3TNQB

Structure and allostery of the pka riib tetrameric holoenzyme
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
331
Chain Sequence
EFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein kinase, cAMP-dependent, catalytic, alpha
publication title Structure and allostery of the PKA RIIbeta tetrameric holoenzyme
pubmed doi rcsb
source organism Rattus norvegicus
total genus 98
structure length 331
sequence length 334
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tnqB01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tnqB02
3JVRA 2ITUA 4YUQA 4YSJA 4MF1A 4OW8A 2HXLA 3COMA 3KXGA 4IDTA 5J9YA 3KVXA 5IKWA 4TYIA 3RAKA 2F7XE 4RJ6A 3U51A 5T68A 4MCVA 3WF7A 4CFNA 2PVHA 5J5SA 1EH4A 4V0GB 2WTKC 3KRWA 3F5UA 3LCSA 2UW6A 3TNWA 4E7WA 5CXZA 3EFLA 3FYKX 5G1XA 5L8JA 1W0XC 2ITZA 5CSPA 1RDQE 5BMSA 1OGUA 3NS9A 3CCNA 2OWBA 4CYIA 4MBJA 2DWBA 1ZY4A 3QAME 3DKGA 4X6QC 1YKRA 4Q2AA 3AMYA 3KL8A 2LGCA 1IR3A 5EOLA 4NCTA 3JS2A 3QHWA 4EJ7A 3IOKA 3R73A 4DEEA 2Y4PA 4R5YA 2B9FA 2ERZE 3IW5A 3LQ8A 2W1IA 4U3ZA 2WMAA 4BCIA 4TZRA 5KMIA 4XOYA 4YJTA 4GYGA 2ZYBA 2R7BA 4C37A 1Q8TA 3L8VA 3SX9A 3E3BX 4W8EA 4LRJA 3BKBA 3MH1A 4AZEA 5F9EA 1XWSA 5DA3A 2UW0A 2CLQA 3OOGA 1ZMUA 2HZ0A 3BQRA 4FT3A 5AMNA 4K1BA 3Q52A 5HNBA 3LFQA 1Q8YA 2IW9A 1OKYA 1WBVA 3Q4UA 4FSNA 3F7ZA 4XYFA 3UNZA 1P4FA 1M7QA 3PJ8A 1PKGA 5LOHA 4AW5A 2UV2A 4IEBA 2W96B 3NUAA 1GIHA 2XK6A 4E5WA 3BLHA 5GIOE 4I6HA 2OK1A 5E8VA 4AT4A 4YJVA 4NCTC 4DTKA 3GUBA 5B7VA 5IDNA 2XNEA 4U41A 2BAQA 3P7BA 5CU4A 3IPHA 4IWDA 3TNQB 5I4NA 1GOLA 2WNTA 3ODYX 3I7BA 3N51A 4KSQA 3LW0A 4DCEA 5CF8A 4KAOA 2XNBA 3QZGA 4C3RA 1TVOA 5HG8A 4YGAA 5J79A 3AD5A 5HVYA 4JQ7A 4A4OA 2YM5A 4I92A 4NM5A 5IQHA 4EORA 2ITWA 4EH5A 3KKVA 3VUHA 3R7GA 3VQHA 3ORMA 3MY0A 4CZUA 3B2WA 2I6LA 1W84A 1OM1A 3FBVA 2QR7A 3F82A 3V5WA 5CVFA 4IX6A 2NRYA 4C4FA 1PXLA 4R1YA 3ULIA 5I3RA 2ZM3A 2AUHA 2CN5A 2H9VA 2ZDTA 3R21A 4HYUA 3P79A 3NYOA 4JRNA 4N6YA 1J1BA 3GU7A 1UWJA 4L01A 1ND4A 4DEIA 5EM8A 1UU9A 2QC6A 3OXTA 5HBEA 2HZNA 4M66A 1E9HA 1L3RE 2ITXA 4TYHA 4XG7A 5HCYA 3KCFA 3ZM9A 1JBPE 1UNHA 5IPJA 3CBLA 4HGSA 4ITIA 4QNYA 1YI3A 4AZVA 4ASEA 3I81A 5KKRC 1ZYJA 5CEKA 2YAKA 4E93A 2HY0A 2BAJA 5KCVA 3TTJA 4I0TA 3R63A 4TYGA 2C6KA 1Q8WA 3FLSA 1Q24A 2YAAA 3EZVA 4FKGA 4FUXA 4ANOA 3POZA 5LMKC 4M68A 3REPA 3KXMA 3E8NA 2OW3A 5IDPA 4QMQA 3SD0A 4YP8A 3C1XA 4GIIA 2BDJA 2C6EA 3NCZA 5CVHA 5J8IA 4IZ7A 4LFIA 3RPOA 3WZEA 3UBDA 4Z3VA 4QYYA 4IWPA 4OAVB 1H24A 3NNWA 4HNFA 5ANOA 5AV3A 4WHZA 5KMNA 2WPAA 4E6DA 1QPCA 2C3LA 2ITYA 3UO6A 5CAQA 5AP4A 4L8MA 3OT3A 1KE8A 1Z9XA 2C5XA 4EONA 3H30A 4YNOA 3HL7A 4FIJA 3MPMA 5LJJA 2CKPA 1PXNA 4U43A 3A8WA 3QRJA 4PTGA 4G6NA 2X2KA 1PMUA 4LI5A 5C27A 2UZBA 4OTRA 2CGXA 2R3IA 1LP4A 1U54B 2QLQA 4J98A 3OP5A 5LARA 4FTTA 1H28A 4DTAA 5GIPE 5AUWA 5L8KA 3LFSA 1Q3WA 2ETMA 2VTNA 3LXNA 4LGHA 4YJPA 3V5LA 4ACGA 4DEHA 4YU2A 2VN9A 4BCQA 4DYMA 3IK3A 4ENYA 3VRZA 3HDNA 4CFWA 5A54A 2GTMA 4JG6A 4GVAA 3BIZA 1Y57A 2OSCA 4IB1A 4TNDA 4EK6A 4L3JA 2BDFA 2XUUA 1M17A 4BY9E 1FPUA 2PZYA 5HTBA 3F3UA 1PYEA 5I9YA 3NUSA 3PA4A 4JRVA 5CAPA 3D5VA 4ZY6A 5GNKA 3S00A 3C51A 5GZAA 3MTLA 3BBTB 4JQEA 3QTRA 5TF9A 3O8TA 1OL1A 4FVPA 2WMUA 4FBXA 4YC8A 4DG0E 3R1QA 2BHHA 3DXNA 2ZV8A 4BDIA 4F9BA 1OECA 4WG4A 3NW7A 5C03A 5HG7A 1P5EA 3FLZA 3LFEA 2HXQA 3A4OX 5EQYA 3QWKA 3ZSHA 1YOJA 4H3QA 2W1EA 3D5WA 3F9NA 4UALA 2OGVA 4BIBA 1XKKA 2AC3A 4CMOA 2WTKB 4G2FA 1PJKA 3B8RA 2VO7A 3EH9A 3H0YA 4O91A 3RNIA 4DFUA 2XMYA 3FKLA 2UZDA 4AE6A 3MFSA 5GJGA 2JDOA 4Z55A 4QMZA 1BI7A 4PDSA 5IQAA 2EWAA 3D9VA 3I7CA 4QP2A 3AGLA 2ZAZA 2GU8A 2OF4A 4O21A 3H0ZA 4RVLA 2PYWA 5D11A 4D4RA 1IRKA 4X0MA 4X3FC 4HVHA 3IDBA 4G3EA 4MK0A 4O0TA 4XG6A 3DXQA 3VS3A 1NXKA 2WMWA 4ONAA 3W2RA 4CT2A 5B2KA 3CPCA 3E88A 4FEQA 4WNPA 5DEYA 4AZWA 3ACKA 4YO6A 4L3LA 2XF0A 5KMMA 4AT5A 3S1HA 4UN0C 3ZC6A 3A99A 4MKCA 5DWRA 3U4WA 3VJNA 5EM7A 3DFAA 3Q2MA 3O8UA 3R6XA 4RWJA 2ZM4A 2WB8A 1JAMA 3QZFA 5BYYA 3CTQA 2RG5A 4G5PA 1B38A 4FE2A 3RKBA 3SA0A 4YLKA 1WBOA 4IM3A 2XIRA 4U8ZA 2SRCA 2HZ4A 1O6KA 5FBOA 4E5BA 2WIPA 3QUDA 3QQHA 4C4IA 3PY3A 3W32A 4BI2A 5E8UA 5DFPA 4Z7HA 2JIUA 4ZTHA 3MJ2A 5TE0A 5HVKA 3CLYA 3F2AA 5TKDA 2GFSA 4C33A 4IB5A 5CF5A 4USEA 4YMJA 5KBQA 3WOWA 5JEBA 1CSNA 1YQJA 3R8PA 5AX9A 5GZ8A 5CAVA 2VNWA 4QP8A 3BU3A 4PNKA 1WBNA 2YM6A 4N6ZA 3M11A 4K0YA 1OUKA 5HCXA 1KV2A 4I4EA 2OJIA 4KS7A 2ITVA 3W2CA 4C61A 4XP2A 4CCUA 5FP6A 4BDFA 3I5ZA 4EWQA 3G6HA 3LCOA 4IXPA 4MNEA 1KE7A 4XBRA 1G5SA 4PMPA 3ZBXA 2X39A 3QALE 3QKKA 3NUUA 3PP1A 4XLVA 3GI3A 4APPA 3L9NA 4OGRA 4R77A 3QQGA 2JC6A 4FC0A 4GS6A 5A4QA 2GS7A 1XHAA 4PDOA 3OTUA 3EHAA 5J7HA 3V04A 2BUJA 4F09A 1FVTA 5JQ8A 4UV0A 4K6ZA 2QKWB 5HU3A 3AT3A 1PXJA 4YJSA 3L9LA 5BPYA 3LCKA 1XJDA 4DEDA 5AUYA 5IZFA 1JLUE 1KOAA 3R1NA 3WZKA 2PVYA 3EFWA 3QZIA 3WILA 3PXRA 5KKRB 1ZY5A 3COHA 1BL6A 4ZJIA 5BUEA 4ZTRA 5LMAA 2PUPA 4TN6A 2C30A 3VULA 4BWKA 2YM3A 4EH6A 4FZDB 2VTJA 1ZWSA 4WBBB 3QFVA 5KHWA 4PWNA 5ANEA 5FLFA 4EOQA 3QQUA 1MRVA 3TZ8A 5C4LA 5BVEA 3NEWA 4L53A 3QD2B 4QMTA 4UMUA 4QTCA 3DKCA 4LL0A 4YTCA 4O0SA 2J6MA 3OMVA 4O1OA 3EQRA 4XV9A 1ZYLA 4AG8A 3D0EA 3R0TA 2J0KA 4RX8A 4D2RA 4TYHB 