3TNSA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester inhibitor sg83
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords SARS coronavirus main protease
publication title Crystal structures of SARS-Cov main protease complexed with a series of peptidic unsaturated esters
rcsb
source organism Sars coronavirus
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-09-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3tnsA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tnsA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tnsA02
3SJIA 1QL8A 2ZO3H 4BXWA 2Z9LA 1PQ7A 1JMOH 1THSH 1LHDH 1GBKA 2CHAB 1VITG 2J4IA 4CRAA 3M5NA 4CRFA 1BRBE 2FESH 1NC6A 3BG4B 5A2MH 2GT7A 4Y79A 2V6NA 3UNSA 1EOLA 3MNXA 2K7XA 1V2KT 1XUIA 2BDYA 5AFYH 5DK1A 3UOUA 4YM9A 3GY3A 4UEHH 3Q76A 1TPOA 1Z8JB 1GVLA 1NU9A 4AYVB 1O32A 1F0SA 1W0YH 3LU9B 4X1RU 4D9RA 1YM0A 3FZDA 5A0CA 1HJ9A 1OX1A 1ZSKA 2VWNA 1HAYB 2QF0A 1O3JA 1TGCA 4IMZA 4TWYA 4WVPE 7ESTE 2VH0A 3M3VA 1NROH 1P2MA 3ZZ4A 1K1LA 1QRZA 3O8RA 2C8WB 3BF6H 1JXPA 2QAAA 2AGIX 4CRGA 1K1OA 4A92A 2PSYA 3A7YA 4X6OA 2WV4A 1VGCC 1DT2A 2ZQ2A 2B5TB 2UWOA 1CBWC 4ABHA 1C5UA 1P10A 3BTWE 2G81E 3NKKA 3U1JB 3KEEA 1TPAE 1G32B 3SN8A 1ZMLA 1FIZA 3RXHA 1C1VH 1GJ6A 3L33A 1ZZZA 1O34A 3M5MA 1ZYOA 2A4OA 2WPHS 1AUTC 3SGBE 2J92A 2F91A 3S9BA 2P94A 2FX6A 3SJKA 1C5WB 1F92A 3E16B 1J8AA 3UY9A 3V0XA 2XBVA 3T25A 4YOGA 3EBNA 4U2WA 1TOMH 2W3IA 1HIAB 1IQMA 2STBE 3SU0A 5DP4A 2CF8H 2FS8A 3FFGA 4E7NA 1TNJA 2VWLA 3NXPA 1MU8B 2NU2E 4JZFH 4QT8C 3BTME 1TQ7B 1YF4A 3AVZA 4X0WU 5E0HA 2ZPRA 1IHTH 4Q7ZA 3PWBA 1GMCG 2VU8E 1QL9A 4ISHH 4MPUA 4WH6A 5A09A 3P8OA 3SJOA 1UK2A 1ID5H 1TNIA 1LVBA 2GCTB 4GHQA 1BTYA 1O3IA 3RC5A 1DICA 3L3TA 2TBSA 2FO9A 1O2MA 2F9VA 1YPHE 2KAIA 2PUQH 4TYDA 3GY8A 3RXGA 1RTFB 1S5SA 4MTBA 4I8KA 4ZMAH 3O8BA 1SI5H 5EOKA 1O3AA 3BIUH 5L2ZH 3OSYA 2D2DA 3E91A 2WINI 1Q2WA 1FDPA 1SGYE 4ZROA 2G8TA 2NU0E 1S0RA 4UFEH 2OC1A 4BAHB 2PSXA 4LXBH 1AFQC 1GBEA 4UFGH 4HFPB 3PLBA 2RG3A 1ZOMA 2JKHA 1LPGB 2Z9KA 2FIRH 1O2VA 1YPGH 1C5SA 1DM4B 4NWLA 1AKSB 4TY7A 5DJ7A 1C2IA 1O38A 5C1XA 4A5TS 1FY8E 1G37A 3GCHB 3QWCH 3DT0H 2Z3CA 1SHHB 3PO1B 1UCYK 4XFQA 1ZTLA 3GOVB 5F8XA 1KLTA 4FU7A 1GBAA 4XE4A 6GCHG 3LGVA 5FX6A 1J16A 1W11U 1OWHA 2TGAA 5SGAE 1A7SA 1SMFE 3SBKA 5EPNA 2BQ7B 5HYOA 5JBTA 3KGPA 1SOTA 3ZVEA 1O5DH 5FXLA 3TJOA 2OLGA 2QC2A 1G2LA 1UTOA 2GMTB 5DP8A 4AB8A 1C1WH 1QRXA 1BA8B 1XMNB 3UTUH 1SGRE 1UTKA 3MH5A 4AB9A 3QK1A 1SLWB 2ZECA 4MNWA 2ODQA 3TK5A 1KXDA 4HZHA 1HB0B 2FX4A 1QJ1B 1V2TT 1NFWA 1OP0A 2P95A 1C1SA 5L6NH 4FUHA 4NZQA 3TH2H 1AE5A 1QNJA 3SNBA 5DP5A 9LPRA 3S69A 5LPEA 3VPKA 1FJSA 1SG8B 4MNXA 3BTHE 1EB2A 1C1QA 1MTNC 4AFZA 1ABIH 1AGJA 1BIOA 1SPJA 4MPXA 4GCHF 1OOKB 1EATA 1LCYA 1P01A 1GBBA 1SFIA 1Z8RA 1IQLA 2TGTA 5A0AE 1E36B 2H2ZA 5DGJA 4AFSA 1ELEE 1MQ5A 2H1UA 1O2OA 1C4U2 3MU8A 1ABJH 1XXFA 2GCHF 2PKSC 2ZDKA 3A82A 2PR3A 4MDSA 1CT0E 3S7KB 3RMNH 7GCHF 4NA9H 1P2IA 1ETSH 3M35A 1C1PA 2WPMS 1WAYB 3RC6A 4ZKOU 2ZFPH 3FAOA 2W5EA 3K6ZA 3SV7A 1F7ZA 1GWAA 3ELAH 4A1TA 3A80A 4LK4A 2Y82A 1F5RA 3UWJH 8ESTE 4FUBA 1RJXB 1GMDF 1ZLRA 5C2ZA 1C1NA 1NESE 2R2MB 1Z8GA 1C1OA 1SBWA 3MWIU 3VGCB 1QBVH 1FN8A 2FOHA 1SGTA 1EPTB 2C4FH 2OD3B 3MH4A 1YCPK 5GWZA 3MU0A 1FLEE 3C1KA 2WPKS 2XYAA 1ZGIA 3FP8E 2BX4A 1NY22 4NIYA 1C9TA 2H6MA 1H8IH 3FP7E 1V2PT 1DWCH 2HGTH 1OPHB 1K22H 3UQVA 1TBQH 4JZDH 1Y5UT 4B2BA 1OWDA 4NFEA 4Y11E 4DGJA 1XVMA 5JB9S 2KAIB 5J4SA 4JYTA 2D1JA 4NSVA 1OWEA 3ZZ8A 2O8WA 1UO6A 3ENSB 2CHAC 1HYLA 3OYPA 3LIWA 3TK9A 2BM2A 1U6QA 3BG4C 2W7UA 1C2FA 1FPHH 4HGCA 3ZVBA 3MTYA 3U98H 3A83A 4AGKA 4MPVA 2ZF0H 1ELBA 1FY1A 1XUJA 3RXEA 2W26A 4CH8B 1JOUB 4IMQA 4Z6AH 4INKA 1WSSH 1O2UA 3SV8A 2GD4B 3BEFB 1ELDE 2H9TH 3ODDA 2ZU2A 4F49A 1AVWA 2JETC 4O03A 3ZVDA 3A7ZA 3GYMA 1A0JA 2Z9IA 4I31A 1P8VC 2XNIA 1SOZA 1H8DH 3LC3A 3RXVA 4ABIA 1P2JA 1O2KA 3TGKE 3VXEH 1P2NA 1W12U 2C90B 3K65B 2RA0A 3E3TA 3U1IB 1INCA 2Y5GA 1J15A 5EQQA 1GHVH 1FXYA 1SGFA 3BG8A 5GDSH 2BY7X 4E05H 1Z71A 2YNBA 1SGIB 1CQQA 5GCHG 4TWWA 1YPMH 1GPZA 1PYTC 1Z1IA 1Y5AT 1TWXB 4VGCB 2FXRA 2Y7ZA 3ZZCA 3UNRA 3B23B 3RXKA 1ESBA 4FUGA 1LQDB 4BAQB 3VB3A 1PQ5A 4M7GA 1MD7A 1IQEA 1IQHA 1IQIA 1TOCB 1LVYA 3SGAE 2SGFE 2AERH 1O5EH 1C5PA 5DP7A 2ZTZA 2ZU3A 1ZMNA 4FUIA 2CXVA 1EKBB 1O30A 3UNQA 1TMTH 3HK6B 1BRCE 3ATIA 1QJ7B 1TA6A 2FTMA 2VIDA 2XC5A 1TAWA 4JCNA 1QA0A 3EA8A 4U30A 1RGQA 1GJBB 2BOKA 4I33A 5E2PA 3TJNA 1KIGH 4K5ZA 3A84A 3TIUA 1DOJA 2XC0A 2ZFSA 4FVBA 3RU4E 1Y3XA 1GHAF 1K1IA 5FX5A 2OTVA 2SGAA 2J94A 3TH4H 5C5NA 4LZ1H 1D6RA 1KXCA 1IQJA 1C5QA 4X1QU 1ZHMA 4ABGA 3LGWA 2YNAA 1M9UA 3UUZA 1EXFA 5JBBS 1XUFA 3BTFE 2EI7A 3SV6A 1Y3UA 3NCLA 3FANA 3ZVCA 5JDUB 3LT3A 2GCTC 1MUEB 1ANEA 5FPYA 1GBFA 1V2ST 3UOPA 2A5AA 3ZZ3A 2ZGHA 8KME2 4X2VA 4DJZB 3RXTA 2ZFTA 1ESAA 5E0GA 1G3EA 2GV6A 2QY0B 3RXAA 1QIXB 1TE0A 1EZXC 1YC0A 5C1UA 3V12A 1BMMH 1XM1A 3AAVA 3KF2A 3OX7U 1V2LT 1XUHA 3SU4A 2P16A 4DW2U 1EB1H 4R0IA 3MYWA 5K0HA 4NZLA 1UTQA 3RXUA 2BY8X 1HAVA 1DANH 4B71A 4YTAA 1S82A 1MTNB 1S0QA 1TNHA 1GBMA 1ETRH 1Q31A 3JZ2B 5GJ4B 2FEQH 4X6NA 3EE0B 3H5CB 3KQCA 4AORA 3GCHC 2G52A 3PO1C 3AASA 2VIOA 4OS4A 3GDSA 3VFEA 