3TNVA

Acylphosphatase with thermophilic surface and mesophilic core
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
90
Chain Sequence
AIVRVHYKIYGRVQGVGFRWSTQREGRKLGLNGWVRNLPDGSVEGVLEGDEERVEAMIGWLHQGPPLARVTRVEVKWEQPKGEKGFRIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
publication title Protein surface is a preferred site for thermostability engineering
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 25
structure length 90
sequence length 90
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2011-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tnvA00
1YJTA 1XBWA 3TOQA 2BYCA 2CRLA 2OD6A 2GA7A 1IUJA 2PGCA 4OJGA 2L3MA 2AJ0A 4Q2LA 5F0UA 2ASYA 3UDCA 1AW0A 1JK9B 2IFXA 2BJDA 2OAUA 2XMJA 1Q53A 4HL9A 1Q8LA 2RILA 1OSDA 3HX9A 1P8GA 2KT3A 2XMMA 4FNHA 1YJVA 4NPOA 2XMWA 2XMUA 2OFGX 4A48A 3BB5A 5B0CA 1FESA 1KVIA 2AW0A 2QIFA 1GXTA 2W4PA 1R6YA 3BDEA 3LGMA 1CC8A 4DPOA 1FE4A 5A6PA 2K7JA 4Y2KA 1SQEA 3BN7A 2K1RB 2FTRA 2KT2A 2N7YA 2Q3PA 1WD6A 5B0AA 1Y9OA 2XMTA 2K1RA 2IYIA 1TUVA 2QLXA 3KKFA 3K7RA 5B0GA 1FVQA 2ROPA 2VH7A 2ZDOA 3TRGA 1Q4RA 2OMOA 3HHLC 3HHLD 3LO3A 2W4CA 4F67A 4A47A 1S6UA 5B0DA 1CPZA 1MWZA 1CC7A 3HHLB 2FIUA 2HIQA 3T9NA 2N4CA 3HDSA 1OPZA 2IYGA 2GCFA 4U9RA 5F0WA 1LQ9A 5B09A 2PD1A 4Y2IA 3HFKA 3LGNA 3I9ZA 1YG0A 5T7LB 1Y3JA 2HLTA 4OIXA 2LQBA 1SB6A 1KQKA 2GGPB 4YDXA 1YRXA 2ROGA 2N4DA 2RSQA 5B0BA 1N5QA 2ACYA 5A6WA 1AFIA 1V3ZA 1MWYA 4HI2A 1TZ0A 1SI9A 2K7KA 3IWLA 5IXUA 2VV5A 4QOTA 2HQIA 2QYCA 4OJ1A 5B0FA 4DL0C 3CJKB 2OP5A 2JDJA 4HI1A 1ULRA 3KNGA 2EW9A 2OFHX 2OKQA 4A4JA 1P6TA 1GXUA 2ZDPA 5B08A 1FD8A 1N5TA 4ZOSA 3DCAA 1Q8BA 3IWXA 1TR0A 2ROEA 2GO8A 2FHMA 3WDOA 1FVSA 1X0PA 3QGPA 3TNVA 3HHLA 1TL4A 2LDIA 5K9FA 1YJRA 5KAKA 3MZIA 2RU9A 4Q2MA 2BBEA 2XMVA 2FB0A 2G9OA 3F44A 4FNIA 4EFAC 3BF4A 1S6OA 2KKHA 5T7LA 1VQYA 2HFNA 3MCSA 2GGPA 4ZA1A 1TL5A 3DXSX 4HH0A 4Y2MA 4OJHA 1OQ3A 1AFJA 1Y0HA 4NL5A 1JWWA 1URRA 2HLUA 3FMBA 3KG1A 3BM7A 