3TNSA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester inhibitor sg83
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of SARS-Cov main protease complexed with a series of peptidic unsaturated esters
rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SARS coronavirus main protease
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3tnsA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tnsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tnsA02
2BX3A 1GBEA 4INHA 2Y82A 1V2MT 3SV6A 1O2SA 1NTPA 4CBOA 1EJMA 1G3EA 1SGYE 4DVAU 2Z3EA 1EPTC 2QA9E 4NIVA 1O3AA 4Z6AH 1W0YH 1Y59T 5TJXA 1GJAB 1NRPH 3LGTA 1A0JA 1CBWB 5AFZH 1LCYA 3P95A 2RA3A 4K2YA 1HGTH 1QJ7B 3S0NA 1O2UA 1EB1H 3SQEE 2OBQA 4UFFH 2ZG0H 1HAZB 1TGTA 1GBBA 1TNIA 1AE8H 1FQ3A 1ZGVA 4X1QU 1H8DH 3RDZA 1ZHMA 1CBWC 1O2NA 2EEKA 2P3TB 1DY8A 3TJUA 2HOBA 3SNDA 2ZU2A 1H8IH 1MCTA 5EOKA 1FIWA 4RSPA 1ZPBA 5GIBA 3NPSA 4WXVA 4Q7YA 1GBLA 4BNRA 1O36A 1FPHH 3PB1E 1EAUA 1CHOF 3U8TH 5FAHA 2ANWA 2XC4A 1YGCH 1FUJA 3SU5A 1V2WT 1BMNH 4O97A 1EASA 1HCGA 1A5GH 1P57B 1GJ7B 1O2OA 3GOVB 3MH5A 2ODQA 2BQ6B 3U1IB 2ZGXH 3GCTF 4ZKRU 2BY5X 1EAIA 3LJOA 3RXDA 1D9IA 3ESTA 3E6PH 4AGJA 3BG4C 1P9UA 2BXUH 1SQOA 5DK1A 1UTPA 1PPFE 3E91A 3ATKA 2W5EA 1F2SE 4UFEH 3SBKA 4ZKSU 4DJZB 3BTME 1H9IE 3M35A 3V0XA 2BZAA 4NIXA 1F5LA 2PKSB 3KNXA 4UFDH 2AH4X 4DY7B 1QRZA 1LDTT 1TGSZ 2BVRH 1S0QA 1FXYA 2XCNA 1KXAA 3VB3A 1JXPA 3PYHA 1MBQA 4IS5A 5FX5A 4ABIA 1S5SA 5DP5A 2RDLA 5C1XA 1DX5M 1MTVA 2ZU5A 1C1QA 1OWHA 1AN1E 2Y6TA 4M7GA 2O8UA 3STJA 4NSVA 2VIDA 1NZQH 3RXIA 1Q2WA 1QTFA 1QURH 5IYTA 4WWYA 4UONA 4CRBA 4FUBA 2AYWA 3ITIA 1GJBB 7LPRA 1WV7H 2GV6A 3R0FA 4E06H 1ELAA 1SHHB 1XVMA 1M9UA 4X1SU 2CN0H 1DWBH 1VITF 2Y7ZA 3SGBE 1RIWB 2ZZUH 3BTDE 3S9AA 4CBNA 2QC2A 1F0SA 2OP9A 1W3CA 1SHYA 2WV4A 2O8WA 1P2NA 1MKXK 2C8YB 2PGBB 3DFJA 2B0FA 4R0IA 3SQHE 2QXJA 3ZVBA 3UUZA 2C93B 2Z6BD 3E1XB 5LH8A 4I31A 4YO9A 5EPNA 1ELBA 2FYQA 2XYAA 2ZHDA 4BXWA 3UR6A 1Z8GA 3RXCA 1IHTH 3BIVH 1TX8A 4U2WA 3RXRA 4ABEA 4AG1A 3QGJA 4SGBE 3V13A 4GPGA 3T29A 3CS0A 1QHRB 2ZQ2A 1SGFG 1G2MA 1S6FA 1TX7A 2A7JA 2J4IA 3TITA 1BQYA 1TPPA 1KDQB 1TOMH 3SO3A 4WMFA 5LGOA 5DKMA 1CT4E 2AGGX 2BD2A 2F9NA 3TK6A 2CMYA 1FJSA 1NFWA 4XOJA 2ULLA 3UPEA 2D2DA 3TLOA 2BX4A 1MUEB 2GT7A 1DICA 1S83A 3VB7A 1JBUH 1FV9A 3SGQE 5A8YA 1GMHF 1ZMNA 3GICB 3NKKA 4A6LA 4CRAA 4R8TB 3JZ2B 1SQAA 2YNBA 1CQQA 2ILNA 2QF0A 1TGBA 4BTIB 3M37A 5A09A 1QBOA 1P2QA 2ALVA 3A7XA 3RU4T 4CRDA 3TPIZ 4B2AA 3Q3KA 3M3TA 4ZXYH 3A8CA 1X7AC 1P9SA 1BMMH 4WVPE 3SU0A 3PWBA 2ZPSA 1MTUA 1Z8IB 2UUYA 1DXWA 1RD3B 3FFGA 4NG9H 3SN8A 1GCTC 1TWXB 2BY8X 3AVZA 1AQ7A 2UWLA 2BLOA 1TX6A 3SV2H 2BDAA 2ZHQH 3RXQA 3L6PA 1OP2A 3UNSA 3UWIA 1O2HA 2H1UA 2GMTC 2H5DA 3H7TA 4FVDA 3UQOA 1SGEE 1FONA 2ZDAH 3RXTA 1LKBA 2BY7X 1TQ0B 2PSYA 2BD5A 4FU7A 4AFUA 4WJG2 3W95A 1UHBA 3E0NB 1BJUA 1NU7B 3F1SB 1QRXA 2UUKB 4H6SB 4JZ1A 1XUHA 4F49A 1GHAG 2QY0B 1S82A 1G36A 1O3GA 3KQEA 2ZDLA 1ZRBA 1K1LA 2JETC 1HIAB 2VU8E 4B1TA 4Y0YE 1RTKA 2BVSH 1EKBB 3NCLA 1GHXH 2NWNA 3M3SA 1JWTA 2VWNA 3A84A 1TOCB 3RMMH 1EB2A 1AKSA 2A2XH 5ESTE 1V2UT 1GBAA 4TY7A 3BTQE 1BZXE 3KF2A 5DPAA 5LPFA 4CREA 5AFYH 2FI4E 1TBZH 1ZRKA 3SORA 1LVOA 4CH2B 2BVXH 1C1SA 2EC9H 2G55A 3OU0A 4O9VA 4TY6A 5HM2A 2A5IA 3RXLA 4JMYA 4AFSA 2B8OH 3T27A 3ZVGA 1K9OE 1OYQA 1TPAE 1IQGA 1SLVB 2Z9KA 1W7XH 1DDJA 1AKSB 3A7ZA 1HAIH 3PROA 3RM2H 1P2KA 1RIWC 2QXIA 2A32A 3BEUA 4K60A 4GAWA 3GDUA 2FESH 1GDQA 1C1PA 1NESE 1WCZA 1VJ9U 4WY3A 1QJ6B 3PTBA 4DOQA 2J2UA 3FZZA 5EGMA 1CA0B 3U8OH 1O5EH 1Y3WA 4O3UA 1EOLA 3P6ZB 4ZKOU 4JYVH 2HNTE 1BT7A 3MOCA 1EPTB 1FY4A 3TJOA 1C2EA 3QTOH 1DUEA 2WPLS 1MD8A 1D3QB 1SGIB 1O3MA 4OS1A 1F0RA 3QUMP 5L2ZH 8LPRA 1FNIA 1GI4A 1O35A 4HGCA 2DE9A 1IOEA 1AIXH 2VVVA 4BXSA 1HAPH 1PQAA 3CS7A 1BBRH 1NN6A 3H5CB 1DXPA 4IW4E 1BB0B 1C5QA 3A83A 3KHVA 9LPRA 2ODYB 5CMXH 3B23B 4U32A 3SI3H 2BDYA 1TYNA 4BTUB 4ZROA 1ESAA 1QA7A 3TNTA 2FS9A 4CHAB 4WH8A 1G30B 2GV7A 4IN2A 2P59A 1E37B 4MVNA 1LO6A 4YOIA 2H6MA 2CGAA 2VIPA 1ZTLA 3O8DA 2OC0A 4X6MA 1W2KH 2R2MB 1B7XB 1YP9A 3P92A 1MKWH 1GVLA 4NIYA 4A1TA 1BTUA 1JOUB 3R3GB 1SGDE 1YPGH 1LVYA 3A85A 3VB4A 1KLJH 1XKBC 2BDBA 4ZAEA 3IWMA 1J8AA 1P2JA 1AB9C 1AWHB 1RGQA 2A1DB 4JZFH 1OWDA 1NT1A 3MNSA 3I78A 1GL0E 4MNVA 4ABAA 1HAHH 4Q7ZA 5DP6A 2K1QA 1GDUA 1ARCA 4JK6A 1YCPK 2H9EH 1QL8A 1TNKA 3M5LA 3T28A 6ESTA 2F9BH 8KME2 1A4WH 4ISIH 1BMAA 1UTJA 2G8TA 2A4OA 3UOUA 2G4UA 6GCHF 4K1SA 2SGPE 5HYOA 4E05H 4BOHA 2AFQB 1O3DA 1AMHA 2FI3E 5JYIA 2STBE 2W26A 1GJ8B 3ZZBA 5F8XA 1MTNB 2K7XA 2XBVA 1YKTA 2R0KA 3SV9A 3QN7A 4FU9A 1O5GH 2XWBI 4YESB 1Z1IA 1K22H 2GZ8A 1G3DA 3PMHB 4ZKNU 6GCHG 1IQJA 3WY8A 1RXPA 2BOKA 3MO6A 1A5IA 1P0SH 3OYPA 1CVWH 5CHAC 1GHYH 4BAQB 4GLYA 3MH7A 2NU2E 1ZSJA 1ZPCA 2CF8H 4JYUH 2BDGA 1QL7A 3QZQA 4UFGH 5FXLA 1BRAA 2QAAA 2ZKSA 2Z9GA 1A3EH 2OD3B 2JH5D 3G01A 1YLDA 1UVSH 1YLCA 1BHXF 1FPCH 1UTLM 4YT6H 4INLA 3VEQB 1C5ZB 2BYAX 3ZZ4A 1BMLA 2HNTC 2GDEH 1YCPM 2ZCHP 3ZZ6A 2IPHA 2DUCA 2RG3A 1O3EA 1HNEE 2BTCE 3MYWA 2OINA 1AY6H 3P17H 2Y80A 8ESTE 3K65B 1TGNA 2LIZA 1Y5AT 1GDNA 1BTHH 4DURA 2G81E 1P8VC 3ZV8A 2ZF0H 5EQQA 5F8TA 4CR5A 7GCHF 