3TNQB

Structure and allostery of the pka riib tetrameric holoenzyme
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
334
structure length
331
Chain Sequence
EFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase, cAMP-dependent, catalytic, alpha
publication title Structure and allostery of the PKA RIIbeta tetrameric holoenzyme
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 98
structure length 331
sequence length 334
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3tnqB01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3tnqB02
3UO5A 4UALA 2VNWA 4ZJVA 2CGVA 4YJSA 4G2FA 5IZFA 5AADA 1HOWA 4JX3A 4XRLA 1R0EA 3E3BX 4D4RA 5TE0A 4Y95A 2WB8A 4GFGA 3NW5A 4IH8A 5F1ZA 4IACA 4RIOA 4H39A 1OPLA 5FBNC 3PFQA 2EXMA 3LCSA 3LXPA 4BDKA 2IVVA 3ZO4A 3JXWA 4AWIA 2FUMA 2OJGA 3GU6A 3LJ2A 1U54A 3LXNA 4GG7A 4PRJA 3UVPA 1W0XC 1VYWA 4IBMA 4ZTNA 5DI1A 3TJDA 4J96A 5FEEA 2FSMX 1YW2A 3HV7A 2I0EA 3UE4A 4AZWA 4BDJA 3OHTA 4YUQA 1STCE 4FSRA 3RPVA 5FTGA 1ZY5A 2PE0A 3CKXA 2ITYA 5HZNA 2QOLA 1JWHA 4KIOA 4QPSA 4YZMA 4F1OA 3FSKA 3NLBA 3SXFA 3QRIA 5F20A 2IO6A 5C4KA 3D7ZA 4BC6A 4A4LA 4X2FA 4DH7A 1SVHA 2R5TA 3Q2JA 3VRZA 4E73A 2PYWA 1GY3A 2UW8A 3LFEA 1M2RA 5CANA 1YHVA 2Z7SA 4B99A 1A48A 4LFIA 4R7HA 4PPAA 2PPQA 4ALVA 1OZ1A 5C8KA 3DJ5A 3JPVA 5EDRA 4I0TA 3QGWA 4UBAA 4KRCA 3K3JA 3Q5IA 4J8MA 3NUYA 1JKSA 4KIKB 2YERA 4EH9A 5EW8A 4KBAA 3HV3A 4K11A 4BBEA 2W05A 1J7UA 2WQNA 2PK9A 1PMVA 3R8MA 5EG3A 4A9TA 3G90X 3PJ1A 2WMUA 2PVYA 4FTIA 2CLQA 4RFYA 5CAQA 1OGUA 3PZEA 3Q9YA 5M4IA 2HY81 1XH7A 1XBAA 3P23A 3DAEA 2OJJA 4HYIA 1SNUA 4KINA 3WF7A 5L2WA 4D4SA 2OLCA 1XBCA 4FTMA 4GS6A 3RPOA 1F5QA 4EHVA 3TNPC 1GZNA 3KMMA 4EBWA 2R3MA 2C6TA 3MH1A 3ANQA 3JVSA 3PLAE 2XJ1A 5EI2A 4F64A 4GU9A 4X2GA 1E1XA 1ZXEA 4L3PA 5HD7A 2IW8A 4K77A 4EK6A 3DKCA 5DPVA 4R1YA 2QCSA 1PHKA 4F4PA 3A8XA 3VWAA 2VX3A 3C0GA 5EW3A 3TIYA 4RJ6A 4M69A 4C37A 3D2IA 2YDIA 4CCBA 4TPTA 4PL3A 3HGKA 4DGMA 4G5PA 1OIQA 4J95A 4NM5A 1FQ1B 1WMKA 3QA8A 4L45A 3EQFA 4L42A 4V05A 3G6GA 4E26A 3AC3A 3FBVA 4USDA 1PXIA 3U8WA 3MFSA 2PMIA 4NEUA 3CLYA 3O2MA 4WNKA 4QNAA 3OUNB 3Q5ZA 4W9XA 4CMTA 5AAEA 4IHPA 3EL7A 3DNDA 2WGJA 5KUPA 4HYUA 2QODA 2J0LA 3D83A 5IDPA 3WI6A 2X2KA 5KE0A 4C58A 4MD8E 3I0QA 4YJTA 3HP2A 3IQ7A 3NNVA 1OKYA 5F95A 4FVRA 4H58A 2F2UA 4U97A 5IQIA 4DA5A 4AOIA 3KVWA 4EKKA 5K5NA 4OW8A 2HZ4A 3B8QA 2VO0A 3ZBFA 1Q8WA 3QD0A 3VUKA 4FA2A 5BUEA 3O17A 5EKNA 4AN2A 1NVQA 3LIJA 1VYZA 3CD3A 3ITZA 3QYZA 1GIIA 3QZGA 3CD8A 2PU8A 4XOYA 3O23A 4CZYB 5EW9A 4J53A 4B8LA 4IAFA 3UP7A 4W8EA 3VQHA 4U8ZA 4BTMA 4D0WA 3HRBA 3JYAA 4O7RA 5TF9A 2G15A 5EH0A 5E7RA 4OAVB 4ZY4A 2UZUE 4XBUA 2W5BA 3BIZA 4O1OA 4GW8A 5CXHA 3AMBA 3D5VA 3HMOA 2OW3A 4TWOA 5L8KA 3SXRA 2CLXA 1PKDA 5A3XA 5IQCA 4Z7HA 4A9YA 3UBDA 3BLHA 5IG1A 2GNFA 3R7IA 2RFEA 3I79A 3NUNA 2VWUA 2BILB 4ACMA 3QCSA 2W1EA 2C0TA 5CAOA 4CKRA 5D41A 2GDOA 1Q3DA 4FT9A 4U3YA 3R8VA 3FPQA 3OROA 4M84A 4W9WA 1PMNA 4IQ6A 4EK5A 5BVDA 3G9LX 1IG1A 4I23A 4A06A 4C4IA 4FEWA 2YM8A 4YPDA 3QAME 2UZTA 4E6AA 2Y7JA 3G33A 3GU7A 5HKMA 4FKJA 3ZC6A 2VRXA 2NRUA 2EWAA 2G2IA 5M4CA 4WKQA 2JAVA 5AP1A 1Z57A 4B4LA 4G1WA 1OIYA 4XCUA 4N70A 5BUJA 2IZTA 2R2PA 4JJRA 3GC7A 3KMUA 4O7TA 1FGIA 5J5SA 1ND4A 4I0RA 4KNBA 4QTCA 2WD1A 3U6JA 3P9JA 2WTCA 4L8MA 4YC8A 2ETRA 4MXAA 3WOWA 2JBPA 4I3ZA 4JRNA 2WELA 2VTNA 2PZ5A 3IG7A 4RJ8A 2J51A 2C5YA 4D1SA 4JXFA 4G9RA 1JQHA 3W2RA 4RVKA 5EQEA 5FG8A 2JDRA 3FAAA 3ATSA 4AT3A 4UWYA 2WU6A 3NYNA 2V7OA 4GK3A 1G5SA 4RIXB 2B7AA 4EH8A 3HECA 2HENA 3DDQA 4WOVA 4E20A 1Y8YA 1UU7A 4X2NA 4EL9A 2VTQA 3V5LA 4D2TA 2HAKA 5EM7A 5FDPA 3AT3A 4N6ZA 3V51A 2WMBA 3BZ3A 4P2KA 4EEVA 4ZLYA 3KREA 3HMNA 4CFXA 3GB2A 3ZMMA 4RZWA 3F88A 3ORXA 4RC4A 5IUHA 4JX7A 1Q8TA 4WUAA 4JDIA 5HI2A 5CVGA 1XH9A 4F0FA 4DC2A 3NNUA 3OY1A 4MKCA 4N57A 4MWHA 3HMMA 3FQEA 4ZTLA 3E87A 3DTWA 4W4YA 2CDZA 4YJUA 2EXEA 5T68A 2X8EA 2JKMA 3SQQA 3VBYA 2BPMA 2GS6A 2HZ0A 3C51A 3QKKA 3ZRMA 4EQCA 1FGKA 2ZV8A 4L00A 4ZS0A 4U44A 3M2WA 4R6VA 4RRVA 3TV7A 2DYLA 2BZIB 5HO7A 2WQOA 3IDBA 3Q4TA 5A6NA 2VTMA 3MTLA 4S30A 4USFA 5B2LA 4U42A 2F2CB 4B6LA 2WQBA 4E4XA 2XK9A 3GFWA 1FMOE 2YJRA 4FOBA 4IVCA 4RJ3A 3F3WA 3SW4A 3UIMA 3VBQA 4ZJJA 4JBPA 1GIHA 4BWXA 3NUPA 2QU6A 3A62A 3WYYA 4CV9A 1LEWA 3NSZA 4MBIA 2Q83A 3R8ZA 1OL7A 1YXSA 3GU8A 3RJCA 2P0CA 3FMMA 5IA1A 4C33A 2IWIA 2XBJA 5FP6A 4OTRA 4OT5A 4Z3VA 2A19B 3MN3A 3QZIA 4XS2A 4ALUA 4M66A 4BDAA 4PL5A 5GZ8A 5JGAA 3ZSIA 4H1MA 4FGBA 4R1VA 3NAYA 4EYMA 4RX7A 1FVTA 5CSHA 3SC1A 4OBOA 3UOLA 2PVMA 2BAQA 4QQ5A 2A1AB 2A0CX 2GS2A 4YZNA 4F99A 4EOLA 4FSWA 2IW9A 4QMZA 4X6QC 2RFNA 3V6SA 2VWZA 5E8UA 4D4YA 4FTKA 3EOCA 4RIYA 2CGUA 4HCUA 4LYNA 4QRCA 3ZOSA 2YHVA 1BI7A 2C1AA 3V6RA 4F1MA 2AC3A 1Y6BA 2BAJA 3POZA 4O84A 4XLVA 3KXHA 3Q4ZA 1P14A 3O96A 2ONLC 4J52A 1ZYLA 4ZZMA 3D94A 3TDWA 4GFOA 1Q3WA 3QYWA 4YMJA 4YHFA 4K1BA 3SVVA 2OWBA 2QI8A 5HG9A 4KIKA 5HICA 3VUGA 3WYXA 3LM0A 1YI4A 2R3NA 4YZDA 5AUWA 5CQWA 5K5XA 2QVSE 5AA8A 4G3CA 4RWJA 4UXLA 4G16A 4BZOA 4FKSA 2JIIA 4FKTA 3WZKA 4F7JA 4IB0A 1XKKA 5AA9A 1YI6A 3PVBA 4CXAA 5LVOA 4I5PA 3R7EA 4Z9LA 5CEKA 3CSVA 1PYEA 3FC2A 3ULZA 3WZDA 5IEYA 5E90A 4FUYA 3ROCA 