2OD4A 2HFOA 2LXFA 2AJ1A 4OJ3A 3CJKA 2BJEA 1K0VA 3GZ7A 2W4DA 1W2IA 2GV1A 4A46A 1Y3KA 1X8DA 2BUNA 5B0EA 1FE0A 4DN9A 2K2PA 1N5SA 2LQ9A 3BGUA 2RMLA 3FRYA 1RJJA 3E8OA 1X7VA 2GFFA 1FEEA 1KVJA 3BR8A 4YEAA 1QUPA 3HF5A 1N5VA 1VQSA 3KG0A 1OQ6A 2KYZA 4HH1A 3VTIA 1U7LA 3FGVA 3QMQA 1YJUA 2QLWA 1APSA 2XMKA 2AP6A
chains in the Genus database with same CATH superfamily
1IJEB 2YKAA 5HI7A 3VR1A 1TFWA 4OHZA 3KLHA 5KFCA 5IWAJ 4X62F 1IKWB 4DG1B 1KQSR 3EPIA 5G0RB 2WTFA 3SBMA 2W24A 2FHOB 4ECTA 4DL3A 2P9EA 4OLOA 1SJ3P 4DSLA 2MZTA 2MKYA 3CJ3A 2PSZA 5T7LB 3KK1B 4B9NA 1TKXB 4HI2A 4M5MA 3DI6A 3CWJA 5HQLA 2XBPA 1B99A 1S77D 1VJWA 2GIQA 5J1PA 4GO5X 2HVZA 2PEHA 1IXKA 3HHLA 3M2UA 3F44A 1QDUB 4JI5J 4X65J 1RTHB 3D9BA 2ZH4A 2AYMA 3T6BA 4YB5A 1ZETA 3BGUA 2EFVA 3EGVA 1C1CA 3OTCA 3GTYX 1BY9A 4WCEQ 4OYXA 1WACA 2IRXA 2AP6A 2QV6A 2HHPA 1F0XA 4ILLA 1TQLA 4RW6B 2RS8A 1Q53A 3M2RA 3ZZRA 3HX9A 3NY0A 3C46A 1FD2A 3R6GB 4DR1F 2KT5A 4IFYA 3CCRS 5GADI 4ELUA 1D8ZA 1JLCB 3BKTA 1TP7A 3CE8A 2RDIA 1FRXA 2KU7A 2UUWA 5IV3A 3ZTQA 4I56A 2DY1A 3I0RB 2DRAA 1RWNB 1RU1A 2BOAA 2CNLB 3BGLA 3GU0A 4IO9Q 3J81j 3KNGA 2M2BA 3JQJA 5EUHA 1BE4A 2I9SA 2ZOMA 3WQPA 2DEJA 1CBKA 5A8KB 2RT3A 1U4BA 5KFJA 4J7CA 2IDEA 4OYPA 2IMOA 3PG9A 1QTNB 4RZRA 3PR5B 4NLTA 3S6EA 5AJ3F 4DHVA 1EB0A 3R5GA 1B70B 2ZE2A 1N8RT 4EYIB 3CCJS 3BR8A 2EG1A 5H9FK 2EKNA 3W66A 5HATA 1RE1B 1EAYC 5BJRA 2KJWA 1LWEA 5CA5A 4O44B 1REVB 3ILIA 5AXMA 2VG7B 1S1UA 2LMIA 4MKAA 4K2XA 2FJEB 5J2NB 4GKJJ 2XHCA 4JI7F 1FJGJ 2BZ2A 4RW9B 1HI0P 1CJVB 4NXNF 4TN2A 4Q43A 1FKOA 2KFYA 1XNQF 1IBMJ 2XEXA 1YZ7A 3MECA 4MIBA 2HIQA 2QL7B 4LFAF 5HVHA 3BQ2A 2Z57B 1PCAA 1E6YA 1FKPA 2OO4A 4P52A 4ECXA 2GVZB 2JOQA 5AE1A 4EUVA 3SDEA 4QR1A 4D3HA 1OS5A 1UA1A 3BGFA 4ECYA 1X4AA 2FLNA 3TA1A 4LR9A 4JV1A 4JI4J 3KMQA 1S9EB 5D8HB 3D1QA 2OEMA 1W7WA 3FZ2A 3W9IA 5J1EA 1S1TB 3MMAA 4LVOP 2DR8A 1ZBTA 3MFIA 4NLPA 5IM0A 4HH1A 1NM2A 3OHAA 3V2UC 3T5HA 4TVAB 1YJTA 4GRSA 5K14A 2DGUA 1MLAA 3PW7A 