3FP8E 1YPEH 3BTFE 3ZVCA 1CGJE 1K1MA 1O2KA 3S69A 1V2QT 2BZ6H 4Z0KA 2PKAA 1A0LA 3PO1C 1WOFA 4YLQH 2BMGB 2EA3A 3RLWH 3PMAB 2XBWA 1UCYE 2C8XB 1UVOA 5CHAB 1C9PA 3AASA 3RXGA 2M5TA 1ELFA 4K69A 4H42U 5HGGA 4MDSA 1QA0A 2ZU1A 8GCHF 1V6DA 2P8OB 5E0HA 5EXNA 1O2JA 1ORFA 5C1UA 5E2PA 5FPYA 5C1YA 5L6NH 1AWFH 1MTSA 1TNHA 1DUAA 1O5FH 2PLXA 1UTOA 3URCA 4NZQA 3RXEA 1FY3A 4CH8B 1PYTC 3PLPA 5GWZA 1K2I1 2ESTE 3BTWE 5A0BA 2FLRH 4H6TA 1QBVH 1MD7A 2VH0A 3QX5H 3UFAA 4KGAA 1TGCA 1C2KA 4DGJA 3H7OA 1UTMA 2ZHWH 5BRRE 1GBDA 5DP9A 1GBJA 4JCNA 1C1OA 3LGYA 1QGFA 3EAJA 2C90B 3ZZ9A 2FZZA 1V2ST 1N8OB 1Z71A 2PR3A 3HPTB 1V2KT 1CT0E 2RCEA 4OS2A 5C5OA 1ZOMA 4Y7AA 3T2NA 4ABHA 2FS8A 1C4U2 3TH4H 3TU7H 2GZ7A 2ZWLH 3KQCA 2THFB 2ZPQA 1XMNB 4LOYH 2ZO3H 1P09A 3GCNA 4O03A 4IC5A 1TB6H 5T6FA 4LZ4B 2CF9H 1NM6A 2H2ZA 1ZSKA 3MO9A 4MQAA 1GI9B 1IQNA 1DPOA 4AYVB 4B76A 5A8XA 1HFDA 3MU5A 3SV8A 2ZEBA 3LGUA 3F6UH 1LPZB 1GG6C 4UE7H 1UK2A 1WSSH 7ESTE 1C5UA 1KYNA 5FHTA 3MU1A 1W11U 1GHBG 1MCVA 1O31A 2WPHS 2ZQ1A 4B2CA 5EU8A 2AGEX 5FPSA 1O32A 5JBCS 1O5AB 1BTWA 3B9FH 4Y10E 3T5FH 1NC6A 4Q80A 1TBRH 5HMAA 1ANEA 2FX6A 1C5TA 1O3BA 3MO3A 3A7VA 2F9PA 3D65E 3BF6H 5AVDA 3V12A 3ZZDA 2GDDA 4UD9H 1FAKH 1HB0B 3E3TA 3ELAH 3HGNA 1SGCA 3BIUH 1GMCG 3MNXA 4INKA 5EQSA 1AGJA 3Q3YA 1ETTH 1Z1JA 2XNIA 4MTBA 1VGCC 2OXSA 1OYTH 2SGQE 1O5CB 1BUIA 4XFQA 1GBKA 1VITG 2BD9A 1CGIE 3ODFA 1YM0A 1MAYA 3T25A 1B0FA 2ZTZA 3F68H 3EA9A 4DG4A 4CR9A 1VR1H 1W0ZU 2ZP0H 4ZH8A 3ZZCA 1PFXC 1HAVB 1PPGE 4H4FA 1TA2A 3SU6A 3LH3A 1GPZA 1NRSH 4ISNA 3F9HA 3L33A 2GCTC 3RXPA 1SL3A 1V2RT 2ZGBH 3HKJB 4AG2A 3BTGE 3MWIU 1D3TB 1V2PT 3SU4A 4CRGA 4B75A 4AFZA 1GG6B 1C5NH 5HM9A 2FOMB 2FODA 2ALPA 3HGPA 4D9RA 1AHTH 1BTPA 1Z8JB 1Z8RA 5GCHF 1N8OC 3NZIA 3V7TA 2FOCA 6LPRA 1SQTA 1P2IA 1P11E 1VCWA 4ABBA 1BA8B 3PLKA 3HATH 1QB9A 1ELVA 1P3CA 2WPIS 2VGCC 4BAHB 3S9CA 4Y0ZE 3T26A 2ANYA 1L2EA 1ELDE 3KQBA 1MBMA 1Y5BT 4OGYA 1E35B 1V2LT 2VIWA 2GTBA 3RXFA 1L1GA 4I8KA 4FUFA 4MNYA 5F8ZA 4RKJB 5JPMH 1O2YA 1P01A 1DANH 1ABJH 5FCKA 4K3JA 2Z9IA 5L2YH 1O5BB 5F6MA 2BD4A 3PTNA 1T4VH 3MU8A 4UEHH 4XBDA 3P8OA 1DSUA 1YPJH 1AZ8A 1HAOH 3ATIA 1GI2A 3PMJA 4A1XA 1RRKA 4O3TA 1KDQA 3TJNA 2ZFRH 1S6HA 4Y11E 2AEIH 4FUIA 3M5NA 2OUAA 2QYIA 4YZUA 3FAOA 3FANA 5BPEA 3STIA 3A7YA 3LGWA 1BHXB 1ANCA 4ESTE 2Q1JA 2LPRA 4FUCA 1JRTA 2P3FH 4Y8YA 1BRCE 1SOTA 1GMDG 2VIOA 3E8LA 2BD3A 2R3YA 2FDAA 1HUTH 1C2HA 3SI4H 3T62A 1GCTB 5E0JA 1A46H 2BLWA 4AB9A 1XXDA 3RC5A 3TJVA 1FMGA 2FIRH 5EPYA 1OSSA 1SMFE 3GY8A 4WF8A 2GCHF 2OC7A 1GHVH 3UOPA 3VGCC 1GMDF 4Y8XA 1G3BA 1GJ4H 3LT3A 2F9UA 2O9QA 3D62A 1OP8A 4BAKB 7KMEH 2F83A 4AZ2B 2PW8H 3FP7E 1KTSB 1K1PA 1Y8TA 2GCHG 3MHWU 1A7SA 3EA7A 3E16B 3RMNH 1YF4A 2FLBH 1EAXA 1PPHE 2XC5A 4AN7A 2V0BA 1XVOA 1WYKA 4KKDA 1NS3A 1QNJA 2VH6A 2SGFE 2UUJB 1BRBE 4THNH 2D8WA 1MQ6A 1QCPA 1YPHE 1ARBA 4VGCB 1GGDB 1H9HE 1SB1H 2BDHA 2CXVA 4JK5A 1KLIH 3S7HB 1TLDA 3ENSB 3P8GA 3GYLB 1TALA 1T8OA 3QO6A 3Q76A 4B71A 1GI1A 1AUJA 1QJ1B 1IQFA 1P02A 1O34A 2B5TB 3VPKA 4RN6A 2VGCB 1K21H 2PGQB 4I32A 2FP7B 3KQDA 2HPQH 1AO5A 3TGKE 3HK6B 1HLTH 2XWAA 1LVMA 4HI3A 1UMAH 1GWAA 2R0LA 2OQUA 4JYTA 3QZRA 1G9IE 3NUMA 5L30H 3PO1B 1F5RA 2VWOA 4MPUA 1GCDA 2ZTXA 5ESBA 1IQIA 3E90B 4GSOA 2GVFA 1O3NA 1BBRK 4I8GA 1QFKH 1O2XA 3NK8A 1WBGB 3SNAA 1NU9A 3MMGA 2G4TA 1PQ5A 4Y71A 1O3FA 1O39A 1ANDA 1BRUP 4ABJA 1A1RA 4TPIZ 1OXGA 3SHAH 1FZZA 2OLGA 2ZHEH 3BEIB 3P70B 2V35A 1O2QA 3LIWA 3OY6U 3LPRA 3EA8A 2FXRA 1H9LB 1JMOH 2P93A 3SNBA 1C9TA 1SGPE 4GUXA 1E34B 1V2JT 4HTCH 5DG6A 4AOQA 1CHOG 2SGEE 3DA9B 4X8UH 3ZZ8A 2O8LA 2AMQA 4CHAC 3HK3B 1BOQA 2BLVA 2UWOA 3UQVA 5C67A 1HV7A 2ODPA 1AFEH 1Z6EA 5E8EH 1ELEE 2FOGA 1JRSA 1T31A 3ATLA 1ZMJA 1LMWB 3A7TA 3MH6A 2W7SA 3SHCH 1O2MA 3AW0A 3SJ9A 1GI0A 1L4DA 4HFPB 1AB9B 2A45B 3IG6B 2PKSC 4NA7A 1W13U 1UO6A 1EUFA 3DUXH 2UWPA 3UNRA 3SUEA 2B7DH 1TBQH 1GI6A 3F9FA 5DJ7A 1N1LA 3RXUA 3A88A 1EZQA 1XUIA 1GI3A 3LKWA 2P3UB 4WH6A 2A0QB 2WYJA 3A82A 3VXFH 4E7RG 2TRMA 3OSYA 4K5ZA 3GY3A 2Z3DA 3SUFA 1C5SA 1OS8A 1OX1A 1EXFA 1UTQA 1UVTH 3A80A 2R3UA 3OTJE 3ZYEA 1MMJN 1ZHPA 1HXFH 1TNLA 3ZZAA 1FLEE 1OKXA 2R2WU 4ZHAA 3RLYH 1YPKH 2WUBA 1PPCE 2B9LA 1KLTA 1LHGH 1ZTKA 1TNGA 2C8WB 1XUKA 2A31A 1YPMH 5T3HA 3UY9A 4Y79A 4ABDA 4IBLH 4ZXXH 2ANKH 1O2TA 2FEQH 5DP3A 4IC6A 1C1WH 1O3PB 4LZ1H 3UR9A 3PMBB 2SNVA 1UJ1A 1NFYA 5IDKA 3BG8A 1ZZZA 2Y5FA 4I8LA 4ISLA 1PPBH 1DE7H 3LONA 1C4Y2 2KAIA 1IQHA 2A7CA 3Q00A 2FI5E 2NU3E 3RP2A 2QV1A 1C5OH 1ANBA 1E36B 1XX9A 2Y5GA 1V2VT 3TGIE 2Z94A 1KXBA 1A5HA 1LPGB 3GYMA 3P8FA 1Y3XA 2A4QA 3RU4D 1C5PA 4MPXA 1SGFA 1ACBE 1KIGH 1LHEH 5E2OA 1F7ZA 1MTWA 1WQSA 1AD8H 1ZSLA 2VWMA 4OS7A 2TPIZ 1HJAC 2QN5T 3RXJA 1GMCF 1KY9A 5ETXA 2FOAA 3BTEE 3KCGH 1PQ7A 1LQEA 2ZC9H 4BANB 1AU8A 3TK9A 1MKWK 4ASHA 2G5NA 4NIWA 2A4GA 4Y6DA 2PTCE 2ZFFH 1EOJA 1XKAC 5J4QA 3QK1A 1MZAA 3KN2A 1IQEA 1O37A 1FAXA 1DOJA 4MLFB 4GHTA 1XUGA 2FMJA 2TGAA 1RJXB 3SU1A 3LC5A 1DT2A 1D3DB 2ZDKA 4FVBA 1MAXA 1P06A 1YPHC 2J38A 3C27B 3NWUA 2A5KA 3M7UA 1GVZA 5LPRA 3S9BA 1ZMLA 1MH0A 1FY1A 3B8JA 5FBIA 3A8BA 3PV4A 4PROA 1FIZA 4X6NA 2FTLE 1GBIA 1INCA 1SGRE 2G5VA 2V3HH 1VGCB 4WXIA 3MI4A 1G37A 1OOKB 4JZEH 