3TNTA

Crystal structure of sars coronavirus main protease complexed with an alpha, beta-unsaturated ethyl ester inhibitor sg85
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
306
structure length
306
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SARS coronavirus main protease
publication title Crystal structures of SARS-Cov main protease complexed with a series of peptidic unsaturated esters
rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 86
structure length 306
sequence length 306
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3tntA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tntA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tntA02
3JZ2B 1YPLH 1WQSA 3M5NA 3C1KA 4LOYH 1GG6B 1QTFA 2R0LA 1LHCH 1YPEH 5A8XA 2ZFRH 2VVVA 1SGFA 1UK4A 1KIGH 1SG8B 1ZSLA 2W7SA 1FN6A 1THRH 1O31A 2AYWA 1CQQA 2AIPA 1TMTH 2FOHA 1VJAU 1C1UH 3BEFB 2JETB 1Z1IA 1WYKA 2Z9KA 1GHYH 1LHDH 1XUJA 1BRCE 2F9PA 4ZHAA 2R3UA 3ENSB 3SBKA 1JRSA 2QC2A 3VB4A 2P94A 4FVDA 2ZI2H 5JYIA 5ETXA 2ZFFH 2PTCE 3EA7A 1ZRBA 1MBMA 1T31A 3P8FA 1C5UA 1K9OE 5DPAA 1DY8A 2RA3A 3FZZA 2C8ZB 1SFQB 3ZZ6A 1V2KT 2ZHEH 4WF8A 1C5RA 1EXFA 1MTVA 1QNJA 1O3PB 2Y7ZA 1SBWA 2G00A 1D3TB 2SGFE 1C1NA 3L6PA 4NSYA 1F5RA 3ZZCA 1JIRA 3FP8E 2JH6D 2BQ6B 2PGQB 3LH3A 3AVZA 3A7TA 1IHSH 4VGCC 2K7XA 3BEUA 2AEIH 1GBMA 2ODYB 1O3EA 3U8OH 2WPIS 1O2UA 4I8KA 3PTNA 2XC0A 2ZGHA 1W8BH 1WTHD 5GXPA 2BM2A 2CMYA 5DKMA 1DY9A 2ZU2A 1FONA 1PPFE 4A92A 1XXFA 1ZMJA 4AOQA 2P8OB 1BDAA 1EB1H 2Y5HA 1QRZA 2BD9A 2SFAA 4JZDH 3VXFH 2P3TB 4NIWA 4TWWA 2ZKSA 1PYTC 2QXHA 2QV1A 3BTEE 1P2KA 3KQEA 5EW1H 1UHBA 2FOMB 1GG6C 3MWIU 2FTLE 4FXGH 5I25A 7KMEH 1GBHA 1ESBA 1ZTKA 1C5WB 1Z6EA 2BX4A 1XUGA 1A0HB 1MKWK 1AFEH 3BTWE 4WMDA 1A3EH 2UUFB 6CHAB 1JMOH 5L2YH 1SLVB 4XBCA 1FIZA 2BY9X 2AERH 1L4DA 3QGJA 2JH5D 1ACBE 5A2MH 2TRMA 1FNIA 2ZPSA 3ODFA 4INLA 3LGUA 4IN1A 2ESTE 1UVUH 2GMTC 2FS8A 3ZYDA 1LMWB 1SGRE 2UWOA 1OWHA 5HGGA 4K60A 1A7SA 4HGCA 1OS8A 3LU9B 4AFQA 1TGSZ 1RS0A 2D2DA 2ASUB 2J92A 1HAPH 3TGIE 1P05A 1L4ZA 1D3QB 1GVZA 1T8MA 3SV6A 1ZSJA 1K1LA 5K0HA 1SLWB 2FLBH 1BTPA 2QXGA 1NU7B 1ZJDA 3U1IB 4K8YA 5EG4A 2WUCA 1KXAA 2SGEE 3F6UH 3STJA 1HIAB 1UTPA 1OWDA 1XX9A 4GCHF 4NIXA 4LXBH 1IQKA 1TX8A 3GCTF 1W3CA 4XFQA 2OUAA 2FI3E 2ZCKP 4Y8ZA 1GDQA 4BTTB 2ZWLH 3LJJA 5T6FA 1E37B 4XBBA 2O8LA 3HATH 3MU5A 2HRVA 3TK5A 1ABJH 1KXDA 3NK8A 2F83A 1OSSA 1QL9A 3BTDE 1O2HA 1VR1H 1TBQH 4GCHG 2P8OC 1GJBB 1ABIH 3RXMA 1EQ9A 3GCTG 3SI3H 1B0FA 4TWYA 1DITH 2FOCA 1WV7H 2BOKA 3RXRA 1YP9A 2O9QA 1WU1A 2G5VA 2LPRA 1GMHF 4FUDA 1C2MA 3P8OA 1NROH 2VWLA 2ZGXH 4FUGA 2ZHDA 3RXGA 1EX3A 1U6QA 1P3CA 2ZGJA 4ZUHA 3GY5A 4IC5A 1QQUA 1V2QT 1TALA 2G5NA 2IN2A 5E0HA 3D49H 6CHAC 2XBVA 1MUEB 2SGAA 4DURA 2IOTA 3QGNB 3CENA 3T28A 3TNSA 4FUFA 4Z6AH 1Z8JB 2STBE 5ABWA 2HOBA 1IQEA 3A89A 3ZVEA 3MH6A 2QXJA 2ZGBH 1W7GH 1GHXH 3SV9A 3ZZ8A 5HM9A 1Z8RA 1O30A 3V12A 2ZGCA 1V2JT 3SNAA 4OS7A 1YM0A 3URCA 1CA0B 4JK6A 3TH3H 5TJXA 2XYAA 1MMJN 1PJPA 3A8BA 1TYNA 2J9NA 1P9UA 1X7AC 1PPZA 3A84A 1A5IA 1BMLA 8LPRA 2FOEA 4YM9A 2DE9A 5EPNA 4B1TA 1HAVA 1BCUH 3F68H 2Z9LA 5F8XA 3OTJE 1QL7A 1O2PA 1O3JA 2CHAC 1P2NA 1LKBA 3OSYA 3ZZAA 4R0IA 3PMBB 3TNTA 1AUJA 2ZFSA 1HNEE 3D62A 2NWNA 4ABBA 1ZOMA 3MNXA 1GI5A 1YC0A 4ABAA 2F91A 1MTSA 1DPOA 1V2MT 1S5SA 1UTJA 3IG6B 3UNQA 1V2ST 1O38A 3NCLA 4UE7H 3CS7A 1O33A 1KLIH 2QYIA 1RRKA 1T8OA 3RXPA 1W12U 1GBLA 1KLTA 1KXFA 2Z7FE 3BG8A 4NA9H 4AZ2B 1ZR0A 5J4QA 2O8TA 4FU7A 1JIMA 1TGNA 2HNTF 1B7XB 3B23B 2BOHB 3P8GA 3GYMA 1QY6A 1O35A 3NUMA 3CS0A 1YLCA 2A4QA 2H9EH 2PTNA 3ZVFA 4J2YB 4X1QU 4Y71A 4AFUA 4WY3A 2ZZUH 1HAVB 3PLKA 1EKBB 3A85A 1CBWB 3BTGE 4AG1A 3OU0A 1QURH 1GBDA 4D7FA 3E0PB 3N7OA 1V2PT 3A8DA 5FPSA 3RXAA 1GI3A 1J14A 2Y81A 4X2XA 2XNIA 3FVFB 2ODQA 1O5GH 3UPEA 1S83A 1CA0C 3TH4H 5L6NH 1F2SE 1QBNA 1Y3VA 2V3HH 2AGIX 1C4U2 3RXKA 2GT7A 4AGJA 1FLEE 2FDAA 4IN2A 2ZU4A 4XE4A 5A0AE 4JYTA 1BMNH 3A7VA 1J9CH 3P92A 3PMAB 1PYTD 2Y7XA 3RXOA 4NWKA 3NWUA 1TABE 2ZHQH 4O97A 5FCKA 3AW0A 1N1LA 2VINA 1E36B 1GHAF 1KSNA 2A4RA 1CT4E 2HGTH 3MTYA 1ZGIA 2FXRA 3NXPA 3I78A 1GBIA 2ODPA 4DJZB 1V2RT 8GCHF 1Y5UT 5GPIB 5DG6A 2R9PA 3ATIA 4O03A 1Q2WA 3KIDU 2ZP0H 3MNBA 4ISHH 3RXVA 2Z9IA 4WH6A 8ESTE 1GHAG 2VIOA 1UVTH 2V6NA 2BDYA 1S81A 1LHFH 2WPMS 3LJOA 9ESTA 3ZZ7A 3KQBA 1H8DH 1DFPA 1GI0A 4Y76A 1DWEH 2PHBA 4X6NA 1C2JA 2BZ6H 2FEQH 2FLRH 1Z8GA 1PPHE 1OWIA 1QHRB 3RXQA 4HFPB 2WPHS 1IQGA 3RXUA 5H4IB 1KDQA 3MU8A 4K1SA 1EP6A 2NU2E 1O2XA 2W7UA 5EXLA 1TQ7B 2BY7X 3BTTE 1QBVH 4TPYA 1HJ8A 1YCPM 1GJ5H 3F9EA 2XWBI 4MG3A 3LC3A 1CBWC 1DXWA 1RIWB 1QRXA 3QZRA 1C4Y2 1XM1A 5GCHF 1AGJA 3P17H 4CH8B 3K9XB 4KTCA 3SNEA 2BB4A 1SQTA 3ZVBA 2G4UA 3LIWA 5JB8S 1UK3A 4JYVH 1GHWH 3DUXH 3KQCA 1FY4A 2FI5E 1GMDF 3RLWH 1NESE 1GJ8B 3ATMA 3Q00A 5LPFA 4M7GA 1SQOA 3SQEE 3E8LA 2B7DH 1YBWA 4Q7XA 1EATA 1Q3XA 5GCHG 5E2OA 4YLQH 1AZ8A 2BLOA 4O3UA 1TA2A 3DA9B 1Y3WA 1BOQA 3QX5H 4DY7B 1EJNA 1HBTH 1K1PA 1QA0A 1GMDG 1O3DA 5DK1A 2Z3DA 1P03A 1TB6H 3UR6A 2P95A 1LPZB 1KDQB 4YZUA 2YOLA 4UFDH 1WOFA 2ANKH 1SGNE 4E06H 4GSOA 1EUFA 1C1TA 1G3BA 2A7CA 3A81A 3V13A 1TQ0B 2AFQB 4TYDA 2C93B 5HMAA 4FU8A 2WUBA 3TJUA 4YESB 3FZDA 