F8TA 2XTLA 5FB8B 2X70A 4MCZA 1M7IA 1MCNA 3F65A 3DHJA 5E8NA 4HGKC 5KSVA 2JCCF 4HUWA 5EOCH 3CJJA 4FFYH 4DTGL 1WZLA 3DYOA 4IM8A 4MHHI 2C3VB 5FA4B 5D7IA 4H5SB 4NFDA 4L3EB 1YNKH 5EU4B 3RWJA 5T33L 4YDVA 5HHPA 1D5MA 4MNHB 4ZFFB 4ZFFA 3VD4A 1RFDH 4U6YB 1DUZB 3ILQC 4L29A 3V5DB 2UVEA 4FQJH 4TSAL 3WYRA 2D3VA 4HWBH 4DVRL 5DLMH 2LU7A 2X4SA 4YPGA 5D1QC 3DGCR 3I6GA 2YBRB 3VFVB 1JF1B 2C5DC 2ZUXA 4DFIA 2G2RB 1MFEH 4QHLB 3RP1A 2X42A 1CFQB 1HSBA 1QACA 4JDTL 3QDGD 2FLBT 2AJZA 2NYYD 3Q48A 2FDBP 4UNUA 4PTUB 5LAXA 4JJ5B 4WW1A 4NPYA 4JKPL 4NFCA 1YMMA 2ESVE 2Z93B 2HTLD 4P9MH 3LKNB 5J1AA 2BVUA 4BUHA 4OCXL 2BDNL 4TTGA 3G6JA 4FQIH 3RFZC 5ACZB 5MEPB 4PJGA 5C09A 2R2EA 1TPXC 4GBXB 3QDGA 3KJ4C 1Q38A 2Z91A 3BHBA 3Q1SL 43CAA 5GGQL 4NWUL 1NFDA 4GRMB 5FGSA 3SE4A 1OGAE 4LAQH 4LHQB 5KZCB 1G7QB 1FZOA 4XI5C 3TBTB 3A6BL 1I4FA 4PJFF 4ENEC 1RZ7H 2D03H 2FEEI 5AAMA 3I3EA 2GT9A 5DFTA 3PV6B 1C1EL 4DFHA 2UUDH 4G6JL 4OCYH 4FNLH 3SDDB 2YC1B 1JK8A 3QUYA 4PJ7E 2CKBB 1CFSA 2FJFB 3HC0A 4RGOH 5FEBA 4Y2DD 3OKOA 2IQ9L 2YUWA 3RL1A 3KWWA 5HYJA 1XR8B 2KL6A 1DBKL 1RD6A 1IGJA 3TT3L 2VQUA 2PYEE 5HY9A 3C08L 5DRXB 3OAYK 2OJEA 3QI9D 5EU3B 4XCCH 4FQLH 3B9KD 1FH5H 2XWBB 1NGXA 2PNDA 3S3JA 3ARBC 1LO4L 2B4CC 1S5IL 3IDNB 4L5FH 5HGBA 2VXTH 5DD1L 2NW3B 1BPVA 3I50H 3TF7C 2KQMA 3SJVB 5IBTH 4NN6C 4RAUB 1AE6H 3VXSE 4C83A 2DYPB 2DYPA 3D85B 5EIQA 5BO1H 4ONGL 3ZHLA 3WS6C 3PQYD 4WV1A 5B21A 1A1NB 3IJSB 3DMMA 1AFVH 5ACMA 2P5WD 5LJYH 5HD8D 1U8HB 3MREB 5E70A 2IPKA 2MPAL 2Z31D 3UXFA 4K3EL 4XP4L 1RZKH 4G6MH 4CRPA 3RPIB 4NT6A 1R5WB 1X4YA 3FFCD 1QSEA 5DQDH 5F7EH 4MQ7B 1DVFA 1MIML 1S9XB 3HUJB 3VRIB 4H25B 4ZNEA 5EU6A 1U8PB 2HFFA 3WKNA 4RFOH 5ENWB 1FLRL 4HPYH 1FCCA 4QYOA 3HNSL 1EV2E 5FYJE 4TSAH 1OP9A 4ZTPH 1Q0XL 2H41A 5BZDB 1WT5A 3RUGE 3LN4A 4TNVF 4NWTH 4MNGB 4P5KB 2Y1VA 3GEWB 4X6EB 3BT2H 3QJFA 3WLWC 4AEHH 3QA3A 1I1FB 1CXIA 3IDGA 3QUXA 1I9EA 5FGBC 3RAJH 