3K54A 3OCGA 3UOHA 4ANMA 4FNYA 4RJ5A 4X2FA 1P14A 1KE5A 1P4OA 3MWUA 4F6SA 2REIA 3LJ0A 5HZNA 4FTLA 4IFCA 5DR9A 4JDHA 2P55A 2CNUA 3P4KA 4G9CA 4JIAA 3GU6A 3T9TA 3HV4A 3OBJA 4YJOA 2GMXA 4ZP5A 3MB7A 4FZFB 4HGTA 4QQTA 4EZ3A 5EW9A 4BDBA 3DU8A 2VAGA 3RZBA 3OF0A 3ROYA 1M7NA 4FIGA 2PVMA 2A0CX 2XNOA 4IAFA 3PVBA 2F2UA 5BYLA 1SMHA 3BGZA 3HP2A 3Q9XA 2I0HA 2OXYA 5M55A 2C1BA 3CXWA 3ORNA 4FIFA 1H07A 2BKZA 5KO1A 4LMUA 2Z7QA 4AZTA 1SM2A 4FODA 1OKZA 2PE0A 4HYSA 4BYIA 5CSHA 1UKHA 1BKXA 1J7LA 4E3CA 4FK3A 4E4NA 3PUPA 4U5JA 3V5JA 5JFVA 1CM8A 2GFCA 4FL3A 5JN2A 3R71A 5FD2A 5C9CA 4AWIA 5M09A 2FYSA 5M53A 3A4PA 3ZXTA 4CTCA 1UNGA 3UC4A 4KKGA 3L9MA 4A7CA 4BTKA 3C4XA 2PZ5A 5IUGA 2UZUE 4ZSJA 4C7TA 4DFZE 4WA9A 4HGLA 3A7JA 5H8GA 2ERKA 2DUVA 3NUYA 1A9UA 4CV9A 4ZK5A 1JKSA 3EJ1A 1I09A 3JUHA 4FT0A 3SRVB 4AA0A 4BIEA 4FSWA 4NIFA 2RFDA 3NW6A 2WQEA 4FOCA 4XH6A 4PDYA 3OWKA 5EYKA 2C47A 1MRUA 1GY3A 2PVFA 3CSVA 4ZXTA 1YDTE 2JEDA 2W1FA 4RA5A 5ETIA 1GIIA 4JBVA 2HWPA 4LV8A 4MXOA 4F9WA 3QC9A 4I3ZA 3PJCA 3LMGA 4O7ZA 4AGUA 5AR4A 4U44A 3UO5A 3TI1A 4R7BA 1Q8UA 2XH5A 1E1VA 1OBDA 4HGEA 4QNAA 2JFLA 4I23A 4KD1A 3ALNA 4JDJA 4FT7A 4D55A 3ANRA 3DQXA 5CTPA 4F7NA 1DI8A 4KRDA 4F64A 5DRBA 5IQIA 4BR3A 4HW7A 4PUZA 5DOSA 4D28A 1YXUA 4CXAA 2W17A 3ZU7A 1GIJA 3E8EA 4FV6A 4FSYA 3UNKA 3AC4A 4MYGA 4B99A 2XCKA 5HBHA 3VS5A 4F9YA 4CG8A 3F6XA 4G17A 3OBGA 2R3KA 3O7LB 2BFYA 4G3GA 4UEUA 4DGGA 3UG2A 4AU8A 1OIQA 4FEVA 4YJQA 3OXIA 3R7VA 3Q2JA 5HCZA 1Q3DA 4IAZA 3OEFX 4CLJA 2QOLA 3E3PA 4A9RA 1XBAA 2ONLC 2YWVA 3SOCA 1W7HA 3DPKA 5K0KA 2BRBA 2GTNA 3FZOA 4FG9A 4EJNA 3P7AA 5F94A 3DV3A 2IN6A 2YERA 3RAHA 3U4UA 4A07A 2F7ZE 2QO2A 4N70A 3QYWA 4FKOA 3W8LA 5IEYA 1PXIA 3SXRA 5E8WA 3QTQA 3UIUA 2VU3A 4KIQA 3UG1A 1BI8A 4NM7A 4FZ6A 2W9FB 4W9XA 4EBVA 3WZDA 2G2IA 3EN7A 2QHMA 4GK2A 4B9DA 3DQWA 4MWHA 2YCFA 4OTDA 1YVJA 3ZDIA 5AUZA 3WIKA 5DT0A 3BI6A 4Z16A 5AJQA 4FT9A 4CFXA 3GC8A 3M1SA 4EUUA 3FHRA 3PRFA 3VRYA 2OKRA 4BZNA 1OUYA 4F65A 4IVBA 3RPYA 1WVXA 5AR2A 1WBSA 2B9JA 4IWQA 3BYOA 3NRMA 3OG7A 5GJFA 3U6IA 4FTOA 4MNEB 1OITA 4CNHA 2UZVA 3QXOA 3WYYA 2J5FA 3AC1A 3F88A 5I9VA 3R01A 3DDPA 4OBPA 5HIEA 3GC0A 4IC7A 3OZ6A 4K9YA 4O84A 4K11A 2OG8A 3K3IA 1YOLA 4KBCA 4ERWA 4FV1A 4LMNA 2R4BA 5CI6A 5FGKA 2UZNA 1IA9A 3TM0A 4WG3A 3TEIA 4EC8A 4ASZA 4BDCA 4CGAA 2ZV2A 4H1JA 2QLUA 3A8XA 4U97A 1BMKA 2BIYA 4RX7A 2VO0A 2R2PA 2QQ7A 3NAYA 3NAXA 4FKVA 2E9OA 4D9UA 3MTFA 2VWYA 3CD8A 3BV3A 3NYVA 5A4CA 2C0IA 3RPSA 2O0UA 1WMKA 3KN5A 5AR3A 3IW6A 5CEPA 4EWHA 2E9UA 3ENHA 3ITZA 4FF8A 2XK9A 3LXKA 2B9HA 2X7GA 2WTIA 1A06A 4QTBA 4TNBA 4X3JA 2OH0E 3FQSA 4BB4A 4GCJA 1T46A 3OFMA 2WEVA 2WMQA 1A48A 4DEAA 3HMNA 5AA9A 4BGQA 4PP7A 1ZOEA 3I0QA 3W10A 4O7LA 3TUDA 3FY2A 5EFQA 2JDTA 3R83A 3PSCA 3TNIA 5HOAA 4RZWA 2I0YA 5AP6A 4ZS0A 4QMMA 2B54A 5E7RA 4GK4A 3GC9A 5DE2A 3I6UA 2V55A 3POOA 4RJ4A 5CF4A 3PSDA 3R8ZA 3D2IA 3HGKA 3V8TA 2ITNA 3HRFA 4AX8A 4BZDA 4K2RA 4E6AA 3ZLWA 4A4LA 5E4HA 4QTDA 1RQQA 3PYYA 2I7QA 3VHEA 3LVPA 2VGPA 1SNUA 2BALA 5E92A 5IQCA 5ACBC 3ET7A 3F61A 4RA4A 2WO6A 4S32A 5DHJA 2QG5A 2WHBA 4QT1A 3IOPA 4D1XA 5F20A 5C1QB 1SNXA 1JKTA 3ZRLA 3EL7A 3BYMA 4WOVA 3I60A 5DR6A 4H1MA 3FXZA 1PKDA 5EYMA 3HMPA 2W4JA 4A9TA 1JKLA 3F3ZA 3LLAA 4UYNA 5KMLA 3RHXA 2YZAA 3F5GA 4YHJA 3VUGA 4JL9A 1U54A 4FV0A 4LOQA 5JSMA 3ATTA 1JQHA 4BBMA 3WZJA 2EU9A 3EQFA 3PA5A 2XCHA 4BZOA 5EKOA 3A62A 3BHHA 2C6IA 3Q9YA 5JRQA 1OPLA 1MP8A 4FG7A 1XH4A 4TXCA 3PXFA 4D4VA 3PIZA 2PSQA 3PVGA 4BDEA 4E73A 2C3IB 3QTUA 4EC9A 1XBBA 4RVTA 2ZV9A 1YXVA 3ZYAA 4C02A 4E5AX 5JQ5A 4PL3A 4L46A 1PRYA 3UYTA 4TWNA 4BC6A 3F7WA 3UVQA 4LUEA 3FKNA 3MVLA 2XIKA 4FTAA 5I9XA 4ALUA 4J53A 4BF2A 3QGYA 4EH7A 3CE3A 5HO6A 2E9PA 3BELA 4G16A 4LG4A 4O7SA 3TZ7A 3AT2A 4PL4A 3VUIA 3OCSA 3MV5A 3HV6A 3TV4A 2OFUA 1XH5A 4NIFB 4CMUA 3QD4A 4WNOA 1OZ1A 4FYNA 1B6CB 4AW2A 5EDRA 4FSTA 2YWPA 2OJ9A 4PPCA 2IJMA 4NZWB 2PVLA 2WTDA 2QURA 3FZ1A 3JPVA 4YNEA 5JZNA 4DTBA 5HQ0A 5C4KA 2VX3A 3GXLA 1WBPA 1K2PA 3JR1A 2V0DA 4PPAA 4WNKA 4DFBA 3IONA 4K8AA 1YRPA 4IAAA 5A4TA 2XM8A 3G2FA 3DDQA 4JX7A 4DH3A 4NW5A 4JBOA 5M51A 1YOMA 1PXKA 3OS3A 2IVUA 4JI9A 1W98A 2ZMDA 4HZSA 5ANGA 3LFDA 4JS8A 3R7IA 5LCJA 4J97A 3MH2A 4FV8A 5KZ0A 1GZOA 5I9WA 4FKUA 4TYJA 4ZLYA 3PPKA 4G31A 3SXFA 4BBFA 3E62A 3WZUA 1H1QA 2UZOA 3OEZA 4IACA 5AM7A 2EXCX 4I1ZA 3E92A 2QNJA 3C4CA 5CT0A 1JWHA 1OIRA 4CFUA 3A2CA 2VTLA 1OL6A 2YJSA 3CJFA 3ZH8A 2W7XA 4NYEA 1Q97A 2YEXA 2DQ7X 5EHYA 2UW4A 4U7ZA 2VGOA 3ID6C 2FGIA 4U45A 4OTIA 4QMVA 3IDCA 5H9BA 2W05A 5HNGA 2X9FA 3DY7A 1UU3A 3C5UA 2P2IA 1W83A 3TKHA 3QYZA 4I21A 3HRBA 2WD1A 1NA7A 5JFSA 2R3MA 3QZHA 4ZTLA 3HKOA 4I5HA 4GKIA 4BI1A 1YHSA 4RJ7A 3RAWA 1Q61A 2W4KA 3G5DA 3PXKA 3LFNA 1TKIA 4NFNA 3CTHA 3ORKA 3VF9A 4IE9A 3RK5A 4C8BA 4YZMA 3MJ1A 3B8QA 3N4TA 5I9UA 2HENA 3FLWA 1RW8A 3VUKA 3RCDA 3IGOA 2QOIA 3PWDA 2UVZA 5AP0A 4DG3E 5HO7A 3EMGA 4Y5QA 5D1JA 3UOLA 4ID7A 2VTMA 4D4SA 4ZMFA 5IEXA 3UQGA 2EUFB 1OKVA 1GJOA 4QYHA 2OJFE 3QUPA 4RT7A 4CV8A 5L2WA 4PPBA 2F2CB 2JKKA 3BV2A 4ZS4A 2BRNA 4GMYA 2RFNA 3P7CA 3UIBA 1OVEA 3FZSA 4R5SA 1FGKA 3TJDA 1MUOA 3W33A 3DLSA 2YIWA 4KUJA 2CCIA 2OFVA 5H8BA 3R2BA 3ALOA 3WARA 4NEUA 3RZFA 5CI7A 