1EZUC 3M3VA 3ZZ5A 5IDKA 2GZ7A 2GTBA 1H8IH 1P0SH 1O2LA 2NU4E 1ARCA 4JCNA 4BAOB 1VGCC 1ZTLA 4MLFB 1K1OA 1BT7A 2VIWA 1FY1A 1O3BA 4HI3A 2TBSA 1NY22 1A3BH 2H9HA 2ZO3H 3RMNH 3A82A 1C2IA 3M5LA 4ISNA 4K1TA 2C90B 2R2WU 1O2TA 1OOKB 1BHXB 1IQNA 1JWTA 4JK5A 5EPYA 1LVOA 3KL6A 3P8NA 2ZTZA 4D9RA 1HXEH 1YCPH 1VITH 1O2QA 1EASA 3OYPA 3QLPH 1LDTT 1C5VA 3DFLA 3Q3XA 2WINI 3ITIA 2RCEA 3M3SA 2SNWA 3LOXA 3SORA 4SGAE 1CA8B 1HGTH 1C5YB 4IC6A 3GY3A 1RIWC 1GBTA 3QTOH 1AVXA 2BQ7B 1TGTA 3SHAH 1XKBC 2XCFA 2OTVA 2TGDA 5T3HA 1MKXH 1BMMH 2F9BH 1JXPA 2VGCC 4JZ1A 4NA8A 4FVBA 4F4OC 4PROA 3UNRA 1JRTA 4R8TB 5DP8A 1TOCB 3TJOA 2HPQH 3DD2H 3W94A 1O2IA 2P93A 2RG3A 1QB6A 1NRSH 3SV7A 3M37A 2P3UB 1B5GH 2QCYA 1SPJA 1F5KU 3E16B 2BD4A 1GJDB 1C5LH 1F0TA 1AVGH 4E7NA 1UTQA 3PWBA 1TBRH 2PR3A 2SGDE 3LT3A 1P57B 1AO5A 3M3TA 1EZXC 1ESAA 1ZYOA 5JDUB 2FOBA 3HK6B 3OY6U 3UNSA 2Q6FA 2VIQA 5DO4H 2GZ9A 1SGEE 1KXBA 1F0SA 2GKVE 1LVMA 2PKAA 3G01A 3PWCA 2W3KA 4FUEA 3ZVDA 1QCPA 3GY4A 3RLYH 3AAUA 4K8BA 1BTXA 1HLTH 1H9IE 3O8RA 1KY9A 2VNTA 2PSYA 3H7TA 1GBBA 2GMTB 1BQYA 4BAHB 1BIOA 1C5PA 1SQAA 1WSSH 2UUYA 4CRGA 4D7GA 4OGXA 2UWLA 1JOUB 1G36A 3PB1E 4K1EA 1XMNB 1DWDH 1KLJH 2QF0A 1L2EA 3F9FA 2VIVA 1ESTA 4K5ZA 2P16A 3SU2A 2Y6TA 4CRCA 2QGRA 3LGIA 2VH0A 4OS5A 3RMLH 1GHBF 4H6TA 1FXYA 1TFXA 2H2ZA 4YLUA 2XBYA 5E8EH 3SU6A 1G2LA 1IQFA 3SNDA 5DP4A 1C1MA 2F9UA 2VB0A 4OS1A 4Q2KA 3STIA 3ELAH 5K7RA 3EE0B 1P2JA 3GISB 1H1BA 2ZHFH 3MMGA 2A2QH 1TBZH 1DE7H 2Q1JA 1O2SA 3BIVH 4K69A 4ZKSU 1EOLA 2PKAB 1G32B 1ZPBA 3OY5U 1D3DB 5JBAS 1BTWA 1L1GA 3RDZA 1MZAA 1O5DH 3GCOA 3MU4A 2GCHF 2ZECA 3E6PH 2ZFTA 2SGPE 1GI1A 1THPB 5PTPA 2ZA5A 3L3TA 2ZNKH 2YNBA 1FN8A 1UTOA 4FUIA 5LPRA 5F8TA 3UWJH 3PMJA 3PROA 4TPIZ 4ABDA 1PQ8A 1Y3UA 3SJOA 1H4WA 5DP9A 2GCHG 1J16A 1NC6A 1YPGH 1GBAA 1BHXF 6GCHF 1HIAA 4I8JA 3P70B 1ELEE 1SGCA 1F0RA 5AVDA 1GI4A 2OCVB 4X0WU 1IOEA 1OP8A 2A0QB 1C1VH 1ELVA 1NPMA 1K28D 2FMJA 1N6YA 3Q3KA 1LHEH 2G8TA 4AX9H 6GCHG 1DS2E 1FY5A 3RC6A 3TU7H 4B2CA 4X6MA 3U8TH 4NIVA 2ZU1A 4CRDA 1GI7B 2A5KA 4UONA 1OWKA 4JZIA 1O3KA 4THNH 3UFAA 3GOVB 1G30B 1TNKA 2GZ8A 1MZDA 2R3YA 3QO6A 1ARBA 1GMCF 2WYJA 2WV5A 4I8HA 4UFGH 1GI9B 1S0QA 1P2OA 3ZV8A 1T32A 1MTUA 2W3IA 3GY7A 4ZH8A 4J1YA 3TGKE 1ELBA 3O8DA 3K2UA 2Z3EA 2ANMH 1DUEA 1LPGB 1S0RA 3K65B 1P8VC 5FPYA 1W0YH 1SGPE 4GVUA 1GMCG 2CHAB 3SJ8A 2ZG0H 1ZHMA 2BVXH 1O2WA 1OP2A 1C2EA 3U1JB 1OX1A 1UJ1A 1MQ6A 1YPJH 3KQDA 2FTMA 1C2FA 2QN5T 1T7CA 1Q31A 3T29A 1PPEE 4I31A 3TPIZ 4GPGA 1ELCA 3SJ9A 3E1XB 1IQHA 3A88A 4UDWH 1QRWA 1V6DA 1TNHA 4WMEA 3MH4A 3BG4B 4K2YA 2GX4A 3MNSA 4X8UH 1O5CB 1D3PB 4F49A 1K1IA 2CF8H 2D1JA 4ABFA 5E0JA 2ZHWH 1UK2A 5E0GA 1RTLA 3FANA 2AGGX 2AIQA 5L30H 3TITA 1GVKB 3B9FH 1GJ4H 2FO9A 4CREA 4CBNA 4HZHA 3BN9A 2FYQA 4CRAA 1T8NA 2ZDAH 1XUFA 3RC4A 3KN2A 4Y7AA 4U32A 1AI8H 1GBEA 3D65E 4A1TA 1BJUA 1A4WH 3K6YA 2ZQ1A 3LGVA 3MU1A 3IWMA 1W7XH 1P11E 1CHGA 1GCDA 1NRNH 1ELTA 1GMHG 2QIQA 5CMXH 1HPGA 3BTHE 4AFZA 1NFXA 2C8XB 2FX4A 1Z8IB 5EOKA 1O2OA 2A4GA 3KHVA 2Z9GA 1TRYA 1FDPA 1TMUH 5JPMH 2G55A 1S82A 5SGAE 1Y8TA 5C5NA 2A5AA 3QUMP 2EI7A 5GJ4B 3ZV9A 3KNXA 1SGFG 1UTNA 3SUDA 1NZQH 3U8RH 4BTIB 1C5MD 3E0NB 3NKKA 1ZJKA 5F8ZA 1SR5C 5DP5A 1VJ9U 3U69H 2O8MA 3PYHA 1QBOA 3F9GA 2GT8A 4E05H 5FXLA 1GL1A 1VCPA 2BD5A 4KP0A 2O8UA 2GV6A 4XSKU 4YOGA 1MD8A 5AHGH 3UQOA 1EJAA 4FUHA 2HPPH 2OINA 2BTCE 2G52A 2Y80A 3SJKA 1D6RA 3QN7A 3R0FA 4GLYA 3UY9A 4ZKNU 1UCYH 1G37A 1O3MA 2OP9A 7GCHF 4E7RG 2FOAA 1AE8H 1SGTA 1DWBH 1TNJA 2ZPQA 1AFQB 4ISIH 4TY6A 4MPUA 1L1NA 4I8LA 3SU0A 1GBJA 3JZ1B 2XC5A 1DSUA 2V3OH 2AMDA 2UUJB 2BD3A 3BG4C 1EPTA 2VVUA 4OS4A 7GCHG 1BUIA 2OLGA 5EODA 3U98H 1A46H 4ZROA 1C1QA 1HAGE 2C8YB 4Y11E 1P2MA 1CU1A 4CHAB 2NU1E 2OQUA 3ATKA 2BD2A 4NIYA 4ZAEA 2Y5GA 1W14U 2F9VA 4ABIA 2AGEX 2XRCA 3ESTA 4X8VH 1P06A 2QA9E 3Q3YA 2GDDA 1GBKA 3RU4E 3MNCA 1V2OT 3T25A 2BYAX 1O3AA 2ILNA 3SUEA 1O36A 2UWPA 2I6SA 1IQIA 4A6LA 1FUJA 1MAYA 1MQ5A 2XC4A 5EXNA 3UOUA 2A2XH 4DOQA 4KELA 1CGJE 1O3NA 3RXCA 4MDSA 1EAWA 1V2TT 1K1JA 1O3OA 1NFWA 1C5ZB 3DHKH 1NS3A 3M61U 2FYRA 5DP7A 3LH1A 1GBCA 1GDNA 1DSTA 2F9OA 3TK6A 1EAIA 1M9UA 3CP7A 1SOTA 2FZZA 1EPTB 3BEIB 2A45B 1HJ9A 1QIXB 1ZHPA 4DIHH 2WPLS 1N8OC 1GJAB 1NO9H 4ABEA 4MPXA 3PV4A 1MCTA 1W0ZU 1CSOE 4Q80A 2ZEBA 3A87A 1Z1JA 5FBIA 3MO3A 3KF2A 5E2PA 2OBOA 1YCPK 1RGQA 2QXIA 1P2IA 2G51A 2ULLA 8KME2 2G81E 1AFQC 3UUZA 4A1XA 1DANH 1ANCA 1VGCB 1OWEA 1SLXB 1TPAE 2GCTB 1DLKB 4TY7A 3LGWA 2LIZA 1NM6A 4NA7A 4WWYA 1S6HA 4GUXA 4ABHA 1DX5M 4ISLA 4BXSA 8GCHG 1AQ7A 1MKXK 4U01A 1L0ZA 1EZSC 2GP9B 2TPIZ 3RXTA 4BNRA 2VIDA 1C9TA 1AE5A 4Y7BA 3PTBA 4FUCA 1HXFH 1SOZA 1O2GH 3GY8A 5FHTA 4OS6A 4CHAC 5G4BA 3V3MA 3FAOA 3VGCB 1CGHA 1GI6A 2D8WA 2OC8A 2B0FA 2PUXB 1VCWA 1WQVH 2FM2A 3TLOA 1MH0A 1TA6A 1UVSH 1YF4A 2BLQA 5AFZH 3TIUA 1LQDB 2XBXA 2NU3E 3S9AA 2ZCHP 1K21H 1AU8A 4GHTA 2GD4B 2BY6X 1C1SA 1W13U 4DT7B 3U9AH 1J15A 1UO6A 1A2CH 1ANEA 1O5AB 2B5TB 2DE8A 2TGAA 1J8AA 2GV7A 2VGCB 3EGKH 7ESTE 1Z71A 5T6DA 2BDGA 1QL8A 1NFYA 2BD8A 4YTAA 2WYGA 4JYUH 1A61H 5FX6A 3SV2H 1SC8U 4LZ4B 1GHVH 1T4UH 4ISOA 3SN8A 2ZU3A 1ELGA 2ZDVH 2Q6GA 5FCRA 5LPEA 1DLEA 1CHOF 3E3TA 1EPTC 1C1RA 1TNGA 1Z6JH 3GDVA 5AFYH 2ZDMA 