4WCYL 1X3DA 1Z9MA 1SEBA 3L7FA 3ZYJA 4GLRH 4FQJL 1NKOA 2OYPA 5DD3L 4F7PA 3BEVB 3K4DA 5T3ZD 1G6RH 4Q7DA 4MHHG 3WD5L 3GSXB 4WFEE 1IZJA 5FYKH 1N3NA 5DI8A 2AV1A 1KB9J 3VFRB 2R69H 3ISWA 1RURH 1OSZA 5D1ZC 3UZEA 1QLFA 4EDWL 2VE6B 3BIKA 4HS3B 3TFKC 3MLUL 3ZSTA 2R1YB 4IEFB 5GGRY 4KPHH 1E4JA 2DOCA 2PYEB 3K0WA 3VRLE 4QXTB 4D0CB 1KGCD 2IANA 5GGRB 3NCFB 3TNNB 3T77B 3NH7H 2O5ZH 3BKJL 2NTFA 2ZJSL 2DLFH 4JM2A 1J8HE 1X5YA 1QNZL 5ESVB 1JHLL 4K9EL 1J1PH 3AREC 1ULVA 1UACL 2DN7A 1M7DB 5JHLL 1S5IH 4JANB 3ARGA 4G8FB 1F4WH 4WO4D 3R4DA 4EDXA 3MJ9H 1U8JA 3E6HA 4PY7B 2QR0B 2QR0A 2HJFB 2BVPA 3M8OL 1YN7B 4ZSOB 4ZO6A 4D9RE 2J7LA 4L4VB 4OB5L 3MRRA 5JUEL 3MGOA 4FG6D 3QUMA 5JR1H 2ZKHH 3QQ9D 4N9GA 4N9GB 3HC3H 3D3VE 5IBLC 2OM5A 3HNSH 5JIKA 4KK9C 2XZQL 1NMCB 3RJDA 1HOCA 3BD4A 3G04B 4OF6A 3V9FA 1EHLH 5C7XH 1IC4L 3QNXA 5I17A 4JGUA 1UB5A 2Z35B 3MRMB 1KNOA 1FRGH 4ZTOH 3BESR 5AWNL 3GMOB 1IAIM 3GMOA 1YY8A 4MMZC 4X6CE 3RUGB 3MLZH 3RVTC 3TBWA 3KXFB 4S11A 3IDYC 2V5TA 2IAMA 4MWFB 4UDTB 3I02B 3FO9A 3OQ3B 2E3VA 4YK4C 3SDYL 3VFPB 5GISH 2JJWA 3I6KB 5GS2H 1NLBL 3BP6B 4KROB 3L3JA 4PTTB 1PKQA 5C08E 4HV8B 3AM8A 3CSYB 1AY1H 3TCLA 3W0WE 1B90A 4JPWH 4G8IB 2GITA 3IFNL 5DJ0A 4P2RA 4GG6B 3C09C 5DS8B 5J57B 2FZ3B 1LDPH 4ZS6D 2UWEB 3HC4L 3BZEA 3IDUA 1FHGA 1TZHA 1JHKL 2R2CA 4OUUA 1DDHB 3LS5H 4KY1L 3D87B 2ICWA 1ZK9A 4BFIA 1PX3A 4MA1B 3THMH 2VJXA 2XRAL 2ADJA 2ADJB 2BFVL 5D7JB 3DTXB 3DTXA 1JWUA 5ITFB 4XBGA 3JSSA 2J8UF 2ZJSH 3UTQB 2BMKA 3FQWA 3GI9H 1ZKAA 1KCVL 1F11B 1FGNH 4YXHL 3U4BL 5DQJA 3MLRH 3LN9A 3CFEA 4Q9RL 4W4OA 2B8OT 3ZL4H 3VI3E 4Y1AA 3IFPA 1AGBA 3FONB 1AGBB 5JW3H 1DBKH 3SDXF 1WFUA 1CL7I 3HAEG 2BJMH 3HG1A 1UA6L 3FB6A 3S36L 4RAVB 1KB5B 4JAMB 1F4AA 3C8DA 4DGIL 4JFZL 5DVKA 2V7NB 2EYTA 1T83C 4ORGA 2DM7A 1TZGH 3U46B 4LCYB 4EDWH 3UDWC 4EI5C 3UC0H 4H26B 2YD2A 3UTPD 5JPMA 4XVTL 2XN9E 1A6WL 2XZQH 4FABL 5C0EA 3ILPB 1E6JL 3I9GL 