2CN8A 2C5YA 2X8DA 4OTFA 5DEWA 4F99A 1H25A 3K3JA 4NW6A 1AQ1A 2F7EE 3QQKA 2QODA 2PVJA 4GVJA 2OO8X 4P5ZA 3ENMA 3C9WA 2VTHA 3CC6A 5TT7A 4CLIA 3FL4A 2BZKB 5EYDA 2G15A 4L44A 2WGJA 2VWWA 2Z7RA 5LMKA 5M4UA 5HX8A 1VYWA 4XCUA 5KUPA 3SVVA 4EOSA 4DCAA 2OJJA 2VWXA 3ODZX 4IQ6A 4M15A 3F2RA 1Y91A 4I94A 2XK3A 2GNJA 4BCKA 2YDKA 4OTGA 4QYEA 2IO6A 3GEQA 2X7OA 4PTCA 3PIXA 4OBOA 1ZLTA 4AQCA 2YJRA 4DEBA 2CCHA 2ETRA 3IW8A 3W2SA 5CF6A 3SG9A 4I93A 1O6LA 1H08A 4Q9SA 4EKKA 3PLAE 3AD6A 4O2PA 4C59A 4ANSA 3FLYA 4QP4A 5CEMA 3UVPA 2KTYA 2HK5A 4V04A 4BWXA 3VF8A 4F70A 4J1RA 3HUBA 2IW6A 3G0EA 5CENA 5E8SA 2VTOA 3RJCA 2PU8A 3FAAA 5M08A 1Y6BA 2B52A 2CGVA 2Y4IB 1OPJA 3FY0A 4AXAA 4QMWA 5J9LA 4DE4A 2PZRA 4U79A 3C0IA 3MDYA 3VJOA 1KE6A 5IISA 3HAMA 1YW2A 1ZZLA 4X2KA 3LCDA 1DS5A 5IQBA 3ULZA 1IAJA 5DT4A 4XBUA 5D9HA 2VTRA 2C69A 3QRKA 2PK9A 4KSPA 3C5IA 4WRSA 5EHOA 5L4QA 4BCHA 1Q62A 2B4SB 4G34A 4TT7A 4WSQA 4YZCA 3FMDA 2OJGA 3CPBA 4UZHA 2XNMA 5LWMA 3VS4A 5CZHA 2X2MA 1OBGA 1WBTA 4P2KA 3V01A 4Y72A 2V62A 2Q0NA 5EYCA 5K4IA 3LFCA 5C26A 5IMEA 2G9XA 3F69A 4PDPA 3VBQA 3PPJA 3D94A 1RE8A 4MF0A 3EQBA 2H6DA 1S9IA 1FVVA 2ZVAA 2X8IA 3FV8A 3BGQA 5EW8A 2Q83A 4O0RA 1WAKA 4QMSA 1U5RA 5FDXA 1ZOHA 2WTVA 5A4LA 3VUTA 5AUUA 5CS6A 3QQFA 4ZTQA 2Y8OA 1GZNA 1OI9A 3MW1A 2CLXA 3IG7A 3KF4A 3WE8A 2BTSA 3LM0A 2J7TA 4FKWA 4FICA 3E63A 5AP1A 1TQMA 5EHLA 3EN5A 3WYXA 5TO8A 4XOZA 1IAHA 4KS8A 3PVUA 5K4JA 2HW6A 3IDPA 4E4XA 3Q4ZA 4R3PA 4M69A 3JYAA 4FMQA 3ZZEA 2I1MA 3FMMA 3PY0A 4X3FA 5AIRA 3S95A 2J0LA 3SRVA 4LQMA 3M2WA 4D1SA 4TY1A 4YLJA 3TXOA 1FVRA 3Q4TA 4BVUA 4CKRA 3BGPA 3RPRA 4J96A 4DH7A 4Y83A 4BIDA 2A4LA 2OXXA 3KC3A 2C5OA 2W1CA 3W1FA 1J3HA 2YACA 3UQFA 4G9RA 3KMMA 3Q6WA 3C0HA 4G6OA 5FTQA 4UMPA 2R3RA 4ZOGA 5FEDA 2XRWA 2F57A 4OTWA 4R6VA 5D7AA 4MEDA 4BGGA 2C6OA 3LMHA 1R39A 2PZIA 4GT5A 3ZM4A 3AC2A 2GHGA 4YBKA 5HTIA 4DGOA 5GHVA 3MA3A 1STCE 5ANJA 3R7EA 2PMNX 2R9SA 4ZLOA 4DH1A 1R1WA 4FGBA 4ANNA 3D83A 3MIAA 2QI8A 2WMSA 4ZJJA 4GU9A 3ERKA 4GU6A 3ZUTA 5LMBA 2J51A 3NVKI 2VZ6A 3EQIA 4BRXA 2VTPA 5L3AA 5EI8A 3LHJA 2W1GA 3FQEA 3R9DA 2CKEA 3C4EA 3TIZA 2AYPA 4K77A 2OZAA 2WMVA 4OR5A 4EYMA 3L8SA 3QLFA 5E8XA 1OIYA 2FSLX 4O0WA 1R0EA 4OTPA 3KULA 4XG4A 4W9WA 2FSTX 5T3QA 1LR4A 2XP2A 4L42A 2O2UA 4XV2A 4B8LA 3PVWA 4R78A 2Z2WA 4E6CA 1ZARA 4EHGA 4IAIA 3FPQA 4IB0A 3EN9A 4C58A 1CKJA 4ANLA 4I4FA 4NJDA 5G6VA 4FTQA 3ELJA 4C34A 4AN2A 5FDPA 1SYKA 3HV5A 5IH5A 1ZMVA 2QG7A 5HG9A 4BDHA 4EHVA 3HMMA 5DT3A 5BYZA 3QQLA 4HCTA 3ZUUA 4LRKA 2FB8A 2BZHB 5M4CA 5BQ0A 4X6RA 3OROA 5CU2A 5HLPA 3OWPA 3ZRMA 1BL7A 3D7TB 4D58A 2UZLA 4FNWA 3RALA 4FL2A 3VS6A 4DC2A 4C38A 3PE2A 4E20A 3GQIA 4GEOA 4I0SA 2QO7A 3BBWA 3R8MA 5AEPA 5EI6A 3ORLA 3L1SA 3CIKA 3KMWA 4XEYA 5BUJA 4FTMA 3KA0A 1R3CA 2OLCA 4NSTA 2FSOX 3TV7A 5E8TA 5LWNA 3EFKA 3V6RA 5FEQA 4FKTA 3PPZA 2DS1A 3VUDA 4JX3A 4R3RA 2IVVA 3CQWA 1PHKA 4KA3A 4YJNA 4HVIA 5AAEA 5IA4A 2XIZA 3LZBA 4O83A 2X6EA 2VWZA 3K5VA 4LOOA 4UMTA 4AA5A 4FEXA 5IQDA 4LM5A 4FKSA 2BRMA 4Y5HA 4CKIA 2C6MA 3ORIA 3W2PA 3VO3A 4AE9A 2XKDA 4QMNA 5DPVA 1LUFA 1REJA 3VBWA 1AGWA 2X81A 5JK3A 2XNPA 3O71A 2C3JA 4UWCA 3ZFXA 2I0VA 3Q6UA 4BCGA 3D14A 4AFEA 3QXPA 4IVDA 3LXLA 4DITA 2GNIA 5K9IA 2HY81 1RJBA 1U5QA 5HG5A 4FV7A 3OVVA 4WUAA 4M3QA 3COKA 2UZEA 3CGOA 3L9PA 3LFAA 3NZ0A 5F95A 3WF5A 3ZBFA 2XYUA 3IW7A 3P86A 3TNHA 1IASA 3NWWA 5D10A 4ZTSA 2OZOA 5FTGA 1VYZA 2OU7A 3P78A 1H1RA 4OBQA 4DA5A 5AV1A 3AQVA 4XP0A 3C4ZA 4GV1A 4C4EA 4RIYA 2QOKA 3MA6A 2JITA 2BRHA 4UY9A 5JZJA 1CTPE 4QRCA 2JKOA 4C0TA 4YZDA 4EOPA 2WU6A 4RSSA 4YZ9A 5ICPA 4UYAA 4F1OA 2VWBA 2H34A 5AP2A 4O82A 3KXNA 3W8QA 3GCSA 3EKNA 1G3NA 2R3NA 3CY2A 1S9JA 2YIXA 3OY3A 1DM2A 4N4SA 1FINA 1XH6A 2PZPA 4F4PA 5AR7A 5CEOA 4MXCA 4CCBA 4BCMA 4BICA 4UMRA 3UQCA 2WZJA 3R02A 1UV5A 4USDA 4BWPA 2RG6A 3R1YA 5M44A 2WQOA 4ZSGA 2UUEA 4DEGA 2A1AB 1OL7A 5HI2A 5B2LA 4NL0A 2YHVA 5KMKA 1QPDA 3KMUA 4DBNA 4ZZOA 4S33A 3H10A 4DGNA 3FJQE 4FNXA 4GT3A 2Y6OA 1LEWA 4GYIA 3ZTXA 1P2AA 4O0UA 1WZYA 3W16A 2BKKA 4ZZNA 1XBCA 1YHWA 3RINA 2C68A 3DAKA 4UMQA 4YC3A 2WELA 3AMBA 3KCKA 4BHZA 3N4UA 4CEGA 3LLTA 2YISA 4GSBA 4PX6A 4BCNA 2W9ZB 3H9RA 4IADA 3VAPA 3ZO4A 5HGIA 4D2WA 4EOIA 4WIHA 3UTOA 3OD6X 3H9FA 5HE2A 1OIUA 1U59A 3CY3A 5HLNA 3C50A 2C6LA 2XKCA 1H0VA 4X2JA 4QTEA 4E8AA 4N57A 3F3VA 3TKIA 4NJ3A 4B8MA 1UVRA 3R8UA 3QWJA 5DR2A 2EVAA 3FXWA 5E91A 3I1AA 5JGBA 4M69B 1TQIA 3CD3A 5JH6A 4O6LA 3CJGA 4XRLA 3C13A 1YXSA 3PXYA 3RMFA 2OICA 4X3FB 3JVSA 2WQNA 3RGFA 1PMVA 1URCA 2B55A 4TYEA 3LJ2A 4AZFA 3EWHA 5GZ9A 4ZTNA 4H05A 2KULA 5IA1A 3PDTA 1PF8A 1QPJA 3SW7A 4W4XA 3E87A 3RWQA 4YO4A 3RBWA 2XA4A 3LJ1A 4IB3A 5EM5A 3EQCA 4EZ5A 4IMYA 1XH7A 2GNFA 2JGZA 4XMOA 4JOAA 2QCSA 3ZMMA 2W0JA 4XNEA 2X6DA 5AUVA 2ONLA 1ZMWA 5A6OA 5K5XA 2XIXA 4FL1A 4FIHA 5EOBA 3QUEA 4I22A 4AAAA 5L2TA 4QOXA 3UMWA 3GCPA 3MY5A 3QRUA 4IVAA 4IX3A 4LL5A 4DT8A 2BDWA 3FSKA 1MRYA 2WXVA 4EYJA 5A14A 3QD3A 4MD7E 2BILB 4DLIA 3FZTA 4ZMEA 4F6UA 4HNIA 3ORPA 4RWKA 3SAYA 4AGCA 4PMTA 4IX5A 1CDKA 4A06A 3V8WA 4DLJA 2FA2A 1HOWA 4OT5A 2R3JA 1CKPA 3EN4A 3ZOSA 3MB6A 3TN8A 4KB8A 1REKA 4DGMA 2GNHA 4R7HA 2F4JA 5E1EA 3DZQA 4U3YA 3D5XA 3G15A 4J95A 3MSSA 