3TNSA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester inhibitor sg83
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of SARS-Cov main protease complexed with a series of peptidic unsaturated esters
rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SARS coronavirus main protease
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3tnsA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tnsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tnsA02
1DICA 1HPGA 1W14U 3LH3A 1ZSLA 1RTKA 3HK3B 1UTNA 3BG4C 3HPTB 4LOYH 1GMDG 2ZHQH 5DGJA 3P70B 1C1UH 1J16A 1RTLA 3V12A 1HAOH 1D4PB 3P8GA 2OCVB 1C1PA 1SQOA 3QO6A 2ILNA 3ZVGA 3SO3A 1V2UT 3IITA 1O2XA 1TPOA 2JH5D 3DUXH 1G3EA 3RP2A 4O3UA 1A3EH 4YOGA 3SJOA 4XFQA 4GAWA 1WTGH 3RXAA 1V2KT 4GCHF 2P8OC 4F49A 3TGKE 1LO6A 4ZKRU 3DFLA 3BEIB 3ESTA 2UWLA 8LPRA 2VB0A 4UFGH 1ELBA 2TPIZ 4YOJA 1UTKA 4JZIA 4YESB 1RGQA 1OP8A 4X8TH 1CA0B 4Y7AA 4UONA 1RIWC 2FPZA 2OP9A 2OC0A 2ZPRA 1TBQH 4HFPB 3VB7A 1CU1A 1NRQH 3PYHA 1O32A 1TFXA 2OBOA 2BMGB 3K6YA 3NCLA 2ZTYA 1EQ9A 4UDWH 2V6NA 1Y3WA 4INHA 3RC6A 1BMNH 1ZR0A 2VVVA 3LU9B 1OPHB 2BYAX 3MO6A 2GX4A 1C4V2 2ZFFH 3ZZ4A 4GUXA 2XCFA 1TAWA 1GHWH 4MLFB 1TNJA 4BOHA 5JBCS 1UO6A 4VGCC 1VGCB 3E3TA 1DLEA 1TRNA 3LDXH 3DHKH 1ZJDA 1V2PT 1D9IA 1QBVH 4INLA 4B2CA 2ZA5A 1P12E 2VVUA 5LPRA 2BLWA 3MTYA 1GL1A 4Y8YA 5FCKA 1O5CB 1ZTLA 5L6NH 1PPBH 2PWXA 1ELDE 1P2OA 4X8UH 4JYTA 2VH6A 1ZSJA 1O2OA 1X7AC 4H6SB 1TNIA 4MPVA 3ZZBA 2OTVA 1TMTH 3FP6E 2TGDA 1QIXB 3NZIA 1DANH 1YPEH 4JMYA 4SGAE 3VGCB 4FUHA 3RXTA 1C1SA 4BXWA 1J9CH 1TPAE 2P3FH 2VNTA 2ZTXA 5FX6A 1AZZA 1BHXF 1GMHF 1UCYE 1SGCA 1ZOMA 2RA3A 2P93A 5FX5A 2F9UA 4KELA 1MKXK 1TPSA 1HV7A 1P09A 4MVNA 1A3BH 4MDSA 1C1MA 4CBOA 2XC5A 4JYVH 4X1SU 1C1NA 1LTOA 2ZCLP 2ZWLH 1VZQH 4UD9H 1N8OB 2UUYA 1OP2A 2Y6TA 3U9AH 1O37A 5JBBS 1SI5H 2OINA 2ZKSA 4A1TA 1VJAU 4INKA 3E16B 1O2VA 5DP6A 2FOCA 3HATH 5C5NA 2CGAA 2HVXA 1SFIA 1CT0E 1GI1A 3BTTE 3MH5A 2ZEBA 2TGTA 1A0HB 1CA8B 1HAVB 3UREA 4X6MA 4A1VA 1S85A 1TBRH 2XC4A 4CHAB 2RDLA 4I31A 3K6ZA 3M5MA 4IGDA 2ZECA 2UUKB 3LGUA 2PKAB 4D9RA 5DJ7A 3MNBA 1G3DA 5I46H 2AERH 1NTPA 2P59A 1K1IA 1P9SA 1BCUH 1C5SA 4AG1A 3I78A 1AHTH 1NFUA 1D3DB 1INCA 2D2DA 1AVXA 4J2YB 1GI5A 1GI2A 5C1UA 1BRAA 1FJSA 1BBRK 2FEQH 4WVPE 2C3SA 1HJ9A 2LIZA 1FY3A 1YPLH 2P3TB 4DW2U 4AOQA 3BTME 1W11U 5EPYA 1BMAA 2FI5E 4B1TA 3A81A 3LJJA 4ABFA 1XVOA 1BZXE 2NU3E 3BTHE 4CR9A 1BTZA 1ZPCA 1FY1A 2GDDA 3ZZCA 1AB9C 1ELAA 1AFEH 4K1TA 1IQIA 1YCPK 1QQ4A 3RXCA 1AKSB 3U1IB 2F9VA 1RD3B 3MNXA 1EOJA 1TLDA 2OQ5A 1QQUA 1O3KA 3B23B 3VXFH 1EZQA 2FS8A 1BTYA 1EAXA 3RXMA 3BTFE 2ZZUH 1BQYA 2G55A 2WINI 3SV7A 1HJAB 1SG8B 1QBNA 3M3SA 1Z8GA 1IQEA 4NIWA 4GHQA 4I8JA 5F6MA 3WY8A 4NGAH 3QDZB 2VIVA 2ALVA 1ARBA 1CGHA 3P6ZB 2GCHG 1MQ6A 4I7YH 3SUEA 2SGQE 3PB1E 3GY4A 3A89A 3GCTF 5EQRA 5DP5A 1T4VH 3F9EA 2YNAA 3UR6A 1G2LA 2G51A 4KGAA 5CE1A 1IAUA 1NFYA 1PQ5A 2Y7XA 1FDPA 3CS0A 3UQOA 2CN0H 3RXQA 1SQTA 4Y11E 2HNTE 3MU0A 2SNWA 5GCHF 2Y81A 3UPEA 5HYOA 6CHAB 2P3UB 1BRBE 3GDVA 1T31A 1W10U 2P95A 3I29A 4JZFH 1QR3E 3SU3A 2BQ6B 1SGPE 3M35A 1NRRH 2BVRH 1UTOA 2K1QA 2FM2A 4KKDA 3ZZ5A 1B7XB 4Y76A 1QNJA 2QXGA 4UE7H 2Z3CA 2GV6A 1EX3A 5ETXA 2QY0B 5EGMA 1DX5M 1G37A 1GBTA 2JETC 1QB1A 3E6PH 4Y8XA 1P05A 1BOQA 4X1NU 3NPSA 1GCTC 3MMGA 3A7VA 4NA7A 3GDUA 1Y3UA 1CVWH 1UTLM 4Q7YA 4A7IB 3AW1A 3T25A 1O2IA 4BTTB 3FP8E 1P57B 3RXUA 5FBEA 2FOBA 3ATWA 2D26C 1ZTKA 2BDHA 2BDYA 1OKXA 2HWLB 1NFWA 1SFQB 2B7DH 4NZLA 3FZZA 1DY8A 1MKWK 1O31A 1AFQB 4JZEH 1C5OH 2CF9H 3B8JA 3ZZ8A 3GY8A 1RJXB 1MQ5A 1Y3XA 3UWJH 2FOEA 3CS7A 1KXDA 2GTBA 4MNXA 3GCHC 5F03A 1O2JA 3H5CB 4BAQB 1F7ZA 1DWBH 2H6MA 1TNLA 3LGTA 3S0NA 4B2AA 1O3NA 1FAKH 1P2IA 5C2ZA 3O8CA 2FIRH 1DE7H 1ESTA 2IPHA 1DWDH 1ZRKA 4FUIA 3S9AA 3LC5A 1ELCA 3KCGH 4OGYA 1SOZA 1C2EA 1DT2A 1Y59T 2R3UA 3PMHB 3MNCA 1OOKB 5BPEA 3NK8A 1P3CA 3VB3A 1PYTD 1W0YH 2STAE 1UTJA 4Q7ZA 5FCRA 2P8OB 2XC0A 5FPYA 1TOMH 5A09A 2Z94A 1QB6A 1K1JA 2V35A 3OSYA 2H9HA 1A1RA 1T8MA 1ARCA 5E0HA 4IW4E 1FNIA 2BD3A 2C8WB 1F0TA 1B5GH 2KAIB 2JKHA 2GT7A 1AE5A 2HGTH 2FYRA 1KLJH 1KLIH 3ZVAA 1C1OA 2GT8A 2PFEA 3GCHB 4NWLA 3SU6A 1TGSZ 4LXBH 1OXGA 1IQKA 1ZYOA 1T32A 1WBGB 2B5TB 3GY7A 5FPTA 1QBOA 4DVAU 2FS9A 2VWMA 2QXHA 5HM2A 1TABE 5EXLA 1GDUA 2VVCA 1QJ6B 2NWNA 1O34A 1SGFG 3TVJB 4ISIH 1QJ1B 4JZDH 2QAAA 4O9VA 2YNBA 4BTIB 1ZRBA 3SQHE 1O5DH 1V2NT 1GI0A 3ZV9A 3SNEA 4D7GA 1G30B 1JRTA 2AMPA 1L1GA 7KMEH 2AFQB 2G8TA 3ZYDA 1YPMH 2WPMS 2TGAA 4Y6DA 2VU8E 1ETSH 1GDQA 3URDA 1O2PA 1GHAG 4X0WU 4DT7B 1SGTA 3SJ8A 3KF2A 2O8LA 3PMAB 3U1JB 2QIQA 1H1BA 3SV2H 4U32A 3T28A 4NSVA 3GISB 1MMJN 1EATA 1ANBA 1D3TB 2FOFA 1MZAA 4WWYA 2ALPA 3A84A 5GDSH 4ABAA 1FXYA 4TPIZ 2VIWA 2ZTZA 3GCOA 1IHSH 1KLTA 3AAUA 2FLRH 1O5GH 1J14A 1CO7E 1L0ZA 1MAYA 2ZNKH 3FP7E 1WCZA 4K5ZA 3TITA 1HLTH 1BRCE 2BZAA 1GBLA 1NM6A 3E8LA 2WUCA 3GY3A 5JPMH 3IG6B 2A2QH 1Y5AT 1ANCA 2ZO3H 3SV9A 3TNSA 1SBWA 1NY22 3BSQA 2R2MB 2CMYA 1OSSA 4YM9A 2Y82A 2ZGHA 1FONA 1SGRE 1ELTA 3TPIZ 1Q3XA 3R3GB 5BRRE 3TGIE 1PYTC 1PPFE 1TALA 4AZ2B 4LZ4B 1EXFA 1P2NA 3SW2B 1TX6A 1V2OT 1WTHD 4X1RU 1KYNA 1HXFH 2W26A 3Q3XA 2GP9B 3PWBA 4WY3A 