1G0DA 3HUJE 4Y5YA 3HZYA 2AXFB 3NABL 4E5XB 5DD5L 4OZIE 2V17L 3KPTA 5DTFB 4YQXH 3R8BB 2I60L 5D1XA 5DMJB 4ZAKD 2NR6D 5ANME 2D9QB 1MLCA 4G7VH 4ONHB 4JHAL 4WHYH 1K4CB 4Y4HC 2H2PD 3SE8L 2AEPH 3NA9H 4PRIA 1M71A 1P6FA 5L8LB 1JYVA 2X5PA 2MCG1 4X9IA 4XP6L 3D0LB 2MQ3A 4O4YH 4ETQB 1JGLL 4YDJA 1VGEL 3H6JA 1U3JA 2OQJB 4OLVH 5B3JF 2JE8A 1YC8A 1Q0XH 5F88A 4LOUC 2A38A 4Y16D 4KJQC 1WJ3A 2DQGH 3H7LA 2E27H 4CMMB 4PGEB 2YXFA 4XP1H 2EDYA 5C0AB 1HKFA 1OHQA 4X4MA 4BJLA 5C0IB 1U93B 4NJ9L 2HMIC 5DT1L 5AYQA 5GIRB 2OL3B 4IRJD 1YEDB 4M43L 3Q6GL 5FCUL 4EI5D 4QRRE 4NBZB 5IQ9B 3NCMA 2VLRE 1NEUA 4OAWB 2XPGA 4PRID 1N8ZB 4Z7WA 5ICZB 1U8IB 3KHQA 1QBLH 3EYSH 2X4PB 1OQXA 8FABB 1HCFX 5I1AB 2VSDA 5ISZD 4BQCA 4KI1A 4RDQG 1Q8MA 2VQTA 3MOBH 4RFNB 2BC4A 4Y2DC 1CVSC 3PHSA 1EO5A 3PP3H 2ZCHL 2GEEA 1WBYA 3WUWG 1PJ9A 1MCPH 3WJJC 4APQC 2DTML 1PQZB 4KPHL 2C26A 4NSKB 5IIEA 1SYVB 4D94A 2VAAA 3VDAA 1OTTD 1ZT1A 5K9KB 3V4VH 4WY7H 1FZJA 4OCSL 1C7TA 2IGFL 4PRBB 2VYRE 4YHPB 2R9HC 4GQ9H 3TIEA 4YEFA 5SX5K 3WO4C 2WQ8A 2GUOB 2F5AL 3R06A 1YYML 1AGCB 4LOUD 4Y16C 4GKOA 4FTVD 5FO8B 1UZ6F 1U58A 2B7DT 1CBVH 5EBWB 2QLVB 4PLKD 3NN8B 4I0PD 5D7LE 2O93L 4JPIB 4QY8A 5IJVA 1WF5A 3EBAA 1S8DA 4J3XA 4PJAF 1K5NB 3GMRA 3WKMH 1ITBB 2EIZA 4C4KT 5JUEH 4R7NA 4F57L 3DURB 3K46A 4HJ0C 3V0VA 5EDXA 1SM3L 3CXHK 3U0WL 3NACH 2AQ2A 4JFQA 3U0TB 1ZHNB 4GSDH 1A7OH 2APXA 3AFLA 4NOBA 5AUMB 4Y16A 3OJDB 4EIZC 4D8PA 1W72A 1JTPA 3B9KA 4XP6H 3SDCD 5DJDA 4JDTH 5FAAA 1D5IH 4WU7B 3SDAB 3QO0A 2QHLA 5LGJA 1X5KA 2N1KA 5KVMC 1YNTB 3AS2A 3EOTH 4OM0L 4ZS7H 1INEH 4XPFH 4EBQL 2IFGA 5I73C 3ZKMD 1Q9KB 1HSAB 4TNWK 1G0XA 3ZSSA 1BFVH 2DYPD 1JJUA 4UUJB 4UUJA 1T2JA 5FYJL 5I75C 4WO4C 1UGNA 3F58L 2VXVL 2V9TA 4L8SC 3CK0L 4X7CC 5L2JA 3QBTB 3ZE0F 1T66D 4G8GA 3X11A 3ZHKA 4M6OL 4YWGH 3SHSA 5L88H 3QUYD 3EZ8A 4WWKD 4MXWL 4OLVL 1MI5E 2XZAL 4FQXC 2VDQH 1OB1B 3WDIA 5D1ZD 2AXJA 3CVHB 4KK9D 