1CKJA 3LFDA 3VS4A 3EZRA 4LL0A 2B9HA 4ITIA 2ETKA 3DNEA 4O0XA 2JKOA 4U80A 5DRDA 2FSTX 4CYJA 4R8QA 4AW0A 3SRVA 1KOAA 3QALE 4XHKB 4E4LA 4EC8A 4RJ5A 3RMFA 3O8TA 2WQEA 4NWMA 2KULA 2VTRA 2XVDA 3HAMA 4FKGA 1K9AA 1OKZA 5KKRB 4PDSA 2ITUA 3W8QA 3MH3A 4RWIA 4UY9A 3D7TA 2YWPA 3OOMA 3PVGA 5AIRA 3TZMA 3I5ZA 3ZZEA 4IVAA 4IEBA 3T3VA 2R3RA 3CQWA 4BDCA 5D9HA 2QO2A 3OXZA 3VBXA 4JQ7A 4NIFB 2XIKA 4PMMA 3OCBA 2GHGA 4NTTA 1YWRA 3LMIA 2QO9A 4FSNA 4U5JA 2YM4A 3VJOA 4XG6A 3O7LD 4FV4A 4QMTA 5FM2A 3RZFA 3Q2MA 5ANEA 5I5ZA 4S33A 3M42A 1KV2A 3MY5A 3PXRA 4AS0A 5IEVA 3C4CA 4BICA 5AR4A 2XNNA 2YCSA 2OK1A 2BTRA 1FMKA 4M3QA 4EWHA 3DBDA 4RJ4A 4O7VA 3SDJA 4AT4A 3ACJA 1VEBA 4GRBA 3MESA 4QYFA 4C35A 3FMHA 3VW8A 4DYMA 5J7BA 2EXCX 3D0EA 3Q52A 4IB3A 4CSVA 5LWMA 5LXMA 1PXOA 5AUXA 3PJ8A 4FKWA 4ERWA 4I0SA 2X6DA 2XF0A 5JFVA 3FXXA 1Q62A 3BCEA 3GXLA 4NFNA 4C02A 4QQTA 3ROYA 3ELJA 5BVKA 3DXNA 4FTLA 2XIZA 3OUKA 2C69A 2VTPA 2P3GX 5B2MA 1Q41A 1PXNA 1CMKE 1RQQA 1CSNA 4H3QA 4IM3A 4O0UA 4R5YA 5AV4A 3LQ5A 4DEDA 4EH5A 4C4HA 4Y46A 2OZOA 4D2WA 4IANA 2EUFB 3NEWA 4RX8A 2Y4IB 1ZAOA 3PXKA 5DG5A 3QD3A 1UKHA 3HA8A 4OAUC 5BVFA 2WKMA 3OG7A 5IH4A 2V5QA 3UQFA 3UPZA 3RP9A 2WTIA 3FMNA 5HG5A 4XV2A 2NPQA 3NNWA 4HVGA 4I5HA 4KUJA 4DBXA 4TYGA 2GU8A 4RX5A 3ODZX 3UOJA 4AE9A 3QZFA 4BI1A 3U6HA 2HK5A 3IW4A 4ANLA 4BTKA 1W83A 5IMXA 4O1PA 3VS7A 3PIYA 3QTSA 4KS7A 3VN9A 3DAJA 2QOKA 4HZRA 5EHOA 3CXWA 4BDIA 4BRXA 2UUEA 3H3CA 2QOQA 3O71A 3R7OA 4ANMA 5AJQA 5JN2A 5ETAA 4YZBA 4N0SA 3R9HA 2QU5A 3ZM9A 3BQRA 1PXMA 4BDHA 1ZY4A 2JGZA 2W7XA 3A99A 3GQLA 4FSMA 4JBOA 1ZYCA 5AP7A 4CLJA 1F0QA 3PA5A 2BRMA 5AUYA 2JKKA 2ZVAA 3BLQA 3ATTA 4ENYA 5CU0A 4YLLA 2HOGA 4PTGA 4P5QA 3R7GA 5CX9A 2IW6A 2VUWA 3U9CA 5I9ZA 2J4ZA 4IB1A 4QQJA 1QPDA 3KN5A 5J95A 3P08A 4ZP5A 3KRWA 3OW4A 2PUNA 3KL8A 3C5IA 4DN5A 1ZMUA 5HVJA 2XMYA 5E8SA 3CJFA 1SVGA 2W1CA 3UYTA 5EHYA 3FXZA 3RPYA 2PWLA 2C6OA 3R63A 5ANOA 3LFQA 2W5HA 3ZLSA 1MRVA 2J0JA 4O6LA 3VUHA 3B2TA 3EFWA 2JITA 3DLZA 3OEZA 3PG3A 2WXVA 3ORLA 3UPXA 5IQEA 4ACGA 3FUPA 4Y8DA 2V62A 2X1NA 4FTOA 5ACKA 3POOA 4M69B 4C62A 4GKIA 4O7NA 1UVRA 2GMXA 1H1SA 3KXXA 4NM3A 5BVWA 2F7EE 3JUHA 4M0ZA 4NKSA 5FTQA 2ITZA 2R3KA 3EWHA 5K0KA 5LMBA 3BGZA 1WBVA 4PPBA 5AX3A 4IX4A 1XBBA 1KE7A 4GIHA 4LGHA 4PDPA 5FWKK 2G9XA 3IONA 4DAWA 3EB0A 2OF2A 2QO7A 3LFSA 2VWVA 4O2ZA 4O0YA 4ZSJA 3ZFMA 1CKIA 2C0OA 3C0IA 3QHRA 3RBWA 4J99A 2BVAA 1ZOGA 4E4NA 4FNZA 2XNGA 3MGYA 4DCAA 3UNKA 3FZRA 4KD1A 4ARKA 4OBPA 2DS1A 4NJDA 3FDNA 2WNTA 3PIZA 2W1DA 3C0HA 4EWQA 2FGIA 5JH6A 4APCA 4KSPA 1ATPE 4P5ZA 4ASDA 3KVXA 4FG9A 3O8UA 3DAKA 1GAGA 5E8WA 2R0IA 4F09A 5A4TA 1J91A 2RFSA 4IAYA 4QNYA 1XH6A 4EQUA 4O0VA 4TYEA 4IFGA 2F9GA 4JI9A 4XH6A 5IA3A 4GK2A 1KWPA 1GOLA 3GFEA 3PXYA 3BHVA 3OXTA 3BI6A 5K0XA 1H8FA 3NVMB 2C6MA 2PVLA 3G2FA 5ANGA 4BDGA 5CEPA 2ZM4A 4EI4A 1JPAA 1Y91A 4RLLA 5CZHA 3UMWA 3ALNA 2RGPA 4BKJA 2XJ0A 3SA0A 4IW0A 2HW6A 4FMQA 5CEIA 4YZCA 3ZZWA 1REJA 1GZOA 3S4QA 2UW9A 1JSTA 1XH8A 3EL8A 4DEHA 1M17A 3A60A 3LQ3A 3E3PA 2HW7A 3RHXA 2ERKA 3F7WA 3T9TA 4O7YA 2FSLX 3OT3A 5HTIA 2H6DA 3WF9A 4A9RA 4BDFA 1LEZA 5FUTA 4HVIA 3OFMA 3AD5A 2NNWB 3MPAA 1H07A 3R73A 4TT7A 4J1RA 3KA0A 3FLWA 3PE2A 4F6WA 3R6XA 3KXGA 3OC1A 4GJ2A 5BYLA 3H10A 5IF1A 2OICA 4GUEA 1G8SA 1DAYA 2XNBA 1ZRZA 2C6DA 3PG1A 4IX6A 4Y72A 1KV1A 2ITQA 3ZSGA 3QX4A 1NVRA 4D28A 1YQJA 4YTCA 3TUCA 4CG8A 3EIDA 5DLSA 4BCIA 2OFUA 4C3FA 3F69A 2Y8OA 5AV0A 4Q9ZA 3TNWA 4L44A 3LFBA 1V0OA 2O8YA 4MH7A 4L46A 3SXSA 4LM5A 4TNDA 3U4UA 3GQIA 3ENHA 5L4QA 2QOCA 3GCUA 5FRIA 4O2PA 3L1SA 3NIZA 3E7OA 4L53A 5CNOA 5HEZA 4YHTA 4QMYA 4L6QA 4EOIA 4DGLC 1G3NA 4R5SA 3LXLA 4EK8A 3AMYA 1JNKA 3A4OX 3PTGA 3FKNA 4XP0A 3R00A 3R71A 2JDTA 4GH2A 4YLJA 3UTOA 1BL6A 2WMSA 2WPAA 4F65A 5M4FA 3F2RA 3QTWA 2JDSA 5JKGA 2XM9A 4U0IA 2E9OA 5A54A 3SW7A 2WOTA 4E5WA 1RW8A 2QHMA 3GCQA 2BCJA 4JBVA 3WARA 4XP2A 1R1WA 1GIJA 4UXQA 5CT7A 2CKPA 2J5EA 3F3TA 3F5XA 4P90A 4S34A 5LOHA 3LCDA 4JAIA 4ENXA 4ZS4A 2WTKB 5B2KA 4IZAA 4LUDA 4AG8A 2ZOQA 3OCGA 3R02A 3W2PA 1PXLA 3EQPA 3NCZA 5E1SA 2QHNA 4AA0A 2C6EA 3NS9A 1M14A 3IKAA 3NUUA 4L67A 4V04A 3TCPA 5CSVA 3FZPA 4M68A 5EDQA 4R7BA 2ZV9A 2R3OA 3K5UA 3QZHA 5A46A 4DFNA 3WF6A 4RJ7A 2YDKA 4OTDA 4GIIA 1Q8ZA 4MXCA 4NIFA 4M12A 4NW5A 4TN6A 3RHKA 3V5QA 2XIXA 4YJVA 4QP4A 3UODA 3ZRLA 4CRLA 4E7WA 5HVKA 2C3IB 3QKLA 4CZUA 3ORNA 4O21A 2EB2A 2X7GA 3A61A 4EOJA 3L8XA 5TR6A 4QMUA 3V3VA 2R7BA 4WD5A 2A2AA 2X7OA 4UYNA 4RC3A 3CQEA 5DEWA 3RI1A 3MY0A 5IA2A 2GPHA 1IAJA 2I0YA 5G6VA 3HV4A 2YISA 3H9FA 3QQLA 1Q4LA 4FNWA 4L3JA 5D10A 5DN3A 2FH9A 3KRRA 2VWWA 3PPJA 1JKKA 4O0SA 4V01A 5BMSA 4HZSA 4Z16A 4B8MA 3R28A 3UQGA 3ZONA 1CDKA 2C4GA 5FM3A 3VBWA 4RA4A 3TTJA 4BI2A 5IH5A 4M7IA 5G1XA 5GJGA 4CKIA 2YM6A 2W9FB 4BCOA 4ZMEA 3NYXA 4TTHB 4BCPA 2OJ9A 5JRSA 5TO8A 4Q2AA 4AQCA 4CQEA 1QPCA 3DY7A 2W96B 3NZ0A 5CWZA 5EM6A 1YVJA 4WNMA 5L6WL 3W10A 2ZAZA 3QXOA 3QTUA 4BHZA 1UA2A 4EKLA 5CU4A 2UW6A 3IS5A 3L9PA 1PW2A 5GIPE 3C4EA 3C50A 3CGFA 3BELA 3L9LA 3ZFYA 3ZO1A 2X39A 3GGFA 4LQMA 4HCVA 1DS5A 3ZUUA 4UMUA 3C4XA 5HD4A 4MEDA 1LPUA 3H0ZA 5C4LA 3KF4A 4NL0A 4RIYB 2ITWA 2NO3A 5DMZA 3C4FA 2HXLA 4X2JA 5CSPA 4F9AA 1WBPA 2YACA 