1T8LA 3FANA 3BTQE 1SGDE 2HPQH 4E05H 2BZ6H 4CBNA 3GY6A 1DITH 3SJ9A 3PWCA 3JZ2B 5C1XA 4SGBE 1GI9B 3M37A 3LIWA 2ODQA 1QY6A 4ZROA 2A1DB 2BVXH 1BTUA 4HGCA 1LVYA 1O3IA 2QYIA 3FFGA 2ANMH 2GDEH 3E91A 2GCHF 4XBCA 1UTPA 3U69H 1FI8A 1EASA 4BANB 2TIOA 2A45B 1BT7A 3QZRA 1PPGE 3SNBA 4ABEA 1CBWB 2SFAA 1IQFA 1W8BH 3BTKE 1P0SH 1GJDB 3UY9A 3UFAA 2GMTB 1IOEA 3MH7A 2ZHWH 1JIRA 3TNTA 1AE8H 2XTTB 1EP5A 1O3GA 1O33A 6GCHG 4OS5A 2R0LA 1P2QA 2IN2A 2ZGCA 1GBFA 4ABHA 3ELAH 1V2WT 3A82A 1HCGA 3E90B 3QTVH 2V3OH 1ZPBA 1EPTC 3PM3A 2BLVA 1C2MA 3MNSA 4YLUA 2ZFRH 3KQEA 4WJG2 3RXBA 1MAXA 1UVOA 5E2OA 3UUZA 3MU5A 1CT2E 1UHBB 4CREA 9ESTA 1S82A 1YYY1 4LZ1H 3W94A 5AVDA 3A7TA 1Q31A 3HGNA 1G2MA 5DKMA 3HKJB 2FX6A 3RXFA 5IDKA 1GBCA 2TGPZ 2W7UA 2WPKS 2H2ZA 2D1JA 4VGCB 1MKWH 1LQEA 2A4RA 1EAUA 2WV4A 2Z3EA 1XUJA 3A85A 1TNKA 4X1QU 1SVPA 3D23A 1LQDB 1WV7H 3L3TA 1TX7A 3M5OA 1V2RT 4XE4A 2A31A 3RXSA 1V3XA 2AIPA 1P2KA 3K9XB 1XX9A 1XM1A 3Q3YA 3RU4D 3RXPA 3QWCH 4B76A 4AFSA 2A5AA 1WYKA 1ELGA 2ZU5A 1UMAH 1NC6A 1TYNA 4ABJA 5JDUB 4FU7A 2F91A 1O3BA 1OX1A 1SR5C 2F9OA 4BTUB 2ODPA 3OTJE 5A0CA 1HBTH 2VWOA 2JETB 1YPJH 1TQ7B 5G4BA 3E0NB 2Z9LA 1TX8A 4K3JA 2WPJS 1MBQA 1T8OA 1L1JA 2FX4A 3M7UA 2ZFPH 1O38A 1Z8JB 2OC7A 1OYTH 3Q3KA 1OYQA 5HMAA 1QRXA 4IBLH 1V2VT 4ZKSU 1IHTH 3BTEE 1O2YA 1T8NA 2PV9B 2V3HH 1V2LT 2ZU4A 5DP8A 1XUFA 1HAYB 1IQMA 2P16A 3DFJA 2A5IA 1MTWA 1GJBB 2Z9GA 1ZTJA 2OLGA 3ATIA 4NIVA 3GOVB 4ABDA 1AMHA 1ZMNA 2XYAA 1FIWA 4Q2KA 3T29A 1SGEE 1PPZA 1GI6A 3KQCA 1BJUA 5HM9A 1QCPA 2XCNA 1N8OC 1QL7A 1YLCA 2FYQA 2PW8H 2WPIS 1SGFA 3GY2A 3Q77A 2WYGA 2VWLA 3M7QA 1O2GH 5AHGH 4AG2A 2HOBA 5L30H 3E1XB 1Y5UT 3RMOH 5HXFA 3SU0A 1XUIA 1K22H 1YPGH 1BA8B 4AGJA 3S9CA 1GJ4H 3PV4A 1MD8A 1Z8RA 2FODA 1DUEA 4I8GA 4CRFA 1AUJA 4OS2A 1LVMA 2GMTC 3PLKA 3KN2A 4NCYA 4AB9A 3MU1A 1NS3A 1TOCB 1W12U 3ODDA 1FAXA 3QGNB 1MBMA 2J95A 3KL6A 4QT8C 3SGQE 1Z6EA 2TBSA 1F2SE 3A88A 3FVFB 1N6XA 1ZJKA 1O2KA 1PQAA 5FPSA 2PGBB 1K1PA 5LPEA 2NU4E 1UVTH 4GCHG 1SMFE 1YF4A 1A4WH 1YPHC 1LVBA 4ZAEA 1UJ1A 3N7OA 1MUEB 2BDAA 3GCTG 1SLVB 4Q7XA 3BEUA 2AMDA 3LOXA 2G52A 2J94A 1PPCE 1FIZA 5EPNA 1ESBA 1HAHH 4YT7H 2BQ7B 3BV9B 2FTLE 4IN2A 2XBXA 4GSOA 4DG4A 1C5UA 3LPRA 1GHBG 1TMBH 2VIQA 2Y5FA 1DUAA 4YTAA 4HI3A 1FY5A 1SGQE 1LPZB 1JIMA 1JMOH 1D6RA 2ODYB 3RXKA 1E36B 1FN8A 2ZHDA 4WMEA 2ZHFH 2RCEA 2G81E 1C5NH 1VJ9U 3TK6A 3F9GA 4XDEA 2AGEX 4NWKA 3ZVCA 1QA0A 2O8MA 1EUFA 1C5MD 1SPJA 1EJAA 1VITG 2QXJA 1TPPA 2PSXA 2FOGA 3SGAE 1ELFA 1MTNB 1GMCG 1HNEE 2SGEE 1PQ8A 3TJNA 4FUEA 2GVFA 1WQSA 4NFFA 1WOFA 1HAGE 3LGYA 2FDAA 2D8WA 1YBWA 1EZXC 1GBAA 3NWUA 1F5LA 2XWBI 3QZQA 2C93B 2V0BA 3P95A 1BBRH 4DIIH 2A5KA 4X8SH 3M61U 3MU8A 3MO9A 3TK5A 3RU4E 3A7ZA 1HAXB 2FOHA 3SUDA 1KXEA 3SN8A 2G5VA 1P02A 4X8VH 3IWMA 2ZDVH 4FUFA 1KY9A 2EEKA 1QHRB 2VGCC 4OS1A 2Y5HA 1GVZA 2SGAA 1HIAB 3SGBE 1J8AA 1WUNH 1J17T 1JWTA 2BOKA 4U2WA 2QGRA 2G4UA 3S9BA 2J92A 1GG6B 5K0HA 2ZFQH 4E7NA 3D65E 4D76A 1P10A 3A8CA 3LGWA 3SHAH 1GJAB 3SNAA 1HDTH 3SI3H 5A2MH 3LKWA 3AASA 1YCPM 1IQNA 2H1UA 5PTPA 3BTWE 5E8EH 4ABBA 1KIGH 6GCHF 1DXWA 3OY5U 3T26A 1KDQB 1GBJA 3EA9A 6CHAC 3SI4H 2BX4A 1VR1H 2BD4A 2BVSH 1MKXH 1WSSH 1K1MA 1KXAA 4WMFA 1O3FA 3K65B 1V2JT 2PGQB 2H5DA 2BXUH 1Z71A 4IMZA 1P2JA 1QRZA 1TGTA 2ZU3A 5ABWA 4B73A 4TWWA 1N6YA 4K1EA 4CRDA 3UTUH 1LVOA 3MFJA 4A6LA 3D62A 2HPPH 1EPTA 4IN1A 2NU1E 4Y71A 2ZGJA 3GICB 1XVMA 1A0JA 1HXEH 3UQVA 3SOSA 4ZUHA 4J1YA 2PKAA 1QL8A 5L2YH 4B74A 1FY4A 2PUQH 2GKVE 1DS2E 1PJPA 1O2SA 2XBVA 4DGJA 5LPFA 1LDTT 3STJA 1DWCH 2FWWA 3PLBA 1GVKB 1QL9A 3UIRA 4AFQA 3RMMH 1D3PB 4LK4A 2DE8A 3GDSA 4YO9A 5EODA 1W7GH 3GY5A 5C5OA 1MU8B 1Y3YA 5CHAC 1K1LA 1NU7B 1SGNE 2ZQ2A 5L2ZH 1UK3A 2DE9A 1SHYA 1ZSKA 3E0PB 1P03A 2BD7A 1OWHA 5LH8A 2PKSC 4ASHA 3PO1B 1AU8A 4MQAA 2QXIA 5GJ4B 1FLEE 1XUGA 4BNRA 2Z9JA 3ATMA 1C5YB 2BX3A 4H4FA 3S7HB 3PO1C 3V7TA 2PTCE 3ZVDA 2Q6GA 1ORFA 2O8UA 3TU7H 1PPHE 4ESTE 1NO9H 1O2WA 1O5AB 3RC4A 4Q80A 1FV9A 2AYWA 2GZ8A 1FY8E 5AFZH 3TGJE 5GWZA 1MTVA 3DD2H 1TA6A 1EP6A 1TWXB 2HNTF 1C1RA 1SSXA 5EG4A 1TB6H 1TA2A 1FN6A 4FUDA 3EBNA 2EC9H 3JZ1B 2HNTC 1LHGH 1A5IA 3MI4A 4O97A 1W0ZU 1GBIA 1C4Y2 5A0BA 2R9PA 2ASUB 3KHVA 3A7XA 2ZQ1A 1T4UH 2AGGX 1LKAA 1C5VA 1NN6A 1A7SA 2BXTH 4H42U 2AIQA 2ZG0H 5T6DA 4E06H 3VB4A 1E38B 1P8VC 1TGBA 1YC0A 3ODFA 2XBWA 4FVDA 4Z0KA 4FUCA 3RXGA 2VIDA 3RXIA 3A83A 4XBDA 4PROA 1QTFA 1C5LH 3URCA 2GCTB 4H6TA 1K28D 1XUKA 4CH8B 1C2GA 1O3HA 1DXPA 1TGCA 1C5RA 1TNGA 3SJIA 1NRPH 5TJXA 4NIXA 3RU4T 2VWNA 1FQ3A 3KGPA 4F4OC 1G3BA 1TRYA 4ZHAA 1KXCA 1GBDA 3A7YA 2C8YB 1KTTB 5C20A 1ZPZA 4CRCA 1MD7A 4A1XA 2ZPQA 3SNCA 2RA0A 4DOQA 1RRKA 3T27A 4NIYA 5JYIA 1XXFA 1GPZA 3SU2A 1T7CA 1GHYH 5A8YA 1O36A 2ZU1A 3S69A 1EB2A 4DJZB 1K1OA 1QGFA 1E37B 1BBRE 1K9OE 5F8ZA 1HGTH 5EU8A 3VB5A 3KEEA 3ZZ3A 3LGIA 4M7GA 1OWEA 3RXHA 1GGDB 3PMBB 4Y7BA 3RXDA 4CH2B 1BHXB 2PLXA 4E7RG 5JB8S 4K60A 4B71A 2Y80A 3HGPA 1EJNA 3QLPH 4TWYA 1GVLA 5SGAE 1BTPA 1TE0A 1AZ8A 5DP9A 1C5XB 3STIA 4ZKNU 1C9PA 4DCDA 4D8NA 1AUTC 5TCAA 2SGFE 1ZHMA 2FESH 1YGCH 2BY9X 2I6QA 3O8BA 3FZDA 1O5FH 3TIUA 1VCWA 1DLKB 3BN9A 1F0SA 1CSOE 2GZ9A 1H8DH 2VINA 1AWHB 4OS4A 1C2KA 3KQDA 4KP0A 