3PO1B 4RKOB 1AWHB 1C5QA 1BA8B 3GICB 3HGPA 1FMGA 3ZZ3A 4BAKB 2BDAA 3S9CA 1RTFB 3FP6E 1QGFA 1MTWA 4JZEH 2BX3A 1C5TA 3UTUH 1BB0B 1CHOG 1C2KA 3NZIA 2UUKB 4ABGA 2HWLB 1V2VT 3M7QA 5C1YA 5DP6A 3T5FH 2VWOA 4KTUA 1BZXE 2GDEH 3RXFA 1NRRH 2EI8A 4AN7A 2OC1A 1QFKH 1P01A 1O3IA 3R3GB 1CE5A 4D8NA 4WMFA 3VEQB 1O2VA 2GCTC 1ETTH 1PQ7A 2FIRH 1A5HA 1AHTH 5C1UA 5LH8A 1ORFA 1MU6B 4MNWA 3HK3B 2PWXA 3SNCA 1C1OA 3QWCH 3SUFA 2A32A 1WBGB 3SQHE 3LC5A 3VGCC 4CH2B 2H6MA 2K1QA 1G2MA 3QDZB 3T27A 5A0CA 1HB0B 3RXLA 2BDHA 2SNVA 2VVCA 1IHTH 3VB7A 1E34B 3OX7U 2BY5X 1DDJA 3A7ZA 3K6ZA 2ALVA 1TX7A 1RXPA 1NRQH 1YGCH 1MAXA 3RMMH 4Y10E 1WAYB 1BTUA 1C5XB 1ZRKA 1D4PB 2C8WB 1IQJA 1RD3B 3LGTA 1NT1A 1TRMA 3MYWA 1YPHE 1AN1E 2ZFPH 3MH7A 1TMBH 3VB3A 1K1NA 4NCYA 3T2NA 4AB9A 2BZAA 4X2YA 1ZPZA 1ZZZA 1G9IE 1TPPA 1HAHH 5HXFA 5C3NA 1FY8E 3BIUH 3PO1C 1AKSA 1LQEA 4CR9A 1O39A 3UWIA 1XUIA 1O3GA 4X8SH 1V2UT 3GCHB 2EC9H 3TK9A 3RUOA 4YT6H 3SU4A 2VIPA 2ZC9H 1E35B 2BQWB 1D9IA 3RXSA 3VB5A 4Y79A 4X2VA 1BBRH 1FPCH 3LONA 5C1XA 1DVAH 1SGIB 5BPEA 4ESTE 4X1SU 2IJOB 2A7JA 3UREA 4WXIA 2Y5FA 3RXIA 2FODA 1XVMA 4MQAA 4K3JA 1GWAA 1TAWA 1CO7E 2VU8E 4I33A 1LO6A 1EOJA 2FPZA 4I8GA 1NRPH 1Y3XA 1ZLRA 2PGBB 4RN6A 3IITA 1W2KH 3HGNA 1AUTC 3AASA 2OBQA 2CV3A 5IYTA 1C9PA 1YPHC 2AH4X 1E0FD 1O3LA 1ZPCA 4DVAU 2ZF0H 3BV9B 2J38A 4X1NU 2ZDLA 4BAQB 1BRAA 2BLWA 1SFIA 3SOSA 1Y5BT 1AKSB 2ZTXA 1BRUP 3RXBA 1UMAH 3BF6H 4Q7ZA 5C2ZA 4INKA 2EEKA 4WJG2 1GJ7B 1SLUB 1O2NA 2R0KA 5FX5A 3H7OA 3A7XA 2OC7A 4DIIH 2ZU5A 5CHAB 5J4SA 3UOPA 3A8AA 1P12E 1DUAA 2XBWA 2DUCA 3LPRA 3UR9A 4DCDA 4HTCH 3RM2H 1GHBG 2CJIA 3NPSA 1INCA 1WCZA 3VPKA 1TX6A 1V2NT 2J94A 3EAJA 1K22H 4KKDA 3RU4D 2HLCA 4ZKOU 1G3EA 2TIOA 4H4FA 2A1DB 3EQ0H 2QAAA 5HYOA 3DT0H 1BTYA 3S69A 5B6OA 3S0NA 2OXSA 1FPHH 4X8TH 2BDCA 3SU5A 1HRTH 1ZSKA 3SZNA 2J4IA 4B2BA 3O8CA 1OXGA 3RP2A 1V3XA 4AFSA 1FI8A 2C4FH 2BVSH 3GCHC 1E38B 4H42U 2BXTH 4LK4A 7LPRA 4NZLA 1HV7A 4B71A 1CVWH 1UVOA 1SL3A 3MHWU 1XKAC 2WV4A 1C1PA 1LTOA 5C20A 1LHGH 3M5MA 5CE1A 4NWLA 2XTTB 1TPOA 4MPVA 1GPZA 2BXUH 3P95A 1C2GA 3M35A 1GCTB 1MBQA 2FOFA 3W95A 1Y5AT 1UCYK 1GJCB 2G4TA 1C4V2 1O34A 3KGPA 2EI6A 4RKJB 2JETC 2AMPA 1TONA 5L2ZH 4Z0KA 1HDTH 1GI8B 4IW4E 5GIBA 3C27B 1HUTH 4WVPE 2V35A 5JB9S 5HM2A 3M7TA 5DP3A 2PW8H 3T26A 4CRFA 1O2YA 4MVNA 2JH0D 4SGBE 1PPGE 2F3CE 2OC0A 4KTSA 3PM3A 4X6OA 3SUGA 4YO9A 1UCYE 5CHAC 2VWNA 1TNLA 1ELFA 3KCGH 1S84A 1V2WT 3M5OA 1BTHH 2GGVB 4XOJA 4A5TS 1ETSH 1P09A 4NSVA 2FX6A 1QB9A 3DFJA 3ZVCA 5DGJA 1GJ9B 2WPKS 1UHBB 1THSH 1FAKH 1O5EH 2HALA 2FOGA 4KGAA 2PV9B 2RDLA 2ZQ2A 4LZ1H 1P04A 5ESBA 1XUKA 2H9TH 4CR5A 2WPJS 4Y8XA 1EB2A 1DT2A 1T4VH 2XCNA 1C5SA 1TOMH 2ZFQH 3UIRA 3BTKE 4YOIA 4U30A 4IGDA 1VCQA 1O5BB 2YNAA 1C1WH 3BSQA 2P59A 1HAXB 1CT0E 5TCAA 1MTNB 2HNTE 3RXHA 5FBEA 1A1RA 5A09A 2PSXA 1ZGVA 3A8CA 3GCNA 4INHA 1DXPA 3M7UA 3UQVA 3S7HB 5BRRE 2H5CA 4IBLH 1ZMLA 2CXVA 4I32A 4ZHLU 3ATLA 2CN0H 1TE0A 3TVJB 1OYQA 4ZKRU 1F5LA 1O32A 4B76A 3I29A 1YPMH 1GCTC 2THFB 4ZXYH 4AGKA 4B73A 4D76A 3A83A 4I7YH 1LVBA 5DJ7A 1B0EA 5TCCA 4IMZA 4YT7H 2CF9H 1MCVA 3VFEA 4NG9H 2ZIQH 1C2HA 1O3HA 5FPTA 5GDSH 2ANYA 2BDBA 1C5NH 3H5CB 5ESTE 3ZZ4A 2IPHA 2W26A 1TGCA 1N8OB 3SW2B 1GBFA 3KEEA 3P6ZB 1A5GH 1O3CA 4FU9A 1VZQH 1UVPA 1EJMA 3A80A 3F9HA 1P9SA 1O37A 1TLDA 3ZZBA 2KAIA 1AVWA 1HAOH 1HAYB 1AZZA 4Y6DA 2GVFA 1MKWH 4D9QA 3RXDA 5JBBS 1XXDA 2HNTC 1RFNA 4O9VA 1DOJA 2TGTA 4BXWA 2Z3CA 3D23A 3S9BA 1T8LA 1YYY1 2J95A 1SMFE 2C3SA 1MD7A 2QY0B 1TNIA 4CBOA 3ODDA 1UTMA 4A1VA 3AW1A 2SGQE 3Q76A 2FESH 1O2RA 1P3EA 3TH2H 4O3TA 1AD8H 1AY6H 2QF3A 1NN6A 1L1JA 2A7HA 4YOJA 2BHGA 2W5EA 3ZZ9A 3FFGA 5EW2H 1A0JA 1NFUA 4B74A 1G3CA 3MO6A 2RA0A 1KXCA 2BLVA 1GHZA 1O5FH 3ZVAA 1GDUA 4NFFA 1TGBA 1MTNC 3SGBE 2PFEA 4Y8YA 1FAXA 3V7TA 4UEHH 2CGAA 2R2MB 2J34A 1HCGA 4Q7YA 2XW9A 1SGQE 2KAIB 2O8WA 1O0DH 3GYLB 4Y0ZE 3TJVA 3SU3A 1HJAB 1OYTH 1EAXA 4X6PA 2TGPZ 2PKSB 3MH5A 3BTME 2Z94A 1C2LA 3M36A 1UTLM 1SGDE 2HVXA 1YLDA 5EXMA 2Q6DA 4MPWA 2P3FH 1QJ6B 3ZYEA 5EGMA 1EZQA 3HPTB 1PQAA 2A4OA 5C5OA 1IQLA 1ANDA 1TIOA 3TGJE 4ZHMU 3Q77A 2PUQH 4ZMAH 1QB1A 1HFDA 1YPKH 3LGYA 3WY8A 3GY2A 2PLXA 4H6SB 1SSXA 1BJVA 3BTQE 1GGDB 1KXEA 4FUBA 1ID5H 2BY8X 1DWCH 4GAWA 1EAUA 2VH6A 1AMHA 1DM4B 4ZXXH 3ATWA 9LPRA 3I77A 2BVRH 2ZDNA 4Y0YE 3MU0A 3SV8A 3RMOH 3RXJA 1FZZA 4XDEA 1ELAA 3EBNA 1YKTA 4XBDA 3SGAE 4JZFH 2Z6BD 5FAHA 3SNBA 4MNYA 1QJ7B 4MNVA 5GWZA 1DICA 4OS2A 2XWAA 1ELDE 4BAMB 1CT2E 3RM0H 4ASHA 1LCYA 3SGQE 5AF9H 1Y59T 2BDIA 3GY6A 2ZTYA 5JBCS 1FY3A 4DGJA 3MFJA 1RTKA 5C67A 3URDA 2ANWA 4A7IB 1S6FA 3O8BA 1GI2A 1EP5A 1SGYE 3E90B 3ZZDA 1O2JA 2ALPA 4JMYA 3PMHB 1F0UA 2VJ1A 1K2I1 2H1UA 4MNXA 4RSPA 4AB8A 1KTSB 3RC5A 2JKHA 6ESTA 3EYDA 1AB9B 3RXEA 3EA9A 4QT8C 5EU8A 4X1RU 1OKXA 1LPKB 1WUNH 1HJAC 3MOCA 2ZPRA 3TJNA 5JBTA 4BOHA 2PKSC 4BANB 3T62A 6LPRA 1SVPA 4AORA 3RU4T 1GVLA 1LKAA 3PLPA 1BBRK 1BMAA 3SHCH 2I6QA 1UTKA 3VXEH 1P2QA 5EQRA 3SU1A 1H9LB 3V0XA 3S7KB 1O2MA 4UFFH 4WXVA 1TWXB 3A86A 1AIXH 2A5IA 1O3FA 1QR3E 2Z9JA 4B2AA 3QTVH 1F92A 2A31A 2AS9A 1XUHA 1HAZB 4UFEH 2FS9A 3EDXB 1GJ6A 4OGYA 1Y3YA 2BMGB 2V0BA 1ETRH 4IMQA 2B9LA 1FV9A 3SI4H 1GGDC 1K1MA 1QQ4A 1KYNA 1AWFH 3EA8A 4NZQA 