4HGLA 4MXZA 3GI3A 4AA5A 3COHA 4PY1A 2GFSA 1H0WA 3IW5A 1W98A 1OL1A 3FV8A 4ANSA 1OUKA 2QURA 2V55A 2R3FA 4BCFA 1XJDA 4PDOA 1H28A 3R9DA 5IUGA 3V5TA 4OUCA 4UZDA 3P0MA 3MFTA 3GP0A 5HG7A 5EYCA 3W2QA 4ASZA 4FV9A 1CM8A 1JKLA 4LOOA 1YXUA 3PA3A 2PVFA 4W4VA 3C13A 4J7BA 3FSFA 2BMCA 2C5NA 1B38A 2P2HA 5CVFA 4FKOA 4BY9E 2ACXA 3BPRA 1FPUA 3IDCA 4I6BA 4RVLA 3BKBA 3DFAA 4AU8A 3DZOA 3ORPA 3TDVA 3SAYA 5AUVA 5HQ0A 4QTDA 3QXPA 5J87A 3N9XA 4QTEA 4IJPA 5LVNA 5CVHA 5AV2A 2VD5A 2OJIA 4EHZA 4D1XA 2A27A 1UNHA 5L6OA 1R39A 4DINA 1Y57A 4K9YA 1P5EA 4IMYA 4ZSEA 3SRVB 5K9IA 2OIQA 3QFVA 4DTKA 1WCCA 3W2CA 3GOKA 3I4BA 4EOMA 5JT2A 3EYGA 4I21A 4WNPA 4FT5A 1XH4A 3ODYX 2R3GA 3UOKA 3QTXA 3UOHA 3Q6WA 3D7TB 5FBOA 5FQDC 5J1VA 1APME 4YLKA 4EZ5A 1TQMA 2HZIA 4WIHA 4Y5QA 2BHHA 3CP9A 2B0QA 4AW2A 3F7ZA 3CY2A 3R22A 3ORTA 4QYHA 5AP5A 2J0IA 2H8HA 3N4TA 3FLYA 4J97A 4MQ1A 4UYAA 2R9SA 2PVHA 3U87A 3F9NA 3BLRA 3QQUA 5BMMA 2UW4A 4QMOA 1I44A 3E63A 3R01A 4UMTA 3Q53A 4DE4A 2BFXA 5AFVA 4CD0A 3S0OA 2ZB0A 3MY1A 1S9JA 3ORIA 3HMPA 4YU2A 5HORA 5BUIA 3AC1A 5GHVA 4YP8A 1DI9A 4G34A 4F9CA 4TW9A 1J7IA 1HCKA 3BBTB 4QD6A 4TZRA 3R1YA 2CN5A 4I6FA 2GSFA 3UP2A 3VS1A 3DCVA 2C30A 5HG8A 3OMVA 3QD4A 1O9UA 3MFRA 4CFFA 2YM5A 2UZLA 3QTIA 4FKPA 4DFZE 4DT9A 1UWJA 4QMMA 4IWDA 4AN3A 2WAJA 4D9UA 3P7BA 5M08A 5HTCA 3EQCA 4U6RA 4XG4A 3TL8A 4X21A 5IEXA 4BYJA 2BR1A 3CQUA 4KS8A 4LMNA 2PUPA 4XOZA 3LE6A 3IPHA 4R77A 2Q0BA 2Y0AA 3VUMA 2X8IA 2XZSA 4CG9A 3D5WA 5BQ0A 4I6HA 3OTVA 3CTHA 4FZ7A 5JMSA 3HEGA 1VR2A 4PX6A 4R3CA 4M67A 4NKAA 3DTCA 4RIWA 2UZVA 4XNEA 5M4UA 4G31A 3NX8A 4D58A 5JFWA 4NCTA 3Q60A 5BVOA 5HU9A 4RWKA 3VHEA 5IQGA 4ANQA 1UU3A 3KU2A 3FZSA 3C4ZA 3IOKA 4HGEA 5D11A 3NCGA 5AP3A 5FTOA 3FMKA 3SOCA 4CFUA 3AD6A 1YOMA 3KFAA 4FIEA 4MXOA 5HNBA 4BKYA 5JGBA 3QC4A 2ITXA 3BU5A 4AA4A 2CSNA 3CS9A 3G5DA 2WIPA 1O6YA 4C38A 3N4VA 3EFJA 4MF0A 2F4JA 4D0XA 3AD4A 5ANDA 5LCJA 3MYGA 2ITOA 2YITA 3AC5A 4FV7A 4MTAA 4BF2A 3RK9A 2R3JA 4YR8A 1BUHA 4TYJA 4Y83A 1Y6AA 4YJNA 3PWYA 3R9RA 4C7TA 2XBAA 3HNGA 4D2SA 1H26A 2RFDA 2VAGA 4YC6A 4C59A 3RCDA 3ALOA 4BIEA 3GU5A 4P7EA 4PQNA 4K6ZA 3SD0A 4I93A 3LCOA 4X3FC 1OBGA 3AC4A 2W1FA 2RF9A 3OCTA 4HW7A 2W1ZA 2WMAA 2ETMA 3TG1A 3ETAA 3ZYAA 3EN6A 2YAAA 2AC5A 3PY3A 4FL3A 3KXMA 1KE6A 4II5A 3H0YA 4XG9A 2Z8CA 4PMSA 3DFCB 2OFVA 3O7LB 5IPJA 4A7CA 1YKRA 3HV5A 3EQDA 4YGAA 1UV5A 4QMWA 3CC6A 1S9IA 3VAPA 4C4FA 4UB7A 3NRMA 4DG0E 4KRDA 4F70A 3MVHA 1ZOHA 3T8OA 3OT8A 3TNIA 4O27B 5DH3A 3HRCA 4M14A 3TNQB 3TZ9A 4PTEA 3R8UA 3JR1A 4FR4A 4OT6A 3QTQA 1H1QA 1U59A 2XB7A 3QU0A 3IECA 4IX5A 3D2KA 4WRSA 3AGMA 4ZLZA 3VS3A 4BVUA 4UN0C 2VO3A 4DFYA 4CZTA 1U5RA 4PF4A 1UNGA 1YDSE 2O5KA 2PHKA 2YZAA 4R7IA 4FTJA 4YO6A 3VW6A 5C26A 2B55A 4G5JA 4LL5A 1OPJA 4GT3A 4OR5A 3HV6A 2X9FA 3FL4A 4JNWA 4FZFB 4CMOA 4LMUA 2PULA 5D7VA 3BX5A 4O96A 3QA0A 4I6QA 3HL7A 3QUEA 3HAVA 3ZCLA 4C57A 3RAIA 4BWKA 1ZZ2A 2IVUA 4IVDA 4MD7E 1ZWSA 3FLSA 2C3JA 1H24A 3EJ1A 3IW8A 3QTRA 2J5FA 4BCNA 3ZUTA 4L9IA 4APPA 2ITTA 2RIOA 3S2PA 5KZ0A 4ERKA 4UWCA 5GNKA 5HLNA 5E4HA 3RM7A 4RC2A 1PKGA 4IB5A 4ALWA 1RDQE 4WBBB 5DR6A 3FI8A 3KXZA 1BX6A 2VTJA 4K2RA 1MQBA 3BHHA 2BRHA 1JSUA 4HVSA 3FHIA 4O81A 3MVJA 4AACA 3G15A 2X2MA 4X6RA 4WSQA 2QLUA 4QP3A 2JDOA 3VHKA 5EM5A 4CRSA 3ZSHA 1WBWA 5KMOA 4A9SA 3OD6X 5KO1A 4CCUA 4MNFA 2GCDA 3E62A 4BZDA 3NUXA 4GSBA 3EFKA 3KXNA 3R2YA 3CJGA 4IWQA 4I1ZA 4L3LA 2C0IA 3RPSA 2OGVA 1ZOEA 3AGLA 4F6UA 4BIBA 2WTDA 1E1VA 5EOLA 4BCKA 3DS6A 3A7FA 4F7SA 3PP1A 4UMQA 3W33A 4OLIA 3W16A 3LCTA 4IVBA 5HU3A 2CPKE 3CR0A 2YCFA 4G3GA 1H1RA 2XM8A 3FMDA 3DPKA 4O91A 5TT7A 3LFAA 3EQHA 1H01A 3EFLA 3QLGA 4PP7A 5HLWA 2PMLX 4S32A 3LCKA 3TKHA 2R64A 3GC8A 4JIKA 4WBOA 1FOTA 2QG7A 1UKIA 3RK7A 2F7XE 5A4CA 1XH5A 3C5UA 2XRUA 2XEYA 5KX8A 5C03A 3JY0A 2HZNA 2V0DA 3KY2A 5CZIA 5M51A 4RQVA 4EONA 2W1GA 1L3RE 3FPMA 4E6QA 3TV6A 1ZZLA 1K2PA 2B4SB 2VV9A 1KE8A 2WTVA 2R4BA 1M7NA 5DE2A 5ANJA 4IXPA 3V5PA 3VNTA 4CFWA 5M09A 2HCKA 2VO7A 2C6KA 3E5AA 4NW6A 1CKPA 5H8GA 1Q97A 2B9IA 2GS7A 5HLPA 4FF8A 2ZM1A 3ORMA 3FMLA 4KWPA 3QWJA 4CLIA 3W2SA 5FXQA 2WO6A 3ZXTA 3V8SA 2WIHA 5C8MA 1JKTA 4ANOA 4L52A 3OBGA 3TXOA 5HBJA 2W17A 2BROA 1CTPE 4IDVA 2WMQA 2J9MA 2GFCA 2ZDUA 4DGNA 3F5PA 2VX1A 5CASA 2OIDA 4G3DA 5M06A 4XG7A 2CCIA 3QX2A 4TXCA 3LW0A 5L2SA 5KBRA 3R7UA 2XCHA 5JZNA 3D15A 2B54A 3LFCA 5CEMA 3KC3A 1PXKA 4DGGA 4Z55A 2I7QA 4H3BA 5JGDA 4RSSA 3MW1A 5AUUA 4FE2A 2QONA 2XKCA 4AOJA 4CNHA 3ENMA 4BCQA 3REPA 2BKKA 4AW1A 1UNLA 5HOAA 3K2LA 2BFYA 4C2VA 1H08A 2XIYA 3D9VA 1ERKA 3L8PA 4X7QA 2CGXA 4ZY6A 3HMIA 1J3HA 1MUOA 5DT0A 5CI6A 3P5KA 4CTBA 2HELA 2ITPA 2PE1A 3BU6A 5HIBA 3L8SA 3RZBA 3Q32A 3OVVA 4GT4A 4U81A 3WIGA 1A9UA 4EOSA 2Z7LA 4F7NA 3TM0A 4ZMFA 1OL2A 5E91A 4QMSA 3EQRA 5CTPA 1BKXA 3IGOA 4WHZA 5AP4A 2ITVA 4RG0A 3A7GA 2KTYA 3DT1A 4EHEA 3SV0A 4DCEA 2QQ7A 4JG6A 5JEBA 1H00A 3R1NA 2UZWE 2QKWB 4D5HA 4HGTA 1WBSA 1OITA 1H27A 3DQXA 3RALA 4CVAA 1HCLA 5J9ZA 1YOJA 5I3RA 2B9FA 1FVVA 4ANBA 5KMMA 5GINE 5ANIA 4BCMA 5L2QA 3ZH8A 3CTJA 2VGOA 2J0MB 2OXYA 5DYJA 1YXXA 4FG8A 3GCSA 3F3ZA 1IEPA 4B0GA 3R04A 3DK6A 3IK3A 3QLFA 3FC1X 4W8DA 3CBLA 3DKGA 4FEXA 3BYVA 2FYSA 1GZKA 2W06A 4KKEA 1OIUA 