2FOBA 1HXEH 2BY6X 1TRNA 4TWYA 4X2VA 3TGJE 2NU0E 5T6DA 4MPVA 1C1UH 3M5MA 4ZMAH 4LXBH 1EX3A 1UCYK 3VGCB 1V3XA 3ZV9A 3UWJH 2W7UA 2PSXA 1LPKB 1ELTA 2OBOA 4IN1A 1W8BH 1AVGH 1O3LA 3RXBA 4NSYA 1D4PB 1O3OA 1C2FA 1HAXB 2HLCA 4KELA 1GI7B 2BXTH 2ZPRA 4J1YA 1BBRE 1SG8B 2GT8A 1VZQH 5AHGH 2SGDE 4U30A 1C5YB 1VITH 1P03A 2NU4E 3BSQA 3PWCA 1THPB 1QQUA 3MFJA 3V3MA 1L1JA 2ZDMA 1DLEA 1XM1A 1C2GA 1T8LA 1UVUH 3EE0B 3M7TA 5EW2H 4X2XA 2Y7XA 4UDWH 3GCOA 2XRCA 3HKIB 1GHAF 1SC8U 1TMTH 5DP8A 2VVCA 1E38B 3A89A 5K0HA 2XBXA 1Z6JH 2EI8A 2W3KA 2ZTYA 1F0UA 1W10U 4XSKU 3AW1A 5B6OA 3SJ8A 3I77A 1L0ZA 1OWKA 3LGIA 2ANMH 4NCYA 2OCVB 3BN9A 2ZFSA 1PYTD 2FOEA 4I33A 1O2VA 1SFQB 5EQRA 4X1RU 1C1RA 3SGAE 1A61H 1AZZA 2VVUA 1K28D 2PUXB 3GDVA 5JBAS 4KTUA 1Y3YA 1C5VA 1YBWA 2C8ZB 5DO4H 4XDEA 4NA8A 1KXDA 2LNCA 2XTTB 2WV5A 1ZGIA 1IQMA 1HAVA 3A81A 5FPTA 1SGQE 1DVAH 3ATWA 2HPPH 1C5XB 1UVPA 3AAUA 3SJIA 2HWLB 1MKXH 3ZVEA 5K7RA 2OC1A 1PPEE 1O0DH 3M7QA 5DP7A 5ABWA 5JBBS 4OS5A 5J4SA 3U98H 4DW2U 2J92A 3PM3A 1HJ8A 2BDCA 1TONA 1OP0A 1HIAA 1VJAU 1TE0A 1RTFB 3LC3A 3BEFB 2BY9X 1GJ6A 3RXAA 3SJOA 1S0RA 4AORA 1C4V2 1CO7E 1TIOA 1KXCA 5PTPA 2FYRA 3FZDA 4FU8A 1WAYB 1O3HA 4E7NA 2GP9B 3KGPA 4VGCC 2SGAA 4KTSA 1EZXC 2PFEA 4ABFA 2KAIB 4DIIH 1SLUB 3MU0A 2OTVA 2HVXA 1HAYB 4FUGA 2AMPA 3ZZ3A 1AVWA 1DLKB 4X6OA 2P8OC 3JZ1B 2EI6A 3A8DA 2VIVA 1YPLH 1C2LA 4CRFA 3RXVA 5CE1A 3O8BA 2RA0A 3S7KB 3D23A 1SSXA 2HGTH 1E0FD 1GMHG 5JBTA 1HAGE 2XCFA 4MNWA 1H1BA 2BQ7B 2IJOB 2Q6FA 3SV7A 6CHAB 1AE5A 2J34A 4X2WA 3SU2A 4U01A 4XE4A 4GVUA 5I46H 3TNSA 4HZHA 1J14A 3OX7U 1AI8H 4JZIA 2BD7A 1HBTH 4BAMB 3F9EA 1DWCH 2QGRA 2JKHA 4YM9A 1N6YA 1NRNH 3EQ0H 4AGKA 4D8NA 5JDUB 1DITH 2H9TH 1GJCB 3KEEA 1P2MA 1KXFA 4A7IB 3O8RA 4DCDA 5G4BA 1P12E 5GCHG 1SR5C 2Z7FE 2WPMS 2VINA 1YYY1 3RU4E 4NFFA 2Q6DA 1W14U 2AMDA 2ZIQH 2J95A 2I6QA 2PV9B 2O8MA 2FWWA 1ZR0A 1C5WB 1XXFA 1GJ9B 4J2YB 4ABGA 2WYGA 4YOJA 4D9QA 2ZFQH 1BITA 3MH4A 3SUGA 4AB8A 1C2IA 4X0WU 1T8NA 2AIPA 1Q3XA 1A0HB 1GHZA 5C2ZA 3EDXB 3U8RH 1G32B 3Q77A 1T32A 1QIXB 4ISOA 2AS9A 3ATMA 2BB4A 3TIUA 3LGVA 4X1PU 1Y5UT 1HDTH 4MG3A 3GCHC 5T6GA 2TBSA 3ZVAA 1W12U 1EAWA 1ID5H 3LDXH 3RMLH 1O2WA 1GHWH 1TMBH 1HYLA 2Z3CA 3F9GA 2AERH 1D3PB 5FBEA 3K6ZA 1MZDA 4KP0A 1TA6A 2ZGCA 2XBYA 2IN2A 1G3CA 1OWEA 4A92A 2ASUB 4XBBA 1ZTJA 3M5OA 1UHBB 2ZHFH 2HALA 1RFNA 1SBWA 1GBCA 2D26C 2P95A 4I8HA 3TH3H 1PQ8A 2ZECA 3BV9B 2TIOA 5SGAE 3SNEA 1LHDH 1C2DA 4GCHG 2TGDA 3RXMA 2CHAC 1B0EA 1SOZA 1J9CH 1DS2E 3A86A 1O30A 4XBCA 5FCRA 1HJAB 1QB1A 2ZDVH 3CP7A 2F3CE 4A5TS 1FN6A 4AYYB 1BCUH 1T4UH 1KTTB 2EI7A 4B2BA 1NO9H 1A2CH 1GL1A 1LKAA 2VB0A 4ZHMU 3RXOA 3LH1A 1ABIH 1D6RA 1EQ9A 7GCHG 5EW1H 2WPJS 2J94A 1C5RA 2A7HA 4I8JA 3RMOH 4K1EA 1IQLA 2G51A 1CSOE 1RS0A 3SU3A 1TQ7B 3EBNA 2ZFPH 4YTAA 1IQKA 2ZGHA 2CHAB 1CT2E 2ZNKH 1TFXA 1MU8B 2BD8A 3RM0H 1NY22 1RTLA 1C1NA 2BOHB 1GVKB 3AAVA 3URDA 1SLWB 3K6YA 2YNAA 4X6PA 4FUHA 4Q2KA 2WUCA 2Q6GA 4GHQA 2XW9A 1GBTA 3RC6A 4WMDA 1FN8A 2FOHA 1O3IA 1SPJA 3M3VA 4D76A 1XUFA 1MU6B 2SFAA 4OS6A 4LK4A 1WTHD 1ETRH 3L3TA 1EATA 1ETSH 1WUNH 1TPOA 3RUOA 1QRWA 4TPYA 3RC4A 2ZGJA 4FUEA 4X2YA 8GCHG 1ZPZA 2WINI 4SGAE 1JIRA 2D1JA 1K1JA 3SNCA 1G2LA 1BIOA 2BQWB 5I25A 1EP5A 5DP4A 4X8SH 1UK3A 2C3SA 1GI8B 5GJ4B 1ZLRA 4FUJA 1DY9A 2FTMA 1P3EA 1FI8A 1EJNA 1O3JA 3IITA 1QY6A 2JETB 1Z7KA 3QTVH 1P04A 3GCTG 1DSTA 5GDSH 4RKOB 1O38A 1UK4A 2OC8A 1C1MA 2V3OH 1V2TT 4D7FA 1ZJDA 1Y3VA 2W3IA 1O2IA 3D49H 1AFQC 2F91A 1CU1A 5EXMA 1CA0C 3SW2B 2J9NA 3UTUH 1C1TA 1YCPH 1LVBA 4X8VH 3N7OA 1NFUA 1JIMA 4IMZA 1LHCH 4IGDA 3MNCA 3GY6A 1PPZA 1L4ZA 3I29A 2ZCLP 3RXSA 3ZZ5A 1O5DH 2R9PA 3SUDA 1CE5A 1EZSC 1K1NA 3U69H 1F5KU 3VXEH 1YC0A 1NRRH 1B5GH 2H9HA 1GBMA 3GDSA 3TH2H 3KL6A 4BTTB 2QIQA 3VFEA 1K1IA 1W7GH 3RXHA 3BTHE 1NROH 1BTYA 1C5LH 2ZU4A 1AVXA 4NA9H 1EPTA 2GMTB 3DT0H 3LOXA 1TNJA 2O8TA 2GX4A 1SLXB 3Q3XA 1TRMA 1SI5H 4TWWA 1F92A 5DGJA 4B73A 4NWKA 5EODA 3K9XB 1A3BH 3ZVDA 2XC0A 1LHFH 1IAUA 1SGTA 2SNWA 4OS4A 1FY5A 1ELCA 1KSNA 1T7CA 2GD4B 3UNQA 2FPZA 2Y81A 2UUFB 2Z9JA 4FUDA 1F0TA 2P16A 4TYDA 2PWXA 3LJJA 4JZDH 4BAOB 1GGDC 1BTZA 4DT7B 4Q7XA 2WPKS 5A2MH 1O2RA 1Y3UA 5FX6A 2VNTA 4K8BA 2FX4A 1BTXA 1XUJA 2PHBA 1FDPA 1GJDB 4NFEA 1ESBA 3VB6A 1QL9A 2ZFTA 3TVJB 1O2ZA 2PUQH 5GXPA 3QDZB 3U9AH 3DHKH 1OWIA 4MPWA 3CENA 2VWLA 3ODDA 4ZUHA 1KXEA 4Y7BA 3SJKA 4NGAH 1H4WA 2F9VA 2HRVA 2BM2A 2I6SA 2GGVB 5H4IB 3ZZ7A 1P10A 3QLPH 2NU1E 2QXGA 1TMUH 2QCYA 1GBHA 2H5CA 1WTGH 5A0CA 9ESTA 3ZYDA 2IOTA 1NRQH 5JB9S 1QR3E 3QWCH 2ZCKP 5F03A 5JB8S 2C4FH 1V2NT 2TGTA 3K2UA 1N6XA 2ZI2H 3P8NA 1THSH 3A7WA 5E0GA 2Z9LA 1ELGA 1LQDB 3NXPA 1ZYOA 4A1VA 1UTNA 2TGPZ 1O3KA 3M61U 5EXLA 1MQ5A 2VJ1A 3QGNB 4NWLA 5A8ZA 3ZVFA 1CHGA 1THRH 1O2PA 3KIDU 1BJVA 4X1NU 3TK5A 3E0PB 2QXHA 4AFQA 3SOSA 4F4OC 4ZHLU 1EP6A 1UTKA 1LTOA 1PJPA 1GI5A 1SFIA 1CGHA 4DIHH 2G52A 2ZU3A 3GCHB 4MNXA 4WMEA 2QF3A 1V2OT 1NFXA 1EJAA 1WQVH 1J17T 3EYDA 4D7GA 1Q31A 1C2JA 2AGIX 5C3NA 2BLQA 1HJ9A 1HPGA 3BTTE 3GISB 5C20A 2ZA5A 4KTCA 1MTNC 1TRYA 2GKVE 5TCAA 1P05A 3FVFB 5EG4A 2JH0D 1TPSA 1C2MA 1GBFA 1O2GH 5GPIB 1HRTH 1C5MD 2PTNA 3GY5A 1SVPA 3MTYA 3A8AA 3PLBA 3A87A 3GY2A 3SZNA 2FOFA 5LPEA 1O3CA 2XXLA 1VCPA 4OGXA 1D6WA 1GHBF 1OWJA 1P2OA 1ZHRA 2F9OA 3BTKE 1QBNA 1QQ4A 1TAWA 2DE8A 3BG4B 2GCTB 1AFQB 1S85A 2BDIA 3LU9B 3DD2H 3GY4A 3RXKA 1S84A 2BHGA 1J15A 1GJ5H 1SGNE 4QT8C 2A2QH 2HNTF 3C1KA 4Y8ZA 3UIRA 1DWDH 4K1TA 1VCQA 1DWEH 4CRCA 1NPMA 4I7YH 4YT7H 2JH6D 2V6NA 2CV3A 3W94A 2OQ5A 3UREA 2CJIA 5C5NA 1OPHB 4NZLA 1QB6A 4K8YA 2STAE 4YOGA 2PKAB 4IMQA 6CHAC 2VIQA 1DM4B 1BDAA 5AF9H 1K1OA 1ZJKA 3EGKH 1DFPA 2Y5HA 4GCHF 1EZUC 1S81A 3O8CA 1AUTC 4FXGH 1WU1A 3OY5U 2ZDNA 1T8MA 1FY8E 2FM2A 3MU4A 2P94A 1J16A 4X8TH 4Y76A 1CA8B 3MNBA 5HXFA 2AIQA 4YLUA 1UCYH 2G00A 4ISHH 2FO9A 5A0AE 3VB5A 2GZ9A 1C1VH 2YOLA 3FP6E 4B74A 3GY7A 1IHSH 4AX9H 1L1NA 1O2LA 2A5AA 1ESTA 3M36A 3U1JB 1O33A 3DFLA 5TCCA 1TABE 2A4RA 1U6QA