2ZCLP 4NGAH 4B75A 1BBRE 3A7YA 1RJXB 1N6XA 1W11U 1OPHB 1S85A 1PFXC 4UD9H 2XXLA 1HAIH 2D26C 5F03A 3A7WA 1D6WA 3QK1A 2ZDKA 4BTUB 3B8JA 1V2LT 4DW2U 1MU8B 3MI4A 5F6MA 1SI5H 1PPBH 3BTFE 5I46H 2NU0E 1WTGH 2M5TA 3PLBA 1NU9A 4DG4A 1ZMNA 1Z7KA 3VB6A 1ANBA 3GDSA 1GL0E 1QJ1B 2FI4E 2Y82A 1F7ZA 4NFEA 5T6GA 1FQ3A 1HYLA 1ZHRA 1O2KA 1NTPA 1XVOA 1J17T 1JBUH 2STAE 1IAUA 1PQ5A 2J2UA 1W10U 2LNCA 2AMQA 4CRBA 1SB1H 1BRBE 2FWWA 1FJSA 1LVYA 5EQSA 2EA3A 4ABJA 1AB9C 3QZQA 1P10A 1A0LA 1H9HE 1VITF 3F1SB 1SHHB 2BD7A 1BTZA 1KTTB 1P02A 2H5DA 4FUJA 1BITA 2B8OH 1TRNA 2VWMA 3HKIB 1C2DA 2OD3B 4IS5A 2F9NA 3GDUA 3HKJB 5A8ZA 1OWJA 1SHYA 1C5OH 4GHQA 5A0BA 1VITG 4VGCB 4AYYB 3AAVA 1IQMA 4X2WA 4U2WA 3ZVGA 1ZTJA 3L33A 3SO3A 5LGOA 3SJIA 1TPSA 1G3DA 1O2ZA 5EQQA 1OP0A 5A8YA 4WH8A 3MO9A 4AYVB 3FP7E 3LDXH 1CGIE 3LKWA 4X1PU 1PPCE 2OQ5A 4MTBA 1QA7A 4AG2A 3E91A 1FIWA 2FP7B
chains in the Genus database with same CATH superfamily
3JZ2B 1YPLH 1WQSA 3M5NA 3C1KA 4LOYH 1GG6B 1QTFA 2R0LA 1LHCH 1YPEH 5A8XA 2ZFRH 2VVVA 1SGFA 1UK4A 1KIGH 1SG8B 1ZSLA 2W7SA 1FN6A 1THRH 1O31A 2AYWA 1CQQA 2AIPA 1TMTH 2FOHA 1VJAU 3PV5A 1C1UH 3BEFB 2JETB 1Z1IA 1WYKA 2Z9KA 1GHYH 1LHDH 2RFKC 1XUJA 1BRCE 2F9PA 4ZHAA 2R3UA 4B6FA 3ENSB 3SBKA 1JRSA 2QC2A 3VB4A 2P94A 4FVDA 2ZI2H 5JYIA 5ETXA 2ZFFH 2PTCE 3EA7A 1ZRBA 5EJ1A 1MBMA 1T31A 3P8FA 1C5UA 2LELA 1K9OE 5DPAA 1DY8A 2RA3A 2YMSC 3FZZA 2C8ZB 1SFQB 3ZZ6A 1V2KT 2ZHEH 4WF8A 1C5RA 1EXFA 1MTVA 1QNJA 1O3PB 2Y7ZA 1SBWA 2G00A 1D3TB 2SGFE 1C1NA 3L6PA 4NSYA 1F5RA 3MQKC 3ZZCA 1JIRA 3FP8E 2JH6D 2BQ6B 2PGQB 3LH3A 3AVZA 3A7TA 1IHSH 4VGCC 2K7XA 3BEUA 2AEIH 1GBMA 2ODYB 4XD7D 1O3EA 3U8OH 2WPIS 1O2UA 4I8KA 3PTNA 4FETA 2XC0A 2ZGHA 1W8BH 1WTHD 5GXPA 2BM2A 2CMYA 5DKMA 1DY9A 2ZU2A 1FONA 1PPFE 4A92A 1XXFA 1ZMJA 4AOQA 2P8OB 1BDAA 1EB1H 2Y5HA 1QRZA 2BD9A 2SFAA 4JZDH 3VXFH 2P3TB 4NIWA 4TWWA 2KZ4A 2ZKSA 1PYTC 2QXHA 2QV1A 3BTEE 1P2KA 3KQEA 5EW1H 1KMHB 1UHBA 2FOMB 1GG6C 3MWIU 2FTLE 4FXGH 5F53A 7KMEH 5I25A 1GBHA 1ESBA 1ZTKA 1C5WB 1Z6EA 2BX4A 1XUGA 1A0HB 1MKWK 1AFEH 3BTWE 4WMDA 5C17A 1A3EH 2UUFB 6CHAB 1JMOH 5L2YH 1SLVB 4B6EA 4XBCA 1FIZA 2BY9X 2AERH 3UAIC 3UB0A 1L4DA 3QGJA 2JH5D 1ACBE 5A2MH 2JDID 2TRMA 1FNIA 2ZPSA 3ODFA 4INLA 4Z1MD 3LGUA 4IN1A 2ESTE 1UVUH 2FS8A 2GMTC 3ZYDA 1LMWB 1SGRE 2KCAA 2UWOA 4P02A 1OWHA 5HGGA 4K60A 1A7SA 4HGCA 1OS8A 3LU9B 4AFQA 1TGSZ 1RS0A 5C94A 2D2DA 2ASUB 2J92A 1HAPH 3TGIE 1P05A 1L4ZA 1D3QB 1GVZA 1T8MA 3SV6A 1ZSJA 1K1LA 5K0HA 2KCYA 1SLWB 2FLBH 1BTPA 2QXGA 1NU7B 1ZJDA 3U1IB 4K8YA 5EG4A 2WUCA 1KXAA 2SGEE 3F6UH 3STJA 1HIAB 1UTPA 1OWDA 1XX9A 4GCHF 4NIXA 4LXBH 1IQKA 1TX8A 3GCTF 1W3CA 4XFQA 2OUAA 2FI3E 2ZCKP 4Y8ZA 1GDQA 4BTTB 2ZWLH 3LJJA 5T6FA 1E37B 4XBBA 2O8LA 5CHBA 3HATH 3MU5A 2HRVA 3F0OA 1ABJH 1KXDA 3TK5A 3NK8A 2F83A 1OSSA 1QL9A 3BTDE 1O2HA 1VR1H 1TBQH 2OK5A 4GCHG 2P8OC 1GJBB 1ABIH 5EJLA 3RXMA 1EQ9A 3GCTG 3SI3H 1B0FA 4TWYA 1DITH 2FOCA 2K8IA 1WV7H 2BOKA 3RXRA 1YP9A 2O9QA 1WU1A 2G5VA 2LPRA 1GMHF 4FUDA 1C2MA 3P8OA 1NROH 2VWLA 2ZGXH 4FUGA 2ZHDA 3RXGA 1EX3A 1U6QA 1P3CA 2ZGJA 4ZUHA 3GY5A 4IC5A 1QQUA 1V2QT 1TALA 2G5NA 2IN2A 5E0HA 3D49H 6CHAC 2XBVA 1MUEB 2SGAA 4DURA 2IOTA 3QGNB 3CENA 3T28A 3TNSA 4FUFA 4Z6AH 1Z8JB 2STBE 5ABWA 2HOBA 1IQEA 3A89A 3ZVEA 3MH6A 2RDEA 2QXJA 2ZGBH 1W7GH 1GHXH 3SV9A 3ZZ8A 5HM9A 1Z8RA 1O30A 3V12A 2ZGCA 1V2JT 3EE7A 3SNAA 4OS7A 1YM0A 3URCA 1CA0B 4JK6A 3TH3H 5TJXA 2XYAA 1MMJN 1NBME 1PJPA 3A8BA 1TYNA 2J9NA 1P9UA 1X7AC 1PPZA 3A84A 1A5IA 1BMLA 5EIYA 8LPRA 2FOEA 4YM9A 2DE9A 5EPNA 4B1TA 1HAVA 1BCUH 3F68H 2Z9LA 5F8XA 1BMFD 4ACAA 3OTJE 3F2GA 1QL7A 2J97A 1O2PA 1O3JA 2CHAC 1P2NA 1H8HD 1LKBA 3OSYA 3ZZAA 4R0IA 3PMBB 2EQNA 3TNTA 1AUJA 2ZFSA 1HNEE 3D62A 2NWNA 4ABBA 1ZOMA 3MNXA 1GI5A 1YC0A 4ABAA 2F91A 1MTSA 1DPOA 1V2MT 1S5SA 1UTJA 3IG6B 3UNQA 1V2ST 1O38A 3NCLA 4UE7H 3CS7A 1O33A 1KLIH 2QYIA 1RRKA 1T8OA 3RXPA 1W12U 1GBLA 1KLTA 1KXFA 2Z7FE 3DSGA 3BG8A 4NA9H 4AZ2B 1ZR0A 2YMSD 5J4QA 2O8TA 4FU7A 1JIMA 1TGNA 2HNTF 1B7XB 3B23B 2BOHB 3P8GA 3GYMA 1QY6A 1O35A 3NUMA 3CS0A 1YLCA 2A4QA 2H9EH 2PTNA 3ZVFA 4J2YB 4X1QU 4Y71A 4AFUA 4WY3A 2ZZUH 3FO8D 1HAVB 3PLKA 1EKBB 3A85A 1CBWB 3BTGE 3N99A 4AG1A 3OU0A 1QURH 1GBDA 4D7FA 3E0PB 3WWFA 3N7OA 1V2PT 3A8DA 5FPSA 3RXAA 1GI3A 2KX4A 1J14A 2Y81A 4X2XA 2XNIA 3FVFB 2ODQA 1O5GH 3UPEA 1S83A 3CNRA 2M2AA 1CA0C 3TH4H 5L6NH 5HIZA 1F2SE 1QBNA 1Y3VA 2V3HH 2AGIX 1C4U2 3RXKA 2GT7A 4AGJA 1FLEE 2FDAA 4IN2A 2ZU4A 4XE4A 5A0AE 4JYTA 1BMNH 3A7VA 1J9CH 3P92A 3PMAB 1PYTD 2Y7XA 3RXOA 4NWKA 3NWUA 1TABE 2ZHQH 4O97A 5FCKA 3AW0A 1N1LA 2QF5A 2VINA 1E36B 1GHAF 1KSNA 2A4RA 1CT4E 2HGTH 3ZIAD 3MTYA 1ZGIA 2FXRA 3NXPA 3I78A 1GBIA 2ODPA 4DJZB 1V2RT 8GCHF 1Y5UT 5GPIB 5DG6A 2R9PA 3ATIA 4O03A 1Q2WA 3KIDU 2ZP0H 3MNBA 4ISHH 3RXVA 2Z9IA 4WH6A 8ESTE 1GHAG 2VIOA 1UVTH 2HLDD 2V6NA 2GJGA 2BDYA 1S81A 1LHFH 2WPMS 3LJOA 9ESTA 3ZZ7A 3KQBA 1H8DH 1DFPA 1GI0A 4Y76A 1DWEH 2PHBA 4X6NA 1C2JA 2BZ6H 3F2FA 2FEQH 2FLRH 1Z8GA 1PPHE 3F0PA 1OWIA 1QHRB 2KR7A 4HFPB 3RXQA 2WPHS 1IQGA 3RXUA 5H4IB 1KDQA 3MU8A 4K1SA 1EP6A 2NU2E 1O2XA 2W7UA 5EXLA 1TQ7B 2BY7X 3BTTE 1QBVH 4TPYA 1HJ8A 1YCPM 1E1RD 1GJ5H 3F9EA 2XWBI 4MG3A 3LC3A 3DCLA 1CBWC 1DXWA 1RIWB 