4UZHA 3DXPA 2HXQA 4USEA 2OZAA 3LPBA 4LGDA 3H4JA 4E1ZA 5EDPA 4AW5A 4AZVA 4EK3A 5D12A 2BTSA 5KBQA 2CHLA 3OWJA 5LMKC 1UU9A 4HPTE 5BYZA 5CENA 4AGDA 1IAHA 2VNYA 3D4QA 5DHJA 3HP5A 4H36A 2X4FA 1R78A 3BGQA 5EHLA 2G2HA 2GTMA 5D7AA 5EQPA 1W8CA 4NU1A 2OH0E 1PF8A 4DTBA 4RT7A 3TUDA 3FLQA 3L8VA 5CLPA 5CS6A 5CEOA 2BRBA 5IISA 3P78A 4QPAA 5D1JA 1NW1A 5K3YA 4KIQA 2UZOA 2UZBA 4YZ9A 3IGGA 4DH3A 4FC0A 3KULA 2WFYA 3LQ8A 5HIDA 1KUTA 3OTUA 3HA6A 4DEIA 2YWVA 1GZ8A 4MXYA 5LWNA 2O64A 3F2AA 2YIQA 2HY0A 3GVUA 3MH0A 3KRJA 4E6CA 2G1TA 2R3QA 3GC9A 5HVYA 3I7BA 4EK4A 1SVEA 5AUTA 4GV1A 2XK6A 3GEQA 2YZLA 2NP8A 5BYYA 3ZS5A 3R21A 4MWIA 3QQJA 3K54A 3ZEPA 3PA4A 3ULIA 2GQRA 1H4LA 1RJBA 3LAUA 4PNIA 5BVEA 2A4LA 5F4NA 3A4PA 5CF4A 5AR2A 3FLZA 4IM2A 5EI6A 2I40A 2PZPA 4FV5A 4F6SA 5GJDA 5CF6A 5M56A 4FZDB 4XX9A 2CKEA 5FEDA 3MPTA 2VWXA 2WMRA 3I5NA 5J5TA 4ZJIA 2JIUA 1FVRA 4A9UA 1IA8A 2P2IA 4WG4A 3PRIA 5AAFA 2WTKC 4E5BA 5A4EA 4FTRA 4ZSAA 4OBQA 3PY0A 3MFUA 1ZLTA 2JAMA 1WAKA 3EH9A 4AZTA 3V01A 2YM3A 2Z7QA 4QQCA 1KSWA 3AT2A 5AR7A 3FY0A 3ZO3A 1OL6A 2IZRA 2CNQA 4PUZA 4GCJA 1GNGA 3U6IA 1SMHA 4EJNA 1T46A 3S95A 5E9EA 2QD9A 4PTCA 4Y85A 1URWA 1NT2A 3TI1A 4DEBA 2WMWA 4C4GA 3RNIA 4BKZA 5EKOA 3UJGA 4CEGA 4BHNA 4E93A 4HGSA 5HBHA 2BZJA 1B39A 2EVAA 2Y6MA 1JLUE 3G9NA 3COMA 5A4LA 3TKUA 5BPYA 4GL9A 1OB3A 4DGOA 3FY2A 5A4QA 4IC8A 3GCPA 2QR7A 4LOQA 5I9UA 2I1MA 5IKWA 3TEIA 2ZYBA 3UVRA 3GU4A 4IFCA 4DFXE 3C1XA 1OUYA 2R3LA 4ZK5A 2JFMA 2VN9A 5HCZA 4R3RA 1Q61A 3VIDA 1Z9XA 5T3QA 2PMOX 3CCNA 4EH6A 4M15A 3E8EA 4N6YA 1L8TA 4BGHA 3PP0A 4KBCA 2WMTA 2Y6OA 3NIEA 4JDKA 4RIWB 2OBJA 3ZU7A 2VTAA 2JKQA 4UV0A 4E3CA 3DK3A 4PP9A 3AXWA 3V04A 2PSQA 5K4JA 4NT4A 3FYKX 5HTBA 3HKOA 2ZDTA 3PVUA 2C68A 4QMVA 3EN4A 5E8YA 4EQMA 3E88A 3V5WA 4FIJA 4BI0A 2WMVA 4NTSA 5L8JA 2R3PA 4BIDA 1V1KA 3NMUF 4UX9A 3F66A 4D5KA 2VX0A 4RBLA 2EB3A 3MH2A 3OZ6A 4C0TA 4CTCA 3IO7A 3NYOA 4W4WA 5I9YA 3NPCA 3DA6A 4G17A 3MPMA 4YTIA 4RX9A 3ZO2A 5KHWA 2O0UA 3R9NA 3ZC5A 1K3AA 3QRKA 5JSMA 5CALA 2XK4A 5KCVA 4XYFA 1XR1A 5CAPA 5EYKA 3EN5A 3BQCA 5H3QA 3KGAA 3VS2A 3HZTA 5CY3A 3U4WA 1VJYA 3MJ1A 1WVWA 3VO3A 4QYYA 3ZXZA 3C9WA 4AZEA 4DF3A 3M11A 4CFNA 3GUBA 2YIRA 3MS9A 1QL6A 4ZEGA 3BYSA 1P4FA 3DBFA 4IJ9A 4AP7A 1LP4A 2W1IA 2YCRA 2YDJA 2SRCA 3WZUA 1BMKA 5C27A 3LMGA 3II5A 4AX8A 2RG6A 3HX4A 3S1HA 4QYGA 3Q3BA 5JRQA 1BI8A 5CF5A 4QTBA 3FZTA 4IAKA 2F57A 4TYHA 3COIA 3D14A 4RQKA 3TT0A 1QCFA 2WTWA 4XV1A 3QWKA 4FKRA 2UZNA 3TKIA 5L2IA 1SNXA 4G6OA 3SOAA 4K0YA 1U4DA 4DG3E 5J9LA 3AT4A 3PVWA 5M44A 2W1HA 4ZY5A 3QF9A 1LR4A 4F1TA 3L9NA 4FT3A 4GYGA 4AN9A 5LVMA 4G6LA 5EOBA 3VQUA 4A07A 3SX9A 2B9JA 4FTNA 5E8ZA 5CF8A 2XRWA 2PUIA 2WEVA 2H9VA 3FWQA 3MVMA 1REKA 4W4XA 4XLIA 5ETCA 4EOKA 2BZHB 3R2BA 2UW3A 4MAOA 1A06A 4EUTA 1OL5A 5J7HA 3LLAA 3DV3A 3DDPA 5M07A 2QR8A 5LCKA 2OKRA 5IA5A 5I4NA 4QPMA 3COKA 4FIHA 3NVKI 5I3OA 3FZOA 3RKBA 3SKCA 4QP1A 5EQYA 3G51A 4ZOGA 2OI4X 4FVPA 3F6XA 5CNNA 5DRBA 4FKUA 2B1PA 1IA9A 4KB8A 4QMQA 3PY1A 4FK6A 4I20A 3NYVA 3ACKA 4CFVA 3LOKA 1I09A 4OTHA 2BZKB 2YLEA 4MNEB 4C8BA 1AQ1A 4C36A 4JLCA 4ITJA 4I94A 2BALA 4GEOA 4MQ2A 4GVJA 1URCA 4YJQA 3P4KA 4LG4A 3ZTXA 4FKQA 4CYIA 3QCYA 5DEYA 3ZBXA 5KZIA 4EOOA 4R78A 2HWOA 1BYGA 3EKKA 4EC9A 4DT8A 2O63A 1EH4A 5HX6A 3R30A 1G8AA 4J71A 5GZAA 1MRUA 4IZYA 4TWPA 2PVRA 3KF7A 5BNJA 1TQPA 2XK7A 4JR3A 2YFXA 3TNHA 3QD2B 2XEZA 2XK3A 2XNOA 3AG9A 3KK9A 2CCHA 5AUZA 1QPJA 3E7VA 5JK3A 4TNBA 1J1CA 5DOSA 5ETFA 3FI4A 3FI3A 2OIBA 4FICA 5FDXA 3KRXA 3UZTA 1LUFA 5DVRA 5AP6A 3FI2A 3MIYA 3BE2A 3R1QA 2P55A 5L2TA 3FZ1A 3NDMA 4FYNA 3R83A 4O7LA 5CSXA 1P4OA 1PRYA 5E8XA 1ZMWA 2QNJA 5T6KA 2YJSA 3AQVA 3NW6A 2XKFA 1Q99A 5IA4A 3ORZA 4KIPA 4PWNA 1KE9A 3I60A 4TKSA 4X3JA 3OBJA 4ZTSA 4F7LA 1OKVA 4YURA 3ID6C 4EHGA 3JS2A 2XYNA 5I9XA 5M53A 4LOPA 1FBNA 3I1AA 3EYHA 5EYMA 3OWPA 4I4FA 2VO6A 5HGIA 5CU3A 4GJ3A 5I0BA 4XRJA 4IDTA 4TY1A 5CXZA 3D5UA 2FVDA 1WBOA 2QOIA 5M57A 5I9WA 1ZYJA 3FQSA 4B9DA 4UMRA 5KMIA 1ZYDA 3L9MA 3VBTA 5HO6A 2ZJWA 3UZRA 4QYEA 4FV6A 3PXZA 3MI9A 5AIKA 2ONLA 4H1JA 2VWBA 4XV9A 5HESA 4JRVA 3PYYA 3HUBA 4ZTMA 2JDVA 4KSQA 4BDEA 4Z7GA 5A6OA 3OCSA 3MSSA 4U40A 4E8AA 4JBQA 4XUFA 3NWWA 1ZARA 1WVYA 3QCXA 4G3FA 5DT4A 4EUUA 2OXXA 4OTFA 3G0FA 1H1WA 1XO2B 1OMWA 3R7VA 3R1SA 2IVTA 3EQBA 2XIRA 3S3IA 4DEAA 3BHUA 4QO9A 4PMPA 2IZUA 1V0BA 4IZ7A 3VUDA 4OGRA 3GOPA 4U43A 5CU6A 3DOGA 4FYOA 3PPKA 4GVAA 3BRBA 5HE0A 4U45A 2ZB1A 2Y9QA 2F49A 2PY3A 3HDNA 1YWVA 3A2CA 3F3VA 4DTAA 3CKWA 2C3LA 3MB6A 3KMWA 4YTFA 5L3AA 2VWYA 3I6UA 3QQHA 3ZDUA 2I0HA 1OIRA 4G9CA 3BE9A 3ZUVA 4QP7A 1PXJA 2PZRA 4FTCA 4MHAA 3UMXA 3BWJA 4MBJA 3FMJA 3BYUA 1J1BA 3PXFA 1NXKA 4O0TA 3RAWA 3W1FA 3ERKA 3T3UA 3FL5A 4ZAUA 3I6WA 1W82A 2XCKA 3E8CA 3V8WA 3VUTA 5A14A 4MF1A 4I41A 4WNOA 3HRFA 3LM5A 4FNYA 4CQGA 3WZJA 3TZ7A 4FSTA 2DWBA 3MV5A 4V0GA 4AXAA 4BB4A 4L43A 4L7SA 1Z5MA 3OXIA 3QRJA 5DR9A 2DUVA 3AC8A 1DI8A 3FQHA 4F9WA 3FYJX 3NW7A 3RWQA 4JG8A 4NSTA 1YXVA 3T9IA 3E64A 3AOXA 3PSCA 2X4ZA 3BEGA 4DFBA 5AV3A 5JZJA 4WG5A 1TKIA 5AWMA 3BYOA 4HYSA 4K8AA 1XHAA 1JVPP 2RKUA 5IMEA 4D2RA 3GNIB 4QMXA 1SYKA 5LVLA 4FKLA 4DH1A 1T45A 3FLNC 4HYHA 3R8LA 2P4IA 3UC4A 4F08A 