chains in the Genus database with same CATH superfamily
3MQKC 2BX3A 1GBEA 4INHA 2Y82A 1V2MT 3SV6A 1O2SA 1NTPA 4CBOA 1EJMA 1G3EA 1SGYE 4DVAU 1K0HA 2Z3EA 1EPTC 3CNRA 2QA9E 2KFWA 2KR7A 4NIVA 1O3AA 4Z6AH 1W0YH 1Y59T 5TJXA 1GJAB 1NRPH 3LGTA 1A0JA 1CBWB 2WSSD 5AFZH 1LCYA 3P95A 2RA3A 4K2YA 1HGTH 1QJ7B 3S0NA 1O2UA 1EB1H 3SQEE 2OBQA 4UFFH 2ZG0H 1HAZB 1TGTA 1GBBA 1TNIA 2J5UA 2JJ1D 1AE8H 1FQ3A 1ZGVA 4X1QU 1H8DH 3RDZA 1ZHMA 1CBWC 1O2NA 2YMSC 2EEKA 2P3TB 1DY8A 3DSOA 3TJUA 2HOBA 3SNDA 2ZU2A 1H8IH 1MCTA 5EOKA 1FIWA 4RSPA 1ZPBA 5GIBA 3NPSA 4WXVA 4Q7YA 1GBLA 4BNRA 1O36A 1FPHH 3PB1E 1EAUA 1CHOF 3U8TH 5FAHA 2ANWA 2XC4A 1YGCH 1FUJA 3SU5A 1V2WT 1BMNH 4O97A 3N99A 1EASA 1HCGA 1A5GH 5CDFE 1P57B 2J97A 1GJ7B 1O2OA 3GOVB 3MH5A 1MABB 5C17A 2ODQA 2BQ6B 3U1IB 2ZGXH 3GCTF 4ZKRU 2BY5X 1EAIA 3LJOA 3RXDA 4RT0A 1D9IA 3ESTA 3E6PH 4AGJA 3BG4C 1P9UA 2BXUH 1SQOA 5DK1A 1UTPA 1PPFE 4FOUC 3E91A 3ATKA 2W5EA 1F2SE 4B6FA 4UFEH 3SBKA 4ZKSU 4DJZB 3BTME 1H9IE 3M35A 3V0XA 2BZAA 4NIXA 1F5LA 2PKSB 3KNXA 4UFDH 2AH4X 4DY7B 1QRZA 4F55A 1LDTT 1TGSZ 2BVRH 1S0QA 1FXYA 2XCNA 1KXAA 3VB3A 1JXPA 3PYHA 1MBQA 4IS5A 5FX5A 4ABIA 1S5SA 5DP5A 2RDLA 5C1XA 5T1VA 1DX5M 5KGOA 1MTVA 2ZU5A 1C1QA 1OWHA 1AN1E 2Y6TA 4M7GA 2O8UA 3STJA 4NSVA 2VIDA 1NZQH 3RXIA 1Q2WA 1NBMD 1QTFA 1QURH 5IYTA 4WWYA 4UONA 4CRBA 4FUBA 2AYWA 3ITIA 1GJBB 7LPRA 1WV7H 2GV6A 3R0FA 4E06H 1ELAA 1SHHB 1XVMA 1M9UA 4X1SU 2CN0H 1DWBH 1VITF 2Y7ZA 3PRDA 3SGBE 1RIWB 2ZZUH 3BTDE 3S9AA 4CBNA 2QC2A 1F0SA 2OP9A 1W3CA 1SHYA 2WV4A 2O8WA 1P2NA 1MKXK 2C8YB 2PGBB 3DFJA 2B0FA 4R0IA 5FL7D 3SQHE 2QXJA 2J98B 3UUZA 3ZVBA 2C93B 2Z6BD 3E1XB 5LH8A 4I31A 4YO9A 5EPNA 1ELBA 2FYQA 2XYAA 2ZHDA 4BXWA 3UR6A 1Z8GA 1UW7A 2L74A 3KYGA 3RXCA 1IHTH 3BIVH 1TX8A 4U2WA 3OFND 3RXRA 4ABEA 4AG1A 2XOKD 3QGJA 4SGBE 3V13A 4GPGA 3T29A 3CS0A 1QHRB 2ZQ2A 1SGFG 1G2MA 5EIYA 1S6FA 1TX7A 2A7JA 2J4IA 3TITA 1BQYA 1TPPA 1KDQB 1TOMH 3SO3A 4WMFA 4AC9A 5LGOA 5DKMA 1CT4E 2AGGX 2BD2A 2F9NA 3TK6A 2CMYA 1FJSA 1NFWA 4XOJA 2ULLA 3UPEA 2D2DA 3TLOA 2BX4A 4YXWD 1MUEB 2GT7A 1DICA 1S83A 3VB7A 1JBUH 1FV9A 3SGQE 5A8YA 1GMHF 1ZMNA 2VBCA 3GICB 3NKKA 4A6LA 4CRAA 4R8TB 3JZ2B 5EJ1A 1SQAA 2YNBA 1CQQA 2ILNA 2QF0A 1TGBA 4BTIB 3M37A 5A09A 1QBOA 1P2QA 2ALVA 3A7XA 5HIZA 3RU4T 4CRDA 3TPIZ 4B2AA 3Q3KA 3M3TA 4ZXYH 3A8CA 1X7AC 1P9SA 1BMMH 4WVPE 3SU0A 3PWBA 2ZPSA 1MTUA 1Z8IB 2UUYA 1DXWA 1RD3B 3FFGA 4NG9H 3SN8A 1GCTC 1TWXB 2BY8X 3AVZA 1AQ7A 2UWLA 2BLOA 1TX6A 3SV2H 2BDAA 2ZHQH 3RXQA 3L6PA 1OP2A 3UNSA 3UWIA 1O2HA 2H1UA 2GMTC 2H5DA 3H7TA 4FVDA 3UQOA 1SGEE 1FONA 2ZDAH 3RXTA 1LKBA 2BY7X 1TQ0B 2PSYA 2BD5A 4FU7A 4AFUA 4WJG2 3W95A 1UHBA 3E0NB 1BJUA 1NU7B 3F1SB 1QRXA 2UUKB 4H6SB 4JZ1A 3PV5A 1XUHA 4F49A 1GHAG 2QY0B 1S82A 1G36A 1O3GA 3KQEA 2ZDLA 1ZRBA 1K1LA 2JETC 1HIAB 2VU8E 2W6ID 4B1TA 4Y0YE 3EE7A 1RTKA 2BVSH 1EKBB 3NCLA 1GHXH 2NWNA 3M3SA 1JWTA 2VWNA 3A84A 1TOCB 3RMMH 1EB2A 1AKSA 2A2XH 1FX0B 5ESTE 1V2UT 1GBAA 4TY7A 3BTQE 1BZXE 3KF2A 5DPAA 5LPFA 4CREA 4ZCNA 5AFYH 2FI4E 1TBZH 1ZRKA 3SORA 1LVOA 4CH2B 2BVXH 1C1SA 2EC9H 2G55A 3OU0A 4O9VA 4TY6A 5HM2A 2A5IA 3RXLA 4JMYA 4AFSA 2B8OH 3T27A 3ZVGA 1K9OE 1OYQA 1TPAE 1IQGA 1SLVB 2Z9KA 1W7XH 1DDJA 1AKSB 3A7ZA 1HAIH 3PROA 3RM2H 1P2KA 1RIWC 2QXIA 2A32A 3BEUA 4K60A 4GAWA 3GDUA 2FESH 1GDQA 1C1PA 1NESE 1WCZA 1VJ9U 4WY3A 1QJ6B 3PTBA 4DOQA 2J2UA 3FZZA 5EGMA 1CA0B 3U8OH 1O5EH 1Y3WA 4O3UA 3AK5A 1EOLA 3P6ZB 4Q63A 4ZKOU 4JYVH 2HNTE 1BT7A 3MOCA 1EPTB 1FY4A 3TJOA 1C2EA 3QTOH 1DUEA 2WPLS 3DSGA 4DT4A 1MD8A 1D3QB 1SGIB 4F48B 1O3MA 4OS1A 1F0RA 3QUMP 5L2ZH 8LPRA 1FNIA 1GI4A 1O35A 4HGCA 5C0UA 2DE9A 1IOEA 1AIXH 2VVVA 4BXSA 1HAPH 1PQAA 3CS7A 1BBRH 1NN6A 3H5CB 1DXPA 4IW4E 1BB0B 1C5QA 3A83A 3KHVA 9LPRA 2ODYB 5CMXH 3B23B 4U32A 3SI3H 2BDYA 1TYNA 4BTUB 4ZROA 1ESAA 1QA7A 3TNTA 3UAIC 2FS9A 4CHAB 4WH8A 1G30B 2GV7A 3WWFA 4IN2A 2P59A 1E37B 4MVNA 1LO6A 4YOIA 2H6MA 2CGAA 2VIPA 1ZTLA 3O8DA 2OC0A 4X6MA 1W2KH 2R2MB 3OE7D 1B7XB 1YP9A 3P92A 1MKWH 1GVLA 4NIYA 4A1TA 1BTUA 1JOUB 3R3GB 1SGDE 3FN8A 1YPGH 1LVYA 3A85A 3VB4A 1KLJH 1XKBC 2BDBA 4ZAEA 1BMFD 3IWMA 1J8AA 1P2JA 1AB9C 1AWHB 1RGQA 2A1DB 4JZFH 1OWDA 1NT1A 3MNSA 3I78A 1GL0E 4MNVA 4ABAA 1HAHH 4Q7ZA 5DP6A 2K1QA 1GDUA 1ARCA 4JK6A 1YCPK 2H9EH 1QL8A 1TNKA 3M5LA 3T28A 6ESTA 2F9BH 3OAAD 8KME2 1A4WH 4ISIH 1BMAA 1UTJA 2G8TA 2A4OA 3UOUA 2G4UA 6GCHF 4K1SA 2SGPE 5HYOA 4E05H 4BOHA 2AFQB 1O3DA 1AMHA 2FI3E 