4GFGA 5F4NA 5J9ZA 5LVMA 4L7FA 2BTRA 2ZOQA 5LXMA 1X8BA 2OZAB 5ETCA 4AOJA 4EOMA 2PHKA 2OBJA 4Z9LA 3HP5A 5LVOA 4GFMA 3HX4A 4GFOA 4FR4A 3KULB 2YA9A 3V8SA 2UW3A 3OHTA 3FPMA 3HUCA 4I5CA 4L6QA 4F7JA 1WBWA 4YPSA 5B0XA 1JSVA 5B2MA 1DI9A 3ORTA 5HIDA 5AAGA 3D2KA 5DGZA 5FTOA 3K2LA 4XX9A 3HVCA 4NH1A 5E90A 2QD9A 2ZDUA 3OXZA 4ACHA 4K33A 3VBYA 2PVKA 3CKXA 4HCVA 4O6EA 3EN6A 5IQEA 3DTCA 4RIOA 1M2RA 5CLPA 4QPMA 3EKKA 4JDIA 4HVDA 2X0GA 5LVLA 3VS1A 3UPZA 4NM3A 3DLZA 3S0OA 4BBEA 2WQMA 2ZB1A 4ACCA 4MD8E 1E1XA 3LMIA 2R3GA 4KIKA 3FQHA 4YJUA 3NUPA 5HBJA 4JQ8A 3SGCA 1J7IA 4EH9A 3JY0A 3DKOA 4FVRA 4TPTA 2O8YA 2GPHA 3O8PA 5M56A 4FKIA 5JFWA 4AUAA 4RFZA 1WFCA 4ZY5A 3BHTA 2LAVA 3GBZA 4H58A 4J52A 2GSFA 4JJRA 4WUNA 5IU2A 2G01A 4DT9A 3T8OA 1ZYDA 3Q04A 2HOGA 3DBCA 3UDBA 3W18A 3SHEA 3V5PA 4E1ZA 1KE9A 3HYHA 3Q96A 4GUEA 3E8DA 4NU1A 2YITA 4JIKA 3VUMA 2QOQA 4CG9A 2GHLA 3A61A 4KWPA 2VWIA 3E5AA 4G1WA 1Z57A 3Q3BA 4HZRA 1KWPA 4IM2A 4WRGA 3ROCA 1O6YA 3CTJA 3EOCA 4BN1A 3HA6A 4QO9A 3U6JA 3IKAA 2HZIA 4L9IA 3P5KA 2C0OA 3SXSA 2PUNA 1QCFA 1PMNA 4ENXA 3GC7A 4YZNA 4DINA 4O7VA 1J91A 2CGWA 3NNVA 5L2SA 4QPAA 3MIYA 3TACA 3V6SA 3VBTA 4C36A 3E8CA 3DJ6A 1G8AA 5EDQA 3CR0A 3RWPA 3ZZWA 4C2VA 1UU8A 3QKMA 1XQZA 3C4WA 4F0IA 2Y7JA 4CVAA 2PY3A 5CXHA 1QPEA 4FG8A 4GL9A 2GS6A 4CZTA 4JVGA 1ZYSA 4RIYB 2NRUA 3FSFA 2WMRA 4BHNA 3AC8A 3DA6A 1J7UA 4EQMA 5CNOA 4CD0A 3CKWA 3HV3A 4QMPA 4AOTA 3DBDA 2GNLA 4RX5A 4BDKA 3S2PA 3GU5A 3VQUA 2WEIA 4RWLA 2OI4X 3I4BA 5IG1A 5GJDA 1VZOA 2CGUA 4O7RA 4KNBA 4IIRA 3L8PA 2CPKE 1YXTA 2VV9A 5IEVA 2A2AA 4MWIA 4BDJA 3DZOA 3HDMA 4NTTA 4TWPA 5CVGA 4PRJA 3ZLSA 4OAUC 3FYJX 4QQCA 5EDPA 5L6PA 3PG1A 4H3BA 4C4GA 3DK3A 4QYFA 4Q5HA 2GQRA 4I20A 3TIYA 4O7WA 1Q4LA 3GT8A 4HVGA 4F0GA 2ACXA 4FT5A 4WBOA 3BHUA 2OIQA 2VD5A 5AFVA 2J90A 4UX9A 2X8EA 5LQFA 4QTAA 5JGAA 4KIOA 1H0WA 3ANQA 3DFCB 2XJ1A 3NUNA 3GQLA 3MYGA 4PP9A 3U55A 3DJ7A 3FC2A 2R0UA 4U80A 3R9HA 2RGPA 4DFNA 1H1SA 1FOTA 4GW8A 4FTCA 3PA3A 3P23A 2WMBA 3FLQA 3G33A 1URWA 5BX0A 5HD4A 4TW9A 5AUXA 3DJ5A 2YLEA 5CU0A 3QLGA 3CEKA 2XYNA 3HV7A 4N0SA 4BTMA 3QCYA 2VWVA 4M84A 4ALWA 3I6WA 1O9UA 2GCDA 4BKYA 1ZZ2A 4TWOA 3S4QA 2O3PA 4O7YA 2R3FA 4CZYB 4P5QA 3R00A 4LGDA 4O86A 4ASXA 4GUBA 4JG7A 3SQQA 5AA8A 2F49A 5HNIX 1HCKA 4MQ1A 5DBXA 3VN9A 5LVNA 5E9EA 4MAOA 2ZB0A 3DS6A 1PYXA 4FZAB 4IANA 4AGDA 4RFMA 4L68A 2B53A 3IS5A 2B1PA 2QVSE 4ZZMA 3ZO1A 1ZRZA 4ORKA 4AW1A 4HJOA 4EH8A 4Y8DA 2NNWB 5BVFA 3DCVA 5CYIA 3KRRA 4NM0A 4AP7A 3DBFA 2YIRA 4G3DA 4QMYA 4ALVA 3NUXA 3FMNA 4JLCA 4P7EA 2IZUA 2UW5A 2R3LA 5D12A 4D0WA 2PUIA 5AP3A 3W2QA 4BCFA 1BX6A 3PJ2A 3BE2A 4M12A 1FGIA 3DT1A 3KN6A 5AUTA 2YLFA 1IA8A 1PXOA 1XO2B 2RL5A 4BDGA 4CSVA 3PLSA 3QHRA 5KZIA 4ITJA 2FSMX 1H00A 3KK8A 3FMKA 2BRGA 4DH8A 5CASA 4AA4A 3BYVA 3DB8A 4S31A 3TTIA 3OY1A 3PXQA 4BTFA 2XKEA 3D4QA 5JT2A 3EQPA 4WT6A 3MFTA 4XG3A 1VEBA 5ANKA 4Q9ZA 2EXMA 3QX4A 4IH8A 3F2NA 4DHFA 3MN3A 4HVSA 3AGMA 3R8VA 4W4WA 3EYHA 2RIOA 3QTIA 4J8MA 1J1CA 3ZFYA 1FQ1B 3W55A 3FI2A 3NYXA 2IZSA 4F1TA 3FC1X 2O64A 5FM3A 4F7LA 4D1ZA 1NY3A 2PMIA 3LM5A 3QQJA 4S34A 4AW0A 3BU6A 4JBQA 3ORXA 4AS0A 5HX6A 1OPKA 2JIIA 1CKIA 2OIBA 1K9AA 2VX1A 3CQUA 1XH9A 2NO3A 3DNDA 3GFEA 4J99A 2W1ZA 3DK7A 3VWAA 3ZCLA 4FTJA 3BPRA 2Y9QA 4FKJA 4XRJA 3HNGA 2CHLA 4IWOA 4IHPA 4C4HA 4FV4A 3ZSGA 4NWMA 1B39A 2H96A 4Y46A 5AX3A 3SG8A 5CU3A 1FMOE 3DKFA 3UVRA 5CZIA 4MXYA 1JPAA 5DVRA 3D7TA 3PRIA 1PY5A 3KY2A 3ZRKA 2YCRA 1KSWA 3KB7A 2HAKA 4GJ3A 4YHTA 4MXXA 2V22A 5FQDC 2R5TA 4RZVA 1U46A 5IQFA 3BLRA 4W4VA 4DBXA 3NR9A 2C6TA 4B4LA 2R3QA 2EB3A 3ZDUA 3VBXA 3CGFA 4KIKB 4LRMA 5J7BA 3CP9A 3T9IA 3G9NA 3RK9A 2GQSA 1UU7A 2JAMA 2QU6A 3OT8A 4PMSA 3HZTA 4O7NA 5FXRA 3QL8A 5TR6A 4L3PA 3F5XA 3MPAA 1H8FA 4FYOA 4M7IA 4LGGA 4RBLA 1JSTA 2B9IA 3AMAA 4G3FA 4QYGA 2HELA 4MQ2A 4EHZA 2UW7A 4P90A 2VTAA 5HE1A 5CSXA 3UP2A 2W4OA 4JAIA 3FZPA 1Y8YA 3AC3A 4HYHA 3TUCA 4EH3A 1YDSE 3QRTA 3HMIA 3EYGA 3HMOA 4ZJVA 3FXXA 4EK3A 5KHXA 4KBAA 4X2NA 3KQ7A 5M4IA 4UZDA 3LE6A 1HCLA 5HLWA 3NIEA 4UWYA 1UWHA 4V05A 3UP7A 3UZPA 4WD5A 4WO5A 4IJPA 4YZBA 2BHEA 2BR1A 2PTKA 3A60A 3H4JA 2X4ZA 2VX0A 5FG8A 5BVDA 4MNFA 5DYJA 5CAOA 4I6BA 4BKZA 1XR1A 2XK4A 3Q9WA 4FV5A 4G3CA 3TT0A 1H4LA 1PXMA 2HIWA 2RFSA 2RSVA 2PULA 4F9AA 5D7VA 3VBVA 4I5MA 5IUIA 5A3XA 3MS9A 4I41A 1W82A 3I5NA 3R8LA 3T3UA 2YABA 3IW4A 4UXQA 2XK7A 2VTQA 4QP7A 4PMMA 5L2QA 4MD9E 4YURA 4RRVA 4BCJA 3A7HA 2PL0A 5L2IA 1YWNA 3DAEA 4DFXE 3VW8A 5BVOA 5FRIA 3GB2A 4CT1A 4EL9A 2WTJA 3IGGA 5K5NA 4PQNA 3ZHPC 3FI3A 2QHNA 2ITQA 3Q60A 1Y8GA 5H2UA 4FVQA 4QMXA 2PVRA 4FGRA 5JFXA 5M07A 4I0RA 2JKQA 4FSQA 1VR2A 5KBRA 4RGJA 2HCKA 3GFWA 1YXXA 3LQ5A 3Q9ZA 3QF9A 3TV6A 5CAUA 4DN5A 1LPUA 1Q5KA 1TQPA 1MQBA 4ZTMA 4UBAA 5CSWA 3WIGA 4II5A 2W5HA 3QRIA 4EOJA 5I0BA 4GT4A 2P33A 3T3VA 3MH3A 5AWMA 2FUMA 5A46A 4DAWA 5L6OA 3BCEA 4JR7A 5IH4A 2VNYA 3UYSA 4RJ8A 4IBMA 3CS9A 4YC6A 2Z7SA 5AP7A 3OC1A 5CSVA 1ERKA 1APME 3G6GA 2ESMA 3MESA 4O1PA 4RIXA 3BZ3A 2IPXA 1OMWA 3V5QA 1ZXEA 1V0BA 5KE0A 3UPXA 4ANBA 4BGHA 1M52A 4R3CA 1H26A 3NVMB 2XNGA 5EK7A 3WBLA 4RMZA 4GRBA 3BYUA 3UODA 5J1VA 2Z60A 4I6FA 3BHVA 4P4CA 4YTIA 2NPQA 4TKSA 1OKWA 3FLNC 2YM8A 3KGAA 3UGCA 