4JDJA 5AX9A 2GQSA 3LJ0A 4HPUE 1GJOA 3QRTA 5AR3A 4EOQA 1PY5A 3DJ7A 4J8NA 5J8IA 1W84A 3C7QA 3UVQA 2OZAB 3RM6A 2Y4PA 3TJCA 5AAGA 3UNJA 3UIUA 2PZIA 4BCHA 2XNPA 1DAWA 1Q8UA 3DB8A 4O7SA 4YHJA 3LLTA 4I5CA 2VTOA 4E4MA 3F5GA 4U79A 4FKVA 3QGYA 2FA2A 5KMKA 5TOZA 4HVHA 4Y73A 3EZVA 2YCQA 1Q24A 3CGOA 4HCTA 5LMAA 3Q4CA 1PMUA 1WVXA 2I0VA 4M13A 1PYXA 5CU2A 3WE8A 4AF3A 5IQFA 5K4IA 3ZHPC 4FUXA 3ZEWA 1E9HA 4FL2A 4ZTQA 3PZHA 4U9AA 5LMKA 3KULB 4YJRA 4WA9A 5KMNA 2X7FA 3MTFA 4GYIA 1M2QA 1OI9A 3C4WA 2Z60A 4XG3A 4IM0A 5EI8A 1TVOA 4GK4A 4JQ8A 4RMZA 3FJQE 3Q4UA 4JOAA 2E9PA 3ZDIA 4ACCA 3PUPA 1KOBA 4GG5A 4B7TA 4BZNA 2ERZE 2Z2WA 1BL7A 3U54A 3OS3A 5FXRA 2H34A 2PZYA 5KNJA 4O83A 5F94A 3IOPA 4FK3A 4F0GA 5KHXA 2XYUA 5H8EA 1R0PA 3CIKA 3IDPA 5B7VA 3W18A 5KMJA 1YI3A 2CNVA 4AT5A 4NYEA 2V7AA 5H9BA 3QCQA 2BDJA 3ZRKA 2XNMA 4C4JA 2UVYA 3E93A 1O6LA 1NVSA 3DB6A 5HBEA 5IDNA 3JY9A 4QTAA 1PJKA 1V0PA 5EM8A 4XG8A 2CKOA 4PPCA 2X9EA 2XKEA 5KKRC 4U3ZA 2C3KA 3OY3A 4FIGA 4IAIA 4LUEA 2G2FA 2OF4A 2PVNA 2JBOA 3MB7A 3NNXA 4EH4A 2ITNA 1IRKA 4IAAA 3GT8A 3O0GA 5DA3A 4FEQA 4QMPA 2GNGA 1P2AA 2QOOA 4WO5A 4C34A 1WBNA 4DEEA 2X2LA 4QP2A 4EZ3A 4P4CA 4FV3A 2V22A 4XMOA 4DEGA 2WHBA 4L68A 1NA7A 5AM7A 3E8DA 3QRUA 2BIKB 4LI5A 2IZSA 2QC6A 4DG2E 4O82A 5J1WA 4MNEA 3DU8A 3QL8A 4I4EA 3HUCA 3HYHA 2ZMDA 2VWIA 2X8DA 4FSQA 3R8PA 3ANRA 2OH4A 2X6EA 4NUSA 4OTGA 1YDRE 2YA9A 3JVRA 3B8RA 2O65A 5B0XA 5F9EA 4FT7A 2QOFA 3EQGA 3SG9A 3RVGA 3NGAA 4JAJA 3OW3A 3GENA 2PUUA 5H2UA 5AP0A 4BBFA 4Q9SA 2WZJA 3LXKA 3NAXA 4OTQA 4CGAA 2YLFA 4C2WA 5HE3A 3FMEA 4YBKA 5HE2A 3TV4A 3TTIA 4AGUA 4KABA 2C1BA 4RLKA 2VTHA 4BR3A 3PPZA 4ZZNA 4FBXA 4I22A 3KRLA 3I0OA 4Q5HA 4QMNA 4PMTA 2C6LA 2VGPA 4AZSA 4X2KA 4FSZA 4JQEA 4FV8A 2QG5A 4M97A 2H96A 1RE8A 2J50A 2Y4IC 3MIAA 2XA4A 3PWDA 3TACA 1JBPE 4O6EA 3EKNA 4RPVA 4AE6A 4EOPA 4HVDA 4D55A 1WFCA 5JQ8A 2PTKA 3NUSA 2OG8A 5HNGA 5IQBA 3A7HA 3H30A 2RG5A 3TN8A 3UDBA 2UZDA 2GQGA 5C1QB 4O7WA 5CYIA 4NJ3A 1TQIA 1WBTA 3FKOA 4TL0A 3SGCA 3LMHA 4ONAA 4BWPA 4C3PA 1UWHA 3ZLWA 4K33A 4O7ZA 2XNEA 5AV1A 5ICPA 3BU3A 2WOUA 3KK8A 5HNIX 1U5QA 1M52A 3LHJA 5JFSA 3QUDA 4TYIA 3DGKA 4J98A 4FZAB 5CI7A 1U46A 3ZM4A 3U55A 4GU6A 4IX3A 1B6CB 3LFFA 4L01A 4MXXA 4TYHB 4E6DA 3QTZA 4BGQA 1VZOA 4AZFA 2QOBA 4XBRA 3CPBA 5AM6A 4UWBA 3DKFA 4AFJA 4FV2A 3R0TA 5LJJA 2R3IA 4D4VA 5ETIA 4G6NA 1MP8A 2QLQA 2REIA 5ANKA 2DQ7X 4JIAA 4X3FB 2UW0A 2XJ2A 2ZMCA 4NM0A 4L7FA 3BV3A 3QBNA 4MYGA 2AYPA 5LQFA 3SHEA 4AOTA 3RTPA 3KB7A 4X0MA 2AUHA 4BTJA 5C9CA 3MBLA 2PL0A 4KKGA 2BAKA 2JD5A 4DHFA 4LV8A 3EQIA 1WZYA 3CTQA 3DXQA 4QP8A 4YJPA 5ITAA 3OWLA 4O22A 2YAKA 5L8LA 2XUUA 3BHTA 4S31A 1F3MC 4DH8A 1JSVA 4TWCA 4QP9A 4JL9A 2R3HA 3FHRA 2Z7RA 3LZBA 5AEPA 5IUIA 3HLLA 2VTTA 3I7CA 5DFPA 3UQCA 1Y8GA 2G01A 2VTSA 4UMPA 1XQZA 4QOXA 3CEKA 3DLSA 3EN9A 2XK8A 4FEUA 3PDTA 4JG7A 4WG3A 3RAKA 4KA3A 3VS6A 4ZTHA 4KKHA 3O50A 4MK0A 3P1AA 4GUBA 2C5VA 5EFQA 2CKQA 2IG7A 4TRLA 4I5MA 5DIAA 4YO4A 3A8WA 4XG2A 3PRFA 5HO8A 2BDWA 3DKOA 2BHEA 4RVMA 2W99B 4LRKA 3W55A 1SM2A 5HIEA 2W4OA 3DBCA 4XV3A 4DITA 4EH3A 5FLFA 4DH5A 4FL1A 4WSYA 2J2IB 2YIXA 3RWPA 4JS8A 3UYSA 4BGGA 3MA6A 5E1EA 2UV2A 3MWUA 3A7JA 2E9VA 2C47A 2PE2A 4FSUA 4IE9A 3KCKA 4OTPA 3UNZA 3LKMA 3EN7A 4DLIA 5GIOE 2BKZA 4FI1A 4IIRA 4ITHA 4HNFA 5HCXA 5C8NA 3W32A 3F3UA 3M1SA 2EU9A 4TWNA 2VTLA 4DLJA 1OKWA 3TZ8A 3MJ2A 2CN8A 4ACDA 3QHWA 3UG1A 3LVPA 4RVTA 1R3CA 2CGWA 2YIWA 5IQAA 4BFMA 3S00A 2IPXA 3THBA 3SLSA 4ORKA 4IWOA 1H25A 1U54B 2ESMA 3BV2A 4NCTC 4MD9E 3KKVA 3KQ7A 3MVLA 4PV0A 3OOGA 4RZVA 3OF0A 4WT6A 3Q04A 4JT3A 4EZ7A 2WTJA 2ZV2A 3BYMA 5LVPA 4YSMA 4EH2A 4GFMA 2J0KA 1PXPA 4FIIA 4U41A 5CAVA 4LRJA 3UIXA 2Z02A 3QKMA 2P33A 3IW7A 3LFNA 4M0YA 1Q5KA 3WZEA 4BN1A 2B53A 4MX9A 2E9UA 3VS5A 3EMGA 3QQFA 4FOCA 3CPCA 5IU2A 3FXWA 2J6MA 3ET7A 4YBJA 3F5UA 4ZZOA 2HYYA 4FG7A 3DQWA 2RSVA 5DWRA 1OECA 5E8VA 5E92A 1MRYA 5A9UA 4ZTRA 3FE3A 5CT0A 3O51A 3H9RA 2QKRA 2E2BA 1DM2A 1JOWB 3FKLA 3WF8A 1UU8A 3IW6A 3CY3A 4C61A 4F63A 4IZ5A 3CE3A 3UC3A 2GTNA 2CNUA 1PMEA 2XP2A 4AUAA 4WRGA 5DR2A 3E92A 4U7ZA 4XEYA 4CT2A 3GC0A 4FT0A 3UO4A 5FP5A 3OWKA 3NR9A 4LGGA 2XKDA 4FEVA 5AR5A 4KBKA 2C6IA 2BDFA 2R0UA 3H9OA 4DFLA 3BBWA 5ACBC 2WQMA 4JDHA 2I6LA 4RA5A 5E8TA 4GKHA 2XH5A 4H3PA 4ID7A 3FEGA 2OSCA 1XWSA 4MBLA 5IA0A 4NFMA 2GNLA 3Q9ZA 2JC6A 4RWLA 3U51A 2LGCA 2HWPA 3TWJA 2WEIA 3Q6UA 3VJNA 1OVEA 4RIXA 4CKJA 2VU3A 4I92A 4AGWA 4O86A 4PDYA 2FB8A 4ZXTA 4BCJA 1IASA 3VVHA 2IJMA 1W7HA 3D5XA 5BVNA 4V0GB 3VF8A 3UG2A 4ASEA 2PVJA 4IC7A 3R9OA 3Q9WA 4BBMA 5JQ5A 3DJ6A 3P7AA 4EORA 2YEXA 4E5AX 3O8PA 2QOHA 4YTHA 1M7QA 3WILA 2UW5A 3RPRA 2YIYA 3V8TA 2W4KA 1YRPA 5TKDA 3VS0A 1FINA 1M2PA 4NZWB 4C3RA 5J9YA 4YNOA 2HIWA 3QQGA 4FGRA 2X0GA 5IQDA 4ZIMA 4FV0A 5DNRA 2CMWA 3B2WA 4OTIA 4I24A 4NM7A 1ZYSA 2GNHA 1AD5A 2VZ6A 1ZMVA 2VTIA 4S2ZA 4YC3A 1IR3A 3GCVA 4YNEA 3W8LA 1QPEA 4EYJA 4WUNA 3A7IA 3P79A 5J79A 4QMLA 3QC9A 4IADA 3WIKA 1YWNA 4FSYA 4C4EA 5IH6A 5CSWA 1X8BA 4G3EA 2IN6A 3PIXA 3PJ2A 2OO8X 3PSDA 4O0WA 3WE4A 4F9YA 2X81A 3PXQA 4IAZA 4UEUA 5FD2A 2WU7A 3HDMA 5M55A 3Q9XA 4YPSA 4ASXA 2BRNA 4ZSGA 4QP6A 2F7ZE 5HE1A 2GHLA 4N4SA 2BRGA 4FVQA 4BCGA 4CMUA 3SG8A 