1QRXA 3QZRA 1C4Y2 1XM1A 5GCHF 1AGJA 3P17H 4CH8B 3K9XB 4KTCA 3SNEA 2BB4A 1SQTA 3ZVBA 2G4UA 3LIWA 5JB8S 1UK3A 4JYVH 3U28C 1GHWH 3DUXH 3KQCA 1FY4A 2FI5E 1GMDF 3RLWH 1NESE 1GJ8B 3ATMA 3Q00A 5LPFA 4M7GA 1SQOA 3SQEE 3E8LA 2B7DH 1YBWA 4Q7XA 1EATA 1Q3XA 5GCHG 5E2OA 4YLQH 1AZ8A 2BLOA 4O3UA 1TA2A 3DA9B 2WHXA 1Y3WA 1BOQA 3QX5H 4DY7B 1EJNA 1HBTH 1K1PA 1QA0A 1GMDG 1O3DA 5DK1A 2Z3DA 3W1EA 1P03A 1TB6H 3UR6A 2P95A 1LPZB 1KDQB 4YZUA 2YOLA 4UFDH 1WOFA 2ANKH 1SGNE 4E06H 4GSOA 1EUFA 1C1TA 1G3BA 2A7CA 4ACBA 3A81A 3V13A 1TQ0B 2AFQB 4TYDA 2C93B 5HMAA 4FU8A 2WUBA 3TJUA 4YESB 3FZDA 1EZUC 3M3VA 3ZZ5A 5IDKA 2GZ7A 2GTBA 1H8IH 1P0SH 1O2LA 2NU4E 1ARCA 4JCNA 4BAOB 1VGCC 1ZTLA 4MLFB 1K1OA 1BT7A 2VIWA 1FY1A 1O3BA 4HI3A 2TBSA 1NY22 1A3BH 2YMSB 2H9HA 2ZO3H 4P00A 4TSFD 3RMNH 3A82A 1C2IA 3M5LA 4ISNA 4K1TA 2C90B 2R2WU 2JJ1D 1O2TA 1OOKB 1BHXB 1IQNA 1JWTA 4JK5A 5EPYA 1LVOA 3KL6A 3P8NA 2ZTZA 4D9RA 1HXEH 1YCPH 1VITH 3AK5A 1O2QA 1EASA 3OYPA 3QLPH 1LDTT 1C5VA 3DFLA 3Q3XA 2WINI 3OFND 3ITIA 2RCEA 3M3SA 2SNWA 3LOXA 3SORA 4SGAE 1CA8B 1HGTH 1C5YB 4IC6A 3GY3A 1RIWC 4RT0A 1GBTA 3QTOH 1AVXA 2BQ7B 1TGTA 3SHAH 1XKBC 2XCFA 2OTVA 2TGDA 5T3HA 1MKXH 1BMMH 2F9BH 1JXPA 2VGCC 4JZ1A 4NA8A 4FVBA 4F4OC 4PROA 3UNRA 4FOUC 1JRTA 4R8TB 5DP8A 1TOCB 3TJOA 2HPQH 3DD2H 3W94A 1O2IA 3OEHD 2P93A 2RG3A 1QB6A 1NRSH 3SV7A 3M37A 2P3UB 1B5GH 2QCYA 1SPJA 1F5KU 3E16B 2BD4A 1GJDB 1C5LH 1F0TA 1AVGH 4E7NA 1UTQA 3PWBA 1TBRH 2PR3A 2SGDE 3LT3A 1P57B 1AO5A 3M3TA 2QF4A 1EZXC 1ESAA 1ZYOA 5JDUB 2FOBA 3HK6B 3OY6U 3UNSA 2Q6FA 2VIQA 1NBMD 5DO4H 2GZ9A 1SGEE 1KXBA 2QE7D 1F0SA 1LVMA 2GKVE 2PKAA 3G01A 3PWCA 2W3KA 4FUEA 3ZVDA 1QCPA 3GY4A 3RLYH 3AAUA 4K8BA 1BTXA 1HLTH 1H9IE 3O8RA 1KY9A 2VNTA 2PSYA 5CDFE 3H7TA 1GBBA 2GMTB 1BQYA 4BAHB 1BIOA 1C5PA 1SQAA 1WSSH 2UUYA 4CRGA 4D7GA 4OGXA 2UWLA 4I86A 1JOUB 1G36A 3H09A 3PB1E 4K1EA 1XMNB 1DWDH 1KLJH 2QF0A 1L2EA 3F9FA 2VIVA 1ESTA 4K5ZA 2P16A 3SU2A 2Y6TA 4CRCA 2QGRA 3LGIA 2VH0A 4OS5A 3RMLH 1GHBF 4H6TA 1FXYA 1TFXA 2H2ZA 4YLUA 2XBYA 5E8EH 3SU6A 1G2LA 1UW7A 1IQFA 3SNDA 5DP4A 1C1MA 2F9UA 2VB0A 4OS1A 2J98A 4Q2KA 3STIA 2W6ID 3ELAH 5K7RA 3EE0B 1P2JA 3GISB 1H1BA 2ZHFH 3MMGA 2A2QH 1TBZH 1DE7H 2Q1JA 1O2SA 3BIVH 4K69A 4ZKSU 1EOLA 2PKAB 1G32B 1ZPBA 3OY5U 1D3DB 5JBAS 1BTWA 1L1GA 3RDZA 1MZAA 1O5DH 3GCOA 3MU4A 2XOKD 2GCHF 2ZECA 3E6PH 2ZFTA 2SGPE 1GI1A 1THPB 5PTPA 2ZA5A 3L3TA 2ZNKH 2YNBA 4TT3D 1FN8A 1UTOA 4FUIA 5LPRA 5F8TA 3UWJH 3PMJA 3PROA 4TPIZ 4ABDA 1PQ8A 1Y3UA 3SJOA 1H4WA 5DP9A 2GCHG 1J16A 1NC6A 2EY4C 1YPGH 3KYGA 1GBAA 1BHXF 6GCHF 1HIAA 4I8JA 3P70B 1ELEE 1SGCA 1F0RA 5AVDA 1GI4A 1MABB 2OCVB 4X0WU 1IOEA 1OP8A 2A0QB 2J98B 1C1VH 1ELVA 1NPMA 1K28D 2FMJA 1N6YA 3Q3KA 1LHEH 2G8TA 4AX9H 6GCHG 1DS2E 1FY5A 3RC6A 3TU7H 4B2CA 2HVYB 4RT1A 4X6MA 3U8TH 4NIVA 2ZU1A 4CRDA 1GI7B 2A5KA 4UONA 1OWKA 5C0TA 4JZIA 1O3KA 4THNH 3UFAA 2WZQA 3GOVB 1G30B 1TNKA 2GZ8A 1MZDA 2R3YA 3QO6A 1ARBA 1GMCF 1WXRA 2WYJA 2WV5A 4I8HA 4UFGH 1GI9B 1S0QA 1P2OA 3ZV8A 1T32A 1MTUA 2W3IA 3GY7A 4ZH8A 4J1YA 3TGKE 1ELBA 3O8DA 3K2UA 2Z3EA 2ANMH 1DUEA 1LPGB 1S0RA 3K65B 1P8VC 5FPYA 1W0YH 1SGPE 4GVUA 1GMCG 2CHAB 3SJ8A 2ZG0H 1ZHMA 2BVXH 1O2WA 1OP2A 1C2EA 3U1JB 1OX1A 1UJ1A 1MQ6A 1YPJH 3KQDA 2FTMA 1C2FA 2QN5T 1T7CA 1Q31A 3T29A 1PPEE 4I31A 3TPIZ 4GPGA 1ELCA 3SJ9A 3E1XB 1IQHA 3A88A 4UDWH 3OTPA 1QRWA 1V6DA 1TNHA 4WMEA 3MH4A 3BG4B 4K2YA 2GX4A 3MNSA 4X8UH 1O5CB 1D3PB 4F49A 1K1IA 2CF8H 2D1JA 4ABFA 5E0JA 2ZHWH 1UK2A 5E0GA 1RTLA 3FANA 2AGGX 2AIQA 5L30H 3TITA 1GVKB 3B9FH 1GJ4H 2FO9A 4CREA 4CBNA 4HZHA 3BN9A 2FYQA 4CRAA 1T8NA 2ZDAH 1XUFA 3RC4A 3KN2A 4Y7AA 4U32A 1AI8H 1GBEA 3D65E 4A1TA 1BJUA 1A4WH 2L6OA 3K6YA 2ZQ1A 3LGVA 3MU1A 3IWMA 1W7XH 1P11E 1CHGA 1GCDA 1NRNH 1ELTA 1GMHG 2QIQA 5CMXH 1HPGA 3BTHE 4AFZA 1NFXA 2C8XB 2FX4A 1Z8IB 5EOKA 1O2OA 2A4GA 3KHVA 2Z9GA 1TRYA 1H8ED 1FDPA 1TMUH 3WWBA 5JPMH 2G55A 1S82A 3PV2A 5SGAE 4HG6A 1Y8TA 5C5NA 2A5AA 3QUMP 2EI7A 5GJ4B 3ZV9A 3KNXA 1SGFG 1UTNA 3SUDA 3GS9A 1NZQH 3U8RH 4BTIB 1C5MD 3E0NB 3NKKA 1ZJKA 5F8ZA 1SR5C 5DP5A 1VJ9U 3U69H 2O8MA 3PYHA 1QBOA 3F9GA 2GT8A 4E05H 5FXLA 2CK3D 1GL1A 1VCPA 2BD5A 4KP0A 2O8UA 2GV6A 4XSKU 4YOGA 1MD8A 5AHGH 3UQOA 1EJAA 4FUHA 2HPPH 2OINA 2BTCE 2G52A 2Y80A 3SJKA 1D6RA 3QN7A 3R0FA 4GLYA 3UY9A 4ZKNU 1UCYH 1S6LA 1G37A 1O3MA 2OP9A 7GCHF 4OM9A 2FOAA 4E7RG 1AE8H 1SGTA 1DWBH 1TNJA 2ZPQA 1AFQB 4ISIH 4TY6A 4MPUA 1L1NA 4I8LA 3SU0A 1GBJA 5GNDA 3JZ1B 2XC5A 1DSUA 2V3OH 2AMDA 2UUJB 2BD3A 3BG4C 1EPTA 2VVUA 4OS4A 7GCHG 1BUIA 2OLGA 5EODA 3U98H 1A46H 2L74A 4ZROA 1C1QA 1HAGE 2C8YB 3FKSD 4Y11E 1P2MA 1CU1A 4CHAB 2NU1E 2OQUA 3ATKA 2BD2A 4NIYA 4ZAEA 2Y5GA 1W14U 2F9VA 4ABIA 2AGEX 2XRCA 3ESTA 4X8VH 1P06A 2QA9E 3Q3YA 2GDDA 1GBKA 3RU4E 2WV9A 3MNCA 1V2OT 3T25A 2BYAX 1O3AA 2ILNA 3SUEA 1O36A 2UWPA 2I6SA 1IQIA 4A6LA 1FUJA 1MAYA 1MQ5A 4Q63A 2XC4A 5EXNA 3UOUA 2A2XH 4DOQA 4KELA 1CGJE 1O3NA 3RXCA 4MDSA 1EAWA 1V2TT 1K1JA 1O3OA 1W0KD 1NFWA 1C5ZB 1E1QD 3DHKH 2JJ2D 1NS3A 3M61U 2FYRA 5DP7A 3LH1A 1GBCA 1GDNA 1DSTA 2F9OA 3TK6A 1EAIA 1M9UA 3CP7A 1SOTA 3DSPA 2FZZA 1EPTB 1OHHD 2A45B 3BEIB 1HJ9A 3F3BA 1QIXB 1ZHPA 4DIHH 2WPLS 1N8OC 1GJAB 4F48B 1NO9H 4ABEA 4MPXA 3PV4A 1MCTA 1W0ZU 1CSOE 