4L7SA 2C6DA 4ZSLA 4GIHA 3AXWA 4QP9A 3S3IA 3MVJA 5FUTA 3FEGA 1OB3A 1ZOGA 2GDOA 2WOTA 3RM7A 4JR3A 1WCCA 2QO9A 3OTVA 3V3VA 3U6HA 4QMUA 2WU7A 3A7GA 3A7IA 5DI1A 5IUHA 2JBPA 5ACKA 3NSZA 4AF3A 4WNMA 4YHFA 3IQ7A 1JSUA 3II5A 2QKRA 3EIDA 3NCGA 4ARKA 4IC8A 2XBAA 5A9UA 4YTFA 4U40A 1ZYCA 5DG5A 3BU5A 5CY3A 4EK8A 5CX9A 2JDRA 2UVXA 1ZAOA 4FTIA 3LKMA 3TWJA 1M14A 4EK4A 3LIJA 5L6WL 3V5TA 3F3TA 1FMKA 4HOKA 5E8ZA 4RJ3A 3GU4A 5T6KA 4RPVA 3QTZA 4XG9A 5JKGA 4FTKA 4C62A 5DRDA 4FIEA 2PVNA 3PP0A 4O7TA 1IEPA 5C8MA 3QGWA 3OW3A 3G9LX 4ZSEA 3O0GA 5BNJA 3PE1A 3NPCA 4EKLA 2PE1A 2VUWA 3KRXA 4JAJA 3NNXA 3LCTA 5EW3A 4WG5A 3RI1A 5A4EA 5BVNA 1M2PA 1U4DA 4E6QA 1UKIA 2VO3A 3PZHA 4FKRA 1V0OA 5JMSA 1SVHA 4U6RA 3KXHA 1GZ8A 2VTTA 3P1AA 5CEIA 1QL6A 2E9NA 3VC4A 3NNUA 4J8NA 2JAVA 2PE2A 3OWJA 3OUKA 2P2HA 3WF8A 3UC3A 1G8SA 2R64A 5M4FA 5HHWA 2V7OA 5GINE 3ZEPA 3LFFA 1UA2A 4BDAA 3TDWA 3L8XA 4NK9A 2BIKB 3EB0A 3NMUF 4PNIA 4U0IA 3GGFA 4IJ9A 4RIWA 2G1TA 2B7AA 3E7OA 4R1VA 4U42A 4ZY4A 1JKKA 2J4ZA 3GCVA 5EQEA 3DAJA 3AT4A 4QPSA 1MQ4A 5FBNC 4FEUA 3PZEA 3VW6A 3EFJA 4XJ0A 1IG1A 4IX4A 5TOZA 3GCUA 3R7OA 4ASDA 4F1MA 4FKLA 3LPBA 3IO7A 4DG2E 3RTPA 3LXPA 2GNGA 2H8HA 4USFA 5KMOA 5C8KA 5M57A 2BMCA 3TZMA 2P0CA 3FL5A 4FV9A 3U9NA 4EQUA 3E93A 3DB6A 3VS0A 4BKJA 3QD0A 2XZSA 2XIYA 4R8QA 4RQKA 1OL5A 3MFUA 1YHVA 4I6QA 3NDMA 2OH4A 4O0VA 4PY1A 3TL8A 2C5VA 3SDJA 2F9GA 5HESA 3PJ3A 3DNEA 1F3MC 2WAJA 4RFYA 4Y95A 5ETFA 4ACMA 1H27A 2J9MA 3NGAA 4C57A 4O0XA 4D0XA 4ZLZA 3QA0A 5FP5A 3HECA 2PMLX 3R1SA 2HWOA 2WOUA 1BUHA 3U87A 3HEGA 2Y0AA 5AR8A 2XS0A 4A9YA 4A9UA 1WVWA 5H3QA 2O63A 1VJYA 4QD6A 4UXLA 4BFMA 4YR8A 4H3PA 4CRSA 4FNZA 3HA8A 2CJMA 3PY1A 2YDIA 3PJ1A 3VS7A 2O65A 2RFEA 4C3FA 3U8WA 3ZSIA 5EKNA 1YWVA 5BVWA 4AGWA 2VO6A 2QOBA 2R3OA 4XV1A 1H01A 2VRXA 2IVSA 4M0ZA 3N4VA 5J1WA 4GK3A 2XB7A 4MTAA 2JDVA 5L8LA 1H1WA 3PXZA 3CQEA 3AC5A 3B2TA 4M8TA 4YLLA 1Q41A 2YFXA 2CMWA 4GH2A 4E4LA 3VHKA 2BFXA 2ITTA 3GOPA 4H36A 2QOFA 4M14A 5FEEA 3FZRA 5I3OA 3FKOA 5HE0A 4O96A 5E8YA 4FSMA 3I0OA 4I5PA 4GJ2A 4NFMA 2QR8A 3EQGA 2IVTA 4ERKA 4IVCA 5IA3A 4NKAA 5ANIA 4A4XA 4CQEA 4TRLA 4OUCA 2XVDA 3MI9A 4HPUE 4IFGA 4S2ZA 3O50A 1H1PA 3OCTA 4KKEA 3SV0A 2W99B 4H39A 4IZAA 4U81A 4WKQA 5IF1A 3OW4A 1V1KA 2IG7A 4WSYA 5K0XA 3TG1A 2UZWE 5K3YA 4FA2A 2VWUA 1QMZA 2I40A 3C4FA 4BI0A 4Q5EA 1BYGA 2WMTA 3BHYA 4GKHA 3KEXA 4BTJA 3HAVA 2XEYA 4KBKA 3FHIA 4OTQA 3DBQA 3SLSA 3GNIB 4IZ5A 5EQPA 3HRCA 3BX5A 1F0QA 3R28A 4QP1A 3BWFA 3D7ZA 4S30A 3KREA 2R3HA 4EUTA 4Y85A 3W2OA 3R2YA 5ITAA 4B0GA 2CSNA 4AZSA 2YZLA 3O96A 3OUNB 5DN3A 1Y6AA 2XNNA 3VS2A 1OL2A 2QOHA 2EXEA 3RVGA 3VVHA 4D2VA 1NT2A 1F5QA 4MX9A 1ATPE 5IA2A 2PMOX 5C8NA 4IAYA 4CMTA 5F1ZA 4RIXB 2BROA 3C0GA 3D5UA 3O7LD 2QOOA 3GVUA 3RK7A 4F0FA 1T45A 3TZ9A 2W5AA 1LEZA 2I0EA 4MXAA 2AC5A 4APCA 2Q0BA 5CWZA 5HICA 3OOMA 4M97A 3U9CA 4FKQA 3R9RA 3GCQA 5JGDA 1SVEA 3H9OA 4F9CA 3ZXZA 3MFRA 5AIKA 2X7FA 2EB2A 4D5KA 2RKUA 4J71A 3QCXA 4FSZA 4RC2A 2G2FA 5CEQA 4CFVA 2WQBA 3RCJA 1KUTA 4KRCA 4BL1A 3TKUA 2ETKA 2HYYA 3HLLA 3U54A 3QCSA 5BVKA 3H3CA 1L8TA 4O22A 4LYNA 4YSMA 4FI1A 4JXFA 3BQCA 4O0YA 4B7TA 4RLKA 5M06A 2Z7LA 3DK6A 4HPTE 2BAKA 3AD4A 3WF9A 2YCSA 3WI6A 1BLXA 4V01A 5DMZA 1M2QA 1R78A 2OXDA 3DTWA 3MY1A 3BE9A 4F08A 2WFYA 2XJ0A 3MBLA 4AACA 4EH2A 4E4MA 3COIA 3EQDA 5EM6A 4TL0A 4EZ7A 4YPDA 3D15A 3NIZA 2C5NA 2YDJA 3RP9A 4W4YA 2IZRA 3SW4A 3V51A 2XEZA 5HIBA 2XRUA 4HYIA 4QP3A 4JBPA 3ATSA 3QTWA 5I9ZA 3FMJA 2GS2A 4NKSA 2BCJA 4XP3A 3R7UA 5DH3A 5KMJA 4L43A 3SKCA 4AFJA 3LFBA 4LUDA 2XM9A 4XLIA 4D2PA 5J5TA 1K3AA 3NW5A 4D4YA 3NX8A 2CNVA 2XK8A 3MVHA 2YIQA 4CYJA 4R7IA 2X9EA 2YN8A 3EL8A 3FMLA 4L00A 5HD7A 2HW7A 4XV3A 4MBIA 2JD5A 1PMEA 4RWIA 3GOKA 4XS2A 4RX9A 3FMEA 2FH9A 3ZFMA 3LAUA 2W5BA 2QONA 3KRLA 4YJRA 1DAWA 3RM6A 4DFLA 5CQWA 2C3KA 2A19B 1NVSA 5IA0A 4AN9A 4E26A 1WVYA 2XJ2A 4CFFA 2JIVA 2QOCA 4DFYA 2Z8CA 4V0GA 3R22A 3P08A 2X4FA 3Q5ZA 1XH8A 4PL5A 4RC3A 4RIWB 2J5EA 5IA5A 2E2BA 2P4IA 3QTSA 5KNJA 3P0MA 2NP8A 4CFMA 4PV0A 5HORA 3KXZA 3R7YA 4IAKA 2A27A 3PG3A 4X7QA 2JDSA 5FXSA 4CTBA 3TDVA 3QTXA 2UW9A 3PWYA 2CKQA 3FWQA 2VTSA 3WF6A 4FKPA 4YTHA 3UZRA 2C4GA 4FV3A 5CALA 5CT7A 3KFAA 2BVAA 1FBNA 2Y6MA 1Q99A 4FZ7A 1UNLA 4MBLA 3BYSA 5IMXA 4QQ5A 4F7SA 5E1SA 2R7IA 5EH0A 1YI6A 3QBNA 4FSRA 3FUPA 3DGKA 4KKHA 5DNRA 3N9XA 2J0IA 3Q53A 3UE4A 4HCUA 3M42A 4FOBA 2IW8A 5A6NA 5AM6A 3UMXA 3OWLA 3UIXA 4FX3A 4ACDA 4DH5A 1SZMA 3LOKA 2J0JA 4QP6A 3Q4CA 3EZRA 3UIMA 4ZAUA 4DF3A 4IDVA 3Q5IA 3UOJA 3F5PA 2W1HA 3ZS5A 2WKMA 3E64A 2YCQA 3FDNA 5AAFA 4D2SA 4KINA 4NT4A 3PIYA 2J2IB 4FIIA 4XHKB 5EI2A 4A9SA 3OCBA 3PSBA 4ZEGA 2YM4A 4F6WA 4OTHA 2QU5A 4LV5A 4D9TA 1V0PA 4EOOA 3THBA 3MPTA 4O81A 2UVYA 3ZLXA 5FXQA 4ZIMA 3TJCA 3WE4A 5HEZA 3C7QA 1YDRE 4FK6A 4AN3A 3G51A 4FTNA 4GG5A 4BDDA 2BPMA 5JRSA 3BWJA 4TTHB 2UZTA 3G0FA 3KK9A 3UNJA 5HVJA 3QU0A 5I5ZA 4UB7A 4L52A 3DXPA 3TCPA 4EK5A 1PW2A 1NW1A 3R9NA 3KF7A 3K5UA 3ORZA 2ITOA 4G5JA 4JNWA 3G90X 4CKJA 5HTCA 2ZJWA 5IQGA 4X2GA 3AOXA 3DOGA 2RF9A 4QMOA 5FM2A 4FTUA 4RVMA 5AR5A 3RHKA 3ZEWA 3ZLYA 3RNYA 2VTIA 4W8DA 4EOKA 3UZTA 5HE3A 3SC1A 5AV4A 2GQGA 2JLDA 3NLBA 4EEVA 2WMXA 3DBEA 3MVMA 3KU2A 