4ZSLA 2GNIA 3VF9A 1YHSA 4RFZA 3UIBA 4DFUA 4AAAA 5CAUA 3ZLYA 4XP3A 4QT1A 5DT3A 3G6HA 3PSBA 4BL1A 2GNJA 2R7IA 5CQUA 1Q8YA 2E9NA 1YHWA 4FIFA 1YXTA 5HHWA 3RNYA 4A4XA 1H1PA 3Q96A 4GT5A 5H8BA 5HCYA 3UO6A 2UVZA 2OU7A 4FX3A 4NK9A 4PNKA 3R7YA 4MVFA 4MCVA 1SZMA 2LAVA 5C01A 3N51A 4FTTA 3BGPA 1AGWA 3MA3A 4K18A 3AC2A 4BDDA 5I9VA 3K3IA 3PJ3A 5CEQA 3NUAA 5GZ9A 3U9NA 2B52A 4AFEA 4KAOA 5FXSA 4BDBA 5EK7A 3DBQA 3WF5A 1OBDA 2BIYA 2YABA 3PJCA 1MQ4A 3DZQA 3F2NA 3PE1A 3PLSA 5EYDA 1NY3A 3ZFXA 2GHMA 4FKIA 2W5AA 3DBEA 1H0VA 4EH7A 3GBZA 2YM7A 3DK7A 3KN6A 3BHYA 3QUPA 5DBXA 3RAHA 2Q0NA 3RINA 2JLDA 1JAMA 1YDTE 2O2UA 4D9TA 2FO0A 4R3PA 1J7LA 3ZLXA 5BX0A 4ZLOA 2NRYA 3QQKA 4HNIA 1OM1A 4O0RA 4X3FA 4ACHA 3EHAA 5AR8A 5FEQA 3VUIA 5JFXA 4BTFA 4FNXA 5AMNA 4FODA 4CV8A 4DBNA 1YOLA 1O6KA 4M8TA 2RL5A 2UZEA 3HVCA 4D2VA 3V5JA 3W2OA 3K5VA 4HJOA 3BWFA 2O3PA 3UZPA 3KEXA 3P86A 5AP2A 4D1ZA 3WBLA 3TUBA 4FTUA 1BLXA 4LV5A 2W0JA 4BYIA 4EBVA 1OPKA 3RGFA 2JIVA 3BEAA 4Q5EA 3VULA 2J90A 2PVKA 4FZ6A 2UW7A 4FV1A 4HOKA 3RK5A 3VBVA 4A4OA 4PL4A 4EJ7A 4F9BA 3LJ1A 4XJ0A 5HX8A 4RGJA 5FGKA 4Y5HA 2PMNX 4CFMA 3I81A 4FTQA 3UGCA 2UVXA 2BUJA 3OEFX 5KMLA 2WMXA 4CT1A 3TIZA 2XS0A 5GJFA 5DGZA 2CJMA 4NH1A 4AGCA 3VRYA 1QMZA 5LARA 3AMAA 3KCFA 2JEDA 1KE5A 2OXDA 4FTAA 5IQHA 4ANNA 2FSOX 4D2PA 2W9ZB 4H05A 2C5OA 2J7TA 4JVGA 2OJFE 4OTWA 2JFLA 3F82A 3G0EA 3RCJA 3ORKA 4GMYA 4YJOA 4F0IA 3P7CA 4JR7A 2W4JA 3OP5A 4RFMA 2C5XA 2YN8A 4IWPA 2ZV7A 3VC4A 5L6PA 4LRMA 3F61A 4O38A 3MDYA 2IVSA 3E8NA 3N4UA 4YSJA 2ZM3A
chains in the Genus database with same CATH superfamily
3UO5A 4UALA 2VNWA 4ZJVA 2CGVA 4YJSA 4G2FA 5IZFA 5AADA 1HOWA 4JX3A 4XRLA 1R0EA 3E3BX 4D4RA 5TE0A 4Y95A 2WB8A 4GFGA 3NW5A 4IH8A 5F1ZA 4IACA 3UDSA 4RIOA 4H39A 1OPLA 5FBNC 3PFQA 2EXMA 3LCSA 3LXPA 4BDKA 2IVVA 3ZO4A 3JXWA 4AWIA 2FUMA 2OJGA 3GU6A 3LJ2A 1U54A 3LXNA 4GG7A 4PRJA 3UVPA 1W0XC 1VYWA 4IBMA 4ZTNA 5DI1A 3TJDA 4J96A 5FEEA 2FSMX 1YW2A 3HV7A 2I0EA 3UE4A 4AZWA 4BDJA 3OHTA 4YUQA 1STCE 4FSRA 3RPVA 5FTGA 1ZY5A 2PE0A 3CKXA 2ITYA 5HZNA 2QOLA 1JWHA 4KIOA 4QPSA 4YZMA 4F1OA 3FSKA 3NLBA 3SXFA 3QRIA 5F20A 2IO6A 5C4KA 3D7ZA 4BC6A 4A4LA 4X2FA 4DH7A 1SVHA 2R5TA 3Q2JA 3VRZA 4E73A 2PYWA 1GY3A 2UW8A 3LFEA 1M2RA 5CANA 1YHVA 2Z7SA 4B99A 1A48A 4LFIA 4R7HA 4PPAA 2PPQA 4ALVA 1OZ1A 5C8KA 3DJ5A 3JPVA 5EDRA 4I0TA 3QGWA 4UBAA 4KRCA 3K3JA 3Q5IA 4J8MA 3NUYA 1JKSA 4KIKB 2YERA 4EH9A 5EW8A 4KBAA 3HV3A 4K11A 4BBEA 2W05A 1J7UA 4LV7A 2WQNA 2PK9A 1PMVA 3R8MA 5EG3A 4A9TA 3G90X 3PJ1A 2WMUA 2PVYA 4FTIA 2CLQA 4RFYA 5CAQA 1OGUA 3PZEA 1G8KA 3Q9YA 5M4IA 2HY81 1XH7A 1XBAA 3P23A 3DAEA 2OJJA 4HYIA 1SNUA 4KINA 3WF7A 5L2WA 4D4SA 2OLCA 1XBCA 4FTMA 4GS6A 3RPOA 1F5QA 4EHVA 3TNPC 4I6LA 1GZNA 3KMMA 4EBWA 2R3MA 2C6TA 3MH1A 3ANQA 3JVSA 3PLAE 2XJ1A 5EI2A 4F64A 4GU9A 4X2GA 1E1XA 1ZXEA 4L3PA 5HD7A 2IW8A 3AKLA 4K77A 4EK6A 3DKCA 5DPVA 4R1YA 3W0SA 2QCSA 1PHKA 4F4PA 3A8XA 3VWAA 2VX3A 3C0GA 5EW3A 3TIYA 4RJ6A 4M69A 4C37A 3D2IA 2YDIA 4CCBA 4TPTA 4PL3A 3HGKA 4DGMA 4G5PA 1OIQA 4J95A 4NM5A 1FQ1B 1WMKA 3QA8A 4L45A 3EQFA 4L42A 4V05A 3G6GA 4E26A 3AC3A 3FBVA 4USDA 1PXIA 3U8WA 3MFSA 2PMIA 4NEUA 3CLYA 3O2MA 4WNKA 4QNAA 3OUNB 3Q5ZA 4W9XA 4CMTA 5AAEA 4IHPA 3EL7A 3DNDA 2WGJA 5KUPA 4HYUA 2QODA 2J0LA 3D83A 5IDPA 1ST4A 3WI6A 2X2KA 5KE0A 4C58A 4MD8E 3I0QA 4YJTA 3HP2A 3IQ7A 3NNVA 1OKYA 5F95A 4FVRA 4H58A 2F2UA 4U97A 5IQIA 4DA5A 4AOIA 3KVWA 4EKKA 5K5NA 4OW8A 2HZ4A 3B8QA 2VO0A 3ZBFA 1Q8WA 3QD0A 3VUKA 4FA2A 5BUEA 3O17A 5EKNA 4AN2A 1NVQA 3LIJA 1VYZA 3CD3A 3ITZA 3QYZA 1GIIA 3QZGA 3CD8A 2PU8A 4XOYA 3O23A 1VLRA 4CZYB 5EW9A 4J53A 4B8LA 4IAFA 3UP7A 4W8EA 3VQHA 4U8ZA 4BTMA 4D0WA 3HRBA 3JYAA 3BLAA 4O7RA 5TF9A 2G15A 5EH0A 5E7RA 4OAVB 4ZY4A 2UZUE 4XBUA 2W5BA 3BIZA 4O1OA 4GW8A 5CXHA 3AMBA 3D5VA 3HMOA 2OW3A 4TWOA 5L8KA 3SXRA 2CLXA 1PKDA 5A3XA 5IQCA 4Z7HA 4A9YA 3UBDA 3BLHA 5IG1A 2GNFA 3R7IA 2RFEA 3I79A 3NUNA 2VWUA 2BILB 4ACMA 3QCSA 2W1EA 2C0TA 5CAOA 4CKRA 5D41A 2GDOA 1Q3DA 4FT9A 4U3YA 3R8VA 3FPQA 3OROA 4M84A 4W9WA 1PMNA 4IQ6A 4EK5A 5BVDA 3G9LX 1IG1A 4I23A 4A06A 4C4IA 4FEWA 2YM8A 4YPDA 3QAME 2UZTA 4E6AA 2Y7JA 3G33A 3GU7A 5HKMA 4FKJA 3ZC6A 2VRXA 2NRUA 2EWAA 2G2IA 5M4CA 4WKQA 2JAVA 5AP1A 1Z57A 4B4LA 4G1WA 1OIYA 4XCUA 4N70A 5BUJA 2IZTA 2R2PA 4JJRA 3GC7A 3KMUA 4O7TA 1FGIA 5J5SA 1ND4A 4I0RA 4KNBA 4QTCA 2WD1A 3U6JA 3P9JA 2WTCA 4L8MA 4YC8A 2ETRA 4MXAA 3WOWA 2JBPA 4I3ZA 4JRNA 2WELA 2VTNA 2PZ5A 3IG7A 4RJ8A 2J51A 2C5YA 4D1SA 4JXFA 4G9RA 1JQHA 3W2RA 4RVKA 5EQEA 5FG8A 2JDRA 3FAAA 3ATSA 4AT3A 4UWYA 2WU6A 3NYNA 2V7OA 4GK3A 1G5SA 4RIXB 2B7AA 4EH8A 3HECA 2HENA 3DDQA 4WOVA 4E20A 1Y8YA 1UU7A 4X2NA 4EL9A 2VTQA 3V5LA 4D2TA 2HAKA 5EM7A 5FDPA 3AT3A 4N6ZA 3V51A 2WMBA 3BZ3A 4P2KA 4EEVA 4ZLYA 3KREA 3HMNA 4CFXA 3GB2A 3ZMMA 4RZWA 4FJVA 3F88A 3ORXA 4RC4A 5IUHA 4JX7A 1Q8TA 4WUAA 4JDIA 5HI2A 5CVGA 1XH9A 4F0FA 4DC2A 3NNUA 3OY1A 4MKCA 4N57A 4MWHA 3HMMA 3FQEA 4ZTLA 3E87A 3DTWA 4W4YA 2CDZA 4YJUA 2EXEA 1G8JA 5T68A 2X8EA 2JKMA 3SQQA 3VBYA 2BPMA 2GS6A 2HZ0A 3C51A 3QKKA 3ZRMA 4EQCA 1FGKA 2ZV8A 4L00A 4ZS0A 4U44A 3M2WA 4R6VA 4RRVA 3TV7A 2DYLA 2BZIB 5HO7A 2WQOA 3IDBA 3Q4TA 5A6NA 2VTMA 3MTLA 4S30A 4USFA 