2OC1A 3MHWU 4FUGA 1ETTH 2OC8A 2ZGXH 1BMLA 1TQ0B 3RMLH 1AO5A 3ZV8A 1CA0C 1HUTH 3MH6A 2QN5T 4ISLA 1SOTA 1ZLRA 2BQWB 4WXVA 1M9UA 2XBYA 1S5SA 1CE5A 2UUFB 1W2KH 3HK6B 1F5RA 1TONA 1P04A 1C9TA 3W95A 3ZVFA 1K21H 4OGXA 1C5TA 2Z3DA 2FI3E 3Q00A 1V2MT 4K1SA 1UK4A 1FPHH 3D49H 1DM4B 1GHZA 3SU4A 4IMQA 1VGCC 5I25A 3ITIA 2TRMA 3QGJA 2BLQA 1O2ZA 1PPEE 3T2NA 1GBEA 2J4IA 4UFEH 1EKBB 1S6FA 3RUOA 2YOLA 2LPRA 1SB1H 4GVUA 2C4FH 1C2LA 1GJCB 2ZCHP 1SLXB 3AAVA 1SGIB 3MH4A 2F83A 5DG6A 1QJ7B 2H9EH 2VIPA 3S7KB 3SU1A 3U8RH 1CHOG 4YOIA 1GL0E 1GBMA 3M3VA 4MNYA 1GHXH 1BTXA 1GBHA 3EGKH 4K8BA 1ZMJA 4Y0ZE 1H9LB 5JBTA 4NFEA 1W3CA 1GJ9B 5DPAA 1YP9A 2PSYA 4ZKOU 1FUJA 1KTSB 4FU8A 3V3MA 4I33A 1BIOA 1O3DA 4XSKU 1GWAA 8GCHG 2F9NA 1GGDC 1O2UA 2G00A 1QA7A 3U8TH 3SV6A 2VJ1A 4TYDA 1HAIH 1S83A 1EB1H 1IQLA 1DPOA 3TH3H 1Y5BT 1BJVA 4IS5A 5T6FA 4B75A 1ETRH 1O3PB 1C1QA 3K2UA 1HJAC 1YCPH 2PR3A 5DP4A 1EZUC 5CHAB 3RXJA 4ABIA 1DOJA 4K8YA 1KXFA 2FI4E 1ACBE 3P8FA 3VXEH 1O3MA 2HALA 1HIAA 1MCTA 3A86A 3F9HA 1BUIA 1V6DA 3BG4B 2XNIA 1GG6C 5DK1A 1E34B 2W7SA 1Z7KA 1KSNA 1S6HA 1MU6B 3F6UH 2A7JA 4NG9H 2QA9E 3M5NA 1SL3A 2GGVB 6ESTA 5E2PA 1P11E 2UWOA 5FAHA 3SHCH 4Z6AH 5FHTA 1WQVH 3SV8A 4YT6H 1C4U2 2LNCA 4I8KA 3PLPA 4CRGA 1GBBA 4ZXXH 4RSPA 3NXPA 5T6GA 2DUCA 2BD8A 5JB9S 1DDJA 1W7XH 9LPRA 1W13U 2HLCA 2GZ7A 7GCHG 2BD5A 1S0QA 5F8TA 5K7RA 1RS0A 4WF8A 2OXSA 2Z6BD 4MPWA 3NKKA 4A5TS 2UUJB 1O3EA 3SBKA 1HYLA 3PROA 1LHFH 4JK5A 3UNQA 1GHAF 2JH0D 1A61H 3VGCC 2J38A 2WV5A 2WPLS 5H4IB 3RXRA 1V2QT 4Y8ZA 2WYJA 1RFNA 5A0AE 4X6OA 1OS8A 3VB6A 1CQQA 1ID5H 3BIUH 2NU0E 4YLQH 4TPYA 4DURA 2P94A 4FUBA 3AW0A 3BEFB 1L2EA 4AFZA 1A5GH 5J4QA 1OWDA 4UEHH 4MPXA 3TLOA 3VPKA 1FPCH 3P8NA 2GV7A 1O2LA 2ANWA 1DWEH 1HAZB 4WH6A 2ZCKP 3TJVA 3EDXB 1L4DA 2OQUA 3I77A 3ZZAA 3GCNA 1G3CA 1O3AA 1S81A 1NU9A 1NESE 3QUMP 1YPKH 4Y10E 1AVGH 1AKSA 2XRCA 3RLYH 3DA9B 4FU9A 1GHBF 5LGOA 2ZFSA 5IYTA 8KME2 5TCCA 1O2NA 1LHCH 1OWKA 2FO9A 3ZZ6A 1GMHG 4CHAC 3UNRA 1G32B 1C5ZB 1SLUB 3VEQB 1D3QB 1K2I1 1Z1JA 1AVWA 1SHHB 1WAYB 3ZZ9A 1PQ7A 1YPHE 2RG3A 1ZZZA 3RXVA 1UCYK 2OBQA 5EW2H 2SGDE 3A8BA 1BTWA 3OYPA 2FOMB 3QX5H 1A5HA 3PTNA 2QCYA 2Y5GA 3UNSA 4ZXYH 3RLWH 1C1VH 4HZHA 4TY6A 4NSYA 2WPHS 2Z9IA 1O30A 5B6OA 1C2HA 3OY6U 2BLOA 1EJMA 3TK9A 2Q1JA 3RC5A 3A8AA 2BB4A 1F0UA 2Y7ZA 4WMDA 1GI8B 1GI3A 3B9FH 1NPMA 2ZIQH 2H5CA 3SNDA 3UOPA 2Q6DA 1N1LA 4AGKA 1LCYA 3LONA 1H8IH 1IQHA 1Q2WA 4XBBA 1THSH 4KTCA 1HFDA 1XUHA 4JYUH 5C67A 3GYMA 2Z7FE 4K2YA 1SQAA 2GD4B 5EQSA 4RKOB 3M7TA 5DO4H 4K69A 1BB0B 1CGIE 5GXPA 1GHVH 1RXPA 3P17H 2F9PA 3A8DA 2ZDLA 1BITA 4JZ1A 1C5QA 1GI7B 1F5KU 2BY6X 3QK1A 3RM0H 2AMQA 2B0FA 1TBZH 1UVSH 1ZGIA 2BHGA 2ZP0H 7LPRA 4Y79A 2O8TA 1JBUH 1O3JA 3O8DA 1UHBA 5C1YA 1UVPA 1DSUA 5EQQA 1FZZA 1P9UA 3HKIB 2B9LA 1P01A 3F1SB 1C2IA 3Q76A 5CMXH 3V13A 3EAJA 2HRVA 2CHAC 7ESTE 1VCQA 2ZF0H 1OWIA 4JK6A 3ZZDA 1LPGB 1B0EA 2ZHEH 3EYDA 2IJOB 4CRAA 3BTGE 1C2FA 1MCVA 1ZHPA 3ZVBA 3SZNA 1MTNC 4ISHH 2XWAA 3MYWA 3U8OH 4BXSA 1D6WA 1ANDA 2XW9A 1GMDF 2XXLA 3SUGA 3GYLB 1CBWC 3L6PA 3H7TA 3TJOA 8ESTE 2VIOA 1AQ7A 3C27B 1TMUH 3FAOA 4BAKB 1CGJE 1GDNA 1HJ8A 5C3NA 1Y3VA 3R0FA 4D7FA 4MG3A 2ESTE 2PHBA 1GCTB 1YKTA 2C8XB 4A92A 5A8XA 1CHOF 1V2TT 2A4QA 4UFFH 5DP3A 1HB0B 1H9HE 5T3HA 1F0RA 1AD8H 4U01A 2QF3A 5DP7A 1C2JA 2ANKH 3RXLA 2A4OA 1LHDH 1L4ZA 1DSTA 1NT1A 2EI6A 2R3YA 2EA3A 1CHGA 2W5EA 3M36A 5AFYH 4AORA 1BMMH 1ZHRA 1GJ7B 4BAOB 1NZQH 2K7XA 2M5TA 5J4SA 2BY7X 5ESTE 2OUAA 1O2HA 3QTOH 2BY8X 1ABJH 1YM0A 2A4GA 4AYVB 3DT0H 1BDAA 1C5PA 2BOHB 3NUMA 1QRWA 1HAVA 2BD9A 1A0LA 1O35A 2BTCE 3T5FH 3BF6H 4YZUA 4MNVA 1O39A 1TRMA 1Y8TA 1O2TA 4GPGA 2G4TA 4O3TA 3L33A 1GJ6A 3ATLA 3ATKA 2Z9KA 3TH4H 1THPB 2ZFTA 2PUXB 1C2DA 2ULLA 1O3LA 2BDCA 4FVBA 2A7CA 2JH6D 2THFB 2J2UA 1OP0A 1NROH 1RTFB 5E0JA 2FLBH 4MTBA 4CR5A 3KNXA 4ZH8A 1O2RA 1LKBA 2FZZA 4X1PU 1AWFH 1MTSA 4WH8A 5F8XA 3UOUA 3F68H 2BM2A 2ZPSA 3ZYEA 1J15A 4Y0YE 4GLYA 3G01A 2NU2E 1A2CH 5FBIA 3T62A 1ELEE 5FXLA 2SGPE 1GBKA 3ENSB 1HAPH 3UWIA 1ZGVA 1SC8U 4IC5A 6LPRA 3P92A 1B0FA 1BRUP 3QN7A 1EAWA 1GMCF 3RM2H 3KQBA 1G36A 1O3OA 3CENA 1UK2A 3KIDU 1Z6JH 1GJ5H 1TIOA 2ZU2A 1SGYE 1L1NA 3SQEE 1K1NA 1XKBC 2EI7A 1VITF 2STBE 4ZMAH 1O2MA 4ABGA 2BY5X 2QV1A 1JRSA 1AI8H 2A7HA 1JXPA 2VGCB 1HRTH 1UVUH 1NRSH 4GHTA 1EAIA 1DFPA 2FP7B 3SUFA 4RN6A 3MWIU 2VH0A 3A80A 2W3IA 1C1TA 2ZDMA 2ZDNA 2O9QA 3MO3A 1S0RA 4UFDH 4OS6A 4ISOA 2AH4X 2ANYA 4NA9H 1IQJA 2A32A 1FMGA 3RMNH 2QC2A 4I8HA 2J34A 2R2WU 3LT3A 1AGJA 4FXGH 4BAMB 1A46H 4IC6A 2BD2A 4X2VA 4X2YA 5GPIB 2I6SA 1LMWB 1O2QA 1NRNH 1VITH 1LHEH 1O5BB 4R8TB 1YLDA 2A0QB 2CHAB 2FXRA 4CRBA 1DVAH 3MOCA 1TGNA 3V0XA 1AFQC 1XMNB 2BDBA 3PTBA 1EOLA 4O03A 2CJIA 4JCNA 5GIBA 1AB9B 4XOJA 3TJUA 3P8OA 1UCYH 3F9FA 4ISNA 1AIXH 1EZSC 1MTUA 1UTQA 2GCTC 4RKJB 5ESBA 1AN1E 1G9IE 1SLWB 2WUBA 1XXDA 1ABIH 1PFXC 5A8ZA 3OX7U 5JBAS 4KTUA 3BG8A 3EQ0H 3H7OA 5HGGA 1C1WH 4R0IA 2PKSB 5EOKA 1H9IE 1GCDA 4WXIA 1OWJA 3MU4A 4D9QA 1UTMA 4X6NA 2AGIX 4B2BA 2FOAA 4OS7A 1QFKH 1KDQA 4TY7A 3PMJA 1KXBA 2SNVA 5EW1H 1TNHA 1QB9A 2O8WA 1WU1A 3ZZ7A 2IOTA 3O8RA 3TH2H 1O5EH 2F9BH 3SJKA 4MNWA 3C1KA 5E0GA 1U6QA 4DY7B 3LH1A 2J9NA 2ZGBH 3RDZA 3RXEA 2C8ZB 4MPUA 3BIVH 1THRH 2FTMA 3U98H 4AYYB 2ZI2H 3A87A 2CV3A 1GI4A 2BDIA 1MZDA 4THNH 7GCHF 2A2XH 1EPTB 5AF9H 2ZC9H 4KTSA 1C5WB 2CXVA 4DIHH 2ZDKA 3LC3A 4I8LA 1O0DH 2C90B 2H9TH 3EA7A 2Q6FA 3UR9A 1P2MA 3RXOA 1P3EA 1E0FD 1DY9A 2ZDAH 1Z8IB 1H4WA 1AY6H 1LPKB 5EXNA 1F92A 2B8OH 4BAHB 2CF8H 4AFUA 1Z1IA 1P06A 3EA8A 3AVZA 1S84A 2BDGA 4AN7A 3VFEA 3M5LA 3OU0A 5GCHG 1XKAC 1NFXA 4X2XA 3CP7A 2KAIA 1QURH 1RIWB 1CT4E 4U30A 4X2WA 4ZHMU 4ZHLU 1BTHH 1VCPA 4HTCH 3SORA 1JOUB 3EE0B 2G5NA 2FMJA 4AX9H 3ZVEA 1ESAA 3SU5A 2OD3B 1ELVA 4AB8A 1V2ST 1O3CA 3LGVA 4FUJA 3BTDE 1E35B 3LJOA 4X6PA 2AS9A 3A7WA 1ZMLA 2AEIH 1GJ8B 2W3KA 2R0KA 2EI8A 4NA8A 4NZQA 2QF0A 2F3CE 2UWPA 1IQGA 1MH0A 1ANEA 5EXMA 8GCHF 2PTNA 4I32A 3M3TA