1JVPP 2XKFA 4EQCA 4Z7GA 4EH4A 4FTRA 3GENA 1CMKE 5CQUA 4RVKA 4XUFA 4IM0A 1KV1A 4JT3A 3ZO2A 4JDKA 4M0YA 5FWKK 4D2TA 4Y73A 4J7BA 2CDZA 2X2LA 5D41A 5HKMA 2WTWA 3P9JA 3AG9A 2BZJA 4LOPA 2J50A 4RQVA 4U9AA 2V7AA 2WTCA 4ITHA 4KABA 3QC4A 2OIDA 4MXZA 2XBJA 4XG2A 2ZM1A 3F66A 5J95A 4OLIA 4CRLA 2OF2A 4RLLA 4L45A 5AV2A 3PFQA 4RC4A 2GHMA 4BYJA 3UO4A 3PTGA 3I79A 3TNPC 3QCQA 4I24A 3A7FA 2X1NA 2C1AA 2DYLA 1Q8ZA 3JXWA 1NVRA 2JKMA 3RAIA 4EBWA 3UOKA 2W06A 3O2MA 4YBJA 3NYNA 5DIAA 2C0TA 3E7VA 2R3PA 3GP0A 4B6LA 3QX2A 5AV0A 2JBOA 4AT3A 3O23A 4MHAA 3O51A 3KRJA 5ANDA 5J87A 4CQGA 5IH6A 2CKOA 4M67A 3ACJA 2Y4IC 4GG7A 1JNKA 4IW0A 4TWCA 4FUYA 5H8EA 2CNQA 3ZO3A 4MH7A 3FMHA 1W8CA 1I44A 5DLSA 4JG8A 3SOAA 1GAGA 2ZV7A 2BZIB 5LCKA 1SVGA 4ZSAA 3QA8A 5HU9A 1DAYA 4PF4A 5HO8A 4BCPA 4FEWA 4BCOA 4RG0A 3ZONA 4MVFA 4UWBA 4EOLA 2V5QA 3R30A 3R04A 3FI4A 2PWLA 2B0QA 2PUUA 4FV2A 1AD5A 4O27B 5AP5A 3RPVA 5EG3A 3MGYA 4EHEA 3LQ3A 2J0MB 4X21A 1PXPA 3ZUVA 2Z02A 3KXXA 2W1DA 4XG8A 3VNTA 5CU6A 4G6LA 4OT6A 4AOIA 3BLQA 3IECA 2E9VA 4IZYA 1KOBA 3O17A 5BUIA 5LVPA 2G2HA 4PTEA 2O5KA 3Q32A 4O38A 4EI4A 1R0PA 3R9OA 3KVWA 2UW8A 3F3WA 5C01A 3BEAA 2IWIA 3TUBA 3ETAA 2R0IA 2WIHA 4K18A 2FVDA 5ETAA 4C35A 4F63A 4M13A 1GZKA 4KIPA 4FSUA 4C3PA 3ZC5A 3FI8A 2FO0A 2P3GX 2YIYA 4ANQA 4NUSA 4L67A 3UJGA 4DGLC 5AADA 2YM7A 5CANA 2PPQA 1YI4A 3BEGA 3JY9A 5BMMA 2ZMCA 3MH0A 2IZTA 4QQJA 4C2WA 1YWRA 4O2ZA 3VIDA 1NVQA 4C4JA 2JFMA 2ITPA 3FE3A 1JOWB 3QKLA 3EQHA 5CNNA 4D5HA 3GU8A 1Z5MA 5KX8A 4QMLA 3BRBA 4NTSA 1GNGA
chains in the Genus database with same CATH superfamily
3JVRA 2ITUA 4YUQA 4YSJA 4MF1A 4OW8A 2HXLA 3COMA 3KXGA 4IDTA 5J9YA 3KVXA 5IKWA 4TYIA 3RAKA 2F7XE 4RJ6A 3U51A 5T68A 4MCVA 3WF7A 4CFNA 2PVHA 5J5SA 1EH4A 4V0GB 2WTKC 3KRWA 3F5UA 3LCSA 2UW6A 3TNWA 4E7WA 5CXZA 3EFLA 3FYKX 5G1XA 5L8JA 1W0XC 2ITZA 5CSPA 1RDQE 5BMSA 1OGUA 3NS9A 3CCNA 2OWBA 4CYIA 4MBJA 2DWBA 1ZY4A 3QAME 3DKGA 4X6QC 1YKRA 4Q2AA 3AMYA 3KL8A 2LGCA 1IR3A 5EOLA 4NCTA 3JS2A 3QHWA 4EJ7A 3IOKA 3R73A 4DEEA 2Y4PA 4R5YA 2B9FA 2ERZE 3IW5A 3LQ8A 2W1IA 4U3ZA 2WMAA 4BCIA 4TZRA 5KMIA 4XOYA 4YJTA 4GYGA 2ZYBA 2R7BA 4C37A 1Q8TA 3L8VA 3SX9A 3E3BX 4W8EA 4LRJA 3BKBA 3MH1A 4AZEA 5F9EA 1XWSA 5DA3A 2UW0A 2CLQA 3OOGA 1ZMUA 2HZ0A 3BQRA 4FT3A 5AMNA 4K1BA 3Q52A 5HNBA 3LFQA 1Q8YA 2IW9A 1OKYA 1WBVA 3Q4UA 4FSNA 3F7ZA 4XYFA 3UNZA 1P4FA 1M7QA 3PJ8A 1PKGA 5LOHA 4AW5A 2UV2A 4IEBA 2W96B 3NUAA 1GIHA 2XK6A 4E5WA 3BLHA 5GIOE 4I6HA 2OK1A 5E8VA 4AT4A 4YJVA 4NCTC 4DTKA 3GUBA 5B7VA 5IDNA 2XNEA 4U41A 2BAQA 3P7BA 5CU4A 3IPHA 4IWDA 3TNQB 5I4NA 1GOLA 2WNTA 3ODYX 3I7BA 3N51A 4KSQA 3LW0A 4DCEA 5CF8A 4KAOA 2XNBA 3QZGA 4C3RA 1TVOA 5HG8A 4YGAA 5J79A 3AD5A 5HVYA 4JQ7A 4DHJA 4A4OA 2YM5A 4I92A 4NM5A 5IQHA 4EORA 2ITWA 4EH5A 3KKVA 3VUHA 3R7GA 3VQHA 3ORMA 3MY0A 4CZUA 3B2WA 2I6LA 1W84A 1OM1A 3FBVA 2QR7A 3F82A 3V5WA 5CVFA 4IX6A 2NRYA 4C4FA 1PXLA 4R1YA 3ULIA 5I3RA 2ZM3A 2AUHA 2CN5A 2H9VA 2ZDTA 3R21A 4HYUA 3P79A 3NYOA 4JRNA 4N6YA 1J1BA 3GU7A 1UWJA 4L01A 1ND4A 4DEIA 5EM8A 1UU9A 2QC6A 3OXTA 5HBEA 2HZNA 4M66A 1E9HA 1L3RE 2ITXA 4TYHA 4XG7A 5HCYA 3KCFA 3ML1A 3ZM9A 1JBPE 1UNHA 5IPJA 3CBLA 4HGSA 4ITIA 4QNYA 1YI3A 4AZVA 4ASEA 3I81A 5KKRC 1ZYJA 5CEKA 2YAKA 4E93A 2HY0A 2BAJA 5KCVA 3TTJA 4I0TA 3R63A 4TYGA 2C6KA 1Q8WA 3FLSA 1Q24A 2YAAA 3EZVA 4FKGA 4FUXA 4ANOA 3POZA 5LMKC 4M68A 3REPA 3KXMA 3E8NA 2OW3A 5IDPA 4QMQA 3SD0A 4YP8A 3C1XA 4GIIA 2BDJA 2C6EA 3NCZA 5CVHA 5J8IA 4IZ7A 4LFIA 3RPOA 3WZEA 3UBDA 4Z3VA 4QYYA 4IWPA 4OAVB 1H24A 3NNWA 4HNFA 5ANOA 5AV3A 4WHZA 5KMNA 2AEGA 2WPAA 4E6DA 1QPCA 2C3LA 2ITYA 3UO6A 5CAQA 5AP4A 4L8MA 3OT3A 1KE8A 1Z9XA 2C5XA 4EONA 3H30A 4YNOA 3HL7A 4FIJA 3MPMA 5LJJA 2CKPA 1PXNA 4U43A 3A8WA 3QRJA 4PTGA 4G6NA 2X2KA 1PMUA 4LI5A 5C27A 2UZBA 4OTRA 2CGXA 2R3IA 1LP4A 1U54B 2QLQA 4J98A 3OP5A 5LARA 4FTTA 1H28A 4DTAA 5GIPE 5AUWA 5L8KA 3LFSA 1Q3WA 2ETMA 2VTNA 3LXNA 4LGHA 4YJPA 3V5LA 4ACGA 4DHZA 4DEHA 4YU2A 2VN9A 4BCQA 4DYMA 4QEBA 3IK3A 4ENYA 3VRZA 3HDNA 4CFWA 5A54A 2GTMA 4JG6A 4GVAA 3NFGB 3BIZA 1Y57A 2OSCA 4IB1A 4TNDA 4EK6A 4L3JA 2BDFA 2XUUA 1M17A 4BY9E 1FPUA 2PZYA 5HTBA 3F3UA 1PYEA 5I9YA 3NUSA 3PA4A 4JRVA 5CAPA 3D5VA 4ZY6A 5GNKA 3S00A 3C51A 5GZAA 3MTLA 3BBTB 4JQEA 3QTRA 5TF9A 3O8TA 1OL1A 4FVPA 2WMUA 4FBXA 4YC8A 4DG0E 3R1QA 2BHHA 3DXNA 2ZV8A 4BDIA 4F9BA 1G8KA 1OECA 4WG4A 3NW7A 5C03A 5HG7A 1P5EA 3FLZA 3LFEA 2HXQA 3A4OX 5EQYA 3QWKA 3ZSHA 1YOJA 4H3QA 2W1EA 3D5WA 3F9NA 4UALA 2OGVA 4BIBA 1XKKA 2AC3A 4CMOA 2WTKB 4G2FA 1PJKA 3B8RA 2VO7A 3EH9A 3H0YA 4O91A 3RNIA 4DFUA 2XMYA 3FKLA 2UZDA 4AE6A 3MFSA 5GJGA 2JDOA 4Z55A 4QMZA 1BI7A 4PDSA 5IQAA 2EWAA 3D9VA 3I7CA 4QP2A 3AGLA 2ZAZA 2GU8A 2OF4A 4O21A 3H0ZA 4RVLA 2PYWA 5D11A 4D4RA 1IRKA 4X0MA 4X3FC 4HVHA 3IDBA 4G3EA 4MK0A 4O0TA 4XG6A 3DXQA 3VS3A 1NXKA 2WMWA 4ONAA 3W2RA 4CT2A 5B2KA 3CPCA 3E88A 4FEQA 4WNPA 5DEYA 4AZWA 3ACKA 4YO6A 4L3LA 2XF0A 5KMMA 4AT5A 3S1HA 4UN0C 3ZC6A 3A99A 4MKCA 5DWRA 3U4WA 3VJNA 5EM7A 3DFAA 3Q2MA 3O8UA 3R6XA 4RWJA 2ZM4A 2WB8A 1JAMA 3QZFA 5BYYA 2RG5A 3CTQA 4G5PA 1B38A 4FE2A 3RKBA 3SA0A 4YLKA 1WBOA 4IM3A 2XIRA 4U8ZA 2SRCA 2HZ4A 1O6KA 5FBOA 4E5BA 2WIPA 3QUDA 3QQHA 4C4IA 3PY3A 