3ONQA 2G0JA 3GSDA 2Z2LA 4RLEA 4OX9J 4NLOA 5I3QA 3GIJA 2FVPA 1XR5A 4MK8A 3UPFA 3GWCA 5L38A 3EYZA 1SPBP 2CJYB 2YKMA 1SUQA 2CQGA 3FK4A 4M1KA 2XNRA 1CJTA 4OZLA 6AT1B 3KWMA 1RT4B 4DLGA 2F9JA 3PDNA 3UVJB 1SJQA 4KRWA 1S0MA 1N0VC 3EZ5A 3OLBA 2MZ1A 1P6TA 4NLGA 1MN7A 4LREA 4LF4F 2V94A 2UUAJ 2VG5B 3RBEA 1TL5A 3BV8A 2YNIB 1R8PA 3MFHA 4NL5A 4QWBA 4DUZF 1MU2A 3KLEB 1QSSA 3KXDA 2AJ1A 1R0BG 2M88A 3MMCA 4F0HA 4ZITA 1UEUA 4PG7A 2XCPA 2J8SA 3HF5A 3CD0A 3M8ZA 3ETMA 3BZQA 4UUXA 1Z2LA 1WORA 4NOHA 1T11A 1SCJB 1FRIA 2QA4S 3IS9A 4NWBA 3IR6B 4OHVA 4FPIA 4F0MA 3AHPA 1FTCA 5C42A 3MMBA 3BSCA 3OR1B 4J5OA 2YQ0A 2WOMA 3PO5A 3R5JB 2R2RA 2BE7D 2M4MA 3LWLA 1NKCA 3TJAA 1EZZB 1HNZF 1RWOB 3LUYA 1S0NA 2C2DA 3LP0B 3FNNA 2FLLA 4JI2F 3AH6A 4UTGA 1S7HA 2A2DA 4OI6A 4KO0A 3JAMU 2XYHB 5LL6d 7FDRA 3HVWA 4Y6IA 4M95A 1TUWA 1GK8A 2J6UA 4LSLB 4HDHA 4RNNA 1YSJA 5CXTA 1QSYA 2K3KA 3EZUA 4WXWA 4DFKA 4FS2A 4WE1B 4H4MB 3MAAA 1YJ9S 2W9AA 1FRLA 4ZVHA 1KLMA 3NGSA 4PG4A 4YDDB 4HHHA 1R8CA 2MGZA 4ED1A 2J6TA 3EGWB 2QZ8A 2W4PA 1F6TA 1KTQA 1GTEA 2ZD1B 1PIEA 1WTFA 4ID5A 1YWXA 1JLQB 2Y1RI 4ZCKA 2V68A 3QJPA 4FF3A 1JXEA 4P2XA 2UV8G 2M0GB 4RBTA 4LRCA 4C97A 3QT7A 4EGLA 1F2HA 4OYIA 1T8EA 5EX0A 4RBVA 1UTAA 1RWXB 1WHWA 1KKHA 1CS4A 3NOCA 2FHMA 3M6VA 4RW7A 3QWPA 3G8SA 5DDPC 2IHR1 2CNNB 4DL2A 2CQ1A 1LW2A 2MXYA 2IC3A 4DXLA 5IT9U 3DRPB 4TNOA 1MMLA 2KHCA 1BWVA 1N5SA 4ETXA 2BJ3A 4OI2A 3M32A 2N3OA 2HURA 5AT1B 4NLRA 2BJDA 2IIHA 3N5FA 3MM5B 2NQPA 1FESA 1WC1A 1ZPWX 4EZ6A 2A0FB 2VFTA 2R8KA 1FT8A 4TLQA 2JC0A 2C1EB 4B3OB 4ELTA 3G6YA 2VFVA 5HAOA 1D8YA 4I4BA 4WKYA 4ICLB 3M2VB 3ICLA 4KPYA 5A2QU 2HW3A 4HI1A 1Q95G 1MROB 1KS2A 4WIQA 1PYSB 3IM8A 1R89A 2RVJA 4FBTA 3Q23A 2JRSA 4TYBA 3HJVA 4O23A 4ED4A 3LTOA 5DJBA 1HHTP 5DM6Q 5CYQB 1DRZA 3PJ9A 3WC2A 3W7BA 3M4XA 2LXFA 1HBNA 3THPA 5GADU 3M9MB 2DPIA 3DLEA 2AD9A 5L8RC 1FI4A 1BUXA 1T9TA 1VISA 5M2UA 1S72S 1I94F 2H5EA 2ZH8A 2WONB 4Z37A 4ETZA 1OWXA 1UVNA 1WI8A 3H25A 4IG0A 3AAWB 