4A6YB 4E0RB 3O8XC 4WCYH 43C9A 4MSWB 3ULVF 4P2CG 4WWKA 4HJ0D 1QBAA 2AK4D 1CD8A 1ONQA 3D0VA 5E0QA 5J1TC 2X9WA 4Y19D 3GMQB 2B0SH 3LQAH 1OVZA 5DDHA 4P9HC 3X17A 2BZDA 2IAMD 1L0QA 1X5IA 2XN9B 4TNVK 2FB4L 1G7LA 1V8HA 1LD9A 4X7SH 1LD9B 3QNZA 4OD2B 1DQLH 4U3XA 3PDGA 1F97A 3ARED 1OM3H 1RMFL 1DFBL 3KYNA 5FKPB 1QRNA 3B9DA 4XNQB 2KBGA 4V1DB 1AP2A 3HMWL 5L9DL 5FUOH 3S5LB 3QP3A 2P7TB 1TZIB 5J8OA 4MA1C 4P23B 4XTRD 4NKOB 1WUNT 4URTB 3NFNB 5LBSH 4OD3L 1YEFL 3HPJA 1FZMB 5IFJB 1L9MA 2I27N 3QWRA 3QXAB 3L1OH 4KQ3L 1NC4B 4LLQB 1B9ZA 2L4OA 4R96B 2XI9A 2PO6A 4HFUH 1FAKT 3KS0H 3TYFA 3TYFB 1P4LB 3LEXA 1CIUA 1NGZB 2CKBH 4M1DL 3NBNA 4RMUA 1H3PH 1CLZL 1RJCA 2HFTA 3MO1A 5IB3A 3BAEL 3P73A 1RUMH 3UYRH 4JB9L 4HJJL 1FDLL 4P5MB 5JMOC 2K1MA 3CXDL 1S3KH 2XKSA 4RBPH 2WLYA 2PXYA 1IBGH 1YYMH 4K07A 2MCPL 3RVXD 1CWVA 1FVDA 4XPAH 3DBXA 1UJ3B 3E8UH 1RJLA 1LO4H 3W0WB 1XF5A 5MERA 2RFXB 2W65B 5TGBA 3MRPB 2VLRD 5ESAB 3TWCL 1EAJA 1KJMA 2NY1B 3KPLB 2AW2A 4WI3A 5E8DH 4LU5L 1IQWL 3OBAA 2VXQH 2HT4D 4K7PH 1EHLL 1G9ML 3MV8B 5E8EB 2PCPA 3QUXD 1MRCH 5IBUB 3T1FB 3UO1L 4HUVB 3T0EB 3VXUE 4KUZH 3ZLQC 2VB5A 5J6GA 4OFPA 4WEUD 3QG7H 4CJ0A 2FWOB 5JOEA 5MENE 3P30L 1I3GH 4X7FC 1I3RB 4Y88A 3RI5F 1KLUB 4M5ZH 4E42A 3KPQA 1IC7L 3WJLA 2DI8A 4UZGA 2AJ3B 3O6FC 4WW2F 3W39B 5EZOL 3O6FB 5IW1B 4JRXB 2BVQA 3PHOB 4NNPH 3QUKB 3CFCL 3IT8D 4PJHF 1F13A 2B0SL 3QEQE 5T3XL 4OI8A 2JLLA 2DQFB 4PBXA 1AC6A 5HHVH 3QYCA 5DRZA 5CJBA 1IGTB 2EICA 4BQ8A 3QIWC 2RR3A 4YHYB 3C5ZB 1N6QH 4LHJB 1UKSA 1XZ0B 4Y5VB 3FT3B 4PG9A 4R4NC 2JJSC 1NDGB 4AMKH 1ZTXH 2MKLC 2FIKB 4J1UA 4M1GL 1IEAA 5I2IA 4UT7H 2Y36H 3QDMB 2IAMC 3C6LB 5MENA 1L7IL 3T8XA 3RAJL 4G6FB 3PGDB 4IMKC 4PJHA 1NBZB 4KQ3H 4R8WL 3UTPE 1P5UA 1KC5H 3V4VL 1Q1JH 4NKDB 4EXPX 4NC2B 4PJGE 1JFQH 2OL3L 5ID0A 2K7QA 3U7AA 5F7WC 5TDOA 5TDOB 5DK0B 2DWEB 2YRLA 1QQDB 2NY5C 3VA6A 3WD5H 1AHWB 3WXWL 3GB7B 4Q0XL 4HIJB 3BYTA 2D7PA 