chains in the Genus database with same CATH superfamily
1DICA 1HPGA 1W14U 3LH3A 1ZSLA 1RTKA 3HK3B 1UTNA 3BG4C 3HPTB 4LOYH 1GMDG 2ZHQH 5DGJA 3P70B 1C1UH 1J16A 1RTLA 3V12A 1HAOH 1D4PB 3P8GA 2OCVB 1C1PA 1SQOA 3QO6A 2ILNA 3ZVGA 3SO3A 1V2UT 3IITA 1O2XA 1TPOA 3FO8D 2JH5D 3DUXH 1G3EA 3RP2A 4O3UA 1A3EH 4YOGA 3SJOA 4XFQA 4GAWA 1WTGH 3RXAA 1V2KT 4GCHF 2P8OC 4F49A 3TGKE 1LO6A 4ZKRU 3DFLA 3BEIB 3ESTA 2UWLA 8LPRA 2VB0A 4UFGH 1ELBA 2TPIZ 4YOJA 1UTKA 4JZIA 4YESB 1RGQA 1OP8A 4X8TH 1CA0B 4Y7AA 4UONA 1RIWC 2FPZA 2OP9A 2OC0A 2ZPRA 1TBQH 4HFPB 3VB7A 1CU1A 1NRQH 3PYHA 1O32A 1TFXA 2OBOA 2BMGB 3K6YA 3NCLA 2ZTYA 1EQ9A 4UDWH 2V6NA 1Y3WA 4INHA 3RC6A 1BMNH 1ZR0A 2VVVA 3F3BA 3LU9B 1OPHB 2BYAX 3MO6A 2GX4A 1C4V2 2ZFFH 5EJLA 3ZZ4A 4GUXA 2XCFA 1TAWA 1GHWH 4MLFB 1TNJA 4BOHA 5JBCS 1UO6A 4VGCC 1VGCB 3E3TA 1DLEA 1TRNA 3LDXH 3DHKH 1ZJDA 1V2PT 1D9IA 1QBVH 4INLA 4B2CA 5FL7D 2ZA5A 1P12E 2VVUA 5LPRA 2BLWA 2XNDD 3MTYA 1GL1A 4Y8YA 5FCKA 1O5CB 1ZTLA 5L6NH 1PPBH 2PWXA 1ELDE 1P2OA 4X8UH 4JYTA 2IPQX 2VH6A 3OE7D 2J5UA 1ZSJA 1O2OA 1X7AC 4H6SB 4ASUD 1TNIA 2WSSD 4MPVA 3ZZBA 2OTVA 1TMTH 3FP6E 2TGDA 1QIXB 3NZIA 1DANH 1YPEH 4JMYA 4SGAE 3VGCB 4FUHA 3RXTA 1C1SA 4BXWA 1J9CH 1TPAE 2P3FH 2VNTA 2ZTXA 3N7DA 5FX6A 1AZZA 1BHXF 1GMHF 1UCYE 1SGCA 1ZOMA 2RA3A 2P93A 5FX5A 2F9UA 4KELA 1MKXK 1TPSA 1HV7A 1P09A 4MVNA 1A3BH 4MDSA 1C1MA 4CBOA 2XC5A 2F4LA 4JYVH 4AC9A 4X1SU 1C1NA 1LTOA 1OHHD 2ZCLP 2ZWLH 1VZQH 4UD9H 1N8OB 2UUYA 1OP2A 2Y6TA 3U9AH 1O37A 5JBBS 1SI5H 2OINA 2ZKSA 4A1TA 1VJAU 4INKA 2KX4A 3E16B 1O2VA 5DP6A 2FOCA 3HATH 5C5NA 2CGAA 2HVXA 1SFIA 1CT0E 1GI1A 3BTTE 3MH5A 2ZEBA 2TGTA 1A0HB 1CA8B 1HAVB 3UREA 4X6MA 4A1VA 1S85A 1TBRH 2XC4A 4CHAB 2RDLA 4I31A 5CDFE 4Z1MD 3K6ZA 3M5MA 4IGDA 2ZECA 2UUKB 3LGUA 2PKAB 4D9RA 5DJ7A 3MNBA 1G3DA 5I46H 2AERH 1NTPA 5C0TA 2P59A 5HKKD 1K1IA 1P9SA 1BCUH 1C5SA 3EE7A 4AG1A 3I78A 1AHTH 1NFUA 1D3DB 1INCA 2D2DA 1AVXA 4J2YB 1GI5A 1GI2A 5C1UA 1BRAA 1FJSA 1BBRK 2FEQH 4WVPE 2C3SA 1HJ9A 2LIZA 1FY3A 1YPLH 2P3TB 4DW2U 4AOQA 3N7EA 3BTME 1W11U 5EPYA 1BMAA 2FI5E 4B1TA 3A81A 3LJJA 4ABFA 1XVOA 1BZXE 2NU3E 3BTHE 4CR9A 1BTZA 1ZPCA 1FY1A 2GDDA 2WZQA 4F55A 2CK3D 3ZZCA 1AB9C 1ELAA 1AFEH 4K1TA 1IQIA 1YCPK 1QQ4A 3RXCA 1AKSB 3DSGA 2F9VA 3U1IB 1RD3B 3MNXA 1EOJA 1TLDA 2OQ5A 1QQUA 1O3KA 3B23B 3VXFH 2KCYA 1EZQA 2FS8A 1BTYA 1EAXA 3RXMA 3BTFE 2ZZUH 1BQYA 2G55A 2WINI 3SV7A 1HJAB 3WWFA 5EJZA 1SG8B 1QBNA 3M3SA 1Z8GA 1IQEA 4NIWA 4GHQA 4I8JA 5F6MA 3WY8A 4NGAH 3QDZB 2VIVA 2ALVA 1ARBA 1CGHA 3P6ZB 2GCHG 1MQ6A 4I7YH 3SUEA 2SGQE 3PB1E 3GY4A 3A89A 3GCTF 5EQRA 5DP5A 1T4VH 3F9EA 2YNAA 3UR6A 1G2LA 2G51A 4KGAA 5CE1A 1IAUA 1NFYA 1PQ5A 2M2AA 1FDPA 2Y7XA 3CS0A 3UQOA 2CN0H 3N99A 4P02A 3RXQA 1SQTA 4Y11E 2HNTE 3MU0A 2SNWA 5GCHF 2Y81A 3UPEA 5HYOA 6CHAB 2P3UB 1BRBE 3F0PA 5C94A 3GDVA 1T31A 1W10U 2P95A 3I29A 4JZFH 1QR3E 3SU3A 2BQ6B 1SGPE 3M35A 1NRRH 2BVRH 1UTOA 2K1QA 2FM2A 4KKDA 3ZZ5A 1B7XB 4Y76A 1QNJA 1UW7A 2QXGA 4UE7H 2Z3CA 2GV6A 1EX3A 5ETXA 2QY0B 5EGMA 1DX5M 1G37A 1GBTA 1EFRD 2JETC 1QB1A 3E6PH 4Y8XA 1P05A 1BOQA 4X1NU 3NPSA 1GCTC 3MMGA 3A7VA 4NA7A 3GDUA 1Y3UA 1CVWH 1UTLM 4Q7YA 4A7IB 3AW1A 3T25A 1O2IA 4BTTB 3FP8E 1P57B 3RXUA 5FBEA 2FOBA 3ATWA 2D26C 1ZTKA 2BDHA 2BDYA 1OKXA 2HWLB 1NFWA 1SFQB 2B7DH 4RI0A 4NZLA 3FZZA 1DY8A 1MKWK 1O31A 3UB0A 1AFQB 4JZEH 1C5OH 2CF9H 3B8JA 3ZZ8A 3GY8A 1RJXB 1MQ5A 1Y3XA 3UWJH 2FOEA 3CS7A 1KXDA 2GTBA 4MNXA 3GCHC 5F03A 1O2JA 3H5CB 4BAQB 1F7ZA 1DWBH 1FX0B 2H6MA 1TNLA 3LGTA 3S0NA 4B2AA 1O3NA 1FAKH 1P2IA 5C2ZA 3O8CA 2FIRH 1DE7H 1ESTA 2IPHA 1DWDH 1ZRKA 4FUIA 3S9AA 3LC5A 1YY3A 1ELCA 3KCGH 4OGYA 1SOZA 1C2EA 1DT2A 1Y59T 2R3UA 3PMHB 3MNCA 1OOKB 5BPEA 3NK8A 1P3CA 3VB3A 1PYTD 1W0YH 2STAE 1UTJA 4Q7ZA 5FCRA 3SZEA 2P8OB 5KGOA 2XC0A 5FPYA 1TOMH 5A09A 2Z94A 1QB6A 1K1JA 2V35A 3OSYA 2H9HA 1A1RA 1T8MA 1ARCA 5E0HA 4IW4E 1FNIA 2BD3A 2C8WB 1F0TA 1B5GH 2KAIB 2JKHA 2GT7A 1AE5A 2HGTH 5KECA 2FYRA 1KLJH 1KLIH 3ZVAA 1C1OA 2HVYB 2GT8A 2PFEA 3GCHB 4NWLA 3SU6A 1TGSZ 4LXBH 1OXGA 1IQKA 1ZYOA 4B6FA 1T32A 1WBGB 2B5TB 3GY7A 5FPTA 1QBOA 4DVAU 2FS9A 2VWMA 2QXHA 2KR7A 5HM2A 1TABE 5EXLA 1GDUA 2VVCA 1QJ6B 2NWNA 2PP6A 2J97A 1O34A 1SGFG 3TVJB 2J98A 1QJ1B 4ISIH 4JZDH 2QAAA 4O9VA 2YNBA 4BTIB 1ZRBA 3SQHE 1O5DH 1V2NT 1GI0A 3ZV9A 3SNEA 4D7GA 1G30B 1JRTA 2AMPA 1L1GA 7KMEH 2AFQB 2G8TA 3ZYDA 2L74A 1YPMH 3W1EA 2WPMS 2TGAA 4Y6DA 2VU8E 1ETSH 1GDQA 2KZ4A 3URDA 