5B6LA 5JYIA 2STBE 2W26A 1GJ8B 3ZZBA 5F8XA 1MTNB 2K7XA 2XBVA 1YKTA 2R0KA 3SV9A 3QN7A 4FU9A 1O5GH 2XWBI 4YESB 1Z1IA 1E79D 1K22H 2GZ8A 1G3DA 3PMHB 4ZKNU 6GCHG 1IQJA 3WY8A 1RXPA 2BOKA 3MO6A 1A5IA 1P0SH 3OYPA 1CVWH 5CHAC 1GHYH 1S6LA 4BAQB 3FOAA 4GLYA 3MH7A 2NU2E 1ZSJA 1ZPCA 2CF8H 4JYUH 2BDGA 1QL7A 3QZQA 4UFGH 5FXLA 1BRAA 2QAAA 2ZKSA 2M2AA 2Z9GA 1A3EH 2OD3B 2JH5D 1E1QD 2LELA 3G01A 1YLDA 1UVSH 1YLCA 1BHXF 1FPCH 1UTLM 4YT6H 4INLA 3VEQB 1C5ZB 2BYAX 3ZZ4A 1BMLA 1WDIA 2HNTC 2GDEH 1YCPM 2ZCHP 1H8HD 3ZZ6A 2IPHA 2DUCA 2W6JD 2RG3A 1O3EA 1HNEE 4FETA 2BTCE 3MYWA 3F0PA 2OINA 1AY6H 3P17H 2Y80A 8ESTE 3K65B 1TGNA 2LIZA 1Y5AT 1GDNA 1BTHH 4DURA 2G81E 1P8VC 3ZV8A 2ZF0H 5EQQA 5F8TA 4CR5A 7GCHF 3FP8E 1YPEH 3BTFE 3ZVCA 1CGJE 1K1MA 1O2KA 3S69A 1V2QT 2BZ6H 4Z0KA 2PKAA 1A0LA 3PO1C 1WOFA 4YLQH 2BMGB 2EA3A 3RLWH 3PMAB 2XBWA 1UCYE 2C8XB 1UVOA 5CHAB 1C9PA 3AASA 3RXGA 2M5TA 1ELFA 4K69A 4H42U 2EY4C 5HGGA 4MDSA 1QA0A 2LP6A 2ZU1A 8GCHF 1V6DA 2P8OB 5E0HA 5EXNA 1O2JA 1ORFA 5C1UA 5E2PA 5FPYA 3VG8A 5C1YA 5L6NH 1AWFH 1MTSA 1TNHA 4RI0A 1DUAA 5IK2D 1O5FH 2F4LA 2PLXA 1UTOA 3URCA 4NZQA 3RXEA 1FY3A 4CH8B 1PYTC 3PLPA 5GWZA 1K2I1 2ESTE 3BTWE 5A0BA 2FLRH 4H6TA 1QBVH 1MD7A 2VH0A 3QX5H 3UFAA 4KGAA 1TGCA 1C2KA 4DGJA 3H7OA 1UTMA 2ZHWH 5BRRE 1GBDA 5DP9A 1GBJA 4JCNA 1C1OA 3LGYA 1QGFA 3EAJA 2C90B 3ZZ9A 2FZZA 1V2ST 1N8OB 1Z71A 2PR3A 3HPTB 1V2KT 1CT0E 2RCEA 4OS2A 5C5OA 1ZOMA 2RDEA 4Y7AA 3T2NA 4ABHA 2FS8A 1C4U2 3TH4H 3TU7H 2GZ7A 2ZWLH 3KQCA 2THFB 2ZPQA 1XMNB 4LOYH 2ZO3H 1P09A 3GCNA 4O03A 4IC5A 1TB6H 5T6FA 4LZ4B 2CF9H 1NM6A 2H2ZA 1ZSKA 3FO8D 3MO9A 4MQAA 2WV9A 1GI9B 1IQNA 1DPOA 4AYVB 4B76A 5A8XA 1HFDA 3MU5A 3SV8A 2ZEBA 2KM0A 3LGUA 3F6UH 1LPZB 1GG6C 4UE7H 1UK2A 1WSSH 2IJD1 7ESTE 1C5UA 1KYNA 5FHTA 3MU1A 1W11U 1GHBG 1MCVA 1O31A 2WPHS 2ZQ1A 4B2CA 5EJZA 5EU8A 2AGEX 5FPSA 1O32A 5JBCS 1O5AB 1BTWA 3B9FH 4Y10E 3T5FH 1NC6A 4Q80A 1TBRH 5HMAA 3U28C 1ANEA 2FX6A 1C5TA 1O3BA 3MO3A 3A7VA 2F9PA 3D65E 2HLDD 3BF6H 5AVDA 2YMSD 3V12A 3ZZDA 2GDDA 4UD9H 1FAKH 2WZQA 3N7DA 1HB0B 3E3TA 3ELAH 3F2GA 3HGNA 1SGCA 3BIUH 1GMCG 3MNXA 4INKA 5EQSA 1AGJA 3WW7A 3Q3YA 1ETTH 3UB0A 1Z1JA 2XNIA 4MTBA 1VGCC 2OXSA 1OYTH 2SGQE 1O5CB 1BUIA 4XFQA 1GBKA 1VITG 2BD9A 1CGIE 3ODFA 1YM0A 1MAYA 3T25A 1B0FA 2ZTZA 3F68H 3EA9A 4DG4A 4CR9A 1VR1H 1W0ZU 2ZP0H 4ZH8A 3ZZCA 1PFXC 1HAVB 1PPGE 4H4FA 1TA2A 3SU6A 3LH3A 1GPZA 1NRSH 4ISNA 3F9HA 3L33A 2GCTC 3RXPA 1SL3A 1V2RT 3F2HA 2ZGBH 3HKJB 4AG2A 3BTGE 3MWIU 1D3TB 1V2PT 3SU4A 4CRGA 4B75A 4AFZA 1GG6B 1C5NH 5HM9A 2FOMB 2FODA 2ALPA 3HGPA 4D9RA 1AHTH 1BTPA 1Z8JB 1Z8RA 5GCHF 1N8OC 3NZIA 3V7TA 2FOCA 6LPRA 1H8ED 1SQTA 1P2IA 1P11E 1VCWA 4ABBA 1BA8B 3PLKA 3HATH 1QB9A 1ELVA 1P3CA 1YLNA 2WPIS 2VGCC 4BAHB 3S9CA 4Y0ZE 3T26A 2ANYA 1L2EA 1ELDE 2QF5A 3KQBA 1MBMA 1Y5BT 4OGYA 1E35B 1V2LT 2VIWA 2GTBA 3RXFA 1L1GA 4I8KA 2L6OA 4FUFA 4MNYA 5F8ZA 4OM9A 4RKJB 5JPMH 1O2YA 1P01A 1DANH 1ABJH 5FCKA 4K3JA 2Z9IA 5L2YH 1O5BB 5F6MA 2BD4A 3PTNA 1T4VH 3MU8A 4UEHH 4XBDA 3P8OA 1DSUA 1YPJH 1AZ8A 1HAOH 3ATIA 1GI2A 3PMJA 4A1XA 1RRKA 4O3TA 1KDQA 3TJNA 2ZFRH 1S6HA 4Y11E 2AEIH 4FUIA 3M5NA 2OUAA 2QYIA 4YZUA 3FAOA 3FANA 5BPEA 3STIA 3A7YA 3LGWA 1BHXB 1ANCA 3FKSD 4ESTE 2Q1JA 2LPRA 4FUCA 1JRTA 2P3FH 4Y8YA 1BRCE 1SOTA 1GMDG 2VIOA 3E8LA 2BD3A 2R3YA 2FDAA 4XRNA 1HUTH 1C2HA 3SI4H 3T62A 1GCTB 5E0JA 1A46H 2BLWA 4AB9A 5DSFA 1XXDA 3RC5A 3TJVA 1FMGA 2FIRH 1SKYE 5EPYA 1OSSA 1SMFE 3GY8A 4WF8A 2GCHF 2OC7A 1GHVH 3UOPA 3VGCC 1GMDF 4Y8XA 1G3BA 1GJ4H 3LT3A 2QE7D 2F9UA 2O9QA 3D62A 1OP8A 4BAKB 7KMEH 2F83A 4AZ2B 2PW8H 3FP7E 2K0QA 1KTSB 1K1PA 1Y8TA 2GCHG 4P00A 3MHWU 1A7SA 3EA7A 3E16B 3RMNH 1YF4A 2FLBH 1EAXA 1PPHE 2XC5A 4AN7A 2V0BA 1XVOA 1WYKA 4KKDA 1NS3A 1QNJA 2VH6A 2SGFE 2UUJB 1BRBE 4THNH 2D8WA 3NRLA 1MQ6A 1QCPA 1YPHE 1ARBA 4VGCB 1GGDB 1H9HE 1SB1H 2BDHA 2CXVA 4JK5A 1KLIH 3S7HB 1TLDA 3ENSB 3P8GA 3GYLB 1TALA 1T8OA 3QO6A 2JJ2D 3Q76A 4B71A 1GI1A 1AUJA 1QJ1B 1IQFA 1P02A 1O34A 2B5TB 3VPKA 4RN6A 2VGCB 1W0JD 1K21H 2PGQB 4I32A 2FP7B 3KQDA 2HPQH 2OK5A 1AO5A 3TGKE 3HK6B 1HLTH 2XWAA 1LVMA 4HI3A 1UMAH 1GWAA 2R0LA 2OQUA 4JYTA 3QZRA 1G9IE 3NUMA 5L30H 3PO1B 1F5RA 2VWOA 4MPUA 1GCDA 2ZTXA 5ESBA 1IQIA 3E90B 4GSOA 2GVFA 1O3NA 1BBRK 4I8GA 1QFKH 1O2XA 3NK8A 1WBGB 3SNAA 1NU9A 3OTPA 3MMGA 2G4TA 1PQ5A 4Y71A 1O3FA 1O39A 1ANDA 1BRUP 4ABJA 1A1RA 4TPIZ 1OXGA 3SHAH 1FZZA 2OLGA 2ZHEH 3BEIB 3P70B 2V35A 1O2QA 3LIWA 3OY6U 3LPRA 3EA8A 1EFRD 2FXRA 1H9LB 1JMOH 2P93A 3SNBA 2IPQX 1C9TA 1SGPE 4GUXA 1E34B 1V2JT 4HTCH 5DG6A 4AOQA 1CHOG 2SGEE 3DA9B 4X8UH 3ZZ8A 2O8LA 2KZ4A 2AMQA 4CHAC 3HK3B 1BOQA 2BLVA 2UWOA 3UQVA 5C67A 3DSPA 1HV7A 2ODPA 1AFEH 1Z6EA 5E8EH 1ELEE 2FOGA 1JRSA 1T31A 3ATLA 1QZ8A 1ZMJA 2KCPA 1LMWB 3A7TA 3MH6A 2W7SA 3SHCH 1O2MA 3AW0A 3SJ9A 1GI0A 1L4DA 4HFPB 1AB9B 2A45B 3IG6B 2RFKC 2PKSC 4NA7A 2WHXA 1W13U 1UO6A 1EUFA 3DUXH 2UWPA 3UNRA 3SUEA 2B7DH 1TBQH 1GI6A 3F9FA 5DJ7A 1N1LA 3RXUA 3A88A 1EZQA 1XUIA 1GI3A 3LKWA 2P3UB 4WH6A 2QF4A 2A0QB 2WYJA 3A82A 3VXFH 4E7RG 2TRMA 3OSYA 4K5ZA 3GY3A 2Z3DA 3SUFA 1C5SA 2XNDD 1OS8A 1OX1A 1EXFA 1UTQA 1UVTH 3A80A 2R3UA 3OTJE 3PV2A 3ZYEA 1MMJN 1ZHPA 1HXFH 1TNLA 3ZZAA 1FLEE 