3BKYL 2VDNH 3QIWA 2LQRA 3GSOB 4TUJA 5F9JA 5HJ3B 1NUNB 2R56L 5GGUB 3MOAH 3RY5A 4DN4H 2V2TA 2HRPL 5F7NC 4DAGH 1ZT7A 2G9HB 4JQVC 4WUUB 2P5EA 1H3WM 4GW4B 1NFIA 3O6KL 4XVTH 3K4ZA 1P4BH 1RSFA 1XGPB 2VOTA 5BV7B 1I8KB 1YYLL 3NH7L 4KI5E 1SM3H 3HN3A 4GMTH 3RRQA 1KPUA 5ID1A 3OB8A 5C0AE 4XNZB 2MCPH 2CDEA 4PJ7B 5FDYA 4KGJA 4Q9QL 1T5WA 4ODSL 3B6SB 5JW4M 2NCMA 2ICWJ 3WFBH 1W72L 1PFCA 3BQUC 4XCEB 2R8SH 3IFOA 1E4XL 2FJHB 3LQZA 4F7TA 1ORSA 3DSFL 1X5HA 2EZ0D 1T04B 1VGKA 1AXTL 2BOCA 3QUZA 5IWLC 2P24B 4ZODA 5CP3H 1T2XA 4HXBH 4M8VA 5DA4A 3P30H 4O51A 5T3XH 2BDNH 3TA3A 2Z92B 4O5LH 4PLKC 4Z95H 3GI8H 1AR1C 1FO0A 1FO0B 1NGQL 2R1XA 4JZNA 3DXAD 1ZVSA 2XA8H 1MCBA 2DTSA 1MLBA 4LPYA 5L2KD 2ZOLB 3RZWA 3O6FD 5EZLA 3FOLB 5C07D 3GK8L 1UT9A 4WI8A 1EMTL 3QEHB 3KPSE 2NX5D 3HZKB 2VDPH 4FP8H 2Q6WB 2ZPKL 4X5WB 4H1LH 2YPLE 2XXCB 2Z8RA 3LZFH 5GS1A 5GS1B 1FL5B 3ARQA 3EYOA 3BP7A 4NUGH 1YEHH 2UV3A 3WHE0 2XKNA 4Q6IA 1OTUC 4G9FA 2Y72A 4YDIL 2YN5A 4PP1D 4GW1A 5EA0L 2O5YH 2CIKA 3LRSA 2CIKB 1KFAL 2N7BA 3LRSB 5J89A 4LKCA 1QHOA 4OGZA 1FO0L 1N6UA 4HAFA 3AAZB 5GHWL 3KR3L 1MCFA 4MNGE 4GOSA 1S7TA 4DZBA 4P5TA 1FV1A 1VEPA 3RX8A 1FLTX 1NCUA 1A22B 5EORL 4WY7L 3EO9H 5DURB 2Z8WC 3JWNC 3ZTNH 4OZHB 2AK1L 1QHPA 2W9LA 3PIQB 3UPAA 3EAKA 1IGFH 1FH5L 1I8IB 5BRZE 4YIQB 3BXNB 1GGBL 1OLZA 4HFUL 4IRZH 3MRQB 4QRRA 2H3NA 4C56A 1IM9A 4LCWD 3ALWA 3T0EE 5FECA 1KLFA 2IPUK 3OKKB 1XGUA 5JA9A 1NC2D 4HUWB 1CT8B 4JY5H 4JDZB 1X5AA 1U8QA 3DVIA 3S34H 1A1OB 4J4PC 4XNMA 5GS2D 3C6SB 4QHMB 2F5BH 4OKDA 1Y6MR 5GJSL 1A21A 4AT6A 2HG5B 1JGUL 4IOFD 1H0DB 5CGYD 1AQDA 5C07E 1E6JH 2A0LD 1W72H 1HZHH 4JRXE 4Z95L 1MI5B 3TZVB 4DW2H 1ACYL 3O4LE 4M43H 3VWKD 5EZIH 1TJHH 4LKXA 4X9BA 2FATL 2P4AB 4IMLA 4PGDA 2AK4B 4JN1L 5JIIA 4XHJD 2X44D 3WJLC 5T1MB 3FMGL 3ARBB 3VD3A 3QUYC 3L3GA 2DBLH 4GG8B 4KMTL 4X4XA 2EKSA 1A7QL 2HTKD 1JHTB 2VABB 4RMRA 1UJ3C 1T03L 3MV7A 2VDOH 3NCEB 