4Q80A 2ZEBA 3A87A 1Z1JA 5FBIA 3MO3A 3KF2A 5E2PA 2OBOA 1YCPK 1RGQA 2QXIA 1P2IA 4AC9A 2G51A 2ULLA 8KME2 2G81E 1AFQC 4Q4LA 3UUZA 4A1XA 1DANH 1ANCA 1VGCB 1OWEA 1SLXB 1TPAE 2GCTB 1DLKB 4TY7A 3LGWA 2LIZA 5HIYA 1NM6A 4NA7A 4WWYA 1S6HA 4GUXA 4ABHA 1DX5M 4ISLA 4BXSA 8GCHG 1AQ7A 1MKXK 4U01A 1L0ZA 1EZSC 2GP9B 2TPIZ 3RXTA 4BNRA 2VIDA 1C9TA 1AE5A 4Y7BA 3PTBA 4FUCA 1HXFH 1SOZA 1O2GH 3GY8A 5FHTA 4OS6A 4CHAC 5G4BA 3V3MA 3FAOA 3VGCB 5B6LA 1CGHA 1GI6A 2D8WA 2OC8A 2B0FA 2PUXB 1VCWA 1WQVH 2FM2A 3TLOA 1MH0A 1TA6A 1UVSH 1YF4A 2BLQA 5AFZH 3TIUA 1LQDB 2XBXA 2NU3E 3S9AA 2ZCHP 1K21H 1AU8A 4GHTA 2GD4B 2BY6X 1C1SA 1W13U 4DT7B 3U9AH 1J15A 1UO6A 1A2CH 1ANEA 1O5AB 2B5TB 2DE8A 2TGAA 1J8AA 2GV7A 2VGCB 3EGKH 7ESTE 1Z71A 5T6DA 4ASUD 2BDGA 1QL8A 1NFYA 2BD8A 4YTAA 2WYGA 4JYUH 1A61H 5FX6A 3SV2H 1SC8U 4LZ4B 1GHVH 1T4UH 4ISOA 3SN8A 2ZU3A 1ELGA 2ZDVH 2Q6GA 5FCRA 5LPEA 1DLEA 1CHOF 3E3TA 1EPTC 1C1RA 1TNGA 1Z6JH 3GDVA 5AFYH 2ZDMA 3PO1B 4RKOB 1AWHB 1C5QA 1BA8B 3GICB 3HGPA 1FMGA 3ZZ3A 4BAKB 2BDAA 3S9CA 1RTFB 3FP6E 1QGFA 1MTWA 4JZEH 2BX3A 1C5TA 3UTUH 1BB0B 1CHOG 1C2KA 3NZIA 2UUKB 4ABGA 2HWLB 1V2VT 3M7QA 5C1YA 5DP6A 3T5FH 2VWOA 4KTUA 1BZXE 2GDEH 3RXFA 1NRRH 2EI8A 4AN7A 2OC1A 1QFKH 1P01A 1O3IA 3R3GB 4ZCNA 1CE5A 4D8NA 4WMFA 3VEQB 1O2VA 2GCTC 1ETTH 1PQ7A 2FIRH 1A5HA 1AHTH 3FN8A 5C1UA 5LH8A 1FX0B 1ORFA 1MU6B 4MNWA 3HK3B 2PWXA 3SNCA 1C1OA 3QWCH 3SUFA 2A32A 1WBGB 3SQHE 3LC5A 3VGCC 4CH2B 2H6MA 2K1QA 1G2MA 3QDZB 3T27A 5A0CA 1HB0B 3RXLA 2BDHA 2SNVA 2VVCA 1IHTH 3VB7A 1E34B 2AHME 2PP6A 1COWD 3OX7U 2BY5X 1DDJA 3A7ZA 3K6ZA 2ALVA 3DSOA 1TX7A 1RXPA 1NRQH 1YGCH 1MAXA 3RMMH 4Y10E 1WAYB 1BTUA 1C5XB 1ZRKA 1D4PB 2C8WB 1IQJA 1RD3B 3LGTA 1NT1A 1TRMA 3MYWA 1YPHE 1AN1E 2ZFPH 3MH7A 1K0HA 1TMBH 3VB3A 1K1NA 4NCYA 3T2NA 4AB9A 2BZAA 5C0UA 4X2YA 1ZPZA 1ZZZA 1G9IE 1TPPA 1HAHH 4YXWD 5HXFA 5C3NA 1FY8E 3BIUH 3PO1C 1AKSA 1LQEA 4CR9A 1O39A 3UWIA 1XUIA 1O3GA 4X8SH 1V2UT 3GCHB 2EC9H 3TK9A 3RUOA 1W0JD 4YT6H 3SU4A 4RI0A 2VIPA 2ZC9H 1E35B 2BQWB 1D9IA 3RXSA 3VB5A 4Y79A 4X2VA 1BBRH 1FPCH 1YY3A 3LONA 5C1XA 1DVAH 1SGIB 5BPEA 4ESTE 4X1SU 2IJOB 2A7JA 3UREA 4WXIA 2Y5FA 3RXIA 2FODA 1XVMA 4MQAA 4K3JA 1GWAA 1TAWA 1CO7E 2VU8E 4I33A 1LO6A 1EOJA 2FPZA 4I8GA 1NRPH 1Y3XA 1ZLRA 2PGBB 4RN6A 3IITA 1W2KH 3HGNA 1AUTC 3AASA 2OBQA 2CV3A 5IYTA 1C9PA 1YPHC 2AH4X 1E0FD 1O3LA 3VG8A 1ZPCA 4DVAU 2ZF0H 3BV9B 2J38A 4X1NU 2ZDLA 4BAQB 3OE7D 1BRAA 2BLWA 1SFIA 3SOSA 1Y5BT 1AKSB 2ZTXA 1BRUP 3RXBA 1UMAH 3BF6H 4Q7ZA 5C2ZA 4INKA 2EEKA 4WJG2 1GJ7B 5DN6D 1SLUB 1O2NA 2R0KA 5FX5A 3H7OA 3A7XA 2OC7A 4DIIH 2ZU5A 5CHAB 5J4SA 3UOPA 3A8AA 1P12E 1DUAA 2XBWA 2DUCA 3LPRA 3FOAA 3UR9A 4DCDA 4HTCH 3RM2H 1GHBG 2CJIA 3NPSA 1INCA 1WCZA 3VPKA 1TX6A 1V2NT 2J94A 3EAJA 1K22H 4KKDA 3RU4D 2HLCA 4ZKOU 1G3EA 2TIOA 4H4FA 2A1DB 3EQ0H 2QAAA 5HYOA 3DT0H 1BTYA 3S69A 5B6OA 3S0NA 2OXSA 1FPHH 4X8TH 2BDCA 3SU5A 1HRTH 1ZSKA 3SZNA 2J4IA 4B2BA 3O8CA 1OXGA 3RP2A 1V3XA 4AFSA 1FI8A 2C4FH 2BVSH 3GCHC 1E38B 4H42U 2BXTH 2K0QA 4LK4A 7LPRA 4NZLA 1HV7A 4B71A 1CVWH 1UVOA 1SL3A 3MHWU 1XKAC 3SYJA 2WV4A 1C1PA 1LTOA 5C20A 1LHGH 5HKKD 3M5MA 5CE1A 4NWLA 2XTTB 1TPOA 4MPVA 1GPZA 2BXUH 3P95A 1C2GA 3M35A 1GCTB 1MBQA 2FOFA 3W95A 1Y5AT 1UCYK 1GJCB 2G4TA 1C4V2 1O34A 3KGPA 2EI6A 4RKJB 2JETC 2AMPA 1TONA 5L2ZH 4Z0KA 1HDTH 1GI8B 4IW4E 5GIBA 3C27B 1HUTH 4WVPE 2V35A 5JB9S 5HM2A 3M7TA 5DP3A 2PW8H 3T26A 4CRFA 1O2YA 4MVNA 2JH0D 4SGBE 1PPGE 2F3CE 2OC0A 4KTSA 3PM3A 4X6OA 3SUGA 4YO9A 1UCYE 5CHAC 2VWNA 1TNLA 1ELFA 3KCGH 2JIZD 1S84A 3KYFA 1V2WT 3M5OA 1BTHH 2GGVB 4XOJA 4A5TS 1ETSH 1P09A 4NSVA 2FX6A 1QB9A 3DFJA 3ZVCA 5DGJA 1GJ9B 2WPKS 1UHBB 1YLNA 1THSH 1FAKH 1O5EH 2HALA 2FOGA 4KGAA 2PV9B 2RDLA 2ZQ2A 4LZ1H 1P04A 5ESBA 1XUKA 2H9TH 2J5UA 4CR5A 2WPJS 4Y8XA 1EB2A 1DT2A 1T4VH 2XCNA 2IPQX 1C5SA 1TOMH 2ZFQH 3UIRA 3BTKE 4YOIA 4U30A 2IJD1 3OEED 4IGDA 1VCQA 1O5BB 2YNAA 1C1WH 3BSQA 4XRNA 2P59A 1HAXB 1CT0E 5TCAA 1MTNB 2HNTE 3RXHA 5FBEA 1SQRA 1A1RA 5A09A 2PSXA 1ZGVA 3A8CA 5IK2D 3GCNA 4INHA 1DXPA 3M7UA 3UQVA 3S7HB 1EFRD 5BRRE 2H5CA 4IBLH 1ZMLA 2CXVA 4I32A 4ZHLU 3ATLA 2CN0H 1TE0A 3TVJB 1OYQA 4ZKRU 1F5LA 1O32A 4B76A 3I29A 1YPMH 1GCTC 2THFB 3N7EA 4ZXYH 4AGKA 4B73A 4D76A 3A83A 4I7YH 1LVBA 5DJ7A 1B0EA 5TCCA 4IMZA 4YT7H 2CF9H 1MCVA 3VFEA 4NG9H 2ZIQH 1C2HA 1O3HA 2F43B 2KM0A 5FPTA 5GDSH 2ANYA 2BDBA 1C5NH 3H5CB 5ESTE 3ZZ4A 2IPHA 2W26A 1TGCA 1N8OB 3SW2B 1GBFA 3KEEA 3P6ZB 1A5GH 1O3CA 4FU9A 1VZQH 1UVPA 1EJMA 3A80A 3F9HA 1P9SA 1O37A 1TLDA 3ZZBA 2KAIA 5T1VA 1AVWA 1HAOH 1HAYB 1AZZA 4Y6DA 2GVFA 1MKWH 4D9QA 3RXDA 5JBBS 1XXDA 2HNTC 1RFNA 4O9VA 1DOJA 2TGTA 5KGOA 2Z3CA 3D23A 4BXWA 3S9BA 1T8LA 1YYY1 2J95A 1SMFE 2C3SA 3PRBA 1MD7A 2QY0B 1TNIA 4CBOA 3ODDA 1UTMA 4A1VA 3AW1A 2SGQE 3Q76A 2FESH 1O2RA 1P3EA 3TH2H 4O3TA 1AD8H 1AY6H 2QF3A 3F2HA 1NN6A 1L1JA 2V7QD 2A7HA 4YOJA 2BHGA 2KCPA 2W5EA 3ZZ9A 3FFGA 5EW2H 1A0JA 1NFUA 4B74A 1G3CA 3MO6A 2RA0A 1KXCA 2BLVA 1GHZA 1O5FH 3ZVAA 1GDUA 4NFFA 1TGBA 1MTNC 3SGBE 2PFEA 4Y8YA 1FAXA 3V7TA 4UEHH 2CGAA 2R2MB 2J34A 1HCGA 4Q7YA 2XW9A 1SGQE 2KAIB 2O8WA 1O0DH 3GYLB 4Y0ZE 3TJVA 3SU3A 1HJAB 1OYTH 1EAXA 4X6PA 2TGPZ 2PKSB 3MH5A 3BTME 2Z94A 1C2LA 1WDIA 3M36A 1UTLM 1SGDE 