1O2PA 1GHAG 1S6LA 4X0WU 4DT7B 3KQ5A 1SGTA 3SJ8A 3KF2A 2O8LA 3PMAB 3U1JB 2QIQA 1H1BA 3SV2H 5EJ1A 4U32A 3T28A 4NSVA 3GISB 1MMJN 1EATA 1ANBA 1D3TB 2FOFA 1MZAA 4WWYA 2ALPA 3A84A 5GDSH 4ABAA 1FXYA 4TPIZ 2VIWA 2ZTZA 3GCOA 1IHSH 1KLTA 3AAUA 2FLRH 1O5GH 1J14A 1CO7E 1L0ZA 1MAYA 2ZNKH 3FP7E 1WCZA 4K5ZA 3TITA 1HLTH 1BRCE 2BZAA 2LELA 1GBLA 1NM6A 3E8LA 2WUCA 3GY3A 5JPMH 3IG6B 2A2QH 1Y5AT 1ANCA 2ZO3H 3SV9A 3TNSA 1SBWA 1NY22 3BSQA 2R2MB 2CMYA 1OSSA 4YM9A 2Y82A 2ZGHA 1FONA 1SGRE 1ELTA 3TPIZ 2RDEA 1Q3XA 3R3GB 5BRRE 3TGIE 1PYTC 1PPFE 1TALA 3OTPA 4TSFD 4AZ2B 4LZ4B 1EXFA 4TT3D 1P2NA 3SW2B 1TX6A 1V2OT 1WTHD 4X1RU 1KYNA 1HXFH 2W26A 3Q3XA 2GP9B 3PWBA 4WY3A 1T8LA 3FANA 3BTQE 1SGDE 2HPQH 4E05H 2BZ6H 4CBNA 3GY6A 1DITH 3SJ9A 3PWCA 3JZ2B 5C1XA 4SGBE 1GI9B 3M37A 3LIWA 2ODQA 1QY6A 4ZROA 2A1DB 2BVXH 1BTUA 4HGCA 1LVYA 4M9FA 1O3IA 2QYIA 3FFGA 2ANMH 2GDEH 3E91A 2GCHF 4XBCA 1UTPA 2YMSD 3U69H 1FI8A 1EASA 4BANB 2TIOA 2A45B 1BT7A 3QZRA 1PPGE 3SNBA 3UAIC 4ABEA 1CBWB 2SFAA 1IQFA 1W8BH 3BTKE 1P0SH 2EY4C 1GJDB 3UY9A 3UFAA 2GMTB 1IOEA 3MH7A 2ZHWH 1JIRA 3TNTA 1AE8H 2XTTB 1EP5A 1O3GA 1O33A 6GCHG 4OS5A 2R0LA 2OK5A 1P2QA 2IN2A 2ZGCA 1GBFA 5B6LA 4ABHA 3ELAH 1V2WT 3A82A 1HCGA 3E90B 3QTVH 2V3OH 1ZPBA 1EPTC 3PM3A 2BLVA 1C2MA 3MNSA 4YLUA 2WV9A 2ZFRH 3KQEA 4WJG2 3RXBA 1MAXA 1UVOA 5E2OA 3UUZA 3MU5A 1CT2E 2K8IA 1UHBB 4CREA 9ESTA 1S82A 1YYY1 4LZ1H 3W94A 5AVDA 3A7TA 1Q31A 3HGNA 1G2MA 5DKMA 3HKJB 2FX6A 3RXFA 5IDKA 1GBCA 2TGPZ 2W7UA 2WPKS 2H2ZA 2D1JA 4VGCB 5EIYA 1MKWH 1LQEA 2A4RA 1EAUA 2WV4A 2Z3EA 1XUJA 3A85A 1TNKA 4X1QU 5IK2D 1SVPA 3VG8A 3D23A 1LQDB 1WV7H 3L3TA 1TX7A 3M5OA 1V2RT 4XE4A 2A31A 3RXSA 1V3XA 2AIPA 1P2KA 3K9XB 1XX9A 1XM1A 2GJGA 3Q3YA 3RU4D 3RXPA 3QWCH 4B76A 4AFSA 2A5AA 1WYKA 1ELGA 2ZU5A 1UMAH 1NC6A 1TYNA 4ABJA 5JDUB 4FU7A 3KYGA 2F91A 1O3BA 1OX1A 1SR5C 2F9OA 4BTUB 2ODPA 3OTJE 5A0CA 1HBTH 2QE7D 2VWOA 2JETB 1YPJH 1TQ7B 5G4BA 3E0NB 2Z9LA 3FOAA 1TX8A 4K3JA 2WPJS 1MBQA 1T8OA 1L1JA 2FX4A 3M7UA 2ZFPH 1O38A 1Z8JB 2OC7A 1OYTH 3Q3KA 1OYQA 5HMAA 1QRXA 4IBLH 1V2VT 4ZKSU 1IHTH 3BTEE 1O2YA 1T8NA 2PV9B 2V3HH 1V2LT 2ZU4A 5DP8A 1XUFA 1HAYB 1IQMA 2P16A 3DFJA 2A5IA 1MTWA 1GJBB 2Z9GA 1ZTJA 2OLGA 3ATIA 4NIVA 3GOVB 4ABDA 1AMHA 1ZMNA 2XYAA 1FIWA 4Q2KA 3T29A 1SGEE 1PPZA 1GI6A 3KQCA 1BJUA 5HM9A 1QCPA 2XCNA 1N8OC 1QL7A 1YLCA 2FYQA 2PW8H 2WPIS 1SGFA 3GY2A 3Q77A 2WYGA 2VWLA 3M7QA 1O2GH 5AHGH 1E1QD 3FN8A 2HOBA 4AG2A 3E1XB 5L30H 1Y5UT 3RMOH 5HXFA 3SU0A 2KCPA 1XUIA 1YWUA 1K22H 1YPGH 1BA8B 4AGJA 3S9CA 1GJ4H 3PV4A 1MD8A 1Z8RA 2FODA 1DUEA 4I8GA 4CRFA 1AUJA 4OS2A 5KEDA 1LVMA 2GMTC 3PLKA 3KN2A 4NCYA 4AB9A 3MU1A 1NS3A 1TOCB 1W12U 2JIZD 3ODDA 1FAXA 3QGNB 1MBMA 2J95A 3KL6A 4QT8C 3SGQE 1Z6EA 2TBSA 1F2SE 3A88A 3FVFB 1N6XA 1ZJKA 1O2KA 1PQAA 5FPSA 1K1PA 2PGBB 5LPEA 2NU4E 1UVTH 4GCHG 1SMFE 1YF4A 1A4WH 1YPHC 1LVBA 4ZAEA 1UJ1A 3N7OA 1MUEB 2BDAA 3GCTG 1SLVB 4Q7XA 3MQKC 3BEUA 2AMDA 3LOXA 2G52A 2J94A 1PPCE 1FIZA 5EPNA 1ESBA 1HAHH 4YT7H 2BQ7B 3BV9B 4OM9A 2FTLE 4IN2A 2XBXA 4GSOA 4ACBA 4DG4A 1C5UA 1MABB 3LPRA 1GHBG 1TMBH 2W6ID 2VIQA 2W6JD 1DUAA 2QF5A 2Y5FA 4YTAA 4HI3A 1FY5A 5CHBA 1SGQE 5F53A 1LPZB 1JIMA 1JMOH 1D6RA 2ODYB 3RXKA 1E36B 1FN8A 2ZHDA 4WMEA 2ZHFH 2RCEA 2G81E 1C5NH 1VJ9U 3TK6A 3F9GA 4XDEA 2AGEX 4NWKA 3ZVCA 1QA0A 2O8MA 1EUFA 1C5MD 1SPJA 1EJAA 1VITG 2QXJA 1TPPA 2PSXA 2FOGA 3SGAE 1ELFA 1MTNB 1GMCG 1HNEE 2SGEE 1PQ8A 3F0OA 4FUEA 2GVFA 3TJNA 3AK5A 1WQSA 4NFFA 1WOFA 5T1VA 3F2FA 1HAGE 3LGYA 2FDAA 2D8WA 1YBWA 1EZXC 1GBAA 3NWUA 1F5LA 2XWBI 3QZQA 2C93B 2V0BA 3P95A 1BBRH 4DIIH 2A5KA 4X8SH 3M61U 3MU8A 3MO9A 3TK5A 3RU4E 3A7ZA 1HAXB 2FOHA 3SUDA 4RT0A 1KXEA 3SN8A 2G5VA 1P02A 5C17A 4X8VH 3IWMA 2ZDVH 4FUFA 1KY9A 2EEKA 1QHRB 2VGCC 4FOUC 4OS1A 2Y5HA 1GVZA 2SGAA 1HIAB 3SGBE 1J8AA 1WUNH 1H8ED 4F48B 1J17T 1JWTA 5GNDA 2BOKA 3OEHD 4U2WA 2G4UA 2QGRA 3S9BA 2J92A 1GG6B 4RT1A 5K0HA 2ZFQH 4E7NA 3D65E 4D76A 1P10A 3A8CA 3LGWA 3SHAH 1GJAB 3SNAA 1HDTH 3SI3H 2RFKC 5A2MH 3LKWA 3AASA 1YCPM 1IQNA 4XRNA 3CNRA 2H1UA 5PTPA 3BTWE 5E8EH 4ABBA 1KIGH 6GCHF 1DXWA 3OY5U 3T26A 1KDQB 1GBJA 3EA9A 2KCOA 6CHAC 3SI4H 2BX4A 4YXWD 1VR1H 2BD4A 2BVSH 1MKXH 1WSSH 1K1MA 1KXAA 4WMFA 1O3FA 3K65B 1SQRA 1V2JT 2PGQB 2H5DA 2BXUH 1Z71A 4IMZA 1P2JA 1QRZA 1TGTA 2ZU3A 5ABWA 4B73A 4TWWA 1N6YA 4K1EA 4CRDA 3UTUH 1LVOA 3MFJA 4A6LA 3D62A 2HPPH 1EPTA 4IN1A 2NU1E 4Y71A 2ZGJA 3GICB 1XVMA 1W0KD 1A0JA 4I86A 1HXEH 3UQVA 3SOSA 4ZUHA 4J1YA 2PKAA 1QL8A 5L2YH 4B74A 1FY4A 2PUQH 2GKVE 1DS2E 1PJPA 1O2SA 2XBVA 4DGJA 5LPFA 1LDTT 3STJA 1DWCH 2FWWA 3PLBA 1GVKB 1QL9A 3UIRA 4AFQA 3RMMH 1D3PB 4LK4A 2DE8A 3GDSA 4YO9A 5EODA 1W7GH 3GY5A 2F43B 5C5OA 1MU8B 1Y3YA 5CHAC 1K1LA 1NU7B 1SGNE 4FETA 2ZQ2A 5L2ZH 1UK3A 2DE9A 1SHYA 1ZSKA 3E0PB 1P03A 2BD7A 1OWHA 5LH8A 2PKSC 4ASHA 3PO1B 1AU8A 4MQAA 2QXIA 5GJ4B 1FLEE 1XUGA 5C0UA 4BNRA 2Z9JA 3ATMA 1C5YB 2BX3A 4H4FA 3S7HB 3PO1C 3V7TA 2PTCE 3ZVDA 2Q6GA 1ORFA 2O8UA 3TU7H 1PPHE 4ESTE 1NO9H 1O2WA 1O5AB 3RC4A 4Q80A 1FV9A 2AYWA 2GZ8A 1FY8E 5AFZH 3TGJE 5GWZA 1MTVA 3DD2H 1TA6A 1EP6A 1TWXB 2HNTF 1C1RA 2LP6A 1SSXA 5EG4A 1TB6H 1TA2A 1FN6A 4FUDA 3EBNA 2EC9H 3JZ1B 2HNTC 1LHGH 1A5IA 3MI4A 