4O9VA 2OQUA 4D76A 1V2WT 1TX8A 2ZPQA 4GUXA 1KXBA 3RU4T 1C5RA 1DSTA 1J17T 1GI9B 1GBLA 1WOFA 2GMTC 4FU9A 5FPTA 3A88A 2ZC9H 2A31A 3P70B 5DKMA 2ZFRH 2VIVA 2XTTB 2AEIH 3LGTA 5TJXA 4NIXA 5HXFA 2QN5T 2AIPA 1GL1A 3SZNA 1GJAB 4YZUA 5DP6A 1FY5A 1HPGA 1LMWB 2BVXH 5EU8A 5F03A 2G4TA 3TNTA 1AN1E 3QLPH 4NWKA 3LJJA 3RXCA 4I7YH 3K6YA 1GI1A 1NN6A 1SVPA 3UR6A 2HRVA 2VVCA 1LTOA 3GDUA 2TIOA 3ODFA 4AYYB 3SI4H 2BY6X 3RC4A 5ETXA 2AFQB 1GHBG 1THRH 2QXJA 2QCYA 5DO4H 1QR3E 2AH4X 2SGEE 3UFAA 1L1GA 2GX4A 1HAHH 4KTUA 4AOQA 3SW2B 1NRNH 2FPZA 1RXPA 4KTCA 1BJVA 2QV1A 1Q3XA 1TGBA 1ZTKA 4THNH 4UFFH 2ZU5A 1DUEA 3P8NA 3IWMA 3EAJA 1TPPA 4GVUA 1TRNA 4SGBE 3U9AH 3UR9A 4K60A 2VINA 1C5OH 1C2DA 4IBLH 5EXLA 3EGKH 4KTSA 3SGQE 2QIQA 1VJAU 1AZ8A 3BTDE 9ESTA 2C93B 1YYY1 2JETB 1P57B 1SFQB 1ANBA 1QCPA 1TRYA 1MU6B 1IQFA 2F9PA 3P92A 3VGCC 4U32A 5HM9A 5TCCA 1EPTC 3I78A 3ZVFA 1E34B 4KGAA 4H6TA 1ETTH 1HV7A 4K8YA 5EODA 5C1YA 3ZZDA 2TRMA 4XDEA 2SGDE 3PTBA 1BRUP 1C5LH 4DY7B 1S85A 2VIPA 4WY3A 1Y5BT 1D3PB 3M37A 1SLXB 1YPEH 1GI5A 1MH0A 3SQEE 1L1NA 1O2GH 1S6HA 2ESTE 4E06H 2A5KA 1C5NH 1O3CA 1Z7KA 1C1UH 1F5KU 1HAIH 4Z0KA 1QRWA 2AMDA 2BD3A 1QHRB 2PV9B 3SV9A 2R0KA 1CHOF 3ZYDA 1TNKA 1O35A 2A7HA 2HWLB 1KYNA 2UUKB 1XX9A 2FYQA 1H9HE 1Y8TA 5FBIA 3A89A 2BQWB 1MTVA 1O3EA 1E35B 2O8LA 3KQEA 1VCWA 3SI3H 1P9SA 1BTHH 1EOJA 1H9IE 3LONA 1K2I1 1AWFH 2GP9B 3PLPA 2FLRH 2PKAA 2HVXA 1ARBA 2BD5A 1GHWH 3GY4A 4ZUHA 3KL6A 2ZDLA 1NU7B 1ZR0A 1CA0B 1GJ9B 1DY9A 3SNAA 3D49H 2A5IA 2OCVB 3ATMA 3TK6A 3A87A 1A3BH 1UHBB 2RA3A 3KHVA 1LHFH 2A0QB 3TGJE 3GY7A 2NU4E 3NZIA 4K2YA 4MPWA 4BAKB 1GBCA 1KSNA 4ISLA 4DG4A 7LPRA 1C1TA 3M5LA 4AGJA 4MQAA 3EA9A 1DWDH 4OGXA 1CA8B 3SOSA 1EASA 2A7JA 4GSOA 1S83A 1QURH 3QN7A 1BCUH 4VGCC 2OUAA 3TVJB 3Q3KA 1TPSA 1T32A 1VR1H 1W0ZU 1L4ZA 4JYVH 1KTSB 4FUFA 4YO9A 1GI7B 2XBWA 4OS6A 1BTPA 1KDQA 5HGGA 4GHTA 1C5MD 1ELTA 3A8BA 3A85A 1P06A 7GCHG 1O5CB 1HAPH 1P2OA 3GICB 1V3XA 1L4DA 2ZFFH 2FOFA 1MCVA 4Q80A 2OBOA 2JH5D 4JZEH 2ALPA 1BMLA 1AMHA 4BXSA 1DWBH 1TBRH 3IITA 1QB6A 4ZAEA 2I6SA 3E1XB 1T8NA 5EQSA 1QB1A 3M3SA 3HPTB 3DD2H 1GJ4H 2BLQA 4X2WA 2BVSH 3RXOA 1AWHB 3EA7A 2R3UA 4X1SU 1BBRH 3N7OA 2C8XB 1V2JT 2A4RA 5FBEA 4B75A 3SUGA 1YPKH 1AHTH 1HGTH 2F9UA 3AAUA 1HBTH 2UUFB 1S84A 2XBXA 3DA9B 4DT7B 1AY6H 3BSQA 3PMAB 3F9GA 1OWIA 2PLXA 4MNVA 3P17H 1D4PB 1BJUA 3ATWA 5B6OA 2W3KA 1YCPM 2OBQA 1A0LA 3ATKA 1TNGA 2BDIA 1TBZH 1GBIA 5FCRA 4A7IB 2J95A 2A2QH 3A7WA 5ESBA 3U69H 2AGGX 3DFLA 1GJCB 2R0LA 8LPRA 4YOJA 3LGIA 1O2WA 2TGDA 3STJA 3TJVA 2NU3E 1OSSA 1C2LA 1P0SH 4B73A 1ZJDA 3A86A 2AIQA 3RXQA 4ZKRU 2HLCA 1LQEA 2PFEA 1LVMA 1MTWA 3MFJA 2H5CA 1HJAB 1GI8B 1DS2E 2GV7A 4Y6DA 3TPIZ 1O2IA 4K1EA 1OP2A 4OS2A 2TGPZ 2RDLA 1EAWA 1FNIA 4WXVA 5H4IB 1AQ7A 5F8TA 4JMYA 4SGAE 2BZ6H 2Z94A 2WV5A 1SB1H 1UVUH 3O8CA 1K28D 3SUDA 1GMCF 3GY6A 1GI3A 1NFYA 2BDHA 1SGPE 4RKOB 4TPYA 5DPAA 3S9AA 2VWOA 1O2ZA 1HAOH 1WV7H 1ZHPA 2ZEBA 3ATLA 1O5GH 2XWBI 1O3OA 3DUXH 1O5AB 2FS9A 5CHAB 4AFUA 3F9FA 5IYTA 1XUKA 4AG1A 3SU2A 1SQAA 3PMHB 2VNTA 4INHA 1HDTH 1O37A 1EX3A 5T6DA 3B8JA 3KCGH 1TRMA 4DCDA 1VCQA 2VJ1A 1ZTJA 4H4FA 2BXUH 3LC5A 3RM2H 4ASHA 3RXRA 3V13A 1O5BB 4FU8A 3LH3A 1AUJA 1PQ8A 3G01A 5EW1H 1KXFA 1PYTD 1P3CA 2G5VA 3MI4A 3VB4A 3ZZ5A 1FY3A 1V6DA 3WY8A 1SL3A 4UFDH 2B0FA 2XRCA 4YT7H 1DWEH 3MO9A 1G9IE 3H7TA 4YLUA 3ZV8A 1ZPCA 1EZUC 1OS8A 1K9OE 4DURA 3VB7A 2BDCA 3ZZ9A 4D8NA 1TYNA 2AGEX 1MBQA 3MU1A 4ISNA 3VEQB 2BLVA 1QBNA 3GCTG 3PWCA 2Q6DA 1N6XA 2QYIA 5AF9H 3MH7A 1UK3A 1KDQB 1K21H 1W14U 8GCHG 1NO9H 1DPOA 5T6FA 4BTIB 1YLDA 3OY5U 1LHGH 3AW0A 3RMMH 4OGYA 3UREA 2CF9H 2FOMB 3OTJE 1O3HA 1AO5A 1A5IA 1O2QA 2ANKH 4LOYH 1UVSH 1UJ1A 2G4UA 5CMXH 1THPB 1GMHG 2ZGCA 2GTBA 1P04A 3KIDU 2G55A 1IHSH 2BLWA 3STIA 4CHAB 3KQBA 1QY6A 4Y0YE 1PQAA 5I25A 1JRSA 1KY9A 1PPCE 3E0PB 4B74A 3SQHE 1CU1A 1HXFH 1A2CH 1CT4E 1TGNA 1X7AC 4I8GA 2J2UA 4ABFA 2HPPH 5T3HA 3PTNA 1ACBE 3SJ8A 1WTHD 2HNTF 3GCNA 2ZKSA 1FONA 5LPFA 3M36A 5PTPA 1EJNA 4I32A 4Q7XA 3TLOA 1UVTH 2PGBB 3NUMA 6LPRA 3PB1E 1O2XA 1KLIH 3MHWU 4HI3A 2BXTH 3V3MA 3LGUA 3K2UA 5GXPA 4WMDA 1ZPZA 1KTTB 2BD7A 4BOHA 1H1BA 2B8OH 2O8TA 4UD9H 4ABAA 3ZYEA 3O8DA 3SU1A 2BDAA 3LH1A 2FOBA 1UTLM 4I8JA 1AB9B 2SGPE 1QJ6B 2XWAA 1GGDB 2H9HA 2QXIA 1WTGH 1V2MT 1N8OC 1V2NT 4BNRA 3LDXH 2CJIA 2SFAA 3QTOH 1OWJA 4FUDA 1AIXH 1L2EA 4Y7BA 1YP9A 2Z9JA 4D9QA 4UONA 2ZNKH 3EYDA 3LOXA 3U8TH 3E90B 1SGNE 1XVOA 2G51A 3A81A 5A8YA 2J34A 1GBTA 3BTQE 1Y59T 1CA0C 2G5NA 5E0JA 1QQ4A 1BITA 1A61H 1FAXA 4Y8YA 3V7TA 1JBUH 3ZZAA 5FHTA 3ZZ7A 2PW8H 1ZRBA 3MNSA 1O3FA 3DHKH 1O36A 4DVAU 2TPIZ 1LKAA 4FVDA 4NG9H 1O3KA 4ZHLU 4JYUH 4XSKU 4X8VH 3T27A 1CGJE 5EPYA 1K1MA 4IS5A 1BOQA 1V2RT 2ZTYA 1V2OT 2HNTC 3T5FH 3E0NB 1BTUA 4JK5A 1C2EA 1ELAA 2R3YA 3M5OA 1W3CA 3BTKE 3ZZ6A 1BTWA 4XBBA 1BUIA 3RLWH 4D7FA 4PROA 2ANMH 3SU5A 2BLOA 1P9UA 3EDXB 3LKWA 1TMUH 4BAOB 1AI8H 4Q2KA 1C2KA 1GCTB 4OS1A 4D7GA 3F68H 1ELVA 2FM2A 4AN7A 5JYIA 2Q6FA 1P02A 3W94A 1CGHA 1FAKH 1YLCA 2BD8A 2PGQB 5EQRA 3KNXA 4F4OC 3LJOA 1HAGE 4TPIZ 1OKXA 2SNWA 4FXGH 1GDUA 1HUTH 1CHGA 1F0UA 3Q77A 4NA8A 2WUBA 1HIAA 2OC0A 3U8OH 5HM2A 4MG3A 1O31A 5E2OA 1ZMJA 3TJUA 5JPMH 2D26C 1CSOE 