1OKXA 2R2WU 4ZHAA 3RLYH 1YPKH 2WUBA 1PPCE 2B9LA 1OHHD 5KECA 1KLTA 1LHGH 4ACAA 1ZTKA 1TNGA 2C8WB 1XUKA 2A31A 1YPMH 5T3HA 3UY9A 4Y79A 4ABDA 4IBLH 3PRBA 4ZXXH 2ANKH 1O2TA 2FEQH 5DP3A 2AHME 4IC6A 1C1WH 1O3PB 4LZ1H 3UR9A 3PMBB 2SNVA 1UJ1A 1NFYA 5IDKA 3BG8A 1ZZZA 2Y5FA 4I8LA 4ISLA 1PPBH 1DE7H 3LONA 1C4Y2 2KAIA 1IQHA 2A7CA 3Q00A 2FI5E 2NU3E 3RP2A 2QV1A 1C5OH 1ANBA 1E36B 1XX9A 2Y5GA 1V2VT 3KYFA 3TGIE 2Z94A 1KXBA 1A5HA 1LPGB 3GYMA 5CHBA 3P8FA 1Y3XA 4XD7D 2A4QA 3RU4D 1C5PA 4MPXA 1SGFA 1ACBE 1KIGH 1LHEH 5E2OA 1F7ZA 1MTWA 1WQSA 1AD8H 1ZSLA 2VWMA 4OS7A 2TPIZ 1HJAC 4Q4LA 2QN5T 3RXJA 1GMCF 1KY9A 5ETXA 2FOAA 3BTEE 3KCGH 1PQ7A 1LQEA 2HVYB 2ZC9H 4BANB 1AU8A 3TK9A 1MKWK 4ASHA 2G5NA 4NIWA 2A4GA 4Y6DA 2PTCE 2ZFFH 1EOJA 1XKAC 5J4QA 3QK1A 1MZAA 3KN2A 1IQEA 1O37A 1FAXA 1DOJA 4MLFB 4GHTA 1XUGA 2FMJA 3WWBA 2TGAA 1RJXB 3SU1A 3LC5A 1DT2A 1D3DB 2ZDKA 4FVBA 1MAXA 1P06A 1YPHC 2J38A 3C27B 3NWUA 2A5KA 3M7UA 1GVZA 5LPRA 2KCOA 3S9BA 1ZMLA 1MH0A 1FY1A 3B8JA 5FBIA 3A8BA 3PV4A 4PROA 1FIZA 2J98A 4X6NA 2FTLE 1GBIA 1INCA 1SGRE 2G5VA 2V3HH 1VGCB 4WXIA 3MI4A 1G37A 2JDID 1OOKB 4JZEH 2V3MA 2FOBA 1HXEH 2BY6X 1TRNA 4TWYA 4X2VA 3TGJE 1NBME 2NU0E 5T6DA 4MPVA 1C1UH 3M5MA 4ZMAH 4LXBH 1EX3A 1UCYK 3VGCB 1V3XA 3ZV9A 3UWJH 2W7UA 4TT3D 2PSXA 1LPKB 4P02A 1ELTA 2OBOA 4IN1A 1W8BH 1AVGH 1O3LA 3RXBA 4NSYA 1D4PB 1O3OA 1C2FA 1HAXB 2HLCA 4KELA 5DN6D 1GI7B 2BXTH 2ZPRA 4J1YA 1BBRE 1SG8B 2GT8A 1VZQH 5AHGH 2SGDE 4U30A 1C5YB 1VITH 1P03A 2NU4E 3BSQA 3PWCA 1THPB 1QQUA 3MFJA 3V3MA 1L1JA 2ZDMA 1DLEA 1XM1A 1C2GA 1T8LA 1UVUH 3EE0B 3M7TA 5EW2H 4X2XA 2Y7XA 4UDWH 3GCOA 2XRCA 1E1RD 1GHAF 1SC8U 1TMTH 3HKIB 5DP8A 2VVCA 1E38B 3A89A 5K0HA 2XBXA 1Z6JH 2EI8A 2W3KA 2ZTYA 1F0UA 5HIYA 1W10U 4XSKU 3AW1A 5B6OA 3SJ8A 3I77A 1L0ZA 1OWKA 3LGIA 2ANMH 5F53A 4NCYA 2OCVB 3BN9A 2ZFSA 1PYTD 2FOEA 4I33A 1O2VA 1SFQB 5EQRA 4X1RU 1C1RA 3SGAE 1A61H 1AZZA 2VVUA 1K28D 2PUXB 3GDVA 5JBAS 4KTUA 1Y3YA 1C5VA 1YBWA 2C8ZB 5DO4H 4XDEA 4NA8A 1KXDA 2LNCA 2XTTB 2V7QD 2WV5A 1ZGIA 1IQMA 1HAVA 3A81A 5FPTA 1SGQE 1DVAH 3ATWA 2HPPH 1C5XB 1UVPA 3AAUA 3SJIA 2HWLB 1MKXH 3ZVEA 5K7RA 2OC1A 1PPEE 1O0DH 3M7QA 5DP7A 5ABWA 1WXRA 5JBBS 4OS5A 5J4SA 3U98H 4DW2U 2J92A 3PM3A 1HJ8A 2BDCA 1TONA 1OP0A 1HIAA 1VJAU 1TE0A 1RTFB 3LC3A 4ACBA 3BEFB 2BY9X 1GJ6A 3RXAA 3SJOA 1S0RA 4AORA 1C4V2 1CO7E 1TIOA 1KXCA 5PTPA 2FYRA 3FZDA 4FU8A 1WAYB 1O3HA 4E7NA 2GP9B 3KGPA 4VGCC 2SGAA 4KTSA 1EZXC 2PFEA 4ABFA 2KAIB 4DIIH 1W0KD 1SLUB 3MU0A 2OTVA 2HVXA 1HAYB 4FUGA 2AMPA 3ZZ3A 1AVWA 1DLKB 4X6OA 2P8OC 3JZ1B 2EI6A 3A8DA 2VIVA 1YPLH 1C2LA 4CRFA 3RXVA 5CE1A 3O8BA 3OEED 2RA0A 3S7KB 3D23A 1SSXA 2HGTH 1E0FD 1GMHG 5JBTA 1HAGE 2XCFA 4MNWA 1H1BA 2BQ7B 2IJOB 2Q6FA 3SV7A 6CHAB 1AE5A 2J34A 4X2WA 3SU2A 4U01A 4XE4A 4GVUA 5I46H 1KMHB 3TNSA 4HZHA 1J14A 3SZEA 2KX4A 3OX7U 1AI8H 4JZIA 2BD7A 1HBTH 4BAMB 3F9EA 1DWCH 2QGRA 2JKHA 4YM9A 3H09A 1N6YA 1NRNH 3EQ0H 4AGKA 4D8NA 5JDUB 1DITH 2H9TH 1GJCB 3KEEA 1P2MA 1KXFA 4A7IB 3O8RA 4DCDA 2PP6A 5G4BA 1P12E 5GCHG 2WPDD 1SR5C 2Z7FE 2WPMS 2VINA 1YYY1 3RU4E 4NFFA 2Q6DA 1W14U 2AMDA 2ZIQH 1VKYA 2J95A 2I6QA 2PV9B 2O8MA 2FWWA 1ZR0A 1C5WB 1XXFA 1GJ9B 4J2YB 4ABGA 2WYGA 4YOJA 4D9QA 1SQRA 1BITA 2ZFQH 3MH4A 3SUGA 4AB8A 1C2IA 4X0WU 1T8NA 2AIPA 1Q3XA 1A0HB 1GHZA 5C2ZA 3EDXB 3U8RH 1G32B 3Q77A 1T32A 1QIXB 4ISOA 3N7EA 2AS9A 3ATMA 2BB4A 3TIUA 3LGVA 4X1PU 1Y5UT 1HDTH 4MG3A 3GCHC 5T6GA 2TBSA 3ZVAA 1W12U 1EAWA 1ID5H 3LDXH 3RMLH 1O2WA 1GHWH 1TMBH 5GNDA 1HYLA 2Z3CA 1YWUA 3F9GA 2AERH 1D3PB 5FBEA 3K6ZA 1MZDA 4KP0A 1TA6A 2ZGCA 2XBYA 2IN2A 1G3CA 1OWEA 4A92A 2ASUB 4XBBA 1ZTJA 3M5OA 1UHBB 2ZHFH 2HALA 1RFNA 4TSFD 1SBWA 1GBCA 2D26C 2P95A 4I8HA 3TH3H 1PQ8A 2ZECA 3BV9B 2TIOA 5SGAE 3SNEA 1LHDH 1C2DA 4GCHG 2TGDA 2YMSB 4I86A 3RXMA 2CHAC 1B0EA 1SOZA 1J9CH 1DS2E 3A86A 1O30A 4XBCA 5FCRA 1HJAB 1QB1A 2ZDVH 3CP7A 2F3CE 3W1EA 4A5TS 1FN6A 4AYYB 1BCUH 1T4UH 1KTTB 2EI7A 4B2BA 5HKKD 1NO9H 1A2CH 1GL1A 1LKAA 2VB0A 4ZHMU 3RXOA 3LH1A 1ABIH 1D6RA 1EQ9A 7GCHG 5EW1H 2WPJS 2J94A 1C5RA 2A7HA 4I8JA 3RMOH 4K1EA 1IQLA 2G51A 1CSOE 1RS0A 3SU3A 1TQ7B 3EBNA 2ZFPH 4YTAA 1IQKA 4ASUD 2ZGHA 2CHAB 1CT2E 2ZNKH 1TFXA 1MU8B 2BD8A 3RM0H 1NY22 1RTLA 1C1NA 2BOHB 1GVKB 3AAVA 3URDA 1SLWB 3K6YA 2YNAA 4X6PA 4FUHA 4Q2KA 2WUCA 2Q6GA 4GHQA 2XW9A 1GBTA 3RC6A 4WMDA 1FN8A 2FOHA 1O3IA 1SPJA 3M3VA 4D76A 1XUFA 1MU6B 2SFAA 4OS6A 4LK4A 1WTHD 1ETRH 3L3TA 1EATA 1ETSH 1WUNH 1TPOA 3RUOA 1QRWA 4TPYA 3RC4A 2ZGJA 4FUEA 4X2YA 8GCHG 1ZPZA 2WINI 4SGAE 1JIRA 3F0OA 3F3BA 2D1JA 1K1JA 3SNCA 1G2LA 1BIOA 2BQWB 5I25A 1EP5A 5DP4A 4X8SH 5C94A 1UK3A 2C3SA 1GI8B 5GJ4B 1ZLRA 4FUJA 1DY9A 2FTMA 1P3EA 1FI8A 1EJNA 1O3JA 3IITA 1QY6A 2JETB 1Z7KA 3QTVH 1P04A 3GCTG 1DSTA 5GDSH 4RKOB 1O38A 1UK4A 2OC8A 1C1MA 2V3OH 4Z1MD 1V2TT 4D7FA 1ZJDA 1Y3VA 2W3IA 1O2IA 3D49H 1AFQC 2F91A 1CU1A 5EXMA 1CA0C 3SW2B 2J9NA 3UTUH 1C1TA 1YCPH 1LVBA 4X8VH 3N7OA 1NFUA 1JIMA 4IMZA 1LHCH 4IGDA 3MNCA 3GY6A 1PPZA 1L4ZA 3I29A 2ZCLP 3RXSA 3ZZ5A 1O5DH 2R9PA 3SUDA 1CE5A 1EZSC 1K1NA 3U69H 1F5KU 3VXEH 1YC0A 1NRRH 1B5GH 2H9HA 1GBMA 3GDSA 3TH2H 3KL6A 4BTTB 2QIQA 3VFEA 1K1IA 1W7GH 3RXHA 3BTHE 1NROH 1BTYA 1C5LH 2ZU4A 1AVXA 4RT1A 