3KOAA 3PFEA 2HNZB 1JMTA 3OPKA 4JBCA 3D6FB 3GQCA 1BXNA 2IJFA 3HHLD 4DV0J 4ECUA 1LKZA 4FN5A 1NDCA 1NH8A 3C15A 3ZZYA 1KQKA 1DY3A 1A9NB 1SKWA 3H5YA 1NZ8A 1R0AB 2K7KA 1A7GE 3C6UA 1HIYA 2UP1A 1IR2A 2W2OP 1PJ6A 3G96A 1UMJA 1F5CA 1NXIA 1PG5B 3M8SA 1XIQA 3HK2A 5F3ZA 4EO6A 3FEYB 1NK0A 2BJ8A 1OPIA 3LWMA 4FS1A 3FBBA 1UWAA 3CCUS 3C6TA 1EP4A 2BM1A 4AXIA 5K8NA 3R5CA 1S1VA 4PQUB 5M2RA 5CZVA 3FCVA 2IBKA 1VBZA 2KFZA 3CJTA 1OY9A 3OR2A 2KDOA 4IFVA 1V9OA 3H40A 2E5LJ 1Q8LA 4ZVGA 2VA3A 2RHQB 5LMUF 4JV2A 3AJ1A 4RNOA 3I82A 4GMKA 3VGUA 4LF8J 4J9KA 2CUYA 3KHHA 1DAXA 4USJC 5K8PA 5ETMA 1CPZA 4C48A 3A4TA 3Q2SC 3CJ8A 1VRTA 2XHWA 3HHKA 1T03A 3KK2A 1RWPB 1RADB 1RXOB 2E66A 5A6WA 3IFEA 2XSJB 4P7VA 2BQRA 2HGNA 4WPAA 2YVSA 3IAS9 3J7ZT 4FP9A 3CD7A 1SIZA 3BQ0A 3JTNA 3BH7B 1XN9A 5BYSA 3TANA 1RGVA 1JJCB 4WFZA 3DDNA 1C4CA 4NEYA 2M3DA 3R1HA 3CCES 3O2IA 2XO6A 2B5JA 2JFKA 1Y00A 3T5KA 4XIUA 4WXOA 2MZRA 3EWGA 1FRHA 4KGKA 3L7OA 1O8BA 4C0BA 5HLFB 1U24A 3EGNA 1GMVA 4B3TF 2XMMA 3BN4A 2JEJA 5HVGA 3MM6A 3NAHA 3D2WA 4LF1A 4J9PA 1N6QA 1FVQA 2P2CB 2VG6B 2KZZA 4YHHJ 1IM4A 3GV7B 3A8KA 4IQMA 3FBFA 1RZMA 1HBOA 4WZMA 1SJFA 4F3QA 5HQMA 2BDPA 3FC9A 1HMVA 4EBDA 4M94A 1MWYA 4H54A 3T1HF 1BQNA 2Q6CA 5IS2A 2VBWA 3OUYB 4V19J 5HJYA 2XLIA 3PW0A 2B0GA 1RT2B 1Q78A 4ZMMA 2PI5A 4BLGA 4QIEA 1IKYA 4IR1A 2G2YA 1L3SA 1T9YA 2Y0SD 1HD0A 3OTOJ 3IGNA 3JS9A 2GJFA 2GHPA 1WKJA 2CWXA 3A3OB 2MKKA 3UDCA 2UXDF 2CNOB 4NX9A 1WUUA 2XMJA 3LAKA 4CO2A 4OI4A 4HHUA 1JXLA 2EBEA 5FLXU 4FNHA 4G6VB 2OPPA 2CIMA 5B0CA 1S6QA 2Q1LA 1BWEA 4E2FB 5KFRA 3R1LA 4PPDA 2MQLA 1WJ9A 4DF4A 3SEOA 5KG3A 2F40A 2H4WB 4ECRA 5IT0A 5CD4A 1O0PA 1U1PA 1LK5A 4DPXA 2OHDA 1KWMA 2WVFA 1FNOA 3M6UA 2EFNA 4NI2B 1N34F 3GIIA 4B9TA 2HHHF 3LALA 1WF0A 4NYPA 2A2CA 1AROP 2NXNA 2P6SA 3ZNUA 2QLFB 2O01C 1NSKL 4EWTA 1U8SA 3OD2A 4KFBA 4QIVA 2H48B 3GG0A 3V4IB 3AOBA 3BKFA 4ZPDA 1TVRB 3ENWA 4LMZA 3GILA 1YI2S 2HVHA 1IKWA 3UCZP 5IC6B 4NLQA 1CG2A 1UVIA 3A3PB 1YGYA 1WNEA 