4BZ1H 2QQKL 1XF4B 1WK0A 4MMXC 4L4VE 3BUTA 2X70B 1ZLVK 5GSRA 3DSNA 4LSSH 1VFOA 1BQSA 1EDQA 4C56E 1ACZA 5HGGS 5IQ7L 5FYKL 1EGJL 2G60H 3GKZA 4MAUL 2VLRA 2IH3A 3REWA 4XVUC 3DIFA 4YBLB 2DB8A 2ITCA 3MQIA 1A3QA 1DUZA 4Y4HD 1KEMH 4GO6B 1FNSH 1UXSA 1KTDB 2H26A 3D48R 3IFLL 3RL1B 2DM2A 4OGYH 1CF8H 4F37F 5E6IB 3H9HA 3WFZA 1NUFA 1F2QA 3WLWD 3PGCA 5TQ0H 3D9AH 2HVKA 4X6DB 1CBVL 3S35H 4OFKA 2XV6B 3CZFB 1KJ3H 2JK5A 2BRRL 3FO2B 2Z4QB 5B3NA 2HFGL 2XZZA 2BSED 3V52H 1UWGH 1FGVH 3GNMH 4F57H 3R1GL 4B0MM 1DVFC 5GRVK 2ZCLH 4RQQA 3MXWH 2PYFA 2YWZA 5I1DA 3C2AH 1F3JA 3LKSB 1CGYA 5F7YC 3WFHA 1I7TB 4C4KO 1ZEAH 1ETZB 1MEXL 1A3RL 3KPMB 3LMJL 4YHNA 2P45B 3ZHDA 1H5BB 5KSUA 4X7EC 1B0RA 4UIKL 1GC1L 1GOGA 5GGVH 5EUOE 4M7JL 4JZOA 4X99B 3KYMA 1R5WA 5JIPA 3UTZB 5DJ8B 1F2XK 4OT1L 3RWFA 1MRFL 2ZKHL 2YS4A 4KFZC 3CFJA 5E9DD 3CAFA 4LHUG 5HY9B 4HSQA 4PJEB 2V5SA 1IGFL 5JOFB 3S4SA 3EYFA 1A6VL 1GGBH 5C0CD 3EYUL 2EIDA 3LKRB 3ILQD 2OTUA 3P4NB 1PSKH 1TMCB 4JFDA 1NLBH 5CUSL 3Q2CA 4X7TB 3PXHA 1ZGLB 3NVQA 3ARDC 2GFBB 5JQ6L 4XHJC 1GZPA 2D03L 2DKUA 4BFGA 4YR6B 5I1EH 3QHFH 1G84A 2BOBA 2GCYA 5KSBB 4JFFE 1GSMA 3H8NA 4OIBA 4ZUTB 1K8DB 3ECBA 1ADQA 3OXSB 3N0PB 2D7QA 1MHCB 3DMMB 1H15A 1DVFD 4LCCA 4M6AA 3FB5B 3QIWD 2V2WA 4XI5D 2E7LC 5A2LH 4BZ2L 1MFDH 4L9LC 1B3JA 1KT2B 1MVUA 1QG3A 3VI3F 2YD7A 3ROLB 4PJ5D 3QUMH 4FQQB 2YZ8A 5KN5B 1EMTH 3U83A 5FYLE 1V7ML 3O9WB 1XGTB 5DJ2A 4PJ9D 4XVUD 3GSQB 3GUTA 5KS9E 2VMFA 1BQHG 3NAAH 4FRWA 5K93A 4ZFOA 3MRHB 2CLZA 3F58H 3HMWH 1CXHA 2HFGH 4LFHG 5FYLH 1LDSA 4BELD 4JFYB 5FO9B 1YDPA 2XY1A 3O45A 1UKQA 2FX7H 3M1BB 3V0WH 1EHAA 3F62A 2VN7A 5CJOH 1F6FB 4FXKA 1LO5B 4U1JB 5TDPB 3VJ6A 3BUYB 4LVNB 1MREH 5BS0D 5HYIA 4JHWH 3FO0L 1MHHA 5GJTH 1P53A 3O2VL 5A2KH 3Q0HA 1UFUA 3BGFC 3RY4A 5FOBA 4LLYA 4A6YH 3ZT5A 1KYOK 3BKML 5JDSB 5D1XD 4HGWB 1SMAA 3QCVL 3HE6A 4Y2DA 3CUPA 4LSQH 2BY3A 5F7EL 1HQ4B 4WDIB 4PJBA 4OTXH 1MFCH