5B2LA 4U42A 2F2CB 4B6LA 2WQBA 4E4XA 2XK9A 3GFWA 1FMOE 3VONA 2YJRA 4FOBA 4IVCA 4RJ3A 3F3WA 3SW4A 3UIMA 3VBQA 4ZJJA 4JBPA 1GIHA 4BWXA 3NUPA 2QU6A 3A62A 3WYYA 2X0QA 4CV9A 1XMMA 1LEWA 3NSZA 4MBIA 2Q83A 3R8ZA 1OL7A 1YXSA 3GU8A 3RJCA 2P0CA 3FMMA 5IA1A 4C33A 2IWIA 2XBJA 5FP6A 4OTRA 4OT5A 4Z3VA 2A19B 3MN3A 3QZIA 4XS2A 4ALUA 4M66A 4BDAA 4PL5A 5GZ8A 5JGAA 3ZSIA 4H1MA 4FGBA 4R1VA 3NAYA 4EYMA 4RX7A 1FVTA 5CSHA 3SC1A 4OBOA 3UOLA 2PVMA 2BAQA 4QQ5A 2A1AB 2A0CX 2GS2A 4YZNA 4F99A 4EOLA 4FSWA 2IW9A 4QMZA 4X6QC 2RFNA 3V6SA 2VWZA 5E8UA 4D4YA 4FTKA 3EOCA 4RIYA 2CGUA 4HCUA 4LYNA 4QRCA 3ZOSA 2YHVA 1BI7A 2C1AA 3V6RA 4F1MA 2AC3A 1Y6BA 2BAJA 3POZA 4O84A 4XLVA 2XANA 3KXHA 3Q4ZA 1P14A 3O96A 2ONLC 4J52A 1ZYLA 4ZZMA 3D94A 3TDWA 4GFOA 1Q3WA 3QYWA 4YMJA 4YHFA 4K1BA 3SVVA 2OWBA 2QI8A 5HG9A 4KIKA 5HICA 3VUGA 3WYXA 3LM0A 1YI4A 2R3NA 4YZDA 5AUWA 5CQWA 5K5XA 2QVSE 5AA8A 4G3CA 4RWJA 4UXLA 4G16A 4BZOA 4FKSA 2JIIA 4FKTA 3WZKA 4F7JA 4IB0A 1XKKA 5AA9A 1YI6A 3PVBA 4CXAA 5LVOA 4I5PA 3R7EA 4Z9LA 5CEKA 3CSVA 1PYEA 3FC2A 3ULZA 3WZDA 2IF8A 5IEYA 5E90A 4FUYA 3ROCA 1CKJA 3LFDA 3VS4A 3EZRA 4LL0A 2B9HA 4ITIA 2ETKA 3DNEA 4O0XA 2JKOA 4U80A 5DRDA 2FSTX 4CYJA 4R8QA 4AW0A 3SRVA 1KOAA 3QALE 4XHKB 4E4LA 4EC8A 4RJ5A 3RMFA 3O8TA 2WQEA 4NWMA 2KULA 2VTRA 2XVDA 3HAMA 4FKGA 1K9AA 1OKZA 5KKRB 4PDSA 2ITUA 3W8QA 3MH3A 4RWIA 4UY9A 3D7TA 2YWPA 3OOMA 3PVGA 5AIRA 3TZMA 3I5ZA 3ZZEA 4IVAA 4IEBA 3T3VA 2R3RA 3CQWA 4BDCA 5D9HA 2QO2A 3OXZA 3VBXA 4JQ7A 2XAMA 4NIFB 2XIKA 4PMMA 3OCBA 2GHGA 4NTTA 1YWRA 3LMIA 2QO9A 4FSNA 4U5JA 2YM4A 3VJOA 4XG6A 3O7LD 4FV4A 4QMTA 5FM2A 3RZFA 3Q2MA 5ANEA 5I5ZA 4S33A 3M42A 1KV2A 3MY5A 3PXRA 4AS0A 5IEVA 3C4CA 4BICA 5AR4A 2XNNA 2YCSA 2OK1A 2BTRA 1FMKA 4M3QA 4EWHA 3DBDA 4RJ4A 4O7VA 3SDJA 4AT4A 3ACJA 1VEBA 4GRBA 3MESA 4QYFA 4C35A 3FMHA 3VW8A 4DYMA 3W0PA 5J7BA 2EXCX 3D0EA 3Q52A 4IB3A 4CSVA 5LWMA 5LXMA 1PXOA 5AUXA 3PJ8A 3AKKA 4FKWA 4ERWA 4I0SA 2X6DA 2XF0A 5JFVA 3FXXA 1Q62A 3BCEA 3GXLA 4NFNA 4C02A 4QQTA 3ROYA 3ELJA 5BVKA 3DXNA 4FTLA 2XIZA 3OUKA 2C69A 2VTPA 2P3GX 5B2MA 1Q41A 1PXNA 1CMKE 1RQQA 1CSNA 4H3QA 4IM3A 4O0UA 4O4BB 4R5YA 3LQ5A 4DEDA 4EH5A 4C4HA 4Y46A 2OZOA 4D2WA 5AV4A 4IANA 2EUFB 3NEWA 4RX8A 2Y4IB 1ZAOA 3PXKA 5DG5A 3QD3A 1UKHA 3HA8A 4OAUC 5BVFA 2WKMA 3OG7A 5IH4A 2V5QA 3UQFA 3UPZA 3RP9A 2WTIA 3FMNA 5HG5A 4XV2A 2NPQA 3NNWA 4HVGA 4I5HA 4KUJA 4DBXA 4TYGA 2GU8A 4RX5A 3ODZX 3UOJA 4AE9A 3QZFA 4BI1A 3U6HA 2HK5A 3IW4A 4ANLA 4BTKA 1W83A 5IMXA 4O1PA 3VS7A 3PIYA 3QTSA 4KS7A 3VN9A 3DAJA 2QOKA 4HZRA 5EHOA 3CXWA 4BDIA 4BRXA 2UUEA 3H3CA 2QOQA 3O71A 3R7OA 4ANMA 5AJQA 5JN2A 5ETAA 4YZBA 4N0SA 3R9HA 2QU5A 3ZM9A 3BQRA 1PXMA 4BDHA 1ZY4A 2JGZA 2W7XA 3A99A 3GQLA 4FSMA 4JBOA 1ZYCA 5AP7A 4CLJA 1F0QA 3PA5A 2BRMA 5AUYA 2JKKA 2ZVAA 3BLQA 3ATTA 4ENYA 5CU0A 4YLLA 2HOGA 4PTGA 4P5QA 3R7GA 5CX9A 2IW6A 2VUWA 3U9CA 5I9ZA 2J4ZA 4IB1A 4QQJA 1QPDA 3KN5A 5J95A 3P08A 4ZP5A 3KRWA 3OW4A 2PUNA 3KL8A 3C5IA 4DN5A 1ZMUA 5HVJA 2XMYA 5E8SA 3CJFA 1SVGA 2W1CA 3UYTA 5EHYA 3FXZA 3RPYA 2PWLA 2C6OA 3R63A 5ANOA 3LFQA 2W5HA 3ZLSA 1MRVA 2J0JA 4O6LA 3O5AA 3VUHA 3B2TA 4AXDA 3EFWA 2JITA 3DLZA 3OEZA 3PG3A 2WXVA 3ORLA 3UPXA 5IQEA 4ACGA 3FUPA 4Y8DA 2V62A 2X1NA 4FTOA 5ACKA 3POOA 4M69B 4C62A 4GKIA 4O7NA 1UVRA 2GMXA 1H1SA 3KXXA 4NM3A 5BVWA 2F7EE 3JUHA 4M0ZA 4NKSA 5FTQA 2ITZA 2R3KA 3EWHA 5K0KA 5LMBA 3BGZA 1WBVA 4PPBA 5AX3A 4IX4A 1XBBA 1KE7A 4GIHA 4LGHA 4PDPA 5FWKK 2G9XA 3IONA 4DAWA 3EB0A 2OF2A 2QO7A 3LFSA 2VWVA 4O2ZA 4O0YA 4ZSJA 3ZFMA 1CKIA 2C0OA 3C0IA 3QHRA 3RBWA 4J99A 2BVAA 1ZOGA 4E4NA 4FNZA 2XNGA 3MGYA 4DCAA 3UNKA 3FZRA 4KD1A 4ARKA 4OBPA 2DS1A 4NJDA 3FDNA 2WNTA 3PIZA 2W1DA 3C0HA 4EWQA 2FGIA 5JH6A 4APCA 4KSPA 1ATPE 4P5ZA 4ASDA 3KVXA 4FG9A 3O8UA 3DAKA 1GAGA 5E8WA 4AXFA 2R0IA 4F09A 5A4TA 4QDVA 1J91A 2RFSA 4IAYA 4QNYA 1XH6A 4EQUA 4O0VA 4TYEA 4IFGA 2F9GA 4JI9A 4XH6A 5IA3A 4GK2A 1KWPA 1GOLA 3GFEA 3PXYA 3BHVA 3OXTA 3BI6A 5K0XA 1H8FA 3NVMB 2C6MA 2PVLA 3G2FA 5ANGA 4BDGA 5CEPA 2ZM4A 4EI4A 1JPAA 1Y91A 4RLLA 5CZHA 3UMWA 3ALNA 2RGPA 4BKJA 2XJ0A 3SA0A 4IW0A 2HW6A 4FMQA 5CEIA 4YZCA 3ZZWA 1REJA 1GZOA 3S4QA 2UW9A 1JSTA 1XH8A 3EL8A 4DEHA 1M17A 3A60A 3LQ3A 3E3PA 2HW7A 3RHXA 2ERKA 3F7WA 3T9TA 4O7YA 2FSLX 3OT3A 5HTIA 2H6DA 3WF9A 4A9RA 2NYAA 4BDFA 1LEZA 5FUTA 4HVIA 3OFMA 3AD5A 2NNWB 3MPAA 1H07A 3R73A 4TT7A 4J1RA 3KA0A 3FLWA 3PE2A 4F6WA 3R6XA 3UDTA 3KXGA 3OC1A 4GJ2A 5BYLA 3H10A 5IF1A 2OICA 4GUEA 1G8SA 1DAYA 2XNBA 1ZRZA 2C6DA 3PG1A 4IX6A 4Y72A 1KV1A 2ITQA 3ZSGA 3QX4A 1NVRA 4D28A 1YQJA 4YTCA 3TUCA 4CG8A 3EIDA 5DLSA 4BCIA 2OFUA 4C3FA 3F69A 2Y8OA 5AV0A 4Q9ZA 3TNWA 4L44A 3LFBA 3P5JC 1V0OA 2O8YA 4MH7A 4L46A 3SXSA 4LM5A 4TNDA 3U4UA 3GQIA 3ENHA 5L4QA 2QOCA 3GCUA 5FRIA 4O2PA 3L1SA 3NIZA 3E7OA 4L53A 5CNOA 5HEZA 4YHTA 4QMYA 4L6QA 4EOIA 4DGLC 1G3NA 4R5SA 3LXLA 4EK8A 3AMYA 1JNKA 3A4OX 3PTGA 3FKNA 4XP0A 3R00A 3R71A 2JDTA 4GH2A 4YLJA 3UTOA 1BL6A 2WMSA 2WPAA 4F65A 5M4FA 3F2RA 3QTWA 2JDSA 5JKGA 2XM9A 4U0IA 2E9OA 5A54A 3SW7A 2WOTA 4E5WA 1RW8A 2QHMA 3GCQA 2BCJA 4JBVA 3WARA 4XP2A 1R1WA 1GIJA 4UXQA 5CT7A 2CKPA 2J5EA 3F3TA 3F5XA 4P90A 4S34A 5LOHA 3LCDA 4JAIA 4ENXA 4ZS4A 2WTKB 5B2KA 4IZAA 