4BS2A 2C3UA 4NA1A 3AXMA 3O1LA 2D3O1 4P7TA 2ZUGA 2CQIA 3B78A 4Y2AA 5CYMA 1JKHB 3KK1A 2FGCA 1YVFA 3PTWA 2YNHB 4ZPAA 1WKKA 5DQHA 3K8WA 3KFWX 3DRYA 1H6KX 5IOLA 1YLXA 3K59A 5KAKA 1KNZA 1S1XB 2RHSB 2C28A 2Y1IA 3DOLB 1DLOB 2MSTA 2Z2YB 2JEIA 4LUBA 3T1YF 3TUPA 2MMYA 4YEAA 4JV5J 1JLFB 2E5IA 3G82B 1FEHA 2JVRA 3GJTB 2G0CA 2DR5A 2KL8A 4DCJB 4C8OA 4ZJQA 3WX8A 4P10A 2XMUA 4Q45A 3W5YA 2QTWA 4ZHRA 2VDHA 2X3GA 4P74A 4NCBA 3OVSA 1P1LA 2J0SD 3M8WA 2OMOA 1JLCA 2G1HA 2YTCA 4B3SJ 4I6YA 2BA9A 2RKIA 2XY5A 2GCFA 4OV1A 4FVCA 4OX6A 3I0RA 1Q7LB 3GCXP 3A13A 1OYEA 4HTIA 1I51B 1PSDA 4ZIVA 3TZXA 1B0TA 4EO8A 3FBEA 2OKQA 2AEFA 4GC6A 1S6PA 4O0NA 1WI6A 1TR0A 1XK8A 4OZ1A 3V6DB 4DU8A 2QMWA 5LXYA 3B6BA 4FKXA 2AV5A 2JHEA 4LBPA 2CZ4A 2XWXA 2YXLA 2JX2A 2JC1A 3D0IE 4GC7A 4E8UA 3HD1A 4E98A 2A3JA 5LXRA 3SIPB 2MHEA 3DOMA 1N88A 3FSYA 4Y28C 3M1VA 1FA0A 1NDPA 1IUJA 2B9YA 5I42B 4Q7AA 2OIHA 2KFNA 1TELA 4IOCQ 2HNDB 1LWCB 3MPWA 4RKUC 1IKXB 3J81Y 1HQEB 5KFLA 4ED2A 3PV8A 1T3NA 4LQ3A 2MZSA 2QC3A 5F9LA 2FY1A 4XK8C 2V5HG 2HZCA 1PJ7A 1NPPA 2BE2B 2XY6A 3J80Y 5HJXA 1Y5IB 4PWDA 3PRVA 2CQ4A 2L9WA 5IXUA 3MR5A 1NCLA 5A8WA 1GX5A 4YFUA 3CVKA 3TI0A 3DRSA 4R8UB 3MHYA 3Q8YA 4RUHA 4TU8A 2VL1A 1K1QA 6FD1A 3UD5A 3EDRB 2HGMA 1RA6A 1QJHA 4OI3A 3G6VA 2AGPA 2LQ9A 1T05B 1SC4B 2YH1A 3LP2A 3F73A 1R0CB 3FGVA 4ED3A 3A12A 1A6LA 1ZM2A 3CC7S 4WTYA 4ZPVR 3P5TL 1IBKF 2C2ZB 2EKYA 3DKDA 3W9HA 3D3BJ 1U6ZA 1MSWD 1TAQA 1J5OB 2FUG9 1RCXB 3CO0P 2ZC4A 2R9LA 1G1XA 1N0UA 4NZ0A 2VOOA 4X62J 3G6ES 4DF8A 1LNQA 4L6V3 3IBFB 1VQLS 2JWNA 3TO8A 3BJYA 4TYAA 3NCQA 1TKTB 3M7VA 4CIOA 2DGVA 1RT6B 1N4LA 1DBDA 2J5AA 2UUTA 3WDOA 3HP6A 1NKBA 4A8WA 1UKUA 1ZOTA 3ADAC 3PX0A 2CQ2A 4ZP7A 4QBUA 2YWGA 4QIGA 2OPSB 3Q86A 5FD1A 3I96A 5LSLA 2YNIA 2BW2A 4F4WA 3AB4B 4LRFA 1IR0A 2F1FA 2H65B 3FJ2A 2FHJA 1S97A 3GLJA 2YX4A 3F0NA 1Q1KA 4J9OA 1F9HA 4X4PA 5ETTA 4X66F 2E7XA 1OYDA 2MLZA 1RHMB 2B7CB 4DLEA 2NXEA 3RW7A 2FZGB 2OELA 3AQPA 3CC2S 1TAUA 3O3LA 2MZQA 