3RMOH 3VXFH 1V2QT 1K1JA 1JIMA 1A46H 1ELFA 1E0FD 1PPFE 3TU7H 1C2HA 2I6QA 1E38B 3SHAH 3P6ZB 3T28A 1C2GA 1IOEA 1MAYA 2ZGJA 4Y0ZE 5F8ZA 4JZ1A 4WXIA 1GL0E 2UWLA 5GCHF 2FP7B 1O2YA 1GJ8B 1GJ5H 1OYQA 2Y80A 1H4WA 3F6UH 1AZZA 1RS0A 4A1VA 3UWIA 1QGFA 1RTLA 3S7HB 2WPJS 4ISOA 1EUFA 1VCPA 4K1SA 1EZSC 2ZU1A 2ULLA 1YPLH 4ZXXH 1GI2A 4ABEA 1B0EA 2ANWA 2BD9A 4B2CA 4Y10E 2ALVA 1J9CH 3A8AA 3URDA 1HJAC 3SNEA 3UPEA 2UUJB 3RXLA 5A8XA 2DE8A 1GVZA 5EXNA 2FWWA 3MO6A 3QGJA 2HPQH 1N6YA 7KMEH 1W7GH 4B76A 1AU8A 1O3PB 4J2YB 2JH6D 3Q00A 3HKJB 1Z1JA 4X6MA 2Q1JA 1QFKH 4ZKNU 1SLVB 3P8FA 1QTFA 1SGCA 1DXWA 1V2UT 1T31A 2AMQA 2F3CE 2VIQA 2XBYA 1BBRE 2AS9A 5LPRA 1A5GH 1FIWA 1AKSA 3ZZBA 2P3TB 3P95A 2Z6BD 1TONA 5G4BA 4CREA 1DSUA 1FY4A 1SSXA 3P8GA 3QDZB 3URCA 2RCEA 2FOCA 1O3DA 1WQSA 1BMAA 2SGQE 4BAMB 1QA7A 5CHAC 5BRRE 5I46H 2ZIQH 2A2XH 1UCYH 3CP7A 4WJG2 1ANCA 1RD3B 4GPGA 2ZWLH 4NSYA 1O0DH 3HGNA 5DP3A 1MKXH 2FDAA 1GHXH 1PPGE 3BTTE 5JB8S 1FUJA 1O3NA 4GLYA 3R3GB 1KXAA 2FZZA 1O2TA 3MNCA 5L30H 4ZXYH 4MNYA 2A32A 3LGYA 1LVOA 3ZVAA 1C4V2 1SQTA 3M7QA 3KN2A 1A5HA 2Z3EA 2BTCE 3C27B 1RIWB 1C1RA 4YOIA 4CH2B 4NIWA 4ZH8A 1MKWH 4ZKSU 2A45B 3F9EA 3HK3B 1N1LA 5JBCS 1DFPA 1EAXA 3OY6U 2IPHA 1LO6A 1UK4A 2ZGXH 2DE9A 1C9PA 1DLKB 1HCGA 3AW1A 3MH6A 5IDKA 1SLUB 3T2NA 1GG6B 1MTSA 1QBOA 1A4WH 1GDNA 1GI4A 3PLKA 2P3FH 3Q3XA 3RXSA 2VH6A 3RXFA 1VZQH 2ODYB 1P09A 4AG2A 1OXGA 1O2JA 3QGNB 1BHXB 2GVFA 1HXEH 4XOJA 2B9LA 2M5TA 4K69A 2J38A 5JBAS 1N8OB 4X1NU 1ZGVA 1L0ZA 4CBOA 1MBMA 3L6PA 3ITIA 1GJ7B 2OC7A 2ILNA 4ESTE 1HAVB 3PROA 1C2JA 2PWXA 2FI4E 1SGFG 2ZPSA 1GI6A 2THFB 1O2SA 2FODA 2FLBH 1TGSZ 1PPEE 4CHAC 2ASUB 4MVNA 1T4UH 2ZHFH 3LPRA 3RDZA 1O3LA 3BEIB 3E6PH 3UQOA 4OS7A 2FYRA 1B7XB 2WYGA 1A1RA 1Y3VA 1G36A 2ZP0H 3RXDA 1HAZB 2F9OA 4GCHG 1DITH 3UIRA 2F9NA 2Y5FA 2Y81A 1TX7A 1XXDA 4CBNA 1QL7A 4JK6A 1GHBF 1EPTA 1CVWH 1ZRKA 3BTGE 1UMAH 1IQNA 3T26A 1NRPH 3SUEA 5J4QA 3TGIE 1JRTA 1DX5M 1VITF 4H6SB 1YCPH 2GCHG 5C67A 2FOGA 2ZCLP 4AX9H 4LZ4B 3M3TA 1C5XB 1D3TB 2ZCHP 1QQUA 3FP6E 1A0HB 4OS5A 1AB9C 1AVXA 2VVVA 2XW9A 1DVAH 2IJOB 5ESTE 1GGDC 4IGDA 3SNCA 4ABBA 1HJ8A 1OYTH 1YPHC 1EAUA 2ZFQH 1WUNH 1NRRH 1TIOA 1TNLA 1A3EH 1HAXB 2LNCA 4KKDA 2FTLE 3QX5H 3PM3A 1KXEA 6CHAB 1GMDG 2PHBA 1XUGA 1YGCH 2VGCB 1K1PA 5EW2H 4ZHAA 1TGTA 1GVKB 2PTNA 2WUCA 4O97A 4NCYA 4UE7H 2Z9GA 1YKTA 4I8LA 4CRBA 2IOTA 5BPEA 3BIVH 1G30B 1NRQH 1EAIA 3SUFA 1MD8A 1G3DA 4JZIA 1L1JA 1T8OA 2C8YB 3ESTA 2H9EH 2HOBA 2CN0H 3D23A 3RP2A 5T6GA 3QZRA 5C5OA 1Z8IB 2SNVA 1UVPA 2BY9X 3HATH 2OC8A 4NA7A 3TITA 2V3OH 4XBCA 5C3NA 2P8OB 3S0NA 4K3JA 1MKXK 3VB5A 1GI0A 3F1SB 1GBHA 1PPZA 2ZA5A 2UWPA 1XKAC 4CR5A 3SO3A 3CS0A 3PV4A 1MAXA 1PFXC 2ZDNA 2ZDAH 1TABE 1GCTC 1WBGB 1SGDE 4RSPA 1BB0B 2A1DB 2BDBA 2ZCKP 1C2MA 1FI8A 1P05A 2CV3A 3GCOA 1W10U 1UTMA 2ZGBH 1O33A 1UTJA 1O3BA 1G3CA 2R2WU 3GDVA 3PYHA 1PPHE 4GAWA 1AE8H 2ZDVH 1CO7E 1LKBA 3D65E 3TH3H 3SV2H 5LGOA 1D3QB 2GKVE 1MKWK 2A4GA 3RM0H 3D62A 2Y7XA 1GHYH 4YT6H 1IAUA 1T8LA 3M7UA 2ZDMA 3R0FA 1IQGA 1Y3YA 1DUAA 3A7VA 4CRCA 4Q7YA 3U8RH 1LHEH 4H42U 3RMLH 1NFUA 1GCDA 1SGQE 3A7XA 3DFJA 4TY6A 1NT1A 2PUXB 1G3BA 4RN6A 4X2YA 4BTTB 2EC9H 1TALA 1D6WA 3PMJA 2UUYA 3RUOA 1ESTA 3BN9A 1ZPBA 1GBDA 1EZQA 2HALA 2VWMA 5GIBA 1JWTA 3RXPA 2O8UA 1HLTH 1NRSH 4U01A 2ZHQH 2O9QA 4A6LA 1GHZA 1NPMA 2PKAB 3JZ1B 1F5LA 2BVRH 1ANDA 3W95A 1O2LA 3I77A 2QA9E 4BANB 1SQOA 1W13U 4Y76A 5GPIB 4B1TA 1AFEH 4ISIH 2BX3A 4J1YA 1BHXF 3CENA 1LDTT 1WYKA 1CGIE 1GHAG 2ZTXA 4YLQH 1TB6H 4IN1A 3FVFB 1RTKA 5ABWA 4IW4E 1G2MA 2R9PA 4DIHH 5DG6A 1ZHRA 1FPCH 4WH8A 2BD2A 2GDEH 6GCHF 1VGCB 1T7CA 1MTUA 2ZG0H 3K9XB 1P2QA 4X2XA 1CBWB 3SORA 4NGAH 2A7CA 2CGAA 1AD8H 1YPJH 2YOLA 1O2RA 2DUCA 1EJAA 1WCZA 3HGPA 4CR9A 4R8TB 4X1PU 1TX6A 2Y6TA 2LPRA 3RXJA 1DDJA 1BQYA 3Q3YA 3QZQA 1NS3A 3A8CA 3GISB 2V0BA 4Y8ZA 4X8UH 5TCAA 2V3HH 3QUMP 4O3TA 5FPSA 1BBRK 1O2PA 3MMGA 5FAHA 1KLJH 3SU6A 1GJDB 1DLEA 3B9FH 1P2KA 4ZHMU 1ZSLA 4XBDA 1S81A 5E8EH 1Z6JH 2EEKA 1MZDA 2ZHDA 3RU4D 2P3UB 4B2AA 3HKIB 1S6FA 5AFZH 5L2YH 4YESB 4K8BA 1B0FA 4IN2A 1EP5A 2XCNA 4FUCA 1TFXA 4KELA 3MU5A 2STAE 4Y8XA 1RIWC 1FV9A 4UDWH 3RXIA 3NPSA 1NFXA 2EI8A 2NU1E 1HNEE 1T8MA 2P93A 2ZQ1A 1FMGA 3M61U 1ARCA 4BTUB 3A8DA 4FUJA 2WYJA 1GG6C 5F6MA 2XCFA 3RLYH 4ABJA 1O2NA 3ZV9A 1C5VA 1O39A 1CT2E 3KQDA 5CE1A 2NWNA 1VITH 1LHCH 3SHCH 1DY8A 5LH8A 4DOQA 4MLFB 2BDGA 1BTXA 1W2KH 3NWUA 5HMAA 2XXLA 1ZJKA 5DP9A 2GZ8A 1TMBH 2O8MA 2D8WA 2BB4A 1QB9A 1UCYE 2QXHA 2GDDA 3GY5A 2B7DH 1O5FH 2QXGA 3BTEE 1H9LB 1AFQB 2Y5HA 5EGMA 2BQ6B 3FZZA 1J14A 2BD4A 1YBWA 4KP0A 1OWKA 3GYLB 2FI5E 1C1MA 2C3SA 2WPLS 2OXSA 1RFNA 1F0TA 2EA3A 1P3EA 2OQ5A 2ANYA 2JH0D 5C20A 4WF8A 1UTNA 2V35A 4WMEA 1SHYA 1BTZA 1NZQH 3MOCA 2ZI2H 2A4QA 1MZAA 1RRKA 1WQVH 2J9NA 4Y71A 2ODPA 2AMPA 2VB0A 3MO3A 2HNTE 3MU4A 1CE5A 3GCTF 2OINA 1W8BH 3QTVH 1VJ9U 1TA2A 4RKJB 2G00A 1O2HA 5EXMA 8GCHF 3VB6A 1Z6EA 1P12E 1B5GH 1LPZB 2OP9A 2BOHB 1WU1A 4AFQA 2Z7FE 2PTCE 1TLDA 3CS7A 2BMGB 2FI3E 1ELGA 4IC5A 3PMBB 2P59A 1GMHF 1EQ9A 3OU0A 1D3DB 2CMYA 2F83A 1ZSJA 2W7SA 2VIWA 5A8ZA 1SGEE 4FUEA 4INLA 2FOAA 3T62A 2WPIS 2BY5X 1E37B 6CHAC 2ZU4A 3I29A 2VGCC 1GBJA 3NK8A 4WWYA 1LPKB 