4LUDA 4AG8A 2ZOQA 3OCGA 3R02A 3W2PA 1PXLA 3EQPA 3NCZA 5E1SA 2QHNA 4AA0A 2C6EA 3NS9A 1M14A 3IKAA 3NUUA 4L67A 4V04A 3TCPA 5CSVA 3FZPA 4M68A 5EDQA 4R7BA 2ZV9A 2R3OA 3K5UA 3QZHA 5A46A 4DFNA 3WF6A 4RJ7A 2YDKA 4OTDA 4GIIA 1Q8ZA 4MXCA 4NIFA 4M12A 4NW5A 4TN6A 3RHKA 3V5QA 2XIXA 4YJVA 4QP4A 3UODA 3ZRLA 4CRLA 4E7WA 5HVKA 2C3IB 3QKLA 4CZUA 3ORNA 4O21A 2EB2A 2X7GA 3A61A 4EOJA 3L8XA 5TR6A 4QMUA 3V3VA 2R7BA 4WD5A 2A2AA 2X7OA 4UYNA 4RC3A 3CQEA 5DEWA 3RI1A 3MY0A 5IA2A 2GPHA 1IAJA 2I0YA 5G6VA 3HV4A 2YISA 3H9FA 3QQLA 1Q4LA 4FNWA 4L3JA 5D10A 5DN3A 2FH9A 3KRRA 2VWWA 3PPJA 1JKKA 4O0SA 4V01A 5BMSA 4HZSA 4Z16A 4B8MA 3R28A 3UQGA 3ZONA 1CDKA 2C4GA 5FM3A 3VBWA 4RA4A 3TTJA 4BI2A 5IH5A 4M7IA 5G1XA 5GJGA 4CKIA 2YM6A 2W9FB 4BCOA 4ZMEA 3NYXA 4TTHB 4BCPA 2OJ9A 5JRSA 5TO8A 4Q2AA 4AQCA 4CQEA 1QPCA 3DY7A 2W96B 3NZ0A 5CWZA 5EM6A 1YVJA 4WNMA 5L6WL 3W10A 2ZAZA 3QXOA 3QTUA 4BHZA 1UA2A 4EKLA 5CU4A 2UW6A 3IS5A 3L9PA 1PW2A 5GIPE 3C4EA 3C50A 3CGFA 3BELA 3L9LA 3ZFYA 3ZO1A 2X39A 3GGFA 4LQMA 4HCVA 1DS5A 3ZUUA 4UMUA 3C4XA 5HD4A 4MEDA 1LPUA 3H0ZA 5C4LA 3KF4A 4NL0A 4RIYB 2ITWA 2NO3A 5DMZA 3C4FA 2HXLA 4X2JA 5CSPA 4F9AA 1WBPA 2YACA 4HGLA 4MXZA 3GI3A 4AA5A 3COHA 4PY1A 2GFSA 1H0WA 3IW5A 3BL9A 1W98A 1OL1A 3FV8A 4ANSA 1OUKA 2QURA 2V55A 2R3FA 4BCFA 1XJDA 4PDOA 1H28A 3R9DA 5IUGA 3V5TA 4OUCA 4UZDA 3P0MA 3MFTA 3GP0A 5HG7A 5EYCA 3W2QA 4ASZA 4FV9A 1CM8A 1JKLA 4LOOA 1YXUA 3PA3A 2PVFA 4W4VA 3C13A 4J7BA 3FSFA 2BMCA 2C5NA 1B38A 2P2HA 5CVFA 4FKOA 4BY9E 2ACXA 3BPRA 1FPUA 3IDCA 4I6BA 4RVLA 3BKBA 3DFAA 4AU8A 3DZOA 3ORPA 3TDVA 3SAYA 5AUVA 5HQ0A 4QTDA 3QXPA 5J87A 3N9XA 4QTEA 4IJPA 5LVNA 5CVHA 5AV2A 2VD5A 2OJIA 4EHZA 4D1XA 2A27A 1UNHA 5L6OA 1R39A 4DINA 1Y57A 4K9YA 1P5EA 4IMYA 4ZSEA 3SRVB 5K9IA 2OIQA 3QFVA 4DTKA 1WCCA 3W2CA 3GOKA 3I4BA 4EOMA 5JT2A 3EYGA 4I21A 4WNPA 4FT5A 1XH4A 3ODYX 2R3GA 3UOKA 3QTXA 3UOHA 3Q6WA 3D7TB 5FBOA 5FQDC 5J1VA 1APME 4YLKA 4EZ5A 1TQMA 2HZIA 4WIHA 4Y5QA 2BHHA 3CP9A 2B0QA 4AW2A 3F7ZA 3CY2A 3R22A 3ORTA 4QYHA 5AP5A 2J0IA 2H8HA 3N4TA 3FLYA 4J97A 4MQ1A 4UYAA 2R9SA 2PVHA 3U87A 3F9NA 3BLRA 3QQUA 5BMMA 2UW4A 4QMOA 1I44A 3E63A 3R01A 4UMTA 3Q53A 4DE4A 4DDIA 2BFXA 5AFVA 4CD0A 3S0OA 2ZB0A 3MY1A 1S9JA 3ORIA 3HMPA 4YU2A 5HORA 5BUIA 3AC1A 5GHVA 4YP8A 1DI9A 4G34A 4F9CA 4TW9A 1J7IA 1HCKA 3BBTB 4QD6A 4TZRA 3R1YA 2CN5A 4I6FA 2GSFA 3UP2A 3VS1A 3DCVA 2C30A 5HG8A 3OMVA 3QD4A 1O9UA 3MFRA 4CFFA 2YM5A 2UZLA 3QTIA 4FKPA 4DFZE 4DT9A 1UWJA 4QMMA 4IWDA 4AN3A 2WAJA 4D9UA 3P7BA 5M08A 5HTCA 3PUFC 3EQCA 2X0OA 4U6RA 4XG4A 3TL8A 4X21A 5IEXA 4BYJA 2BR1A 3CQUA 4KS8A 4LMNA 2PUPA 4XOZA 3LE6A 3IPHA 2ZFYA 4R77A 2Q0BA 2Y0AA 3VUMA 2X8IA 2XZSA 4CG9A 3D5WA 5BQ0A 4I6HA 3OTVA 3CTHA 4FZ7A 5JMSA 3HEGA 1VR2A 4PX6A 4R3CA 4M67A 4NKAA 3DTCA 4RIWA 2UZVA 4XNEA 5M4UA 4G31A 3NX8A 4D58A 5JFWA 4NCTA 3Q60A 5BVOA 5HU9A 4RWKA 3VHEA 5IQGA 4ANQA 1UU3A 3KU2A 3FZSA 3C4ZA 3IOKA 4HGEA 5D11A 3NCGA 5AP3A 5FTOA 3FMKA 3SOCA 4CFUA 3AD6A 1YOMA 3KFAA 4FIEA 4MXOA 5HNBA 4BKYA 5JGBA 3QC4A 2ITXA 3BU5A 4AA4A 2CSNA 3CS9A 3G5DA 2WIPA 1O6YA 4C38A 3N4VA 3EFJA 4MF0A 2F4JA 4D0XA 3AD4A 5ANDA 5LCJA 3MYGA 2ITOA 2YITA 3AC5A 4FV7A 4MTAA 4BF2A 3RK9A 2R3JA 4YR8A 1BUHA 4TYJA 4Y83A 1Y6AA 4YJNA 3PWYA 3R9RA 4C7TA 2XBAA 3HNGA 4D2SA 1H26A 2RFDA 2VAGA 4YC6A 4C59A 2A98A 3RCDA 3ALOA 4BIEA 3GU5A 4P7EA 4PQNA 4K6ZA 3SD0A 4I93A 3LCOA 4X3FC 1OBGA 3AC4A 2W1FA 2RF9A 3OCTA 4HW7A 2W1ZA 2WMAA 2ETMA 2X0PA 3TG1A 3ETAA 3ZYAA 3EN6A 2YAAA 2AC5A 3PY3A 4FL3A 3KXMA 1KE6A 4II5A 3H0YA 4XG9A 2Z8CA 4PMSA 3DFCB 2OFVA 3O7LB 5IPJA 4A7CA 1YKRA 3HV5A 3EQDA 4YGAA 1UV5A 4QMWA 3CC6A 1S9IA 3VAPA 4C4FA 4UB7A 3NRMA 4FRFA 4DG0E 4KRDA 4F70A 3MVHA 1ZOHA 3T8OA 3OT8A 3TNIA 4O27B 5DH3A 3HRCA 4M14A 3TNQB 3TZ9A 4PTEA 3R8UA 3JR1A 4FR4A 4OT6A 3QTQA 1H1QA 1U59A 2XB7A 3QU0A 3IECA 4IX5A 3D2KA 4WRSA 3AGMA 4ZLZA 3VS3A 4BVUA 4UN0C 2VO3A 4DFYA 4CZTA 1U5RA 4PF4A 1UNGA 1YDSE 2O5KA 2PHKA 2YZAA 4R7IA 4FTJA 4YO6A 3VW6A 5C26A 2B55A 4G5JA 4LL5A 1OPJA 4GT3A 4OR5A 3HV6A 2X9FA 4O4EA 3FL4A 4JNWA 4FZFB 4CMOA 4LMUA 2PULA 5D7VA 3BX5A 4O96A 3QA0A 4I6QA 3HL7A 3QUEA 3HAVA 3ZCLA 4C57A 3RAIA 4BWKA 1ZZ2A 2IVUA 4IVDA 4MD7E 1ZWSA 3FLSA 2C3JA 1H24A 3EJ1A 3IW8A 3QTRA 2J5FA 4BCNA 4AQKA 3ZUTA 4L9IA 4APPA 2ITTA 2RIOA 3S2PA 5KZ0A 4ERKA 4UWCA 5GNKA 5HLNA 5E4HA 3RM7A 4RC2A 1PKGA 4IB5A 4ALWA 1RDQE 4WBBB 5DR6A 3FI8A 3KXZA 1BX6A 2VTJA 4K2RA 1MQBA 3BHHA 2BRHA 1JSUA 4HVSA 3FHIA 1OGYA 4O81A 3MVJA 4AACA 3G15A 2X2MA 4X6RA 4WSQA 2QLUA 4QP3A 2JDOA 3VHKA 5EM5A 4CRSA 3ZSHA 1WBWA 5KMOA 4A9SA 3OD6X 5KO1A 4CCUA 4MNFA 2GCDA 3E62A 4BZDA 3NUXA 4GSBA 3EFKA 3KXNA 3R2YA 3CJGA 4IWQA 4I1ZA 4L3LA 2C0IA 3RPSA 2OGVA 1ZOEA 3AGLA 4F6UA 4BIBA 2WTDA 1E1VA 5EOLA 4BCKA 3DS6A 3A7FA 4F7SA 3PP1A 4UMQA 3W33A 4OLIA 3W16A 3LCTA 4IVBA 5HU3A 2CPKE 3CR0A 2YCFA 4G3GA 1H1RA 2XM8A 3FMDA 3DPKA 4O91A 5TT7A 3LFAA 3EQHA 1H01A 3EFLA 3QLGA 4PP7A 5HLWA 2PMLX 4S32A 3LCKA 3TKHA 2R64A 3GC8A 4JIKA 4WBOA 1FOTA 2QG7A 1UKIA 3RK7A 2F7XE 5A4CA 1ST0A 1XH5A 3C5UA 2XRUA 2XEYA 5KX8A 5C03A 3JY0A 2HZNA 2V0DA 3KY2A 5CZIA 5M51A 4RQVA 4EONA 2W1GA 1L3RE 3FPMA 4E6QA 3TV6A 1ZZLA 1K2PA 2B4SB 2VV9A 1KE8A 2WTVA 2R4BA 1M7NA 5DE2