2HVXA 1YLDA 5EXMA 2Q6DA 4MPWA 2P3FH 1QJ6B 2LP6A 3ZYEA 5EGMA 1EZQA 3HPTB 1PQAA 2A4OA 5C5OA 1IQLA 5EJZA 1ANDA 1TIOA 3TGJE 4ZHMU 3Q77A 2PUQH 4ZMAH 2VBCA 1QB1A 1HFDA 1YPKH 3LGYA 3WY8A 3GY2A 2PLXA 4H6SB 1SSXA 1BJVA 3BTQE 1GGDB 1KXEA 4FUBA 1ID5H 2BY8X 1DWCH 4GAWA 1EAUA 2VH6A 1AMHA 1DM4B 4ZXXH 3ATWA 9LPRA 3I77A 2BVRH 2WSSD 2ZDNA 4Y0YE 3MU0A 3SV8A 3RMOH 3RXJA 1FZZA 4XDEA 3WW7A 1ELAA 2V3MA 1SKYE 3EBNA 1YKTA 4XBDA 3SGAE 4JZFH 2Z6BD 5FAHA 3SNBA 4MNYA 1QJ7B 4MNVA 5GWZA 1DICA 3OAAD 4OS2A 2XWAA 1ELDE 4BAMB 1CT2E 3RM0H 4ASHA 1LCYA 3SGQE 5AF9H 1Y59T 2BDIA 3GY6A 2ZTYA 5JBCS 1FY3A 4DGJA 3MFJA 1RTKA 3KQ5A 5C67A 3URDA 2ANWA 2WPDD 1S6FA 3O8BA 4A7IB 4DT4A 1GI2A 1EP5A 1SGYE 3E90B 3ZZDA 1O2JA 2ALPA 4JMYA 3PMHB 1F0UA 2VJ1A 1K2I1 2H1UA 4MNXA 4RSPA 4AB8A 1KTSB 3RC5A 2JKHA 6ESTA 3EYDA 1AB9B 3RXEA 3EA9A 4QT8C 5EU8A 4X1RU 1OKXA 1LPKB 1WUNH 1HJAC 3MOCA 2XNDD 2ZPRA 3TJNA 5JBTA 4BOHA 2PKSC 4BANB 3T62A 6LPRA 1SVPA 4AORA 3RU4T 1GVLA 1LKAA 3PLPA 1BBRK 1BMAA 3SHCH 2I6QA 1UTKA 3VXEH 1P2QA 5EQRA 3SU1A 1H9LB 3V0XA 3S7KB 1O2MA 4UFFH 4WXVA 1TWXB 3A86A 1AIXH 2A5IA 1O3FA 1QR3E 2Z9JA 4B2AA 3QTVH 1F92A 2A31A 2AS9A 1XUHA 1HAZB 4UFEH 2FS9A 3EDXB 1GJ6A 4OGYA 1Y3YA 2BMGB 2V0BA 1ETRH 4F55A 4IMQA 2B9LA 1FV9A 3SI4H 1GGDC 3PRDA 1K1MA 1QQ4A 1KYNA 3NRLA 1AWFH 3EA8A 4NZQA 2ZCLP 4NGAH 1E79D 4B75A 1BBRE 3A7YA 1RJXB 1N6XA 1W11U 1OPHB 1S85A 1PFXC 2KFWA 4UD9H 2XXLA 1HAIH 2D26C 5F03A 3A7WA 1D6WA 3QK1A 2ZDKA 4BTUB 3B8JA 1V2LT 4DW2U 1MU8B 3MI4A 5F6MA 1SI5H 1PPBH 3BTFE 5I46H 2NU0E 1WTGH 2M5TA 3PLBA 1NU9A 1YWUA 4DG4A 1ZMNA 1Z7KA 3VB6A 1ANBA 3GDSA 5KEDA 1GL0E 1QJ1B 2FI4E 2Y82A 1F7ZA 4NFEA 5T6GA 5FL7D 2KCOA 1FQ3A 1HYLA 1ZHRA 1O2KA 1NTPA 1XVOA 1J17T 1JBUH 2STAE 1IAUA 1PQ5A 2J2UA 1W10U 2LNCA 2AMQA 4CRBA 1SB1H 1BRBE 2FWWA 1FJSA 1LVYA 5EQSA 2EA3A 4ABJA 1AB9C 3QZQA 1P10A 1A0LA 2F4LA 1H9HE 1VITF 3F1SB 1SHHB 2BD7A 1BTZA 1KTTB 1P02A 2H5DA 5DSFA 4FUJA 1BITA 2B8OH 1TRNA 2VWMA 5KECA 3HKIB 1C2DA 2OD3B 4IS5A 2F9NA 3GDUA 3HKJB 5A8ZA 1OWJA 1SHYA 1C5OH 1QZ8A 4GHQA 1VITG 5A0BA 4VGCB 4AYYB 3AAVA 1IQMA 4X2WA 4U2WA 1VKYA 3ZVGA 1ZTJA 3L33A 3SO3A 5LGOA 3SJIA 1TPSA 1G3DA 1O2ZA 5EQQA 1OP0A 5A8YA 4WH8A 3SZEA 3MO9A 4AYVB 3FP7E 3LDXH 1CGIE 3LKWA 4X1PU 1PPCE 2OQ5A 2W6JD 4MTBA 4M9FA 1QA7A 4AG2A 3E91A 1FIWA 2FP7B 3N7DA
chains in the Genus database with same CATH topology
3JZ2B 1YPLH 1WQSA 3M5NA 3C1KA 4LOYH 1GG6B 1QTFA 2R0LA 1LHCH 1YPEH 5A8XA 2ZFRH 2VVVA 1SGFA 1UK4A 1KIGH 1SG8B 1ZSLA 2W7SA 1FN6A 1THRH 1O31A 2AYWA 1CQQA 2AIPA 1TMTH 2FOHA 1VJAU 1C1UH 3BEFB 2JETB 1Z1IA 1WYKA 2Z9KA 1GHYH 1LHDH 1XUJA 1BRCE 2F9PA 4ZHAA 2R3UA 3ENSB 3SBKA 1JRSA 2QC2A 3VB4A 2P94A 4FVDA 2ZI2H 5JYIA 5ETXA 2ZFFH 2PTCE 3EA7A 1ZRBA 1MBMA 1T31A 3P8FA 1C5UA 1K9OE 5DPAA 1DY8A 2RA3A 3FZZA 2C8ZB 1SFQB 3ZZ6A 1V2KT 2ZHEH 4WF8A 1C5RA 1EXFA 1MTVA 1QNJA 1O3PB 2Y7ZA 1SBWA 2G00A 1D3TB 2SGFE 1C1NA 3L6PA 4NSYA 1F5RA 3ZZCA 1JIRA 3FP8E 2JH6D 2BQ6B 2PGQB 3LH3A 3AVZA 3A7TA 1IHSH 4VGCC 2K7XA 3BEUA 2AEIH 1GBMA 2ODYB 1O3EA 3U8OH 2WPIS 1O2UA 4I8KA 3PTNA 2XC0A 2ZGHA 1W8BH 1WTHD 5GXPA 2BM2A 2CMYA 5DKMA 1DY9A 2ZU2A 1FONA 1PPFE 4A92A 1XXFA 1ZMJA 4AOQA 2P8OB 1BDAA 1EB1H 2Y5HA 1QRZA 2BD9A 2SFAA 4JZDH 3VXFH 2P3TB 4NIWA 4TWWA 2ZKSA 1PYTC 2QXHA 2QV1A 3BTEE 1P2KA 3KQEA 5EW1H 1UHBA 2FOMB 1GG6C 3MWIU 2FTLE 4FXGH 5I25A 7KMEH 1GBHA 1ESBA 1ZTKA 1C5WB 1Z6EA 2BX4A 1XUGA 1A0HB 1MKWK 1AFEH 3BTWE 4WMDA 1A3EH 2UUFB 6CHAB 1JMOH 5L2YH 1SLVB 4XBCA 1FIZA 2BY9X 2AERH 1L4DA 3QGJA 2JH5D 1ACBE 5A2MH 2TRMA 1FNIA 2ZPSA 3ODFA 4INLA 3LGUA 4IN1A 2ESTE 1UVUH 2GMTC 2FS8A 3ZYDA 1LMWB 1SGRE 2UWOA 1OWHA 5HGGA 4K60A 1A7SA 4HGCA 1OS8A 3LU9B 4AFQA 1TGSZ 1RS0A 2D2DA 2ASUB 2J92A 1HAPH 3TGIE 1P05A 1L4ZA 1D3QB 1GVZA 1T8MA 3SV6A 1ZSJA 1K1LA 5K0HA 1SLWB 2FLBH 1BTPA 2QXGA 1NU7B 1ZJDA 3U1IB 4K8YA 5EG4A 2WUCA 1KXAA 2SGEE 3F6UH 3STJA 1HIAB 1UTPA 1OWDA 1XX9A 4GCHF 4NIXA 4LXBH 1IQKA 1TX8A 3GCTF 1W3CA 4XFQA 2OUAA 2FI3E 2ZCKP 4Y8ZA 1GDQA 4BTTB 2ZWLH 3LJJA 5T6FA 1E37B 4XBBA 2O8LA 3HATH 3MU5A 2HRVA 3TK5A 1ABJH 1KXDA 3NK8A 2F83A 1OSSA 1QL9A 3BTDE 1O2HA 1VR1H 1TBQH 4GCHG 2P8OC 1GJBB 1ABIH 3RXMA 1EQ9A 3GCTG 3SI3H 1B0FA 4TWYA 1DITH 2FOCA 1WV7H 2BOKA 3RXRA 1YP9A 2O9QA 1WU1A 2G5VA 2LPRA 1GMHF 4FUDA 1C2MA 3P8OA 1NROH 2VWLA 2ZGXH 4FUGA 2ZHDA 3RXGA 1EX3A 1U6QA 1P3CA 2ZGJA 4ZUHA 3GY5A 4IC5A 1QQUA 1V2QT 1TALA 2G5NA 2IN2A 5E0HA 3D49H 6CHAC 2XBVA 1MUEB 2SGAA 4DURA 2IOTA 3QGNB 3CENA 3T28A 3TNSA 4FUFA 4Z6AH 1Z8JB 2STBE 5ABWA 2HOBA 1IQEA 3A89A 3ZVEA 3MH6A 2QXJA 2ZGBH 1W7GH 1GHXH 3SV9A 3ZZ8A 5HM9A 1Z8RA 1O30A 3V12A 2ZGCA 1V2JT 3SNAA 4OS7A 1YM0A 3URCA 1CA0B 4JK6A 3TH3H 5TJXA 2XYAA 1MMJN 1PJPA 3A8BA 1TYNA 2J9NA 1P9UA 1X7AC 1PPZA 3A84A 1A5IA 1BMLA 8LPRA 2FOEA 4YM9A 2DE9A 5EPNA 4B1TA 1HAVA 1BCUH 3F68H 2Z9LA 5F8XA 3OTJE 1QL7A 1O2PA 1O3JA 2CHAC 1P2NA 1LKBA 3OSYA 3ZZAA 4R0IA 3PMBB 3TNTA 1AUJA 2ZFSA 1HNEE 3D62A 2NWNA 4ABBA 1ZOMA 3MNXA 1GI5A 1YC0A 4ABAA 2F91A 1MTSA 1DPOA 1V2MT 1S5SA 1UTJA 3IG6B 3UNQA 1V2ST 1O38A 3NCLA 4UE7H 3CS7A 1O33A 1KLIH 2QYIA 1RRKA 1T8OA 3RXPA 1W12U 1GBLA 1KLTA 1KXFA 2Z7FE 3BG8A 4NA9H 4AZ2B 1ZR0A 5J4QA 2O8TA 4FU7A 1JIMA 1TGNA 2HNTF 1B7XB 3B23B 2BOHB 3P8GA 3GYMA 