1C5YB 2XC4A 1ORFA 4HTCH 1BZXE 3A7TA 3SU3A 4IC6A 1IQKA 1EJMA 1BMNH 2Q6GA 2C8ZB 4K1TA 3RXMA 2GZ9A 2FOEA 5AVDA 1K1NA 4WMFA 3RXBA 1UVOA 3IG6B 1HRTH 1SC8U 1P03A 1NTPA 5AHGH 1NM6A 1BT7A 1MQ6A 3MNBA 1P11E 1ELCA 1UHBA 4AZ2B 3QO6A 1EP6A 1CHOG 1O3GA 1OP8A 2LIZA 3T29A 3BV9B 2P8OC 1SR5C 2PKSB 2VVUA 1D9IA 4CRDA 1JIRA 3F9HA 1DXPA 2F9BH 4A1XA 3ZVGA 1C5TA 1PPBH 3E8LA 1FQ3A 1C5ZB 2Z3DA 2ZHEH 2EI6A 1FZZA 1T4VH 1BRAA 2ZZUH 1MCTA 1AVGH 1V2VT 1F2SE 3TNSA 2BYAX 4X8SH 6ESTA 4DIIH 4X6PA 1F0RA 5FCKA 4NFFA 1TQ0B 1DE7H 2IN2A 2K1QA 1UTPA 3EQ0H 4Y7AA 4E7RG 2AYWA 1FN6A 1HFDA 2BHGA 3M7TA 5EG4A 3SNDA 2BZAA 4X8TH 2ZHWH 5A0BA 1W7XH 2FMJA 4O3UA 3GY2A 1XKBC 3H7OA 3BEUA 1Y3WA 1PJPA 1GDQA 1MMJN 2GZ7A 2GGVB 1O3MA 1C4Y2 4ABDA 3S9CA 4I8HA 2H5DA 2QGRA 3SJ9A 2GT8A 5K7RA 1BDAA 4NIVA 2QF3A
chains in the Genus database with same CATH superfamily
3SJIA 1QL8A 5C0TA 2ZO3H 4BXWA 2Z9LA 1PQ7A 1JMOH 1THSH 1LHDH 1GBKA 2CHAB 1VITG 2J4IA 4CRAA 3M5NA 4CRFA 1BRBE 2FESH 1NC6A 3BG4B 5A2MH 2GT7A 4Y79A 2V6NA 3UNSA 1EOLA 3MNXA 2K7XA 1V2KT 1XUIA 2BDYA 5AFYH 5DK1A 3UOUA 2LP6A 2W6JD 3GY3A 4UEHH 4YM9A 3Q76A 1TPOA 1Z8JB 1GVLA 1NU9A 4AYVB 1O32A 1F0SA 1W0YH 4Z1MD 3LU9B 4X1RU 4D9RA 1YM0A 3FZDA 5A0CA 1HJ9A 1OX1A 1ZSKA 2VWNA 1HAYB 2QF0A 1O3JA 1TGCA 4IMZA 4TWYA 4WVPE 7ESTE 2VH0A 3M3VA 1NROH 1P2MA 3DSPA 3ZZ4A 1K1LA 1QRZA 3O8RA 2C8WB 2L74A 3BF6H 2JIZD 1JXPA 2QAAA 2AGIX 4CRGA 1K1OA 1VKYA 2PSYA 3A7YA 4X6OA 4A92A 2WV4A 1VGCC 1DT2A 2ZQ2A 2B5TB 2UWOA 1CBWC 4ABHA 1C5UA 1P10A 3BTWE 2G81E 3NKKA 3U1JB 3KEEA 1TPAE 1G32B 3SN8A 1ZMLA 1FIZA 3RXHA 1C1VH 3F0PA 1GJ6A 3GS9A 3OE7D 3L33A 1ZZZA 1O34A 3M5MA 4ACAA 1ZYOA 2A4OA 2WPHS 1AUTC 3SGBE 2J92A 2F91A 3S9BA 2P94A 2FX6A 3SJKA 1C5WB 1F92A 3E16B 1J8AA 3UY9A 3V0XA 5CDFE 2XBVA 3T25A 4YOGA 3EBNA 4U2WA 1TOMH 2W3IA 1HIAB 1IQMA 2STBE 3SU0A 5DP4A 2CF8H 4OM9A 3CNRA 2FS8A 3FFGA 4E7NA 1TNJA 2VWLA 3NXPA 1MU8B 2NU2E 4JZFH 4QT8C 3BTME 1TQ7B 1YF4A 3AVZA 4X0WU 5E0HA 2ZPRA 1IHTH 4Q7ZA 3PWBA 1GMCG 2VU8E 1QL9A 4ISHH 4MPUA 4WH6A 5A09A 3P8OA 3SJOA 1UK2A 1ID5H 1TNIA 1LVBA 2GCTB 4GHQA 1BTYA 1O3IA 3RC5A 1DICA 3L3TA 2TBSA 2FO9A 1O2MA 2F9VA 1YPHE 2KAIA 2PUQH 4TYDA 3GY8A 3RXGA 1RTFB 1S5SA 4MTBA 4I8KA 4ZMAH 3O8BA 1SI5H 5EOKA 1O3AA 3BIUH 5L2ZH 3OSYA 2D2DA 2WSSD 3E91A 2WINI 1Q2WA 1FDPA 1SGYE 4ZROA 2G8TA 2NU0E 1S0RA 4UFEH 2OC1A 4BAHB 2PSXA 4LXBH 1AFQC 1GBEA 4UFGH 4HFPB 3PLBA 2RG3A 1ZOMA 2JKHA 3OEED 1LPGB 2Z9KA 2FIRH 1O2VA 1YPGH 1C5SA 1DM4B 4NWLA 1AKSB 4TY7A 5DJ7A 1C2IA 1O38A 5C1XA 4A5TS 1FY8E 1G37A 3GCHB 3QWCH 3DT0H 2Z3CA 1SHHB 3PO1B 1UCYK 4XFQA 1ZTLA 3GOVB 5F8XA 1KLTA 4FU7A 1GBAA 1W0JD 2XOKD 4XE4A 6GCHG 4ZCNA 3LGVA 5FX6A 1J16A 3F2HA 1W11U 1OWHA 2TGAA 5SGAE 1A7SA 1SMFE 3SBKA 5EPNA 2BQ7B 5HYOA 5JBTA 3KGPA 1SOTA 3ZVEA 1O5DH 2KFWA 5FXLA 3TJOA 2OLGA 2QC2A 1G2LA 1UTOA 2GMTB 5DP8A 4AB8A 2RFKC 1C1WH 1QRXA 2J98A 4RI0A 1BA8B 1XMNB 3UTUH 3KYGA 1SGRE 1UTKA 3MH5A 2QF5A 3QK1A 1SLWB 2ZECA 4MNWA 2ODQA 3TK5A 4AB9A 1KXDA 4HZHA 2PP6A 1HB0B 2FX4A 1NBMD 1QJ1B 1V2TT 1NFWA 1OP0A 2P95A 1C1SA 2HVYB 5L6NH 4FUHA 4NZQA 3TH2H 1AE5A 1QNJA 3SNBA 5DP5A 9LPRA 3S69A 5LPEA 3VPKA 1FJSA 1SG8B 4MNXA 3BTHE 1K0HA 1EB2A 1C1QA 1MTNC 4AFZA 1ABIH 1AGJA 1BIOA 1SPJA 4MPXA 4GCHF 2IPQX 1OOKB 1EATA 1LCYA 1P01A 1GBBA 3VG8A 1SFIA 1Z8RA 1IQLA 2TGTA 5A0AE 1E36B 2H2ZA 5DGJA 2V3MA 1ELEE 4AFSA 1H8ED 1MQ5A 2H1UA 1O2OA 1C4U2 3MU8A 1ABJH 1XXFA 2GCHF 2PKSC 2ZDKA 3A82A 2PR3A 4MDSA 1CT0E 3S7KB 5DN6D 3RMNH 7GCHF 4NA9H 1P2IA 1ETSH 3M35A 1C1PA 2WPMS 4P00A 1WAYB 3RC6A 4ZKOU 2ZFPH 3FAOA 2W5EA 3K6ZA 3SV7A 1F7ZA 1GWAA 3ELAH 4A1TA 3A80A 4LK4A 2Y82A 1F5RA 3UWJH 8ESTE 4FUBA 1RJXB 1GMDF 1ZLRA 5C2ZA 3MQKC 1C1NA 1NESE 2R2MB 1Z8GA 1C1OA 1SBWA 2WZQA 3MWIU 3VGCB 1QBVH 1FN8A 2FOHA 3DCLA 1SGTA 1EPTB 2C4FH 2OD3B 3MH4A 1YCPK 5GWZA 3MU0A 1FLEE 3C1KA 2WPKS 2XYAA 1ZGIA 3FP8E 2BX4A 1NY22 4NIYA 1C9TA 2H6MA 1H8IH 3FP7E 1OHHD 1V2PT 1DWCH 2HGTH 1OPHB 1K22H 3UQVA 1TBQH 1E1QD 1Y5UT 4JZDH 4B2BA 1OWDA 4NFEA 4Y11E 4DGJA 1XVMA 5JB9S 2KAIB 5J4SA 4JYTA 2D1JA 4NSVA 1OWEA 3ZZ8A 2WPDD 2O8WA 1UO6A 3ENSB 2CHAC 1HYLA 3OYPA 3LIWA 3TK9A 2BM2A 1U6QA 3BG4C 5FL7D 2W7UA 1C2FA 1FPHH 4HGCA 3PV2A 3ZVBA 3MTYA 3U98H 3A83A 4AGKA 4MPVA 2ZF0H 1ELBA 1FY1A 1XUJA 3RXEA 2W26A 4CH8B 1JOUB 4IMQA 4Z6AH 4INKA 1WSSH 1O2UA 3SV8A 2GD4B 3BEFB 1ELDE 2H9TH 3ODDA 2ZU2A 4F49A 1AVWA 2JETC 4O03A 3ZVDA 3A7ZA 3GYMA 1A0JA 2Z9IA 4I31A 1P8VC 2XNIA 1SOZA 1H8DH 3LC3A 3RXVA 4ABIA 1P2JA 1O2KA 3TGKE 3VXEH 1P2NA 1W12U 2C90B 3K65B 5HKKD 3H09A 2RA0A 3E3TA 3U1IB 1INCA 2Y5GA 1J15A 5EQQA 1GHVH 1FXYA 1SGFA 3BG8A 2QE7D 5GDSH 2BY7X 3U28C 4E05H 1Z71A 3F0OA 2YNBA 1SGIB 1CQQA 5GCHG 4TWWA 1YPMH 1GPZA 1PYTC 1Z1IA 1Y5AT 1TWXB 4VGCB 2FXRA 2Y7ZA 3ZZCA 3UNRA 3B23B 3RXKA 1ESBA 4FUGA 1LQDB 4BAQB 3VB3A 1PQ5A 4M7GA 1MD7A 1IQEA 1IQHA 1IQIA 1TOCB 1LVYA 3SGAE 2SGFE 2AERH 1O5EH 1C5PA 5DP7A 2ZTZA 2ZU3A 1ZMNA 3PRBA 4FUIA 2CXVA 1EKBB 2V7QD 1O30A 3UNQA 1TMTH 3HK6B 1BRCE 3ATIA 1QJ7B 1TA6A 2L6OA 2FTMA 2VIDA 2XC5A 1TAWA 4JCNA 1QA0A 3EA8A 4U30A 1RGQA 1GJBB 2BOKA 4I33A 5E2PA 3TJNA 1KIGH 4K5ZA 3A84A 3TIUA 1DOJA 2XC0A 2ZFSA 4FVBA 3RU4E 1Y3XA 1GHAF 1K1IA 5FX5A 3ZIAD 2OTVA 2SGAA 2J94A 3TH4H 