4NA9H 4B6EA 1EPTA 5KEDA 2GMTB 3DT0H 3LOXA 1TNJA 2O8TA 2GX4A 1SLXB 3Q3XA 1TRMA 2EQNA 1SI5H 4TWWA 1F92A 5DGJA 4B73A 4NWKA 5EODA 3K9XB 1YY3A 1A3BH 3ZVDA 2XC0A 4HG6A 1LHFH 1IAUA 1SGTA 2SNWA 4OS4A 1FY5A 1ELCA 1KSNA 1T7CA 2GD4B 3UNQA 2FPZA 2Y81A 2UUFB 2Z9JA 4FUDA 1F0TA 2P16A 4TYDA 2PWXA 3LJJA 4JZDH 4BAOB 1GGDC 1BTZA 3OEHD 4DT7B 4Q7XA 2WPKS 5A2MH 1O2RA 1Y3UA 5FX6A 2VNTA 4K8BA 2FX4A 1BTXA 1XUJA 2PHBA 3GS9A 1FDPA 1GJDB 4NFEA 1ESBA 3VB6A 1QL9A 2ZFTA 3TVJB 1O2ZA 2PUQH 5GXPA 3QDZB 3U9AH 3DHKH 1OWIA 4MPWA 3CENA 2VWLA 3ODDA 4ZUHA 1KXEA 4Y7BA 3SJKA 4NGAH 1H4WA 2F9VA 2HRVA 2BM2A 2I6SA 2GGVB 5H4IB 3ZZ7A 1P10A 3QLPH 2NU1E 2QXGA 1TMUH 2QCYA 1GBHA 2H5CA 1WTGH 5A0CA 9ESTA 3ZYDA 3SYJA 2IOTA 1NRQH 5JB9S 1QR3E 3QWCH 2ZCKP 5F03A 5JB8S 2C4FH 1V2NT 2TGTA 3K2UA 1N6XA 2ZI2H 3P8NA 1THSH 4M9FA 3A7WA 5E0GA 2Z9LA 1ELGA 1LQDB 3DCLA 3NXPA 1ZYOA 2CK3D 1UTNA 2TGPZ 4A1VA 1O3KA 3M61U 5EXLA 1MQ5A 3F2FA 2VJ1A 2JIZD 3QGNB 4NWLA 5A8ZA 3ZVFA 1CHGA 1THRH 1O2PA 3KIDU 1BJVA 4X1NU 3TK5A 3E0PB 2QXHA 4AFQA 3SOSA 4F4OC 4ZHLU 1EP6A 1UTKA 1LTOA 1PJPA 1GI5A 3ZIAD 1SFIA 1CGHA 2K8IA 4DIHH 2G52A 2ZU3A 3GCHB 4MNXA 4WMEA 1V2OT 1WQVH 1NFXA 1EJAA 2QF3A 1J17T 3EYDA 4D7GA 1Q31A 1C2JA 2AGIX 5C3NA 2BLQA 1HJ9A 1HPGA 3BTTE 3GISB 5C20A 2ZA5A 4KTCA 1MTNC 5C0TA 1TRYA 2GKVE 5TCAA 1P05A 3FVFB 5EG4A 2JH0D 1TPSA 1C2MA 1GBFA 1O2GH 5GPIB 5EJLA 1HRTH 1C5MD 2PTNA 3GY5A 1SVPA 3MTYA 3A8AA 2KCYA 3PLBA 3A87A 3GY2A 3SZNA 2FOFA 5LPEA 1O3CA 2XXLA 1VCPA 3KQ5A 1D6WA 1GHBF 1OWJA 1P2OA 1ZHRA 2F9OA 4OGXA 3BTKE 1QBNA 1QQ4A 1TAWA 2DE8A 3BG4B 2GCTB 1AFQB 1S85A 2BDIA 3LU9B 3DD2H 3GY4A 3RXKA 1S84A 2BHGA 1J15A 1GJ5H 1SGNE 4QT8C 2A2QH 2HNTF 3C1KA 4Y8ZA 3UIRA 2F43B 1DWDH 4K1TA 1VCQA 1DWEH 4CRCA 1NPMA 4I7YH 4YT7H 2JH6D 2V6NA 2CV3A 3W94A 2OQ5A 3UREA 2CJIA 5C5NA 1OPHB 4NZLA 1QB6A 4K8YA 1COWD 2STAE 4YOGA 2PKAB 4IMQA 6CHAC 2VIQA 1DM4B 1BDAA 5AF9H 1K1OA 1ZJKA 3EGKH 1DFPA 2Y5HA 4GCHF 1EZUC 1S81A 3O8CA 1AUTC 4FXGH 1WU1A 3OY5U 2ZDNA 1T8MA 1FY8E 2FM2A 3MU4A 2P94A 1J16A 2KCAA 4X8TH 4Y76A 1CA8B 3MNBA 5HXFA 2AIQA 4YLUA 1UCYH 2G00A 4ISHH 2FO9A 5A0AE 3VB5A 2GZ9A 1C1VH 2YOLA 3FP6E 4B74A 3GY7A 1IHSH 4AX9H 1L1NA 1O2LA 2A5AA 1ESTA 3M36A 3U1JB 1O33A 3DFLA 5TCCA 1TABE 2A4RA 1U6QA 2GJGA
chains in the Genus database with same CATH topology
2BX3A 1GBEA 4INHA 2Y82A 1V2MT 3SV6A 1O2SA 1NTPA 4CBOA 1EJMA 1G3EA 1SGYE 4DVAU 2Z3EA 1EPTC 2QA9E 4NIVA 1O3AA 4Z6AH 1W0YH 1Y59T 5TJXA 1GJAB 1NRPH 3LGTA 1A0JA 1CBWB 5AFZH 1LCYA 3P95A 2RA3A 4K2YA 1HGTH 1QJ7B 3S0NA 1O2UA 1EB1H 3SQEE 2OBQA 4UFFH 2ZG0H 1HAZB 1TGTA 1GBBA 1TNIA 1AE8H 1FQ3A 1ZGVA 4X1QU 1H8DH 3RDZA 1ZHMA 1CBWC 1O2NA 2EEKA 2P3TB 1DY8A 3TJUA 2HOBA 3SNDA 2ZU2A 1H8IH 1MCTA 5EOKA 1FIWA 4RSPA 1ZPBA 5GIBA 3NPSA 4WXVA 4Q7YA 1GBLA 4BNRA 1O36A 1FPHH 3PB1E 1EAUA 1CHOF 3U8TH 5FAHA 2ANWA 2XC4A 1YGCH 1FUJA 3SU5A 1V2WT 1BMNH 4O97A 1EASA 1HCGA 1A5GH 1P57B 1GJ7B 1O2OA 3GOVB 3MH5A 2ODQA 2BQ6B 3U1IB 2ZGXH 3GCTF 4ZKRU 2BY5X 1EAIA 3LJOA 3RXDA 1D9IA 3ESTA 3E6PH 4AGJA 3BG4C 1P9UA 2BXUH 1SQOA 5DK1A 1UTPA 1PPFE 3E91A 3ATKA 2W5EA 1F2SE 4UFEH 3SBKA 4ZKSU 4DJZB 3BTME 1H9IE 3M35A 3V0XA 2BZAA 4NIXA 1F5LA 2PKSB 3KNXA 4UFDH 2AH4X 4DY7B 1QRZA 1LDTT 1TGSZ 2BVRH 1S0QA 1FXYA 2XCNA 1KXAA 3VB3A 1JXPA 3PYHA 1MBQA 4IS5A 5FX5A 4ABIA 1S5SA 5DP5A 2RDLA 5C1XA 1DX5M 1MTVA 2ZU5A 1C1QA 1OWHA 1AN1E 2Y6TA 4M7GA 2O8UA 3STJA 4NSVA 2VIDA 1NZQH 3RXIA 1Q2WA 1QTFA 1QURH 5IYTA 4WWYA 4UONA 4CRBA 4FUBA 2AYWA 3ITIA 1GJBB 7LPRA 1WV7H 2GV6A 3R0FA 4E06H 1ELAA 1SHHB 1XVMA 1M9UA 4X1SU 2CN0H 1DWBH 1VITF 2Y7ZA 3SGBE 1RIWB 2ZZUH 3BTDE 3S9AA 4CBNA 2QC2A 1F0SA 2OP9A 1W3CA 1SHYA 2WV4A 2O8WA 1P2NA 1MKXK 2C8YB 2PGBB 3DFJA 2B0FA 4R0IA 3SQHE 2QXJA 3ZVBA 3UUZA 2C93B 2Z6BD 3E1XB 5LH8A 4I31A 4YO9A 5EPNA 1ELBA 2FYQA 2XYAA 2ZHDA 4BXWA 3UR6A 1Z8GA 3RXCA 1IHTH 3BIVH 1TX8A 4U2WA 3RXRA 4ABEA 4AG1A 3QGJA 4SGBE 3V13A 4GPGA 3T29A 3CS0A 1QHRB 2ZQ2A 1SGFG 1G2MA 1S6FA 1TX7A 2A7JA 2J4IA 3TITA 1BQYA 1TPPA 1KDQB 1TOMH 3SO3A 4WMFA 5LGOA 5DKMA 1CT4E 2AGGX 2BD2A 2F9NA 3TK6A 2CMYA 1FJSA 1NFWA 4XOJA 2ULLA 3UPEA 2D2DA 3TLOA 2BX4A 1MUEB 2GT7A 1DICA 1S83A 3VB7A 1JBUH 1FV9A 3SGQE 5A8YA 1GMHF 1ZMNA 3GICB 3NKKA 4A6LA 4CRAA 4R8TB 3JZ2B 1SQAA 2YNBA 1CQQA 2ILNA 2QF0A 1TGBA 4BTIB 3M37A 5A09A 1QBOA 1P2QA 2ALVA 3A7XA 3RU4T 4CRDA 3TPIZ 4B2AA 3Q3KA 3M3TA 4ZXYH 3A8CA 1X7AC 1P9SA 1BMMH 4WVPE 3SU0A 3PWBA 2ZPSA 1MTUA 1Z8IB 2UUYA 1DXWA 1RD3B 3FFGA 4NG9H 3SN8A 1GCTC 1TWXB 2BY8X 3AVZA 1AQ7A 2UWLA 2BLOA 1TX6A 3SV2H 2BDAA 2ZHQH 3RXQA 3L6PA 1OP2A 3UNSA 3UWIA 1O2HA 2H1UA 2GMTC 2H5DA 3H7TA 4FVDA 3UQOA 1SGEE 1FONA 2ZDAH 3RXTA 1LKBA 2BY7X 1TQ0B 2PSYA 2BD5A 4FU7A 4AFUA 4WJG2 3W95A 1UHBA 3E0NB 1BJUA 1NU7B 3F1SB 1QRXA 2UUKB 4H6SB 4JZ1A 1XUHA 4F49A 1GHAG 2QY0B 1S82A 1G36A 1O3GA 3KQEA 2ZDLA 1ZRBA 1K1LA 2JETC 1HIAB 2VU8E 4B1TA 4Y0YE 1RTKA 2BVSH 1EKBB 3NCLA 1GHXH 2NWNA 3M3SA 1JWTA 2VWNA 3A84A 1TOCB 3RMMH 1EB2A 1AKSA 2A2XH 5ESTE 1V2UT 1GBAA 4TY7A 3BTQE 1BZXE 3KF2A 5DPAA 5LPFA 4CREA 5AFYH 2FI4E 1TBZH 1ZRKA 3SORA 1LVOA 4CH2B 2BVXH 1C1SA 2EC9H 2G55A 3OU0A 4O9VA 4TY6A 5HM2A 2A5IA 3RXLA 4JMYA 4AFSA 2B8OH 3T27A 3ZVGA 1K9OE 1OYQA 1TPAE 