3W32A 4BI2A 5E8UA 5DFPA 4Z7HA 2JIUA 4ZTHA 3MJ2A 5TE0A 5HVKA 3CLYA 3F2AA 5TKDA 2GFSA 4C33A 4IB5A 5CF5A 4USEA 4YMJA 5KBQA 3WOWA 5JEBA 1CSNA 1YQJA 3R8PA 4JMQA 5AX9A 5GZ8A 5CAVA 2VNWA 4QP8A 3BU3A 4PNKA 1WBNA 2YM6A 4N6ZA 3M11A 4K0YA 1OUKA 5HCXA 1KV2A 4I4EA 2OJIA 4KS7A 2ITVA 3W2CA 4C61A 4XP2A 4O4DA 5FP6A 4BDFA 3I5ZA 4CCUA 4EWQA 3G6HA 3LCOA 4IXPA 4MNEA 1KE7A 4XBRA 1G5SA 4PMPA 3ZBXA 2X39A 3QALE 3QKKA 3NUUA 3PP1A 4XLVA 3GI3A 4APPA 3L9NA 4OGRA 4R77A 3QQGA 2JC6A 4FC0A 4GS6A 5A4QA 2GS7A 1XHAA 4PDOA 3OTUA 3EHAA 5J7HA 3V04A 2BUJA 4F09A 1FVTA 5JQ8A 4UV0A 4K6ZA 2QKWB 5HU3A 3AT3A 1PXJA 4YJSA 3L9LA 5BPYA 3LCKA 1XJDA 4DEDA 5AUYA 5IZFA 1JLUE 1KOAA 3R1NA 3WZKA 2PVYA 3EFWA 3QZIA 3WILA 3PXRA 5KKRB 1ZY5A 3COHA 1BL6A 4ZJIA 5BUEA 4ZTRA 5LMAA 2PUPA 4TN6A 1OGYA 2C30A 3VULA 4BWKA 2YM3A 4EH6A 4FZDB 2VTJA 1ZWSA 4WBBB 3QFVA 5KHWA 4PWNA 5ANEA 5FLFA 4EOQA 3QQUA 1MRVA 3TZ8A 5C4LA 5BVEA 3NEWA 4L53A 3QD2B 4QMTA 4UMUA 4QTCA 3DKCA 4LL0A 4YTCA 4O0SA 2J6MA 3OMVA 4O1OA 3EQRA 4XV9A 1ZYLA 4AG8A 3D0EA 3R0TA 2J0KA 4RX8A 4D2RA 4TYHB 3K54A 3OCGA 3UOHA 4ANMA 4FNYA 4RJ5A 4X2FA 1P14A 1KE5A 1P4OA 3MWUA 4F6SA 2REIA 3LJ0A 5HZNA 4FTLA 4IFCA 5DR9A 4BJJA 4JDHA 2P55A 2CNUA 3P4KA 4G9CA 5BV3A 4JIAA 3GU6A 3T9TA 3HV4A 3OBJA 4YJOA 2GMXA 4ZP5A 3MB7A 4FZFB 4HGTA 4QQTA 4EZ3A 5EW9A 4BDBA 3DU8A 2VAGA 3RZBA 3OF0A 3ROYA 1M7NA 4FIGA 2PVMA 2A0CX 2XNOA 4IAFA 3PVBA 2F2UA 5BYLA 1SMHA 3BGZA 3HP2A 3Q9XA 2I0HA 2OXYA 5M55A 2C1BA 3CXWA 3ORNA 4FIFA 1H07A 2BKZA 5KO1A 4LMUA 2Z7QA 4AZTA 1SM2A 4FODA 1OKZA 2PE0A 4HYSA 4BYIA 1ST0A 5CSHA 1UKHA 1BKXA 1J7LA 4E3CA 4FK3A 4E4NA 4AXFA 3PUPA 4U5JA 3V5JA 5JFVA 1CM8A 2GFCA 4FL3A 5JN2A 3R71A 5FD2A 5C9CA 3W0NA 4AWIA 5M09A 2FYSA 5M53A 3A4PA 1TFFA 3ZXTA 4CTCA 1UNGA 3UC4A 4KKGA 3L9MA 4A7CA 4BTKA 3C4XA 2PZ5A 5IUGA 2UZUE 4ZSJA 4C7TA 4DFZE 4WA9A 4HGLA 2X0PA 3A7JA 5H8GA 2ERKA 2DUVA 3NUYA 1A9UA 4CV9A 4ZK5A 1JKSA 3EJ1A 1I09A 3JUHA 4FT0A 3SRVB 4AA0A 4BIEA 4FSWA 4NIFA 2RFDA 3NW6A 2WQEA 4FOCA 4XH6A 4PDYA 3OWKA 5EYKA 2C47A 1MRUA 1GY3A 2PVFA 3CSVA 4ZXTA 4LV7A 1YDTE 2JEDA 2W1FA 4RA5A 5ETIA 1GIIA 4JBVA 2HWPA 4LV8A 4MXOA 4F9WA 3QC9A 4I3ZA 3O5AA 3PJCA 3LMGA 4O7ZA 4AGUA 5AR4A 4U44A 3UO5A 3TI1A 4R7BA 1Q8UA 2XH5A 1E1VA 1OBDA 4HGEA 4QNAA 2JFLA 4I23A 4KD1A 3ALNA 4JDJA 4FT7A 4D55A 3ANRA 3DQXA 5CTPA 4F7NA 1DI8A 4KRDA 4F64A 5DRBA 5IQIA 4BR3A 4HW7A 4PUZA 5DOSA 4D28A 1YXUA 4CXAA 2W17A 3ZU7A 1GIJA 3E8EA 4FV6A 4FSYA 3UNKA 3AC4A 4MYGA 4B99A 2XCKA 5HBHA 3VS5A 4F9YA 4CG8A 3F6XA 4G17A 3OBGA 2R3KA 3O7LB 2BFYA 4G3GA 4UEUA 4DGGA 3UG2A 4AU8A 1OIQA 4FEVA 4YJQA 3OXIA 3R7VA 3Q2JA 5HCZA 1Q3DA 4IAZA 3OEFX 4CLJA 2QOLA 3E3PA 4A9RA 1XBAA 2ONLC 2YWVA 3SOCA 1W7HA 3DPKA 5K0KA 2BRBA 2GTNA 3FZOA 4FG9A 4EJNA 3P7AA 5F94A 3DV3A 2IN6A 2YERA 3RAHA 3U4UA 4A07A 2F7ZE 4MUQA 2QO2A 4N70A 3QYWA 4FKOA 3W8LA 3UDZA 5IEYA 1PXIA 3SXRA 3UDSA 5E8WA 3QTQA 3UIUA 2VU3A 4KIQA 3UG1A 1BI8A 4NM7A 4FZ6A 2W9FB 4W9XA 4EBVA 3WZDA 2G2IA 3EN7A 2QHMA 4GK2A 4B9DA 3DQWA 4MWHA 2YCFA 4OTDA 1YVJA 3ZDIA 5AUZA 3WIKA 5DT0A 3BI6A 4Z16A 5AJQA 4FT9A 4CFXA 3GC8A 3M1SA 4EUUA 3FHRA 3PRFA 3VRYA 2OKRA 4BZNA 1OUYA 4F65A 4QDEA 4IVBA 3RPYA 1WVXA 5AR2A 1WBSA 2B9JA 4IWQA 3BYOA 3NRMA 3OG7A 5GJFA 3U6IA 4FTOA 4MNEB 1OITA 4CNHA 2UZVA 3QXOA 3WYYA 2J5FA 3AC1A 3F88A 5I9VA 3R01A 3DDPA 4OBPA 5HIEA 3GC0A 4IC7A 3OZ6A 4K9YA 4O84A 4K11A 2OG8A 3K3IA 1YOLA 4KBCA 4ERWA 4FV1A 4LMNA 2R4BA 5CI6A 5FGKA 2UZNA 1IA9A 3TM0A 4WG3A 3TEIA 4EC8A 4ASZA 4BDCA 4CGAA 2ZV2A 4H1JA 2QLUA 3A8XA 4U97A 1BMKA 2BIYA 4RX7A 2VO0A 2R2PA 2QQ7A 3NAYA 3NAXA 4FKVA 2E9OA 4D9UA 3MTFA 2VWYA 3CD8A 3BV3A 3NYVA 5A4CA 2C0IA 3RPSA 2O0UA 1WMKA 3KN5A 5AR3A 3IW6A 5CEPA 4EWHA 2E9UA 3ENHA 3ITZA 4FF8A 2XK9A 3LXKA 2B9HA 2X7GA 2WTIA 1A06A 4QTBA 4TNBA 4X3JA 2OH0E 3FQSA 4BB4A 4GCJA 1T46A 3OFMA 2WEVA 2WMQA 1A48A 4DEAA 3HMNA 5AA9A 4BGQA 4PP7A 1ZOEA 3I0QA 1W2DA 3W10A 4O7LA 3TUDA 3FY2A 5EFQA 2JDTA 3R83A 3PSCA 3TNIA 5HOAA 4RZWA 4DHIB 2I0YA 5AP6A 4ZS0A 4QMMA 2B54A 1ST4A 5E7RA 4GK4A 3GC9A 5DE2A 3I6UA 2V55A 3POOA 4RJ4A 5CF4A 3PSDA 3R8ZA 3D2IA 3HGKA 3V8TA 2ITNA 3HRFA 4AX8A 1G8JA 4BZDA 3PUFC 4K2RA 4E6AA 3ZLWA 4A4LA 5E4HA 4QTDA 1RQQA 3PYYA 2I7QA 3VHEA 3LVPA 2VGPA 1SNUA 2BALA 5E92A 5IQCA 5ACBC 3ET7A 3F61A 4RA4A 2WO6A 4S32A 5DHJA 2QG5A 2WHBA 4QT1A 3IOPA 4D1XA 5F20A 5C1QB 4I6LA 1SNXA 1JKTA 3ZRLA 3EL7A 3BYMA 4WOVA 3I60A 5DR6A 4H1MA 3FXZA 1PKDA 5EYMA 3HMPA 2W4JA 4A9TA 1JKLA 3F3ZA 3UDTA 3LLAA 4UYNA 5KMLA 3RHXA 2YZAA 3F5GA 4YHJA 3VUGA 4JL9A 1U54A 4FV0A 4LOQA 5JSMA 3ATTA 1JQHA 4BBMA 3WZJA 2EU9A 3EQFA 3PA5A 2XCHA 4BZOA 5EKOA 3A62A 3BHHA 2C6IA 3Q9YA 5JRQA 1OPLA 1MP8A 4FG7A 1XH4A 4TXCA 3PXFA 4D4VA 3PIZA 2PSQA 3PVGA 4BDEA 4E73A 2C3IB 3QTUA 4EC9A 4F78A 1XBBA 4RVTA 2ZV9A 1YXVA 3ZYAA 4C02A 4E5AX 5JQ5A 4PL3A 4QDVA 4L46A 1PRYA 3UYTA 4TWNA 4BC6A 3F7WA 3UVQA 4LUEA 3FKNA 3MVLA 2XIKA 4FTAA 5I9XA 4ALUA 4J53A 4BF2A 3QGYA 4EH7A 3CE3A 5HO6A 2E9PA 3BELA 4G16A 4LG4A 4AQKA 4O7SA 3TZ7A 3AT2A 4PL4A 3VUIA 3OCSA 3MV5A 3HV6A 3TV4A 2OFUA 1XH5A 4NIFB 4CMUA 3QD4A 4WNOA 1OZ1A 4FYNA 1B6CB 4AW2A 5EDRA 4FSTA 2YWPA 2OJ9A 4PPCA 2IJMA 4NZWB 2PVLA 2WTDA 2QURA 3FZ1A 3JPVA 4YNEA 5JZNA 4DTBA 