5C5NA 4LZ1H 5C0UA 1D6RA 1KXCA 1IQJA 1C5QA 4X1QU 1ZHMA 4ABGA 3LGWA 2YNAA 1M9UA 3UUZA 1EXFA 5JBBS 1XUFA 3BTFE 2EI7A 3SV6A 1Y3UA 3NCLA 3FANA 3ZVCA 5JDUB 3LT3A 2GCTC 1MUEB 1ANEA 5FPYA 1GBFA 1V2ST 3UOPA 2A5AA 3ZZ3A 2ZGHA 8KME2 4X2VA 4DJZB 3RXTA 2ZFTA 1ESAA 5E0GA 1G3EA 2GV6A 2QY0B 3RXAA 1QIXB 1TE0A 1EZXC 1YC0A 5C1UA 3V12A 2F4LA 1BMMH 1XM1A 3AAVA 3KF2A 3OX7U 1V2LT 1XUHA 3SU4A 3FN8A 2P16A 4DW2U 1EB1H 4R0IA 3MYWA 5K0HA 3KQ5A 4NZLA 1UTQA 3RXUA 2BY8X 1HAVA 1DANH 4B71A 4YTAA 1S82A 1MTNB 1S0QA 1TNHA 1GBMA 1ETRH 1Q31A 3JZ2B 5GJ4B 2FEQH 4X6NA 3EE0B 3H5CB 3KQCA 4AORA 3GCHC 2G52A 3PO1C 3AASA 2VIOA 4OS4A 3GDSA 3VFEA 4O9VA 2OQUA 3OTPA 4D76A 1V2WT 1TX8A 2ZPQA 4GUXA 1KXBA 3RU4T 1C5RA 1DSTA 1J17T 1GI9B 1GBLA 1WOFA 2GMTC 4FU9A 5FPTA 3A88A 2ZC9H 2A31A 3P70B 2J5UA 5DKMA 2ZFRH 2VIVA 2XTTB 2AEIH 3LGTA 5TJXA 3SZEA 4NIXA 5HXFA 2QN5T 2K0QA 2AIPA 1GL1A 1WXRA 3SZNA 1GJAB 4YZUA 5DP6A 1FY5A 3DSOA 2XNDD 1HPGA 1LMWB 2BVXH 5EU8A 5F03A 2G4TA 3TNTA 1AN1E 3QLPH 4NWKA 3LJJA 3RXCA 4I7YH 3K6YA 1GI1A 1NN6A 1SVPA 3UR6A 2HRVA 2VVCA 1LTOA 3GDUA 2TIOA 3ODFA 4AYYB 3SI4H 2BY6X 3RC4A 5ETXA 2AFQB 1GHBG 1THRH 2QXJA 2QCYA 5DO4H 1QR3E 2AH4X 2SGEE 3UFAA 1L1GA 2GX4A 1HAHH 4KTUA 4AOQA 3SW2B 1NRNH 2FPZA 1RXPA 4KTCA 1BJVA 2QV1A 1Q3XA 1TGBA 1ZTKA 2HLDD 4THNH 4UFFH 2ZU5A 1DUEA 1MABB 3P8NA 3IWMA 3EAJA 1TPPA 4GVUA 1TRNA 4SGBE 3U9AH 3UR9A 4K60A 2VINA 1C5OH 1C2DA 4IBLH 5EXLA 3EGKH 4KTSA 3AK5A 3SGQE 2QIQA 1VJAU 1AZ8A 3BTDE 3F2GA 9ESTA 2C93B 1YYY1 2JETB 1P57B 1SFQB 1ANBA 1QCPA 1TRYA 1MU6B 1IQFA 2F9PA 3P92A 3VGCC 4U32A 5HM9A 5TCCA 1EPTC 3I78A 3ZVFA 4ACBA 1E34B 4KGAA 4H6TA 1ETTH 1HV7A 4K8YA 5EODA 5C1YA 3ZZDA 2TRMA 4XDEA 2SGDE 3PTBA 1BRUP 1C5LH 4DY7B 1S85A 2VIPA 4WY3A 1Y5BT 2WV9A 1D3PB 3M37A 1SLXB 1YPEH 1GI5A 1MH0A 3SQEE 1L1NA 1O2GH 1S6HA 2ESTE 4E06H 2A5KA 1C5NH 1O3CA 1Z7KA 1C1UH 1F5KU 1HAIH 4Z0KA 1QRWA 2AMDA 2BD3A 1QHRB 2PV9B 3SV9A 2R0KA 1CHOF 3ZYDA 1TNKA 1O35A 2A7HA 2AHME 2HWLB 5EJZA 5KECA 1KYNA 2UUKB 1XX9A 2FYQA 1H9HE 3OEHD 1Y8TA 5FBIA 3UAIC 3A89A 2BQWB 1MTVA 4XRNA 1O3EA 1E35B 2O8LA 3KQEA 1VCWA 3SI3H 1P9SA 1BTHH 1EOJA 1H9IE 3LONA 1K2I1 2EQNA 1AWFH 2GP9B 3PLPA 2FLRH 2PKAA 2HVXA 1ARBA 2BD5A 1GHWH 3GY4A 2M2AA 4ZUHA 1YY3A 3KL6A 2ZDLA 1NU7B 1ZR0A 1CA0B 1GJ9B 1DY9A 3SNAA 3D49H 2A5IA 2OCVB 3ATMA 3TK6A 3A87A 1A3BH 1UHBB 2RA3A 3KHVA 1LHFH 2A0QB 3TGJE 3GY7A 2NU4E 3NZIA 2KCOA 4K2YA 4MPWA 4BAKB 1GBCA 1KSNA 4ISLA 4DG4A 7LPRA 1C1TA 3M5LA 4AGJA 4MQAA 3EA9A 1DWDH 4OGXA 1CA8B 3SOSA 1EASA 2A7JA 4GSOA 1S83A 1QURH 3QN7A 1BCUH 4VGCC 2OUAA 3TVJB 3Q3KA 1TPSA 1T32A 2KCYA 1VR1H 1W0ZU 1L4ZA 4JYVH 1KTSB 4FUFA 4YO9A 1GI7B 2XBWA 4OS6A 1BTPA 1KDQA 5HGGA 4GHTA 1C5MD 1ELTA 3A8BA 3A85A 1P06A 7GCHG 1O5CB 1HAPH 1P2OA 3GICB 1V3XA 1L4DA 2ZFFH 2FOFA 1MCVA 4Q80A 2OBOA 4TSFD 2JH5D 4JZEH 2ALPA 1BMLA 1AMHA 4BXSA 1DWBH 1TBRH 3IITA 1QB6A 4ZAEA 2I6SA 3E1XB 1T8NA 5EQSA 1QB1A 3M3SA 3HPTB 3DD2H 1GJ4H 2BLQA 4X2WA 2BVSH 3RXOA 1AWHB 3EA7A 2R3UA 4X1SU 1BBRH 3N7OA 2C8XB 1V2JT 2A4RA 5FBEA 4B75A 3SUGA 1YPKH 1AHTH 1HGTH 2F9UA 3AAUA 5CHBA 1HBTH 2UUFB 1S84A 2XBXA 3DA9B 4DT7B 1AY6H 3BSQA 3PMAB 3F9GA 1OWIA 2PLXA 4MNVA 3P17H 1D4PB 1BJUA 3ATWA 5B6OA 2W3KA 1YCPM 2OBQA 2KR7A 1A0LA 3ATKA 5C17A 1TNGA 2BDIA 1TBZH 1GBIA 5FCRA 4A7IB 2J95A 2A2QH 3A7WA 5ESBA 3U69H 2AGGX 3DFLA 1GJCB 2R0LA 8LPRA 4YOJA 3LGIA 1O2WA 2TGDA 3STJA 3TJVA 2NU3E 1OSSA 1C2LA 1P0SH 4B73A 1ZJDA 3A86A 2AIQA 3OFND 3RXQA 4ZKRU 2HLCA 1LQEA 2PFEA 1LVMA 1MTWA 3MFJA 2H5CA 1HJAB 1GI8B 1DS2E 2GV7A 4Y6DA 3TPIZ 1O2IA 4K1EA 1OP2A 4OS2A 2TGPZ 2RDLA 1EAWA 1FNIA 4WXVA 5H4IB 1AQ7A 5F8TA 4JMYA 4SGAE 2BZ6H 4RT0A 4B6FA 2Z94A 2WV5A 1SB1H 1UVUH 3O8CA 1K28D 3SUDA 1GMCF 3GY6A 1GI3A 1NFYA 2BDHA 1SGPE 4RKOB 4TPYA 5DPAA 3S9AA 2VWOA 1O2ZA 1HAOH 4FOUC 1WV7H 1ZHPA 2ZEBA 3ATLA 1O5GH 2XWBI 1O3OA 3DUXH 1O5AB 2FS9A 5CHAB 4AFUA 3F9FA 5IYTA 1XUKA 4AG1A 3SU2A 4B6EA 1SQAA 3PMHB 2VNTA 4INHA 1HDTH 1O37A 1EX3A 5T6DA 3B8JA 3KCGH 1TRMA 4DCDA 1VCQA 2VJ1A 1ZTJA 4H4FA 2BXUH 3LC5A 3RM2H 4ASHA 3RXRA 1NBME 1O5BB 4FU8A 3LH3A 3V13A 1AUJA 1PQ8A 3G01A 5EW1H 1KXFA 1PYTD 1P3CA 2G5VA 3MI4A 3VB4A 3ZZ5A 1FY3A 1V6DA 3WY8A 1SL3A 4UFDH 1BMFD 2B0FA 2XRCA 4YT7H 1DWEH 3MO9A 1G9IE 1KMHB 3H7TA 4YLUA 3ZV8A 1ZPCA 1EZUC 1OS8A 2JDID 1K9OE 4DURA 3VB7A 2BDCA 3ZZ9A 4D8NA 1TYNA 2AGEX 1MBQA 3MU1A 4ISNA 3VEQB 2BLVA 1QBNA 3GCTG 3PWCA 2Q6DA 1N6XA 2QYIA 5AF9H 3MH7A 1UK3A 1KDQB 1K21H 1W14U 8GCHG 1NO9H 1DPOA 5T6FA 4BTIB 1YLDA 3OY5U 1LHGH 3AW0A 3RMMH 4OGYA 3UREA 2CF9H 2FOMB 3OTJE 3KYFA 1O3HA 1AO5A 1A5IA 1O2QA 2ANKH 4LOYH 1UVSH 2JJ1D 1UJ1A 2G4UA 5CMXH 1THPB 1GMHG 2ZGCA 2GTBA 1P04A 3KIDU 2G55A 1IHSH 2BLWA 3STIA 4CHAB 3KQBA 1QY6A 4Y0YE 1PQAA 5I25A 1JRSA 1KY9A 1PPCE 3E0PB 4B74A 3SQHE 1CU1A 1HXFH 1A2CH 1CT4E 4XD7D 1TGNA 1X7AC 4I8GA 2J2UA 4ABFA 2HPPH 5T3HA 3PTNA 1ACBE 3SJ8A 1WTHD 2HNTF 3GCNA 2ZKSA 1FONA 5LPFA 3M36A 5PTPA 1EJNA 4I32A 4Q7XA 3TLOA 1UVTH 2PGBB 3NUMA 6LPRA 3PB1E 1O2XA 1KLIH 3MHWU 4HI3A 2BXTH 2QF4A 3PRDA 4YXWD 3V3MA 3LGUA 3K2UA 5GXPA 4WMDA 1ZPZA 2J98B 1KTTB 2EY4C 5KEDA 2BD7A 4BOHA 1H1BA 3N7EA 2B8OH 2O8TA 4UD9H 5GNDA 4ABAA 3ZYEA 3O8DA 3SU1A 2BDAA 3LH1A 2FOBA 1UTLM 4I8JA 1AB9B 