4O97A 1W0ZU 1GBIA 1C4Y2 5A0BA 2R9PA 2ASUB 3KHVA 3A7XA 2ZQ1A 1T4UH 2AGGX 2JJ1D 1LKAA 1C5VA 1NN6A 1A7SA 2BXTH 4H42U 2AIQA 2ZG0H 5T6DA 4E06H 3VB4A 1E38B 1P8VC 1TGBA 1YC0A 3ODFA 2KCAA 2XBWA 4FVDA 4Z0KA 4FUCA 3RXGA 2VIDA 3RXIA 3A83A 4XBDA 4PROA 1QTFA 2XOKD 1C5LH 3URCA 2GCTB 4H6TA 1K28D 1XUKA 4CH8B 1C2GA 1O3HA 1DXPA 1TGCA 1C5RA 1TNGA 3SJIA 1NRPH 5TJXA 4NIXA 3RU4T 2VWNA 1FQ3A 3KGPA 4F4OC 1G3BA 1TRYA 4ZHAA 1KXCA 1GBDA 3A7YA 2C8YB 1KTTB 5C20A 1ZPZA 4CRCA 4DT4A 1MD7A 4XD7D 4A1XA 2ZPQA 3SNCA 2RA0A 4DOQA 1RRKA 3T27A 4NIYA 5JYIA 1XXFA 3F2GA 1GPZA 3SU2A 2JJ2D 1T7CA 1GHYH 5A8YA 1O36A 2ZU1A 3S69A 1EB2A 4DJZB 1K1OA 1QGFA 1E37B 1BBRE 1K9OE 5F8ZA 1HGTH 5EU8A 3VB5A 3KEEA 3ZZ3A 3LGIA 4M7GA 1OWEA 3RXHA 1E1RD 1GGDB 2J98B 3PMBB 4Y7BA 1NBMD 3RXDA 4CH2B 1BHXB 2PLXA 4E7RG 5JB8S 4K60A 4B71A 2Y80A 2YMSB 3HGPA 1EJNA 3QLPH 4TWYA 1GVLA 5SGAE 1BTPA 1TE0A 1AZ8A 5DP9A 1C5XB 3STIA 4ZKNU 1C9PA 4DCDA 4D8NA 1AUTC 5TCAA 2SGFE 1ZHMA 2FESH 1YGCH 2BY9X 2I6QA 3O8BA 3FZDA 1O5FH 3TIUA 1VCWA 1DLKB 3BN9A 1F0SA 1CSOE 2GZ9A 1H8DH 2VINA 1AWHB 4OS4A 1C2KA 3KQDA 4KP0A 2OC1A 3MHWU 4FUGA 1ETTH 2OC8A 2ZGXH 1BMLA 1TQ0B 3RMLH 1AO5A 3ZV8A 1CA0C 2EQNA 1HUTH 3MH6A 2QN5T 4ISLA 3NRLA 1SOTA 1ZLRA 1W0JD 2BQWB 4WXVA 1M9UA 2XBYA 1S5SA 1SKYE 1CE5A 2UUFB 1W2KH 3HK6B 1F5RA 1TONA 5DSFA 1P04A 1C9TA 3W95A 3ZVFA 1K21H 4OGXA 1C5TA 2Z3DA 2FI3E 3Q00A 1V2MT 4K1SA 1UK4A 1FPHH 3D49H 1DM4B 1GHZA 3SU4A 4IMQA 1VGCC 5I25A 3ITIA 2TRMA 3QGJA 4Q4LA 2BLQA 1O2ZA 1PPEE 3T2NA 1GBEA 2J4IA 4UFEH 1EKBB 1S6FA 1WDIA 3RUOA 2YOLA 2LPRA 1SB1H 4GVUA 2C4FH 1C2LA 1GJCB 2ZCHP 1SLXB 3AAVA 1SGIB 3MH4A 2F83A 5DG6A 1QJ7B 2H9EH 2VIPA 3S7KB 3SU1A 3U8RH 1CHOG 4YOIA 1GL0E 1GBMA 3M3VA 4MNYA 1GHXH 1BTXA 2YMSC 1GBHA 3EGKH 4K8BA 1ZMJA 4Y0ZE 1H9LB 5JBTA 4NFEA 1W3CA 1GJ9B 5DPAA 1YP9A 2PSYA 4ZKOU 1FUJA 1KTSB 4FU8A 3V3MA 4I33A 1BIOA 1O3DA 4XSKU 1GWAA 8GCHG 2F9NA 1GGDC 1O2UA 2G00A 1QA7A 3U8TH 3SV6A 2VJ1A 4TYDA 1HAIH 1S83A 1EB1H 1IQLA 1DPOA 3TH3H 1Y5BT 1BJVA 4IS5A 5T6FA 4B75A 1ETRH 1O3PB 1C1QA 3K2UA 1HJAC 1YCPH 2PR3A 5DP4A 1EZUC 5CHAB 3RXJA 4ABIA 1DOJA 4K8YA 1KXFA 2FI4E 1ACBE 3P8FA 3VXEH 1O3MA 2HALA 1HIAA 5HIZA 1MCTA 3A86A 3F9HA 1BUIA 1V6DA 3BG4B 2XNIA 1GG6C 5DK1A 1E34B 2W7SA 1Z7KA 1KSNA 1S6HA 1MU6B 3F6UH 2A7JA 4NG9H 2QA9E 3M5NA 1SL3A 2GGVB 6ESTA 5E2PA 1P11E 2UWOA 5FAHA 3SHCH 1YLNA 4Z6AH 5FHTA 1WQVH 3SV8A 4YT6H 1C4U2 2LNCA 4I8KA 3PLPA 4CRGA 1GBBA 4ZXXH 4RSPA 3NXPA 5T6GA 2DUCA 2BD8A 2K0QA 5JB9S 1DDJA 1W7XH 9LPRA 1W13U 2HLCA 2GZ7A 7GCHG 2BD5A 1S0QA 5F8TA 5K7RA 1RS0A 4WF8A 2OXSA 2Z6BD 3DSPA 4MPWA 3NKKA 4A5TS 2KFWA 2UUJB 1O3EA 3SBKA 1HYLA 3PROA 1LHFH 4JK5A 3UNQA 1GHAF 2JH0D 1A61H 3VGCC 2J38A 2WV5A 2WPLS 5H4IB 3RXRA 1V2QT 3ZIAD 4Y8ZA 2WYJA 1RFNA 3GS9A 5A0AE 4X6OA 1OS8A 3VB6A 1CQQA 1ID5H 3BIUH 3DSOA 5DN6D 1NBME 2NU0E 4YLQH 4TPYA 4DURA 2P94A 4FUBA 3AW0A 3BEFB 1L2EA 3WW7A 4AFZA 1A5GH 5J4QA 1OWDA 4UEHH 4MPXA 3TLOA 3VPKA 1FPCH 3P8NA 2GV7A 1O2LA 2ANWA 1DWEH 1HAZB 4WH6A 1COWD 2ZCKP 3TJVA 3EDXB 3PRBA 1L4DA 2OQUA 3I77A 3ZZAA 3GCNA 1G3CA 1O3AA 1S81A 1NU9A 1NESE 3QUMP 1YPKH 4Y10E 1AVGH 1AKSA 2XRCA 3RLYH 3DA9B 4FU9A 1GHBF 5LGOA 2ZFSA 5IYTA 8KME2 5TCCA 1O2NA 1LHCH 1OWKA 2FO9A 3ZZ6A 1GMHG 4CHAC 3UNRA 1G32B 1C5ZB 1SLUB 3VEQB 2VBCA 1D3QB 1K2I1 1Z1JA 3KYFA 1AVWA 1SHHB 1WAYB 3ZZ9A 1PQ7A 1YPHE 2AHME 2RG3A 1ZZZA 3RXVA 4HG6A 1UCYK 2OBQA 5EW2H 2SGDE 3A8BA 1BTWA 3OYPA 2FOMB 3QX5H 1A5HA 3PTNA 2QCYA 1WXRA 2Y5GA 3UNSA 4ACAA 4ZXYH 3RLWH 1C1VH 4HZHA 4TY6A 2L6OA 4NSYA 2WPHS 2Z9IA 1O30A 5B6OA 1C2HA 2WPDD 3OY6U 2BLOA 1EJMA 3TK9A 2Q1JA 3RC5A 3OAAD 3A8AA 2BB4A 1F0UA 2Y7ZA 4WMDA 1GI8B 3U28C 1GI3A 3B9FH 1NPMA 2ZIQH 2H5CA 3SNDA 3UOPA 2Q6DA 1N1LA 1VKYA 4AGKA 1LCYA 3LONA 1H8IH 1IQHA 1Q2WA 3OFND 4XBBA 1THSH 4KTCA 1HFDA 1XUHA 4JYUH 5C67A 3GYMA 1BMFD 2Z7FE 4K2YA 1SQAA 2GD4B 5EQSA 4RKOB 3M7TA 5DO4H 4K69A 1BB0B 1CGIE 5GXPA 1GHVH 1RXPA 3P17H 2F9PA 3A8DA 2ZDLA 1BITA 4JZ1A 1C5QA 1GI7B 1F5KU 2BY6X 3QK1A 3RM0H 2AMQA 4P00A 2B0FA 1TBZH 1UVSH 1ZGIA 2BHGA 2ZP0H 7LPRA 4Y79A 2O8TA 1H8HD 1JBUH 1O3JA 3O8DA 2QF4A 1UHBA 5C1YA 1UVPA 1DSUA 5EQQA 1FZZA 1P9UA 3HKIB 2B9LA 1P01A 3F1SB 1C2IA 3Q76A 3SYJA 3V13A 5CMXH 3EAJA 2HRVA 2CHAC 7ESTE 1VCQA 2ZF0H 1OWIA 4JK6A 3ZZDA 1LPGB 1B0EA 1KMHB 2ZHEH 3EYDA 2IJOB 4CRAA 3BTGE 1C2FA 1MCVA 1ZHPA 3ZVBA 3SZNA 1MTNC 4ISHH 2XWAA 3MYWA 3U8OH 4BXSA 1D6WA 1ANDA 2XW9A 1GMDF 2XXLA 3SUGA 3GYLB 1CBWC 3L6PA 3H7TA 3TJOA 8ESTE 2VIOA 1AQ7A 3C27B 1TMUH 3FAOA 4BAKB 1CGJE 1GDNA 1HJ8A 5C3NA 1Y3VA 3R0FA 4D7FA 4MG3A 2ESTE 2PHBA 1QZ8A 1GCTB 1YKTA 2C8XB 4Q63A 4A92A 5A8XA 1CHOF 1V2TT 2A4QA 4UFFH 5DP3A 1HB0B 1H9HE 5T3HA 1F0RA 3H09A 1AD8H 4U01A 2QF3A 5DP7A 1C2JA 2ANKH 3RXLA 2A4OA 1LHDH 1L4ZA 1DSTA 1NT1A 2EI6A 2R3YA 2EA3A 1CHGA 2W5EA 3M36A 5AFYH 4AORA 1BMMH 1ZHRA 1GJ7B 4BAOB 1NZQH 2K7XA 2M5TA 5J4SA 2BY7X 5ESTE 2OUAA 1O2HA 3QTOH 2BY8X 1ABJH 2V7QD 1YM0A 2A4GA 2IJD1 4AYVB 3DT0H 1BDAA 1C5PA 2BOHB 3NUMA 1QRWA 1HAVA 2BD9A 1A0LA 1O35A 2BTCE 3T5FH 3BF6H 4YZUA 4MNVA 1O39A 1TRMA 1Y8TA 1O2TA 4GPGA 2G4TA 4O3TA 3L33A 1GJ6A 3ATLA 3ATKA 2Z9KA 3TH4H 1THPB 2ZFTA 2PUXB 1C2DA 2ULLA 1O3LA 2BDCA 4FVBA 2A7CA 2JH6D 2THFB 2J2UA 