1QY6A 1O35A 3NUMA 3CS0A 1YLCA 2A4QA 2H9EH 2PTNA 3ZVFA 4J2YB 4X1QU 4Y71A 4AFUA 4WY3A 2ZZUH 1HAVB 3PLKA 1EKBB 3A85A 1CBWB 3BTGE 4AG1A 3OU0A 1QURH 1GBDA 4D7FA 3E0PB 3N7OA 1V2PT 3A8DA 5FPSA 3RXAA 1GI3A 1J14A 2Y81A 4X2XA 2XNIA 3FVFB 2ODQA 1O5GH 3UPEA 1S83A 1CA0C 3TH4H 5L6NH 1F2SE 1QBNA 1Y3VA 2V3HH 2AGIX 1C4U2 3RXKA 2GT7A 4AGJA 1FLEE 2FDAA 4IN2A 2ZU4A 4XE4A 5A0AE 4JYTA 1BMNH 3A7VA 1J9CH 3P92A 3PMAB 1PYTD 2Y7XA 3RXOA 4NWKA 3NWUA 1TABE 2ZHQH 4O97A 5FCKA 3AW0A 1N1LA 2VINA 1E36B 1GHAF 1KSNA 2A4RA 1CT4E 2HGTH 3MTYA 1ZGIA 2FXRA 3NXPA 3I78A 1GBIA 2ODPA 4DJZB 1V2RT 8GCHF 1Y5UT 5GPIB 5DG6A 2R9PA 3ATIA 4O03A 1Q2WA 3KIDU 2ZP0H 3MNBA 4ISHH 3RXVA 2Z9IA 4WH6A 8ESTE 1GHAG 2VIOA 1UVTH 2V6NA 2BDYA 1S81A 1LHFH 2WPMS 3LJOA 9ESTA 3ZZ7A 3KQBA 1H8DH 1DFPA 1GI0A 4Y76A 1DWEH 2PHBA 4X6NA 1C2JA 2BZ6H 2FEQH 2FLRH 1Z8GA 1PPHE 1OWIA 1QHRB 3RXQA 4HFPB 2WPHS 1IQGA 3RXUA 5H4IB 1KDQA 3MU8A 4K1SA 1EP6A 2NU2E 1O2XA 2W7UA 5EXLA 1TQ7B 2BY7X 3BTTE 1QBVH 4TPYA 1HJ8A 1YCPM 1GJ5H 3F9EA 2XWBI 4MG3A 3LC3A 1CBWC 1DXWA 1RIWB 1QRXA 3QZRA 1C4Y2 1XM1A 5GCHF 1AGJA 3P17H 4CH8B 3K9XB 4KTCA 3SNEA 2BB4A 1SQTA 3ZVBA 2G4UA 3LIWA 5JB8S 1UK3A 4JYVH 1GHWH 3DUXH 3KQCA 1FY4A 2FI5E 1GMDF 3RLWH 1NESE 1GJ8B 3ATMA 3Q00A 5LPFA 4M7GA 1SQOA 3SQEE 3E8LA 2B7DH 1YBWA 4Q7XA 1EATA 1Q3XA 5GCHG 5E2OA 4YLQH 1AZ8A 2BLOA 4O3UA 1TA2A 3DA9B 1Y3WA 1BOQA 3QX5H 4DY7B 1EJNA 1HBTH 1K1PA 1QA0A 1GMDG 1O3DA 5DK1A 2Z3DA 1P03A 1TB6H 3UR6A 2P95A 1LPZB 1KDQB 4YZUA 2YOLA 4UFDH 1WOFA 2ANKH 1SGNE 4E06H 4GSOA 1EUFA 1C1TA 1G3BA 2A7CA 3A81A 3V13A 1TQ0B 2AFQB 4TYDA 2C93B 5HMAA 4FU8A 2WUBA 3TJUA 4YESB 3FZDA 1EZUC 3M3VA 3ZZ5A 5IDKA 2GZ7A 2GTBA 1H8IH 1P0SH 1O2LA 2NU4E 1ARCA 4JCNA 4BAOB 1VGCC 1ZTLA 4MLFB 1K1OA 1BT7A 2VIWA 1FY1A 1O3BA 4HI3A 2TBSA 1NY22 1A3BH 2H9HA 2ZO3H 3RMNH 3A82A 1C2IA 3M5LA 4ISNA 4K1TA 2C90B 2R2WU 1O2TA 1OOKB 1BHXB 1IQNA 1JWTA 4JK5A 5EPYA 1LVOA 3KL6A 3P8NA 2ZTZA 4D9RA 1HXEH 1YCPH 1VITH 1O2QA 1EASA 3OYPA 3QLPH 1LDTT 1C5VA 3DFLA 3Q3XA 2WINI 3ITIA 2RCEA 3M3SA 2SNWA 3LOXA 3SORA 4SGAE 1CA8B 1HGTH 1C5YB 4IC6A 3GY3A 1RIWC 1GBTA 3QTOH 1AVXA 2BQ7B 1TGTA 3SHAH 1XKBC 2XCFA 2OTVA 2TGDA 5T3HA 1MKXH 1BMMH 2F9BH 1JXPA 2VGCC 4JZ1A 4NA8A 4FVBA 4F4OC 4PROA 3UNRA 1JRTA 4R8TB 5DP8A 1TOCB 3TJOA 2HPQH 3DD2H 3W94A 1O2IA 2P93A 2RG3A 1QB6A 1NRSH 3SV7A 3M37A 2P3UB 1B5GH 2QCYA 1SPJA 1F5KU 3E16B 2BD4A 1GJDB 1C5LH 1F0TA 1AVGH 4E7NA 1UTQA 3PWBA 1TBRH 2PR3A 2SGDE 3LT3A 1P57B 1AO5A 3M3TA 1EZXC 1ESAA 1ZYOA 5JDUB 2FOBA 3HK6B 3OY6U 3UNSA 2Q6FA 2VIQA 5DO4H 2GZ9A 1SGEE 1KXBA 1F0SA 2GKVE 1LVMA 2PKAA 3G01A 3PWCA 2W3KA 4FUEA 3ZVDA 1QCPA 3GY4A 3RLYH 3AAUA 4K8BA 1BTXA 1HLTH 1H9IE 3O8RA 1KY9A 2VNTA 2PSYA 3H7TA 1GBBA 2GMTB 1BQYA 4BAHB 1BIOA 1C5PA 1SQAA 1WSSH 2UUYA 4CRGA 4D7GA 4OGXA 2UWLA 1JOUB 1G36A 3PB1E 4K1EA 1XMNB 1DWDH 1KLJH 2QF0A 1L2EA 3F9FA 2VIVA 1ESTA 4K5ZA 2P16A 3SU2A 2Y6TA 4CRCA 2QGRA 3LGIA 2VH0A 4OS5A 3RMLH 1GHBF 4H6TA 1FXYA 1TFXA 2H2ZA 4YLUA 2XBYA 5E8EH 3SU6A 1G2LA 1IQFA 3SNDA 5DP4A 1C1MA 2F9UA 2VB0A 4OS1A 4Q2KA 3STIA 3ELAH 5K7RA 3EE0B 1P2JA 3GISB 1H1BA 2ZHFH 3MMGA 2A2QH 1TBZH 1DE7H 2Q1JA 1O2SA 3BIVH 4K69A 4ZKSU 1EOLA 2PKAB 1G32B 1ZPBA 3OY5U 1D3DB 5JBAS 1BTWA 1L1GA 3RDZA 1MZAA 1O5DH 3GCOA 3MU4A 2GCHF 2ZECA 3E6PH 2ZFTA 2SGPE 1GI1A 1THPB 5PTPA 2ZA5A 3L3TA 2ZNKH 2YNBA 1FN8A 1UTOA 4FUIA 5LPRA 5F8TA 3UWJH 3PMJA 3PROA 4TPIZ 4ABDA 1PQ8A 1Y3UA 3SJOA 1H4WA 5DP9A 2GCHG 1J16A 1NC6A 1YPGH 1GBAA 1BHXF 6GCHF 1HIAA 4I8JA 3P70B 1ELEE 1SGCA 1F0RA 5AVDA 1GI4A 2OCVB 4X0WU 1IOEA 1OP8A 2A0QB 1C1VH 1ELVA 1NPMA 1K28D 2FMJA 1N6YA 3Q3KA 1LHEH 2G8TA 4AX9H 6GCHG 1DS2E 1FY5A 3RC6A 3TU7H 4B2CA 4X6MA 3U8TH 4NIVA 2ZU1A 4CRDA 1GI7B 2A5KA 4UONA 1OWKA 4JZIA 1O3KA 4THNH 3UFAA 3GOVB 1G30B 1TNKA 2GZ8A 1MZDA 2R3YA 3QO6A 1ARBA 1GMCF 2WYJA 2WV5A 4I8HA 4UFGH 1GI9B 1S0QA 1P2OA 3ZV8A 1T32A 1MTUA 2W3IA 3GY7A 4ZH8A 4J1YA 3TGKE 1ELBA 3O8DA 3K2UA 2Z3EA 2ANMH 1DUEA 1LPGB 1S0RA 3K65B 1P8VC 5FPYA 1W0YH 1SGPE 4GVUA 1GMCG 2CHAB 3SJ8A 2ZG0H 1ZHMA 2BVXH 1O2WA 1OP2A 1C2EA 3U1JB 1OX1A 1UJ1A 1MQ6A 1YPJH 3KQDA 2FTMA 1C2FA 2QN5T 1T7CA 1Q31A 3T29A 1PPEE 4I31A 3TPIZ 4GPGA 1ELCA 3SJ9A 3E1XB 1IQHA 3A88A 4UDWH 1QRWA 1V6DA 1TNHA 4WMEA 3MH4A 3BG4B 4K2YA 2GX4A 3MNSA 4X8UH 1O5CB 1D3PB 4F49A 1K1IA 2CF8H 2D1JA 4ABFA 5E0JA 2ZHWH 1UK2A 5E0GA 1RTLA 3FANA 2AGGX 2AIQA 5L30H 3TITA 1GVKB 3B9FH 1GJ4H 2FO9A 4CREA 4CBNA 4HZHA 3BN9A 2FYQA 4CRAA 1T8NA 2ZDAH 1XUFA 3RC4A 3KN2A 4Y7AA 4U32A 1AI8H 1GBEA 3D65E 4A1TA 1BJUA 1A4WH 3K6YA 2ZQ1A 3LGVA 3MU1A 3IWMA 1W7XH 1P11E 1CHGA 1GCDA 1NRNH 1ELTA 1GMHG 2QIQA 5CMXH 1HPGA 3BTHE 4AFZA 1NFXA 2C8XB 2FX4A 1Z8IB 5EOKA 1O2OA 2A4GA 3KHVA 2Z9GA 1TRYA 1FDPA 1TMUH 5JPMH 2G55A 1S82A 5SGAE 1Y8TA 5C5NA 2A5AA 3QUMP 2EI7A 5GJ4B 3ZV9A 3KNXA 1SGFG 1UTNA 3SUDA 1NZQH 3U8RH 4BTIB 1C5MD 3E0NB 3NKKA 1ZJKA 5F8ZA 1SR5C 5DP5A 1VJ9U 3U69H 2O8MA 3PYHA 1QBOA 3F9GA 2GT8A 4E05H 5FXLA 1GL1A 1VCPA 2BD5A 4KP0A 2O8UA 2GV6A 4XSKU 4YOGA 1MD8A 5AHGH 3UQOA 1EJAA 4FUHA 2HPPH 2OINA 2BTCE 2G52A 2Y80A 3SJKA 1D6RA 3QN7A 3R0FA 4GLYA 3UY9A 4ZKNU 1UCYH 1G37A 1O3MA 2OP9A 7GCHF 4E7RG 2FOAA 1AE8H 1SGTA 1DWBH 1TNJA 2ZPQA 1AFQB 4ISIH 4TY6A 4MPUA 1L1NA 4I8LA 3SU0A