2SGPE 1QJ6B 2XWAA 1GGDB 2H9HA 2QXIA 1WTGH 1V2MT 1N8OC 1V2NT 4BNRA 3LDXH 2CJIA 2SFAA 3QTOH 1OWJA 4FUDA 1AIXH 1L2EA 4Y7BA 1YP9A 2Z9JA 4D9QA 4UONA 2ZNKH 3EYDA 3LOXA 3U8TH 3E90B 1SGNE 1XVOA 2G51A 3A81A 5A8YA 2J34A 1GBTA 5C94A 3BTQE 1Y59T 1CA0C 2G5NA 5E0JA 1QQ4A 1BITA 1A61H 1FAXA 4Y8YA 3V7TA 1JBUH 3ZZAA 5FHTA 3ZZ7A 2PW8H 1ZRBA 3MNSA 1O3FA 3DHKH 1O36A 4DVAU 2TPIZ 1LKAA 4FVDA 4NG9H 1O3KA 4ZHLU 4JYUH 4XSKU 4X8VH 2RDEA 3T27A 1CGJE 5EPYA 1K1MA 4IS5A 1BOQA 1V2RT 2ZTYA 1V2OT 2HNTC 3T5FH 3E0NB 1BTUA 4JK5A 1C2EA 1ELAA 2R3YA 3M5OA 1W3CA 3BTKE 3ZZ6A 1BTWA 4XBBA 1BUIA 3RLWH 4D7FA 4PROA 2ANMH 3SU5A 2BLOA 1P9UA 3EDXB 3LKWA 1TMUH 4BAOB 1AI8H 4Q2KA 1C2KA 1GCTB 4OS1A 4D7GA 3F68H 1ELVA 2FM2A 4AN7A 5JYIA 2Q6FA 1P02A 3W94A 1CGHA 1FAKH 1YLCA 2BD8A 3WWBA 2PGQB 5EQRA 3KNXA 4F4OC 3LJOA 1HAGE 3NRLA 4TPIZ 1OKXA 2SNWA 4FXGH 1GDUA 1HUTH 1CHGA 1F0UA 3Q77A 4NA8A 2WUBA 1HIAA 2OC0A 3U8OH 5EIYA 5HM2A 4MG3A 1O31A 5E2OA 1ZMJA 3TJUA 5JPMH 2D26C 1CSOE 3RMOH 3VXFH 1V2QT 1K1JA 1JIMA 1A46H 1ELFA 1E0FD 2IJD1 1PPFE 3TU7H 1C2HA 2I6QA 1E38B 3SHAH 3P6ZB 3T28A 1C2GA 1IOEA 1MAYA 2ZGJA 4Y0ZE 5F8ZA 4JZ1A 4WXIA 1GL0E 2UWLA 5GCHF 2FP7B 1O2YA 1GJ8B 1GJ5H 1OYQA 2Y80A 1H4WA 3FKSD 3F6UH 1AZZA 1RS0A 4A1VA 3UWIA 1QGFA 1RTLA 3S7HB 2WPJS 4ISOA 1EUFA 1VCPA 4K1SA 1EZSC 2ZU1A 2ULLA 5EJLA 1YPLH 4ASUD 4ZXXH 1GI2A 4ABEA 1B0EA 2ANWA 1EFRD 2BD9A 4B2CA 4Y10E 2ALVA 1J9CH 3A8AA 3URDA 1HJAC 3SNEA 3UPEA 2UUJB 3RXLA 5A8XA 2DE8A 1GVZA 5EXNA 2FWWA 3MO6A 3QGJA 2HPQH 1N6YA 7KMEH 1W7GH 4B76A 1AU8A 1O3PB 2F43B 4J2YB 4F48B 2JH6D 3Q00A 3HKJB 1Z1JA 4X6MA 2Q1JA 1QFKH 4ZKNU 1SLVB 3P8FA 1QTFA 1SGCA 1DXWA 1V2UT 1T31A 2AMQA 2F3CE 2VIQA 2XBYA 1BBRE 2AS9A 5LPRA 1A5GH 1FIWA 1AKSA 3ZZBA 2P3TB 3P95A 2Z6BD 1TONA 5G4BA 4CREA 1DSUA 1FY4A 1SSXA 3P8GA 3QDZB 3URCA 2RCEA 2FOCA 1YLNA 1O3DA 1WQSA 1BMAA 2SGQE 4BAMB 1QA7A 5CHAC 5BRRE 5I46H 2ZIQH 1SKYE 2A2XH 1UCYH 3CP7A 4WJG2 1ANCA 1RD3B 4GPGA 2ZWLH 4NSYA 1O0DH 3HGNA 5DP3A 1MKXH 2FDAA 1GHXH 1PPGE 3BTTE 5JB8S 1FUJA 1O3NA 4GLYA 3R3GB 1KXAA 2FZZA 1O2TA 3MNCA 5L30H 4ZXYH 4MNYA 2A32A 3LGYA 1LVOA 4FETA 3ZVAA 1C4V2 1SQTA 4AC9A 3M7QA 3KN2A 1A5HA 2Z3EA 2BTCE 3C27B 1RIWB 1C1RA 4YOIA 4CH2B 4NIWA 4ZH8A 1MKWH 4ZKSU 2A45B 3F9EA 3HK3B 1N1LA 5JBCS 1DFPA 1EAXA 3OY6U 2IPHA 1LO6A 1UK4A 2ZGXH 2DE9A 1C9PA 3OAAD 1DLKB 1HCGA 3AW1A 3MH6A 5IDKA 1SLUB 3T2NA 1GG6B 1MTSA 1QBOA 2YMSB 1A4WH 1GDNA 1GI4A 3PLKA 2P3FH 3Q3XA 3RXSA 2VH6A 3RXFA 1VZQH 2ODYB 1P09A 4AG2A 1OXGA 1O2JA 3QGNB 1BHXB 2GVFA 1HXEH 4XOJA 2B9LA 2M5TA 4K69A 2J38A 5JBAS 1H8HD 3DSGA 1N8OB 4X1NU 1ZGVA 1L0ZA 4CBOA 1MBMA 3L6PA 3ITIA 1GJ7B 2OC7A 5T1VA 2ILNA 2K8IA 4ESTE 1HAVB 3PROA 1C2JA 2PWXA 2FI4E 1SGFG 2ZPSA 1GI6A 2THFB 1O2SA 2FODA 2FLBH 1TGSZ 1PPEE 4CHAC 2ASUB 4MVNA 1T4UH 2ZHFH 3LPRA 3RDZA 1O3LA 3BEIB 3E6PH 3UQOA 5DSFA 4OS7A 2FYRA 1B7XB 2WYGA 1A1RA 1Y3VA 1G36A 2ZP0H 3RXDA 1HAZB 2KCPA 4M9FA 2F9OA 4HG6A 4GCHG 1DITH 3UIRA 2F9NA 2Y5FA 2Y81A 1TX7A 1XXDA 4CBNA 1QL7A 2J97A 4JK6A 3WW7A 1GHBF 1EPTA 4P02A 1CVWH 1ZRKA 3BTGE 1UMAH 1IQNA 3T26A 1NRPH 3SUEA 5J4QA 3TGIE 1JRTA 1DX5M 1VITF 4H6SB 1YCPH 2GCHG 5C67A 2FOGA 2ZCLP 4AX9H 4LZ4B 3M3TA 1C5XB 1D3TB 2ZCHP 1QQUA 3FP6E 1A0HB 4OS5A 1AB9C 1AVXA 2VVVA 2XW9A 5IK2D 1DVAH 2IJOB 5ESTE 1GGDC 4IGDA 3SNCA 4ABBA 1HJ8A 1OYTH 1YPHC 1EAUA 2ZFQH 1WUNH 1NRRH 1TIOA 1TNLA 1A3EH 1HAXB 1COWD 2LNCA 4KKDA 2FTLE 3QX5H 3PM3A 1FX0B 1KXEA 6CHAB 1GMDG 2PHBA 1XUGA 1YGCH 2VGCB 1K1PA 5EW2H 4ZHAA 1TGTA 1SQRA 1GVKB 2PTNA 2WUCA 4O97A 5HIZA 4NCYA 4UE7H 2Z9GA 1YKTA 4I8LA 4CRBA 2IOTA 5BPEA 3BIVH 1G30B 1NRQH 1EAIA 2VBCA 3SUFA 1MD8A 1G3DA 2CK3D 4JZIA 1L1JA 1T8OA 2C8YB 3ESTA 2H9EH 2HOBA 2CN0H 3D23A 3RP2A 5T6GA 3QZRA 5C5OA 1Z8IB 2SNVA 1UVPA 2BY9X 3HATH 2OC8A 4NA7A 3TITA 2V3OH 4XBCA 5C3NA 2P8OB 4TT3D 3S0NA 4K3JA 1MKXK 3VB5A 1GI0A 3F1SB 1GBHA 1PPZA 5F53A 2ZA5A 2UWPA 1XKAC 4CR5A 3SO3A 3CS0A 3PV4A 1MAXA 1PFXC 2ZDNA 2ZDAH 1TABE 1GCTC 1WBGB 1SGDE 4RSPA 1BB0B 2A1DB 2BDBA 2ZCKP 1C2MA 1FI8A 1P05A 2CV3A 3GCOA 1E79D 1UTMA 1W10U 2ZGBH 1O33A 1UTJA 1O3BA 1G3CA 2R2WU 3GDVA 3PYHA 1PPHE 4GAWA 1AE8H 2ZDVH 1CO7E 1LKBA 3D65E 3TH3H 3SV2H 3UB0A 5LGOA 1D3QB 1QZ8A 2GKVE 1MKWK 2A4GA 3RM0H 3D62A 2Y7XA 1GHYH 4YT6H 3WWFA 1IAUA 1T8LA 3M7UA 2ZDMA 3R0FA 1IQGA 1Y3YA 1DUAA 3A7VA 4CRCA 4Q7YA 3U8RH 2KZ4A 1LHEH 4H42U 3RMLH 1NFUA 1GCDA 1SGQE 3A7XA 3DFJA 4TY6A 1NT1A 2PUXB 1G3BA 4RN6A 2KCAA 4X2YA 4BTTB 2EC9H 1TALA 1D6WA 3PMJA 2UUYA 3RUOA 1ESTA 5KGOA 3BN9A 1ZPBA 1GBDA 1EZQA 2HALA 2VWMA 4I86A 5GIBA 1JWTA 3RXPA 2O8UA 1HLTH 1NRSH 4U01A 2ZHQH 2O9QA 2KX4A 4A6LA 1GHZA 1NPMA 2PKAB 3JZ1B 1F5LA 2BVRH 1ANDA 3W95A 1O2LA 3I77A 1S6LA 2QA9E 4BANB 1SQOA 1W13U 4Y76A 5GPIB 4B1TA 1AFEH 4ISIH 2BX3A 2WHXA 4J1YA 1BHXF 3CENA 1LDTT 1WYKA 1CGIE 1GHAG 2ZTXA 4YLQH 1TB6H 2YMSD 4IN1A 3FVFB 1RTKA 5ABWA 4IW4E 1G2MA 2R9PA 4DIHH 5DG6A 1ZHRA 1FPCH 4WH8A 2BD2A 2GDEH 6GCHF 1VGCB 1T7CA 1MTUA 2ZG0H 3K9XB 1P2QA 4X2XA 2LELA 1CBWB 3SORA 4NGAH 2A7CA 2CGAA 1AD8H 1YPJH 2YOLA 1O2RA 2DUCA 1EJAA 1WCZA 3HGPA 4CR9A 4R8TB 4X1PU 1TX6A 2Y6TA 2LPRA 3RXJA 5HIYA 1DDJA 1BQYA 3Q3YA 3QZQA 1NS3A 3A8CA 3GISB 2V0BA 4Y8ZA 4X8UH 5TCAA 2V3HH 3QUMP 4O3TA 5FPSA 1BBRK 