1OP0A 1NROH 2HLDD 1RTFB 2WHXA 5E0JA 2FLBH 4MTBA 4ZCNA 4CR5A 3KNXA 4ZH8A 2JDID 1O2RA 1LKBA 2FZZA 4X1PU 1AWFH 3PRDA 1MTSA 4WH8A 5F8XA 3UOUA 3F68H 2V3MA 2BM2A 2ZPSA 3ZYEA 1J15A 4Y0YE 4GLYA 3G01A 2NU2E 1A2CH 5FBIA 3T62A 1ELEE 5FXLA 2SGPE 1GBKA 3ENSB 1HAPH 3UWIA 1ZGVA 1SC8U 4IC5A 6LPRA 3P92A 1B0FA 1BRUP 3QN7A 1EAWA 1GMCF 3RM2H 3KQBA 1G36A 1O3OA 3CENA 1UK2A 3DCLA 3KIDU 1Z6JH 1GJ5H 1TIOA 2ZU2A 1SGYE 1L1NA 3SQEE 1K1NA 1XKBC 2EI7A 1VITF 2STBE 4ZMAH 1O2MA 4ABGA 2BY5X 2QV1A 1JRSA 1AI8H 2A7HA 1JXPA 2VGCB 1HRTH 1UVUH 1NRSH 4GHTA 1EAIA 1DFPA 2FP7B 3SUFA 4RN6A 3MWIU 2VH0A 3A80A 2W3IA 1C1TA 2ZDMA 2ZDNA 2O9QA 3MO3A 1S0RA 4UFDH 4OS6A 4ISOA 2AH4X 2ANYA 4NA9H 1IQJA 2A32A 1FMGA 3RMNH 2QC2A 4I8HA 2J34A 2R2WU 3LT3A 1AGJA 4FXGH 4BAMB 1A46H 4IC6A 3FKSD 2BD2A 4X2VA 4X2YA 5GPIB 2I6SA 1E79D 1LMWB 1O2QA 3PV5A 1NRNH 1VITH 1LHEH 1O5BB 4R8TB 1YLDA 2A0QB 2CHAB 2FXRA 4CRBA 1DVAH 3MOCA 1TGNA 3V0XA 1AFQC 1XMNB 2BDBA 3PTBA 1EOLA 4O03A 2CJIA 4JCNA 5GIBA 1AB9B 4XOJA 3TJUA 3P8OA 1UCYH 3F9FA 4ISNA 3OEED 1AIXH 1EZSC 1MTUA 1UTQA 2GCTC 4RKJB 5ESBA 3F2HA 1AN1E 1G9IE 1SLWB 2WUBA 1XXDA 1ABIH 1PFXC 5A8ZA 3OX7U 5JBAS 4KTUA 3BG8A 3EQ0H 3H7OA 5HGGA 1C1WH 4R0IA 2PKSB 5EOKA 1H9IE 1GCDA 4WXIA 1OWJA 4B6EA 3MU4A 3PV2A 4D9QA 1UTMA 4X6NA 2AGIX 4B2BA 2FOAA 4OS7A 1QFKH 1KDQA 4TY7A 3PMJA 1KXBA 2SNVA 5EW1H 1TNHA 1QB9A 2O8WA 1WU1A 3ZZ7A 2IOTA 3O8RA 3TH2H 1O5EH 2F9BH 3SJKA 4MNWA 5HIYA 3C1KA 5E0GA 1U6QA 4DY7B 3LH1A 2J9NA 2ZGBH 3RDZA 3RXEA 2C8ZB 4MPUA 3BIVH 1THRH 2FTMA 3U98H 4AYYB 2ZI2H 3A87A 2CV3A 1GI4A 2BDIA 1MZDA 4THNH 7GCHF 2A2XH 1EPTB 5AF9H 2ZC9H 4KTSA 1C5WB 2CXVA 4DIHH 2ZDKA 3LC3A 4I8LA 1O0DH 2C90B 2H9TH 3EA7A 2Q6FA 3UR9A 1P2MA 3RXOA 1P3EA 1E0FD 1DY9A 2ZDAH 1Z8IB 1H4WA 1AY6H 1LPKB 5EXNA 1F92A 2B8OH 4BAHB 2CF8H 4AFUA 1Z1IA 1P06A 3EA8A 3AVZA 1S84A 2BDGA 4AN7A 3VFEA 3WWBA 3M5LA 3OU0A 5GCHG 1XKAC 1NFXA 4X2XA 3CP7A 2KAIA 1QURH 2KM0A 1RIWB 1CT4E 4U30A 4X2WA 4ZHMU 4ZHLU 1BTHH 1VCPA 4HTCH 3SORA 1JOUB 3EE0B 2G5NA 2FMJA 4AX9H 3ZVEA 1ESAA 3SU5A 2OD3B 1ELVA 4AB8A 1V2ST 1K0HA 1O3CA 3LGVA 4FUJA 3BTDE 1E35B 3LJOA 4X6PA 2AS9A 3A7WA 1ZMLA 2AEIH 1GJ8B 2W3KA 2R0KA 2EI8A 4NA8A 4NZQA 2QF0A 2F3CE 2UWPA 1IQGA 1MH0A 1ANEA 5EXMA 8GCHF 2PTNA 4I32A 3M3TA
chains in the Genus database with same CATH topology
1DICA 1HPGA 1W14U 3LH3A 1ZSLA 1RTKA 3HK3B 1UTNA 3BG4C 3HPTB 4LOYH 1GMDG 2ZHQH 5DGJA 3P70B 1C1UH 1J16A 1RTLA 3V12A 1HAOH 1D4PB 3P8GA 2OCVB 1C1PA 1SQOA 3QO6A 2ILNA 3ZVGA 3SO3A 1V2UT 3IITA 1O2XA 1TPOA 2JH5D 3DUXH 1G3EA 3RP2A 4O3UA 1A3EH 4YOGA 3SJOA 4XFQA 4GAWA 1WTGH 3RXAA 1V2KT 4GCHF 2P8OC 4F49A 3TGKE 1LO6A 4ZKRU 3DFLA 3BEIB 3ESTA 2UWLA 8LPRA 2VB0A 4UFGH 1ELBA 2TPIZ 4YOJA 1UTKA 4JZIA 4YESB 1RGQA 1OP8A 4X8TH 1CA0B 4Y7AA 4UONA 1RIWC 2FPZA 2OP9A 2OC0A 2ZPRA 1TBQH 4HFPB 3VB7A 1CU1A 1NRQH 3PYHA 1O32A 1TFXA 2OBOA 2BMGB 3K6YA 3NCLA 2ZTYA 1EQ9A 4UDWH 2V6NA 1Y3WA 4INHA 3RC6A 1BMNH 1ZR0A 2VVVA 3LU9B 1OPHB 2BYAX 3MO6A 2GX4A 1C4V2 2ZFFH 3ZZ4A 4GUXA 2XCFA 1TAWA 1GHWH 4MLFB 1TNJA 4BOHA 5JBCS 1UO6A 4VGCC 1VGCB 3E3TA 1DLEA 1TRNA 3LDXH 3DHKH 1ZJDA 1V2PT 1D9IA 1QBVH 4INLA 4B2CA 2ZA5A 1P12E 2VVUA 5LPRA 2BLWA 3MTYA 1GL1A 4Y8YA 5FCKA 1O5CB 1ZTLA 5L6NH 1PPBH 2PWXA 1ELDE 1P2OA 4X8UH 4JYTA 2VH6A 1ZSJA 1O2OA 1X7AC 4H6SB 1TNIA 4MPVA 3ZZBA 2OTVA 1TMTH 3FP6E 2TGDA 1QIXB 3NZIA 1DANH 1YPEH 4JMYA 4SGAE 3VGCB 4FUHA 3RXTA 1C1SA 4BXWA 1J9CH 1TPAE 2P3FH 2VNTA 2ZTXA 5FX6A 1AZZA 1BHXF 1GMHF 1UCYE 1SGCA 1ZOMA 2RA3A 2P93A 5FX5A 2F9UA 4KELA 1MKXK 1TPSA 1HV7A 1P09A 4MVNA 1A3BH 4MDSA 1C1MA 4CBOA 2XC5A 4JYVH 4X1SU 1C1NA 1LTOA 2ZCLP 2ZWLH 1VZQH 4UD9H 1N8OB 2UUYA 1OP2A 2Y6TA 3U9AH 1O37A 5JBBS 1SI5H 2OINA 2ZKSA 4A1TA 1VJAU 4INKA 3E16B 1O2VA 5DP6A 2FOCA 3HATH 5C5NA 2CGAA 2HVXA 1SFIA 1CT0E 1GI1A 3BTTE 3MH5A 2ZEBA 2TGTA 1A0HB 1CA8B 1HAVB 3UREA 4X6MA 4A1VA 1S85A 1TBRH 2XC4A 4CHAB 2RDLA 4I31A 3K6ZA 3M5MA 4IGDA 2ZECA 2UUKB 3LGUA 2PKAB 4D9RA 5DJ7A 3MNBA 1G3DA 5I46H 2AERH 1NTPA 2P59A 1K1IA 1P9SA 1BCUH 1C5SA 4AG1A 3I78A 1AHTH 1NFUA 1D3DB 1INCA 2D2DA 1AVXA 4J2YB 1GI5A 1GI2A 5C1UA 1BRAA 1FJSA 1BBRK 2FEQH 4WVPE 2C3SA 1HJ9A 2LIZA 1FY3A 1YPLH 2P3TB 4DW2U 4AOQA 3BTME 1W11U 5EPYA 1BMAA 2FI5E 4B1TA 3A81A 3LJJA 4ABFA 1XVOA 1BZXE 2NU3E 3BTHE 4CR9A 1BTZA 1ZPCA 1FY1A 2GDDA 3ZZCA 1AB9C 1ELAA 1AFEH 4K1TA 1IQIA 1YCPK 1QQ4A 3RXCA 1AKSB 3U1IB 2F9VA 1RD3B 3MNXA 1EOJA 1TLDA 2OQ5A 1QQUA 1O3KA 3B23B 3VXFH 1EZQA 2FS8A 1BTYA 1EAXA 3RXMA 3BTFE 2ZZUH 1BQYA 2G55A 2WINI 3SV7A 1HJAB 1SG8B 1QBNA 3M3SA 1Z8GA 1IQEA 4NIWA 4GHQA 4I8JA 5F6MA 3WY8A 4NGAH 3QDZB 2VIVA 2ALVA 1ARBA 1CGHA 3P6ZB 2GCHG 1MQ6A 4I7YH 3SUEA 2SGQE 3PB1E 3GY4A 3A89A 3GCTF 5EQRA 5DP5A 1T4VH 3F9EA 2YNAA 3UR6A 1G2LA 2G51A 4KGAA 5CE1A 1IAUA 1NFYA 1PQ5A 2Y7XA 1FDPA 3CS0A 3UQOA 2CN0H 3RXQA 1SQTA 4Y11E 2HNTE 3MU0A 2SNWA 5GCHF 2Y81A 3UPEA 5HYOA 6CHAB 2P3UB 1BRBE 3GDVA 1T31A 1W10U 2P95A 3I29A 4JZFH 1QR3E 3SU3A 2BQ6B 1SGPE 3M35A 1NRRH 2BVRH 1UTOA 2K1QA 2FM2A 4KKDA 3ZZ5A 1B7XB 4Y76A 1QNJA 2QXGA 4UE7H 2Z3CA 2GV6A 1EX3A 5ETXA 2QY0B 5EGMA 1DX5M 1G37A 1GBTA 2JETC 1QB1A 3E6PH 4Y8XA 1P05A 1BOQA 4X1NU 3NPSA 1GCTC 3MMGA 3A7VA 4NA7A 3GDUA 1Y3UA 