5HQ0A 5C4KA 2VX3A 3GXLA 1WBPA 1K2PA 3JR1A 2V0DA 4PPAA 4WNKA 4DFBA 3IONA 4K8AA 1YRPA 4IAAA 5A4TA 2XM8A 3G2FA 3DDQA 4JX7A 4DH3A 3W0MA 4NW5A 4JBOA 5M51A 1YOMA 3AKJA 1PXKA 3OS3A 2IVUA 4JI9A 1W98A 2ZMDA 4HZSA 5ANGA 3LFDA 4JS8A 3R7IA 5LCJA 4J97A 3MH2A 4FV8A 5KZ0A 1GZOA 5I9WA 4FKUA 4TYJA 4ZLYA 3PPKA 4G31A 3SXFA 4BBFA 3E62A 3WZUA 1H1QA 2UZOA 3OEZA 4IACA 5AM7A 2EXCX 4I1ZA 3E92A 2QNJA 3C4CA 5CT0A 2X0QA 1JWHA 1OIRA 4CFUA 3A2CA 2VTLA 1OL6A 2YJSA 3CJFA 3ZH8A 2W7XA 4NYEA 1Q97A 2YEXA 2DQ7X 5EHYA 2UW4A 4U7ZA 2VGOA 3ID6C 1TZDA 2FGIA 4U45A 4OTIA 4QMVA 3IDCA 5H9BA 2W05A 5HNGA 2X9FA 3DY7A 4AXCA 1UU3A 3C5UA 2P2IA 1W83A 3TKHA 3QYZA 4I21A 3HRBA 2WD1A 1NA7A 5JFSA 2R3MA 3QZHA 4ZTLA 3HKOA 4I5HA 4GKIA 4BI1A 1YHSA 4RJ7A 2XAOA 3RAWA 1Q61A 2W4KA 3G5DA 3PXKA 3LFNA 1TKIA 4NFNA 3CTHA 3ORKA 3VF9A 4IE9A 3RK5A 4C8BA 4YZMA 3MJ1A 3B8QA 3N4TA 5I9UA 2HENA 3FLWA 1RW8A 3VUKA 3RCDA 3IGOA 2QOIA 3PWDA 2UVZA 5AP0A 4DG3E 5HO7A 3EMGA 4Y5QA 5D1JA 3UOLA 4AXDA 4ID7A 2VTMA 4D4SA 4ZMFA 5IEXA 3UQGA 2EUFB 1OKVA 1GJOA 4QYHA 2OJFE 3QUPA 4RT7A 4CV8A 5L2WA 4PPBA 2F2CB 2JKKA 3BV2A 4ZS4A 2BRNA 4GMYA 2RFNA 3P7CA 3UIBA 1OVEA 3FZSA 4R5SA 1FGKA 3TJDA 1MUOA 3W33A 3DLSA 2YIWA 4KUJA 2CCIA 2OFVA 5H8BA 3R2BA 3ALOA 3WARA 4NEUA 3RZFA 5CI7A 2CN8A 2C5YA 2X8DA 4OTFA 5DEWA 4F99A 1H25A 3K3JA 4NW6A 1AQ1A 2F7EE 3QQKA 3BLAA 2QODA 2PVJA 4GVJA 2OO8X 4P5ZA 3ENMA 3C9WA 2VTHA 3CC6A 5TT7A 4CLIA 3FL4A 2BZKB 5EYDA 2G15A 4L44A 2WGJA 2VWWA 2Z7RA 5LMKA 5M4UA 5HX8A 1VYWA 4XCUA 5KUPA 3SVVA 4EOSA 4DCAA 2OJJA 2VWXA 3ODZX 4IQ6A 4M15A 3F2RA 1Y91A 4I94A 2XK3A 2GNJA 4BCKA 2YDKA 4OTGA 4QYEA 2IO6A 3GEQA 2X7OA 4PTCA 3PIXA 4OBOA 1ZLTA 4AQCA 2YJRA 4DEBA 2CCHA 2ETRA 3IW8A 3W2SA 5CF6A 3SG9A 4I93A 1O6LA 1H08A 4Q9SA 4EKKA 3PLAE 3AD6A 4O2PA 4C59A 4ANSA 3FLYA 4QP4A 5CEMA 3UVPA 2KTYA 2HK5A 4V04A 4BWXA 3VF8A 4F70A 4J1RA 3HUBA 2IW6A 3G0EA 5CENA 5E8SA 2VTOA 3RJCA 2PU8A 3FAAA 5M08A 1Y6BA 2B52A 2CGVA 2Y4IB 1OPJA 3FY0A 4AXAA 4QMWA 5J9LA 4DE4A 2PZRA 4U79A 3C0IA 3MDYA 3VJOA 1KE6A 5IISA 3HAMA 1YW2A 1ZZLA 4X2KA 3LCDA 1DS5A 5IQBA 3ULZA 1IAJA 5DT4A 4XBUA 5D9HA 2VTRA 2C69A 3QRKA 2PK9A 4KSPA 3C5IA 4WRSA 5EHOA 5L4QA 4BCHA 1Q62A 2B4SB 4G34A 4TT7A 4WSQA 4YZCA 3FMDA 2OJGA 3CPBA 4UZHA 2XNMA 5LWMA 3VS4A 5CZHA 2X2MA 1OBGA 1WBTA 4P2KA 3V01A 4Y72A 2V62A 2Q0NA 5EYCA 5K4IA 3LFCA 5C26A 5IMEA 2G9XA 3F69A 4PDPA 3VBQA 3PPJA 3D94A 1RE8A 4MF0A 3EQBA 2H6DA 1S9IA 1FVVA 2ZVAA 2X8IA 3FV8A 3BGQA 5EW8A 2Q83A 4O0RA 1WAKA 4QMSA 1U5RA 5FDXA 1ZOHA 2WTVA 5A4LA 3VUTA 5AUUA 5CS6A 3QQFA 4ZTQA 2Y8OA 1GZNA 1OI9A 3MW1A 2CLXA 3IG7A 3KF4A 3WE8A 2BTSA 3LM0A 2J7TA 4FKWA 4FICA 3E63A 5AP1A 1TQMA 5EHLA 3EN5A 3WYXA 5TO8A 4XOZA 1IAHA 4KS8A 3PVUA 5K4JA 2HW6A 3IDPA 4E4XA 3Q4ZA 4R3PA 4M69A 3JYAA 4FMQA 3ZZEA 2I1MA 3FMMA 3PY0A 4X3FA 5AIRA 3S95A 2J0LA 3SRVA 4LQMA 3M2WA 4D1SA 4TY1A 4YLJA 3TXOA 1FVRA 3Q4TA 4BVUA 4CKRA 3BGPA 3RPRA 4J96A 4DH7A 3TMOA 4Y83A 4BIDA 2A4LA 2OXXA 3KC3A 2C5OA 2W1CA 3W1FA 1J3HA 2YACA 3UQFA 4G9RA 3KMMA 3Q6WA 3C0HA 4G6OA 5FTQA 4UMPA 2R3RA 4ZOGA 5FEDA 2XRWA 2F57A 4OTWA 4R6VA 5D7AA 4MEDA 4BGGA 2C6OA 3LMHA 1R39A 2PZIA 3BL7A 4GT5A 3ZM4A 3AC2A 2GHGA 4YBKA 5HTIA 4DGOA 5GHVA 3MA3A 1STCE 5ANJA 3R7EA 2PMNX 2R9SA 4ZLOA 4DH1A 1R1WA 4FGBA 4ANNA 3D83A 3MIAA 2QI8A 2WMSA 4ZJJA 4GU9A 3ERKA 4GU6A 3ZUTA 5LMBA 2J51A 3NVKI 2VZ6A 3EQIA 4BRXA 2VTPA 5L3AA 5EI8A 3LHJA 2W1GA 3FQEA 3R9DA 2CKEA 3C4EA 3TIZA 2AYPA 4K77A 2OZAA 2WMVA 4OR5A 4EYMA 3L8SA 3QLFA 5E8XA 1OIYA 2FSLX 4O0WA 1R0EA 4OTPA 3KULA 4XG4A 4W9WA 2FSTX 5T3QA 1LR4A 2XP2A 4L42A 2O2UA 4XV2A 4B8LA 3PVWA 4R78A 2Z2WA 4E6CA 1ZARA 4EHGA 4IAIA 3FPQA 4IB0A 3EN9A 4C58A 1CKJA 4ANLA 4I4FA 4NJDA 5G6VA 4FTQA 3ELJA 4C34A 4AN2A 5FDPA 1SYKA 3HV5A 5IH5A 1ZMVA 2QG7A 5HG9A 4BDHA 4EHVA 3HMMA 5DT3A 5BYZA 3QQLA 4HCTA 3ZUUA 4LRKA 2FB8A 2BZHB 5M4CA 5BQ0A 4X6RA 3OROA 5CU2A 5HLPA 3OWPA 3ZRMA 1BL7A 3D7TB 4D58A 2UZLA 4FNWA 3RALA 4FL2A 3VS6A 4O4EA 4C38A 3PE2A 4DC2A 4E20A 3GQIA 4GEOA 4I0SA 2QO7A 3BBWA 3R8MA 5AEPA 5EI6A 3ORLA 3L1SA 3CIKA 3KMWA 4XEYA 5BUJA 4FTMA 3KA0A 1R3CA 2OLCA 4NSTA 2FSOX 3TV7A 5E8TA 5LWNA 3EFKA 3V6RA 2X0OA 5FEQA 4FKTA 3PPZA 2DS1A 3VUDA 3VONA 4JX3A 4R3RA 2IVVA 3CQWA 1PHKA 4KA3A 4YJNA 4HVIA 5AAEA 5IA4A 2XIZA 3LZBA 4O83A 2X6EA 2VWZA 3K5VA 4LOOA 4UMTA 4AA5A 4FEXA 5IQDA 4LM5A 4FKSA 2BRMA 4Y5HA 4CKIA 2C6MA 3ORIA 3W2PA 3VO3A 4AE9A 2XKDA 4QMNA 5DPVA 1LUFA 1REJA 3VBWA 1AGWA 2X81A 5JK3A 2XNPA 3O71A 2C3JA 4UWCA 3ZFXA 2I0VA 3Q6UA 4BCGA 3D14A 4AFEA 3QXPA 4IVDA 3LXLA 4DITA 2GNIA 5K9IA 2HY81 1RJBA 1U5QA 5HG5A 4FV7A 3OVVA 4WUAA 4M3QA 3COKA 2UZEA 3CGOA 3L9PA 3LFAA 3NZ0A 5F95A 3WF5A 3ZBFA 2XYUA 3IW7A 3P86A 3TNHA 1IASA 3NWWA 5D10A 4ZTSA 4FRFA 2OZOA 5FTGA 1VYZA 2OU7A 3P78A 1H1RA 4OBQA 4DA5A 5AV1A 3AQVA 4XP0A 3C4ZA 4GV1A 4C4EA 4RIYA 2QOKA 3MA6A 2JITA 2BRHA 4UY9A 5JZJA 1CTPE 4QRCA 2JKOA 4C0TA 4YZDA 4EOPA 2WU6A 4RSSA 4YZ9A 5ICPA 4UYAA 4F1OA 2VWBA 2H34A 5AP2A 4O82A 3KXNA 3W8QA 3GCSA 3EKNA 1W2CA 1G3NA 2R3NA 3CY2A 1S9JA 2YIXA 3OY3A 1DM2A 4N4SA 1FINA 1XH6A 2PZPA 4F4PA 5AR7A 5CEOA 3AKLA 4MXCA 4CCBA 4BCMA 4AAYA 4BICA 4UMRA 3UQCA 2WZJA 3R02A 1UV5A 4USDA 4BWPA 2RG6A 3R1YA 5M44A 2WQOA 4ZSGA