1O2PA 3MMGA 5FAHA 1KLJH 3SU6A 1GJDB 1DLEA 3B9FH 1P2KA 4ZHMU 1ZSLA 4XBDA 1S81A 5E8EH 1Z6JH 2EEKA 1MZDA 2ZHDA 3RU4D 2P3UB 4Q63A 4B2AA 3HKIB 1S6FA 5AFZH 5L2YH 4YESB 4K8BA 1B0FA 4IN2A 1EP5A 2XCNA 4FUCA 1TFXA 4KELA 3MU5A 2STAE 4Y8XA 1RIWC 1FV9A 4UDWH 3RXIA 3NPSA 1NFXA 2EI8A 2NU1E 1HNEE 1T8MA 2P93A 2ZQ1A 1FMGA 3M61U 1ARCA 4BTUB 3A8DA 4FUJA 2WYJA 1GG6C 5F6MA 2YMSC 2XCFA 3RLYH 4ABJA 1O2NA 3ZV9A 3N99A 1C5VA 1O39A 1CT2E 5B6LA 3KQDA 5CE1A 2NWNA 1VITH 1LHCH 3SHCH 4Q4LA 1DY8A 1UW7A 4DOQA 4MLFB 5LH8A 2BDGA 1BTXA 1W2KH 3NWUA 5HMAA 2XXLA 1ZJKA 5DP9A 2GZ8A 1TMBH 2GJGA 2D8WA 2BB4A 2O8MA 1QB9A 1UCYE 2JJ2D 2QXHA 2GDDA 3GY5A 2B7DH 1O5FH 2QXGA 3BTEE 1H9LB 1AFQB 2Y5HA 5EGMA 2BQ6B 3FZZA 2W6ID 1J14A 2BD4A 1YBWA 3SYJA 4DT4A 4KP0A 1OWKA 3GYLB 2FI5E 1C1MA 3N7DA 2C3SA 2WPLS 2OXSA 1RFNA 1F0TA 2EA3A 1P3EA 2OQ5A 2ANYA 2JH0D 5C20A 4WF8A 4RT1A 1UTNA 2V35A 4WMEA 1SHYA 1BTZA 1NZQH 3MOCA 2ZI2H 1YWUA 2A4QA 1MZAA 1RRKA 1WQVH 3EE7A 2J9NA 1W0KD 4Y71A 2ODPA 2AMPA 2VB0A 3MO3A 2HNTE 3MU4A 1CE5A 3GCTF 2OINA 1W8BH 3QTVH 1VJ9U 1TA2A 4RKJB 2G00A 1O2HA 5EXMA 8GCHF 3VB6A 1Z6EA 1P12E 1B5GH 1LPZB 2OP9A 2BOHB 1WU1A 4AFQA 3W1EA 2Z7FE 2PTCE 3F2FA 1TLDA 2OK5A 3CS7A 3F3BA 2BMGB 2FI3E 1ELGA 4IC5A 3PMBB 2P59A 1GMHF 1EQ9A 3OU0A 1D3DB 2CMYA 2F83A 1ZSJA 2W7SA 2VIWA 5A8ZA 1E1RD 1SGEE 4FUEA 4INLA 2FOAA 3T62A 2WPIS 2BY5X 1E37B 6CHAC 2ZU4A 3I29A 5EJ1A 2VGCC 1GBJA 3NK8A 4WWYA 1LPKB 1C5YB 2XC4A 1ORFA 4HTCH 1BZXE 3A7TA 3SU3A 4IC6A 1IQKA 1EJMA 3PV5A 1BMNH 2Q6GA 2C8ZB 4K1TA 3RXMA 2GZ9A 2FOEA 5AVDA 1K1NA 4WMFA 3RXBA 1UVOA 3IG6B 1HRTH 1SC8U 1P03A 1NTPA 5AHGH 1NM6A 1BT7A 1MQ6A 3MNBA 1P11E 1ELCA 1UHBA 4AZ2B 3QO6A 4F55A 1EP6A 1CHOG 1O3GA 1OP8A 2LIZA 3T29A 3BV9B 2P8OC 1SR5C 2PKSB 2VVUA 1D9IA 4CRDA 1JIRA 3F9HA 1DXPA 2F9BH 4A1XA 3ZVGA 1C5TA 1PPBH 3E8LA 1FQ3A 1C5ZB 2Z3DA 2ZHEH 2EI6A 1FZZA 1T4VH 1BRAA 2ZZUH 1MCTA 1AVGH 1V2VT 1F2SE 3TNSA 2BYAX 4X8SH 6ESTA 4DIIH 4X6PA 1F0RA 3FO8D 5FCKA 4NFFA 1TQ0B 2KM0A 1DE7H 2IN2A 2K1QA 1UTPA 3EQ0H 4Y7AA 4E7RG 2AYWA 1FN6A 1HFDA 2BHGA 3M7TA 5EG4A 3SNDA 2BZAA 4X8TH 2ZHWH 5A0BA 1W7XH 2FMJA 4O3UA 3GY2A 1XKBC 3H7OA 3BEUA 1Y3WA 1PJPA 1GDQA 1MMJN 2GZ7A 1WDIA 2GGVB 1O3MA 1C4Y2 4ABDA 3S9CA 4I8HA 2H5DA 2QGRA 3SJ9A 2GT8A 5K7RA 1BDAA 3FOAA 4NIVA 2QF3A
chains in the Genus database with same CATH topology
3SJIA 1QL8A 2ZO3H 4BXWA 2Z9LA 1PQ7A 1JMOH 1THSH 1LHDH 1GBKA 2CHAB 1VITG 2J4IA 4CRAA 3M5NA 4CRFA 1BRBE 2FESH 1NC6A 3BG4B 5A2MH 2GT7A 4Y79A 2V6NA 3UNSA 1EOLA 3MNXA 2K7XA 1V2KT 1XUIA 2BDYA 5AFYH 5DK1A 3UOUA 4YM9A 3GY3A 4UEHH 3Q76A 1TPOA 1Z8JB 1GVLA 1NU9A 4AYVB 1O32A 1F0SA 1W0YH 3LU9B 4X1RU 4D9RA 1YM0A 3FZDA 5A0CA 1HJ9A 1OX1A 1ZSKA 2VWNA 1HAYB 2QF0A 1O3JA 1TGCA 4IMZA 4TWYA 4WVPE 7ESTE 2VH0A 3M3VA 1NROH 1P2MA 3ZZ4A 1K1LA 1QRZA 3O8RA 2C8WB 3BF6H 1JXPA 2QAAA 2AGIX 4CRGA 1K1OA 4A92A 2PSYA 3A7YA 4X6OA 2WV4A 1VGCC 1DT2A 2ZQ2A 2B5TB 2UWOA 1CBWC 4ABHA 1C5UA 1P10A 3BTWE 2G81E 3NKKA 3U1JB 3KEEA 1TPAE 1G32B 3SN8A 1ZMLA 1FIZA 3RXHA 1C1VH 1GJ6A 3L33A 1ZZZA 1O34A 3M5MA 1ZYOA 2A4OA 2WPHS 1AUTC 3SGBE 2J92A 2F91A 3S9BA 2P94A 2FX6A 3SJKA 1C5WB 1F92A 3E16B 1J8AA 3UY9A 3V0XA 2XBVA 3T25A 4YOGA 3EBNA 4U2WA 1TOMH 2W3IA 1HIAB 1IQMA 2STBE 3SU0A 5DP4A 2CF8H 2FS8A 3FFGA 4E7NA 1TNJA 2VWLA 3NXPA 1MU8B 2NU2E 4JZFH 4QT8C 3BTME 1TQ7B 1YF4A 3AVZA 4X0WU 5E0HA 2ZPRA 1IHTH 4Q7ZA 3PWBA 1GMCG 2VU8E 1QL9A 4ISHH 4MPUA 4WH6A 5A09A 3P8OA 3SJOA 1UK2A 1ID5H 1TNIA 1LVBA 2GCTB 4GHQA 1BTYA 1O3IA 3RC5A 1DICA 3L3TA 2TBSA 2FO9A 1O2MA 2F9VA 1YPHE 2KAIA 2PUQH 4TYDA 3GY8A 3RXGA 1RTFB 1S5SA 4MTBA 4I8KA 4ZMAH 3O8BA 1SI5H 5EOKA 1O3AA 3BIUH 5L2ZH 3OSYA 2D2DA 3E91A 2WINI 1Q2WA 1FDPA 1SGYE 4ZROA 2G8TA 2NU0E 1S0RA 4UFEH 2OC1A 4BAHB 2PSXA 4LXBH 1AFQC 1GBEA 4UFGH 4HFPB 3PLBA 2RG3A 1ZOMA 2JKHA 1LPGB 2Z9KA 2FIRH 1O2VA 1YPGH 1C5SA 1DM4B 4NWLA 1AKSB 4TY7A 5DJ7A 1C2IA 1O38A 5C1XA 4A5TS 1FY8E 1G37A 3GCHB 3QWCH 3DT0H 2Z3CA 1SHHB 3PO1B 1UCYK 4XFQA 1ZTLA 3GOVB 5F8XA 1KLTA 4FU7A 1GBAA 4XE4A 6GCHG 3LGVA 5FX6A 1J16A 1W11U 1OWHA 2TGAA 5SGAE 1A7SA 1SMFE 3SBKA 5EPNA 2BQ7B 5HYOA 5JBTA 3KGPA 1SOTA 3ZVEA 1O5DH 5FXLA 3TJOA 2OLGA 2QC2A 1G2LA 1UTOA 2GMTB 5DP8A 4AB8A 1C1WH 1QRXA 1BA8B 1XMNB 3UTUH 1SGRE 1UTKA 3MH5A 4AB9A 3QK1A 1SLWB 2ZECA 4MNWA 2ODQA 3TK5A 1KXDA 4HZHA 1HB0B 2FX4A 1QJ1B 1V2TT 1NFWA 1OP0A 2P95A 1C1SA 5L6NH 4FUHA 4NZQA 3TH2H 1AE5A 1QNJA 3SNBA 5DP5A 9LPRA 3S69A 5LPEA 3VPKA 1FJSA 1SG8B 4MNXA 3BTHE 1EB2A 1C1QA 1MTNC 4AFZA 1ABIH 1AGJA 1BIOA 1SPJA 4MPXA 4GCHF 1OOKB 1EATA 1LCYA 1P01A 1GBBA 1SFIA 1Z8RA 1IQLA 2TGTA 5A0AE 1E36B 2H2ZA 5DGJA 4AFSA 1ELEE 1MQ5A 2H1UA 1O2OA 1C4U2 3MU8A 1ABJH 1XXFA 2GCHF 2PKSC 2ZDKA 3A82A 2PR3A 4MDSA 1CT0E 3S7KB 3RMNH 7GCHF 4NA9H 1P2IA 1ETSH 3M35A 1C1PA 2WPMS 1WAYB 3RC6A 4ZKOU 2ZFPH 3FAOA 2W5EA 3K6ZA 3SV7A 1F7ZA 1GWAA 3ELAH 4A1TA 3A80A 4LK4A 2Y82A 1F5RA 3UWJH 8ESTE 4FUBA 1RJXB 1GMDF 1ZLRA 5C2ZA 1C1NA 1NESE 2R2MB 1Z8GA 1C1OA 1SBWA 3MWIU 3VGCB 1QBVH 1FN8A 2FOHA 1SGTA 1EPTB 2C4FH 2OD3B 3MH4A 1YCPK 5GWZA 3MU0A 1FLEE 3C1KA 2WPKS 2XYAA 1ZGIA 3FP8E 2BX4A 1NY22 4NIYA 1C9TA 2H6MA 1H8IH 3FP7E 1V2PT 1DWCH 2HGTH 1OPHB 1K22H 3UQVA 1TBQH 4JZDH 1Y5UT 4B2BA 1OWDA 4NFEA 