1CVWH 1UTLM 4Q7YA 4A7IB 3AW1A 3T25A 1O2IA 4BTTB 3FP8E 1P57B 3RXUA 5FBEA 2FOBA 3ATWA 2D26C 1ZTKA 2BDHA 2BDYA 1OKXA 2HWLB 1NFWA 1SFQB 2B7DH 4NZLA 3FZZA 1DY8A 1MKWK 1O31A 1AFQB 4JZEH 1C5OH 2CF9H 3B8JA 3ZZ8A 3GY8A 1RJXB 1MQ5A 1Y3XA 3UWJH 2FOEA 3CS7A 1KXDA 2GTBA 4MNXA 3GCHC 5F03A 1O2JA 3H5CB 4BAQB 1F7ZA 1DWBH 2H6MA 1TNLA 3LGTA 3S0NA 4B2AA 1O3NA 1FAKH 1P2IA 5C2ZA 3O8CA 2FIRH 1DE7H 1ESTA 2IPHA 1DWDH 1ZRKA 4FUIA 3S9AA 3LC5A 1ELCA 3KCGH 4OGYA 1SOZA 1C2EA 1DT2A 1Y59T 2R3UA 3PMHB 3MNCA 1OOKB 5BPEA 3NK8A 1P3CA 3VB3A 1PYTD 1W0YH 2STAE 1UTJA 4Q7ZA 5FCRA 2P8OB 2XC0A 5FPYA 1TOMH 5A09A 2Z94A 1QB6A 1K1JA 2V35A 3OSYA 2H9HA 1A1RA 1T8MA 1ARCA 5E0HA 4IW4E 1FNIA 2BD3A 2C8WB 1F0TA 1B5GH 2KAIB 2JKHA 2GT7A 1AE5A 2HGTH 2FYRA 1KLJH 1KLIH 3ZVAA 1C1OA 2GT8A 2PFEA 3GCHB 4NWLA 3SU6A 1TGSZ 4LXBH 1OXGA 1IQKA 1ZYOA 1T32A 1WBGB 2B5TB 3GY7A 5FPTA 1QBOA 4DVAU 2FS9A 2VWMA 2QXHA 5HM2A 1TABE 5EXLA 1GDUA 2VVCA 1QJ6B 2NWNA 1O34A 1SGFG 3TVJB 4ISIH 1QJ1B 4JZDH 2QAAA 4O9VA 2YNBA 4BTIB 1ZRBA 3SQHE 1O5DH 1V2NT 1GI0A 3ZV9A 3SNEA 4D7GA 1G30B 1JRTA 2AMPA 1L1GA 7KMEH 2AFQB 2G8TA 3ZYDA 1YPMH 2WPMS 2TGAA 4Y6DA 2VU8E 1ETSH 1GDQA 3URDA 1O2PA 1GHAG 4X0WU 4DT7B 1SGTA 3SJ8A 3KF2A 2O8LA 3PMAB 3U1JB 2QIQA 1H1BA 3SV2H 4U32A 3T28A 4NSVA 3GISB 1MMJN 1EATA 1ANBA 1D3TB 2FOFA 1MZAA 4WWYA 2ALPA 3A84A 5GDSH 4ABAA 1FXYA 4TPIZ 2VIWA 2ZTZA 3GCOA 1IHSH 1KLTA 3AAUA 2FLRH 1O5GH 1J14A 1CO7E 1L0ZA 1MAYA 2ZNKH 3FP7E 1WCZA 4K5ZA 3TITA 1HLTH 1BRCE 2BZAA 1GBLA 1NM6A 3E8LA 2WUCA 3GY3A 5JPMH 3IG6B 2A2QH 1Y5AT 1ANCA 2ZO3H 3SV9A 3TNSA 1SBWA 1NY22 3BSQA 2R2MB 2CMYA 1OSSA 4YM9A 2Y82A 2ZGHA 1FONA 1SGRE 1ELTA 3TPIZ 1Q3XA 3R3GB 5BRRE 3TGIE 1PYTC 1PPFE 1TALA 4AZ2B 4LZ4B 1EXFA 1P2NA 3SW2B 1TX6A 1V2OT 1WTHD 4X1RU 1KYNA 1HXFH 2W26A 3Q3XA 2GP9B 3PWBA 4WY3A 1T8LA 3FANA 3BTQE 1SGDE 2HPQH 4E05H 2BZ6H 4CBNA 3GY6A 1DITH 3SJ9A 3PWCA 3JZ2B 5C1XA 4SGBE 1GI9B 3M37A 3LIWA 2ODQA 1QY6A 4ZROA 2A1DB 2BVXH 1BTUA 4HGCA 1LVYA 1O3IA 2QYIA 3FFGA 2ANMH 2GDEH 3E91A 2GCHF 4XBCA 1UTPA 3U69H 1FI8A 1EASA 4BANB 2TIOA 2A45B 1BT7A 3QZRA 1PPGE 3SNBA 4ABEA 1CBWB 2SFAA 1IQFA 1W8BH 3BTKE 1P0SH 1GJDB 3UY9A 3UFAA 2GMTB 1IOEA 3MH7A 2ZHWH 1JIRA 3TNTA 1AE8H 2XTTB 1EP5A 1O3GA 1O33A 6GCHG 4OS5A 2R0LA 1P2QA 2IN2A 2ZGCA 1GBFA 4ABHA 3ELAH 1V2WT 3A82A 1HCGA 3E90B 3QTVH 2V3OH 1ZPBA 1EPTC 3PM3A 2BLVA 1C2MA 3MNSA 4YLUA 2ZFRH 3KQEA 4WJG2 3RXBA 1MAXA 1UVOA 5E2OA 3UUZA 3MU5A 1CT2E 1UHBB 4CREA 9ESTA 1S82A 1YYY1 4LZ1H 3W94A 5AVDA 3A7TA 1Q31A 3HGNA 1G2MA 5DKMA 3HKJB 2FX6A 3RXFA 5IDKA 1GBCA 2TGPZ 2W7UA 2WPKS 2H2ZA 2D1JA 4VGCB 1MKWH 1LQEA 2A4RA 1EAUA 2WV4A 2Z3EA 1XUJA 3A85A 1TNKA 4X1QU 1SVPA 3D23A 1LQDB 1WV7H 3L3TA 1TX7A 3M5OA 1V2RT 4XE4A 2A31A 3RXSA 1V3XA 2AIPA 1P2KA 3K9XB 1XX9A 1XM1A 3Q3YA 3RU4D 3RXPA 3QWCH 4B76A 4AFSA 2A5AA 1WYKA 1ELGA 2ZU5A 1UMAH 1NC6A 1TYNA 4ABJA 5JDUB 4FU7A 2F91A 1O3BA 1OX1A 1SR5C 2F9OA 4BTUB 2ODPA 3OTJE 5A0CA 1HBTH 2VWOA 2JETB 1YPJH 1TQ7B 5G4BA 3E0NB 2Z9LA 1TX8A 4K3JA 2WPJS 1MBQA 1T8OA 1L1JA 2FX4A 3M7UA 2ZFPH 1O38A 1Z8JB 2OC7A 1OYTH 3Q3KA 1OYQA 5HMAA 1QRXA 4IBLH 1V2VT 4ZKSU 1IHTH 3BTEE 1O2YA 1T8NA 2PV9B 2V3HH 1V2LT 2ZU4A 5DP8A 1XUFA 1HAYB 1IQMA 2P16A 3DFJA 2A5IA 1MTWA 1GJBB 2Z9GA 1ZTJA 2OLGA 3ATIA 4NIVA 3GOVB 4ABDA 1AMHA 1ZMNA 2XYAA 1FIWA 4Q2KA 3T29A 1SGEE 1PPZA 1GI6A 3KQCA 1BJUA 5HM9A 1QCPA 2XCNA 1N8OC 1QL7A 1YLCA 2FYQA 2PW8H 2WPIS 1SGFA 3GY2A 3Q77A 2WYGA 2VWLA 3M7QA 1O2GH 5AHGH 4AG2A 2HOBA 5L30H 3E1XB 1Y5UT 3RMOH 5HXFA 3SU0A 1XUIA 1K22H 1YPGH 1BA8B 4AGJA 3S9CA 1GJ4H 3PV4A 1MD8A 1Z8RA 2FODA 1DUEA 4I8GA 4CRFA 1AUJA 4OS2A 1LVMA 2GMTC 3PLKA 3KN2A 4NCYA 4AB9A 3MU1A 1NS3A 1TOCB 1W12U 3ODDA 1FAXA 3QGNB 1MBMA 2J95A 3KL6A 4QT8C 3SGQE 1Z6EA 2TBSA 1F2SE 3A88A 3FVFB 1N6XA 1ZJKA 1O2KA 1PQAA 5FPSA 2PGBB 1K1PA 5LPEA 2NU4E 1UVTH 4GCHG 1SMFE 1YF4A 1A4WH 1YPHC 1LVBA 4ZAEA 1UJ1A 3N7OA 1MUEB 2BDAA 3GCTG 1SLVB 4Q7XA 3BEUA 2AMDA 3LOXA 2G52A 2J94A 1PPCE 1FIZA 5EPNA 1ESBA 1HAHH 4YT7H 2BQ7B 3BV9B 2FTLE 4IN2A 2XBXA 4GSOA 4DG4A 1C5UA 3LPRA 1GHBG 1TMBH 2VIQA 2Y5FA 1DUAA 4YTAA 4HI3A 1FY5A 1SGQE 1LPZB 1JIMA 1JMOH 1D6RA 2ODYB 3RXKA 1E36B 1FN8A 2ZHDA 4WMEA 2ZHFH 2RCEA 2G81E 1C5NH 1VJ9U 3TK6A 3F9GA 4XDEA 2AGEX 4NWKA 3ZVCA 1QA0A 2O8MA 1EUFA 1C5MD 1SPJA 1EJAA 1VITG 2QXJA 1TPPA 2PSXA 2FOGA 3SGAE 1ELFA 1MTNB 1GMCG 1HNEE 2SGEE 1PQ8A 3TJNA 4FUEA 2GVFA 1WQSA 4NFFA 1WOFA 1HAGE 3LGYA 2FDAA 2D8WA 1YBWA 1EZXC 1GBAA 3NWUA 1F5LA 2XWBI 3QZQA 2C93B 2V0BA 3P95A 1BBRH 4DIIH 2A5KA 4X8SH 3M61U 3MU8A 3MO9A 3TK5A 3RU4E 3A7ZA 1HAXB 2FOHA 3SUDA 1KXEA 3SN8A 2G5VA 1P02A 4X8VH 3IWMA 2ZDVH 4FUFA 1KY9A 2EEKA 1QHRB 2VGCC 4OS1A 2Y5HA 1GVZA 2SGAA 1HIAB 3SGBE 1J8AA 1WUNH 1J17T 1JWTA 2BOKA 4U2WA 2QGRA 2G4UA 3S9BA 2J92A 1GG6B 5K0HA 2ZFQH 4E7NA 3D65E 4D76A 1P10A 3A8CA 3LGWA 3SHAH 1GJAB 3SNAA 1HDTH 3SI3H 5A2MH 3LKWA 3AASA 1YCPM 1IQNA 2H1UA 5PTPA 3BTWE 5E8EH 4ABBA 1KIGH 6GCHF 1DXWA 3OY5U 3T26A 1KDQB 1GBJA 3EA9A 6CHAC 3SI4H 2BX4A 1VR1H 2BD4A 2BVSH 1MKXH 1WSSH 1K1MA 1KXAA 4WMFA 1O3FA 3K65B 1V2JT 2PGQB 2H5DA 2BXUH 1Z71A 4IMZA 1P2JA 1QRZA 1TGTA 2ZU3A 5ABWA 4B73A 4TWWA 1N6YA 4K1EA 4CRDA 3UTUH 1LVOA 3MFJA 4A6LA 3D62A 2HPPH