1IQGA 1SLVB 2Z9KA 1W7XH 1DDJA 1AKSB 3A7ZA 1HAIH 3PROA 3RM2H 1P2KA 1RIWC 2QXIA 2A32A 3BEUA 4K60A 4GAWA 3GDUA 2FESH 1GDQA 1C1PA 1NESE 1WCZA 1VJ9U 4WY3A 1QJ6B 3PTBA 4DOQA 2J2UA 3FZZA 5EGMA 1CA0B 3U8OH 1O5EH 1Y3WA 4O3UA 1EOLA 3P6ZB 4ZKOU 4JYVH 2HNTE 1BT7A 3MOCA 1EPTB 1FY4A 3TJOA 1C2EA 3QTOH 1DUEA 2WPLS 1MD8A 1D3QB 1SGIB 1O3MA 4OS1A 1F0RA 3QUMP 5L2ZH 8LPRA 1FNIA 1GI4A 1O35A 4HGCA 2DE9A 1IOEA 1AIXH 2VVVA 4BXSA 1HAPH 1PQAA 3CS7A 1BBRH 1NN6A 3H5CB 1DXPA 4IW4E 1BB0B 1C5QA 3A83A 3KHVA 9LPRA 2ODYB 5CMXH 3B23B 4U32A 3SI3H 2BDYA 1TYNA 4BTUB 4ZROA 1ESAA 1QA7A 3TNTA 2FS9A 4CHAB 4WH8A 1G30B 2GV7A 4IN2A 2P59A 1E37B 4MVNA 1LO6A 4YOIA 2H6MA 2CGAA 2VIPA 1ZTLA 3O8DA 2OC0A 4X6MA 1W2KH 2R2MB 1B7XB 1YP9A 3P92A 1MKWH 1GVLA 4NIYA 4A1TA 1BTUA 1JOUB 3R3GB 1SGDE 1YPGH 1LVYA 3A85A 3VB4A 1KLJH 1XKBC 2BDBA 4ZAEA 3IWMA 1J8AA 1P2JA 1AB9C 1AWHB 1RGQA 2A1DB 4JZFH 1OWDA 1NT1A 3MNSA 3I78A 1GL0E 4MNVA 4ABAA 1HAHH 4Q7ZA 5DP6A 2K1QA 1GDUA 1ARCA 4JK6A 1YCPK 2H9EH 1QL8A 1TNKA 3M5LA 3T28A 6ESTA 2F9BH 8KME2 1A4WH 4ISIH 1BMAA 1UTJA 2G8TA 2A4OA 3UOUA 2G4UA 6GCHF 4K1SA 2SGPE 5HYOA 4E05H 4BOHA 2AFQB 1O3DA 1AMHA 2FI3E 5JYIA 2STBE 2W26A 1GJ8B 3ZZBA 5F8XA 1MTNB 2K7XA 2XBVA 1YKTA 2R0KA 3SV9A 3QN7A 4FU9A 1O5GH 2XWBI 4YESB 1Z1IA 1K22H 2GZ8A 1G3DA 3PMHB 4ZKNU 6GCHG 1IQJA 3WY8A 1RXPA 2BOKA 3MO6A 1A5IA 1P0SH 3OYPA 1CVWH 5CHAC 1GHYH 4BAQB 4GLYA 3MH7A 2NU2E 1ZSJA 1ZPCA 2CF8H 4JYUH 2BDGA 1QL7A 3QZQA 4UFGH 5FXLA 1BRAA 2QAAA 2ZKSA 2Z9GA 1A3EH 2OD3B 2JH5D 3G01A 1YLDA 1UVSH 1YLCA 1BHXF 1FPCH 1UTLM 4YT6H 4INLA 3VEQB 1C5ZB 2BYAX 3ZZ4A 1BMLA 2HNTC 2GDEH 1YCPM 2ZCHP 3ZZ6A 2IPHA 2DUCA 2RG3A 1O3EA 1HNEE 2BTCE 3MYWA 2OINA 1AY6H 3P17H 2Y80A 8ESTE 3K65B 1TGNA 2LIZA 1Y5AT 1GDNA 1BTHH 4DURA 2G81E 1P8VC 3ZV8A 2ZF0H 5EQQA 5F8TA 4CR5A 7GCHF 3FP8E 1YPEH 3BTFE 3ZVCA 1CGJE 1K1MA 1O2KA 3S69A 1V2QT 2BZ6H 4Z0KA 2PKAA 1A0LA 3PO1C 1WOFA 4YLQH 2BMGB 2EA3A 3RLWH 3PMAB 2XBWA 1UCYE 2C8XB 1UVOA 5CHAB 1C9PA 3AASA 3RXGA 2M5TA 1ELFA 4K69A 4H42U 5HGGA 4MDSA 1QA0A 2ZU1A 8GCHF 1V6DA 2P8OB 5E0HA 5EXNA 1O2JA 1ORFA 5C1UA 5E2PA 5FPYA 5C1YA 5L6NH 1AWFH 1MTSA 1TNHA 1DUAA 1O5FH 2PLXA 1UTOA 3URCA 4NZQA 3RXEA 1FY3A 4CH8B 1PYTC 3PLPA 5GWZA 1K2I1 2ESTE 3BTWE 5A0BA 2FLRH 4H6TA 1QBVH 1MD7A 2VH0A 3QX5H 3UFAA 4KGAA 1TGCA 1C2KA 4DGJA 3H7OA 1UTMA 2ZHWH 5BRRE 1GBDA 5DP9A 1GBJA 4JCNA 1C1OA 3LGYA 1QGFA 3EAJA 2C90B 3ZZ9A 2FZZA 1V2ST 1N8OB 1Z71A 2PR3A 3HPTB 1V2KT 1CT0E 2RCEA 4OS2A 5C5OA 1ZOMA 4Y7AA 3T2NA 4ABHA 2FS8A 1C4U2 3TH4H 3TU7H 2GZ7A 2ZWLH 3KQCA 2THFB 2ZPQA 1XMNB 4LOYH 2ZO3H 1P09A 3GCNA 4O03A 4IC5A 1TB6H 5T6FA 4LZ4B 2CF9H 1NM6A 2H2ZA 1ZSKA 3MO9A 4MQAA 1GI9B 1IQNA 1DPOA 4AYVB 4B76A 5A8XA 1HFDA 3MU5A 3SV8A 2ZEBA 3LGUA 3F6UH 1LPZB 1GG6C 4UE7H 1UK2A 1WSSH 7ESTE 1C5UA 1KYNA 5FHTA 3MU1A 1W11U 1GHBG 1MCVA 1O31A 2WPHS 2ZQ1A 4B2CA 5EU8A 2AGEX 5FPSA 1O32A 5JBCS 1O5AB 1BTWA 3B9FH 4Y10E 3T5FH 1NC6A 4Q80A 1TBRH 5HMAA 1ANEA 2FX6A 1C5TA 1O3BA 3MO3A 3A7VA 2F9PA 3D65E 3BF6H 5AVDA 3V12A 3ZZDA 2GDDA 4UD9H 1FAKH 1HB0B 3E3TA 3ELAH 3HGNA 1SGCA 3BIUH 1GMCG 3MNXA 4INKA 5EQSA 1AGJA 3Q3YA 1ETTH 1Z1JA 2XNIA 4MTBA 1VGCC 2OXSA 1OYTH 2SGQE 1O5CB 1BUIA 4XFQA 1GBKA 1VITG 2BD9A 1CGIE 3ODFA 1YM0A 1MAYA 3T25A 1B0FA 2ZTZA 3F68H 3EA9A 4DG4A 4CR9A 1VR1H 1W0ZU 2ZP0H 4ZH8A 3ZZCA 1PFXC 1HAVB 1PPGE 4H4FA 1TA2A 3SU6A 3LH3A 1GPZA 1NRSH 4ISNA 3F9HA 3L33A 2GCTC 3RXPA 1SL3A 1V2RT 2ZGBH 3HKJB 4AG2A 3BTGE 3MWIU 1D3TB 1V2PT 3SU4A 4CRGA 4B75A 4AFZA 1GG6B 1C5NH 5HM9A 2FOMB 2FODA 2ALPA 3HGPA 4D9RA 1AHTH 1BTPA 1Z8JB 1Z8RA 5GCHF 1N8OC 3NZIA 3V7TA 2FOCA 6LPRA 1SQTA 1P2IA 1P11E 1VCWA 4ABBA 1BA8B 3PLKA 3HATH 1QB9A 1ELVA 1P3CA 2WPIS 2VGCC 4BAHB 3S9CA 4Y0ZE 3T26A 2ANYA 1L2EA 1ELDE 3KQBA 1MBMA 1Y5BT 4OGYA 1E35B 1V2LT 2VIWA 2GTBA 3RXFA 1L1GA 4I8KA 4FUFA 4MNYA 5F8ZA 4RKJB 5JPMH 1O2YA 1P01A 1DANH 1ABJH 5FCKA 4K3JA 2Z9IA 5L2YH 1O5BB 5F6MA 2BD4A 3PTNA 1T4VH 3MU8A 4UEHH 4XBDA 3P8OA 1DSUA 1YPJH 1AZ8A 1HAOH 3ATIA 1GI2A 3PMJA 4A1XA 1RRKA 4O3TA 1KDQA 3TJNA 2ZFRH 1S6HA 4Y11E 2AEIH 4FUIA 3M5NA 2OUAA 2QYIA 4YZUA 3FAOA 3FANA 5BPEA 3STIA 3A7YA 3LGWA 1BHXB 1ANCA 4ESTE 2Q1JA 2LPRA 4FUCA 1JRTA 2P3FH 4Y8YA 1BRCE 1SOTA 1GMDG 2VIOA 3E8LA 2BD3A 2R3YA 2FDAA 1HUTH 1C2HA 3SI4H 3T62A 1GCTB 5E0JA 1A46H 2BLWA 4AB9A 1XXDA 3RC5A 3TJVA 1FMGA 2FIRH 5EPYA 1OSSA 1SMFE 3GY8A 4WF8A 2GCHF 2OC7A 1GHVH 3UOPA 3VGCC 1GMDF 4Y8XA 1G3BA 1GJ4H 3LT3A 2F9UA 2O9QA 3D62A 1OP8A 4BAKB 7KMEH 2F83A 4AZ2B 2PW8H 3FP7E 1KTSB 1K1PA 1Y8TA 2GCHG 3MHWU 1A7SA 3EA7A 3E16B 3RMNH 1YF4A 2FLBH 1EAXA 1PPHE 2XC5A 4AN7A 2V0BA 1XVOA 1WYKA 4KKDA 1NS3A 1QNJA 2VH6A 2SGFE 2UUJB 1BRBE 4THNH 2D8WA 1MQ6A 1QCPA 1YPHE 1ARBA 4VGCB 1GGDB 1H9HE 1SB1H 2BDHA 2CXVA 4JK5A 1KLIH 3S7HB 1TLDA 3ENSB 3P8GA 3GYLB 1TALA 1T8OA 3QO6A 3Q76A 4B71A 1GI1A 1AUJA 1QJ1B 1IQFA 1P02A 1O34A 2B5TB 3VPKA 4RN6A 2VGCB 1K21H 2PGQB 4I32A 2FP7B 3KQDA 2HPQH 1AO5A 3TGKE 3HK6B 1HLTH 2XWAA 1LVMA 4HI3A 1UMAH 1GWAA 2R0LA 2OQUA 4JYTA 3QZRA 1G9IE 3NUMA 5L30H 3PO1B 1F5RA 2VWOA 4MPUA 1GCDA 2ZTXA 5ESBA 1IQIA 3E90B 4GSOA 2GVFA 1O3NA 1BBRK 4I8GA 1QFKH 1O2XA 3NK8A 1WBGB 3SNAA 1NU9A 3MMGA 2G4TA 1PQ5A 4Y71A 1O3FA 1O39A 1ANDA