4Y11E 4DGJA 1XVMA 5JB9S 2KAIB 5J4SA 4JYTA 2D1JA 4NSVA 1OWEA 3ZZ8A 2O8WA 1UO6A 3ENSB 2CHAC 1HYLA 3OYPA 3LIWA 3TK9A 2BM2A 1U6QA 3BG4C 2W7UA 1C2FA 1FPHH 4HGCA 3ZVBA 3MTYA 3U98H 3A83A 4AGKA 4MPVA 2ZF0H 1ELBA 1FY1A 1XUJA 3RXEA 2W26A 4CH8B 1JOUB 4IMQA 4Z6AH 4INKA 1WSSH 1O2UA 3SV8A 2GD4B 3BEFB 1ELDE 2H9TH 3ODDA 2ZU2A 4F49A 1AVWA 2JETC 4O03A 3ZVDA 3A7ZA 3GYMA 1A0JA 2Z9IA 4I31A 1P8VC 2XNIA 1SOZA 1H8DH 3LC3A 3RXVA 4ABIA 1P2JA 1O2KA 3TGKE 3VXEH 1P2NA 1W12U 2C90B 3K65B 2RA0A 3E3TA 3U1IB 1INCA 2Y5GA 1J15A 5EQQA 1GHVH 1FXYA 1SGFA 3BG8A 5GDSH 2BY7X 4E05H 1Z71A 2YNBA 1SGIB 1CQQA 5GCHG 4TWWA 1YPMH 1GPZA 1PYTC 1Z1IA 1Y5AT 1TWXB 4VGCB 2FXRA 2Y7ZA 3ZZCA 3UNRA 3B23B 3RXKA 1ESBA 4FUGA 1LQDB 4BAQB 3VB3A 1PQ5A 4M7GA 1MD7A 1IQEA 1IQHA 1IQIA 1TOCB 1LVYA 3SGAE 2SGFE 2AERH 1O5EH 1C5PA 5DP7A 2ZTZA 2ZU3A 1ZMNA 4FUIA 2CXVA 1EKBB 1O30A 3UNQA 1TMTH 3HK6B 1BRCE 3ATIA 1QJ7B 1TA6A 2FTMA 2VIDA 2XC5A 1TAWA 4JCNA 1QA0A 3EA8A 4U30A 1RGQA 1GJBB 2BOKA 4I33A 5E2PA 3TJNA 1KIGH 4K5ZA 3A84A 3TIUA 1DOJA 2XC0A 2ZFSA 4FVBA 3RU4E 1Y3XA 1GHAF 1K1IA 5FX5A 2OTVA 2SGAA 2J94A 3TH4H 5C5NA 4LZ1H 1D6RA 1KXCA 1IQJA 1C5QA 4X1QU 1ZHMA 4ABGA 3LGWA 2YNAA 1M9UA 3UUZA 1EXFA 5JBBS 1XUFA 3BTFE 2EI7A 3SV6A 1Y3UA 3NCLA 3FANA 3ZVCA 5JDUB 3LT3A 2GCTC 1MUEB 1ANEA 5FPYA 1GBFA 1V2ST 3UOPA 2A5AA 3ZZ3A 2ZGHA 8KME2 4X2VA 4DJZB 3RXTA 2ZFTA 1ESAA 5E0GA 1G3EA 2GV6A 2QY0B 3RXAA 1QIXB 1TE0A 1EZXC 1YC0A 5C1UA 3V12A 1BMMH 1XM1A 3AAVA 3KF2A 3OX7U 1V2LT 1XUHA 3SU4A 2P16A 4DW2U 1EB1H 4R0IA 3MYWA 5K0HA 4NZLA 1UTQA 3RXUA 2BY8X 1HAVA 1DANH 4B71A 4YTAA 1S82A 1MTNB 1S0QA 1TNHA 1GBMA 1ETRH 1Q31A 3JZ2B 5GJ4B 2FEQH 4X6NA 3EE0B 3H5CB 3KQCA 4AORA 3GCHC 2G52A 3PO1C 3AASA 2VIOA 4OS4A 3GDSA 3VFEA 4O9VA 2OQUA 4D76A 1V2WT 1TX8A 2ZPQA 4GUXA 1KXBA 3RU4T 1C5RA 1DSTA 1J17T 1GI9B 1GBLA 1WOFA 2GMTC 4FU9A 5FPTA 3A88A 2ZC9H 2A31A 3P70B 5DKMA 2ZFRH 2VIVA 2XTTB 2AEIH 3LGTA 5TJXA 4NIXA 5HXFA 2QN5T 2AIPA 1GL1A 3SZNA 1GJAB 4YZUA 5DP6A 1FY5A 1HPGA 1LMWB 2BVXH 5EU8A 5F03A 2G4TA 3TNTA 1AN1E 3QLPH 4NWKA 3LJJA 3RXCA 4I7YH 3K6YA 1GI1A 1NN6A 1SVPA 3UR6A 2HRVA 2VVCA 1LTOA 3GDUA 2TIOA 3ODFA 4AYYB 3SI4H 2BY6X 3RC4A 5ETXA 2AFQB 1GHBG 1THRH 2QXJA 2QCYA 5DO4H 1QR3E 2AH4X 2SGEE 3UFAA 1L1GA 2GX4A 1HAHH 4KTUA 4AOQA 3SW2B 1NRNH 2FPZA 1RXPA 4KTCA 1BJVA 2QV1A 1Q3XA 1TGBA 1ZTKA 4THNH 4UFFH 2ZU5A 1DUEA 3P8NA 3IWMA 3EAJA 1TPPA 4GVUA 1TRNA 4SGBE 3U9AH 3UR9A 4K60A 2VINA 1C5OH 1C2DA 4IBLH 5EXLA 3EGKH 4KTSA 3SGQE 2QIQA 1VJAU 1AZ8A 3BTDE 9ESTA 2C93B 1YYY1 2JETB 1P57B 1SFQB 1ANBA 1QCPA 1TRYA 1MU6B 1IQFA 2F9PA 3P92A 3VGCC 4U32A 5HM9A 5TCCA 1EPTC 3I78A 3ZVFA 1E34B 4KGAA 4H6TA 1ETTH 1HV7A 4K8YA 5EODA 5C1YA 3ZZDA 2TRMA 4XDEA 2SGDE 3PTBA 1BRUP 1C5LH 4DY7B 1S85A 2VIPA 4WY3A 1Y5BT 1D3PB 3M37A 1SLXB 1YPEH 1GI5A 1MH0A 3SQEE 1L1NA 1O2GH 1S6HA 2ESTE 4E06H 2A5KA 1C5NH 1O3CA 1Z7KA 1C1UH 1F5KU 1HAIH 4Z0KA 1QRWA 2AMDA 2BD3A 1QHRB 2PV9B 3SV9A 2R0KA 1CHOF 3ZYDA 1TNKA 1O35A 2A7HA 2HWLB 1KYNA 2UUKB 1XX9A 2FYQA 1H9HE 1Y8TA 5FBIA 3A89A 2BQWB 1MTVA 1O3EA 1E35B 2O8LA 3KQEA 1VCWA 3SI3H 1P9SA 1BTHH 1EOJA 1H9IE 3LONA 1K2I1 1AWFH 2GP9B 3PLPA 2FLRH 2PKAA 2HVXA 1ARBA 2BD5A 1GHWH 3GY4A 4ZUHA 3KL6A 2ZDLA 1NU7B 1ZR0A 1CA0B 1GJ9B 1DY9A 3SNAA 3D49H 2A5IA 2OCVB 3ATMA 3TK6A 3A87A 1A3BH 1UHBB 2RA3A 3KHVA 1LHFH 2A0QB 3TGJE 3GY7A 2NU4E 3NZIA 4K2YA 4MPWA 4BAKB 1GBCA 1KSNA 4ISLA 4DG4A 7LPRA 1C1TA 3M5LA 4AGJA 4MQAA 3EA9A 1DWDH 4OGXA 1CA8B 3SOSA 1EASA 2A7JA 4GSOA 1S83A 1QURH 3QN7A 1BCUH 4VGCC 2OUAA 3TVJB 3Q3KA 1TPSA 1T32A 1VR1H 1W0ZU 1L4ZA 4JYVH 1KTSB 4FUFA 4YO9A 1GI7B 2XBWA 4OS6A 1BTPA 1KDQA 5HGGA 4GHTA 1C5MD 1ELTA 3A8BA 3A85A 1P06A 7GCHG 1O5CB 1HAPH 1P2OA 3GICB 1V3XA 1L4DA 2ZFFH 2FOFA 1MCVA 4Q80A 2OBOA 2JH5D 4JZEH 2ALPA 1BMLA 1AMHA 4BXSA 1DWBH 1TBRH 3IITA 1QB6A 4ZAEA 2I6SA 3E1XB 1T8NA 5EQSA 1QB1A 3M3SA 3HPTB 3DD2H 1GJ4H 2BLQA 4X2WA 2BVSH 3RXOA 1AWHB 3EA7A 2R3UA 4X1SU 1BBRH 3N7OA 2C8XB 1V2JT 2A4RA 5FBEA 4B75A 3SUGA 1YPKH 1AHTH 1HGTH 2F9UA 3AAUA 1HBTH 2UUFB 1S84A 2XBXA 3DA9B 4DT7B 1AY6H 3BSQA 3PMAB 3F9GA 1OWIA 2PLXA 4MNVA 3P17H 1D4PB 1BJUA 3ATWA 5B6OA 2W3KA 1YCPM 2OBQA 1A0LA 3ATKA 1TNGA 2BDIA 1TBZH 1GBIA 5FCRA 4A7IB 2J95A 2A2QH 3A7WA 5ESBA 3U69H 2AGGX 3DFLA 1GJCB 2R0LA 8LPRA 4YOJA 3LGIA 1O2WA 2TGDA 3STJA 3TJVA 2NU3E 1OSSA 1C2LA 1P0SH 4B73A 1ZJDA 3A86A 2AIQA 3RXQA 4ZKRU 2HLCA 1LQEA 2PFEA 1LVMA 1MTWA 3MFJA 2H5CA 1HJAB 1GI8B 1DS2E 2GV7A 4Y6DA 3TPIZ 1O2IA 4K1EA 1OP2A 4OS2A 2TGPZ 2RDLA 1EAWA 1FNIA 4WXVA 5H4IB 1AQ7A 5F8TA 4JMYA 4SGAE 2BZ6H 2Z94A 2WV5A 1SB1H 1UVUH 3O8CA 1K28D 3SUDA 1GMCF 3GY6A 1GI3A 1NFYA 2BDHA 1SGPE 4RKOB 4TPYA 5DPAA 3S9AA 2VWOA 1O2ZA 1HAOH 1WV7H 1ZHPA 2ZEBA 3ATLA 1O5GH 2XWBI 1O3OA 3DUXH 1O5AB 2FS9A 5CHAB 4AFUA 3F9FA 5IYTA 1XUKA 4AG1A 3SU2A 1SQAA 3PMHB 2VNTA 4INHA 1HDTH 1O37A 1EX3A 5T6DA 3B8JA 3KCGH 1TRMA 4DCDA 1VCQA 2VJ1A 1ZTJA 4H4FA 2BXUH 3LC5A 3RM2H 4ASHA 3RXRA 3V13A 1O5BB 4FU8A 3LH3A 1AUJA 1PQ8A 3G01A 5EW1H 1KXFA 1PYTD 1P3CA 2G5VA 3MI4A 3VB4A 3ZZ5A 1FY3A 1V6DA 3WY8A 1SL3A 4UFDH 2B0FA 2XRCA 4YT7H 1DWEH 3MO9A 1G9IE 3H7TA 4YLUA 3ZV8A 1ZPCA 1EZUC 1OS8A 1K9OE 4DURA 3VB7A 2BDCA 3ZZ9A 4D8NA 1TYNA 2AGEX 1MBQA