1HI8A 1SIWB 2E1MC 4WU3A 4NA2A 2MZJA 1NSPA 4NRUA 4ZP8A 1VQKS 3AD7C 2C22A 3OR1A 2VFUA 4AQYJ 2NXCA 2LQ8A 4B9MA 5JUMA 4DR1J 4DSFA 4HT7A 1LWXA 2RSQA 2YX1A 3MF5A 4U8YA 1SVDA 2J7WA 4V1Ak 3QAEA 1QE1B 5AXLA 2BBEA 3MM7A 1KRPA 2LQJA 2VU5A 4NMXA 2Y3YA 4ERDA 1CQMA 1U0HA 3FSXA 3DHWC 1S9FA 3GFXA 3KG0A 5AJ3J 4P71A 3OXGA 3R5AA 1JJ4A 4H4OA 1T95A 2RRBA 3VHQA 2WVDA 1XTZA 2CQBA 3CCSS 2IVFB 1S57A 3H20A 4Q8FA 2XGPA 2BRKA 1S1WB 4ECSA 1JLQA 3B82A 3IM9A 3HHLB 5KFFA 4YQWA 3M2UB 3R3TA 4A8MP 2W9BA 1FFGB 3K0JA 4JI7J 5A8RB 3OV7A 4B3MF 2B9EA 4NXNJ 2KZMA 1XNQJ 4K4XA 1FERA 1C1CB 1NPRA 4LFAJ 3R97A 3POTA 3JSMB 1KFSA 3PW5A 2HVIA 3CJ0A 3CNQP 1NB7A 4O4RA 4KAIA 5J2MB 4U95A 3IWNC 1X4EA 3M2RB 4GVBA 5JJBA 1H38A 2E5JA 5GAEI 1T94A 2H9ZA 3GMGA 3FDSA 2HYIB 4JB8B 4UZCA 3JQKA 2V4JA 4IFYB 4UY8T 4F2RA 3QGIA 3HO1A 1XBWA 1ZM4A 2AGOA 4U96A 3U1MA 3MEEB 4DSIA 4WBFA 2KRBA 1FHTA 2PO4A 2PA8D 4RNMA 2GMHA 4NPOA 3OJSA 4XAKA 1FXRA 2Q3PA 3TUZC 2HGLA 3FBCA 2BJ7A 3EM1A 4B3OA 4G1IA 1V3RA 1RAJA 4WIIA 3I5CA 4IG3A 2PMHA 1UL3A 4ICLA 2DCUB 3M2VA 4O3RA 2FZCB 2VA2A 4CO0A 5K20B 3MURP 1R31A 2ZE2B 3ENAA 2FVQA 2ZBRA 3VAFA 2RQMA 3V4MA 5A76A 2XMVA 2OEJA 2GGPA 4EI2A 3HPOA 4IH7A 1OQ3A 5CYQA 3L9ZA 4C9DA 2KG0A 1VMBA 4DL4A 2W7AA 1S1UB 2VIHA 4LF4J 2YKQA 2J9EA 2PDAA 3MOJB 4ZCMA 1KFDA 4ES2A 4JYAF 3P3DA 8ATCB 1L3TA 3BPDA 2CPXA 4K59A 4DUZJ 1FKOB 2NLWA 2CFXA 2G4BA 3IN5A 3H5UA 1UJ5A 4BWJA 4HL9A 4LF6F 1WKLA 1OMSA 4DV2F 3Q24A 1E6YB 3LGMA 5IQ6A 4ZDNA 2ZH5A 1KEKA 3JQMA 3HT3A 3SDEB 3T6JA 1G7CB 2XB2D 4KQZA 1RAEB 1VBYA 2J8AA 1XR6A 1LQ9A 1ZA2B 1QAXA 1N5QA 1O51A 4LIWA 2YX7A 3KUEA 1UW9A 4N8NA 2O3DA 5J1EB 2LU1A 1WG4A 3TZYA 1GXUA 4YB7A 3W8PA 2AX1A 3DLKB 5IM0B 3RB0A 2JFDA 5GMEA 1HNZJ 3Q0AA 4LJMA 2DEIA 4URQU 1WWHA 3DRXA 3QPIA 1HNXF 5K14B 1GEHA 3UCUP 4MK7A 3Q8SB 4JI2J 2JLEA 4DBQA 2O5DA 1I1GA 3BSNA 2C3OA 3MTKA 2V4RA 4UW2A 3HI9A 1R8AA 4YY3F 3KDNA 4FPRA 2KXHA 4PQUA 1U7LA 5LT5A 4K5SA 3NOGA 2JH3A 4P9SA 5E3AA 1VBKA 4ZVRB 1SUQB 3E51A 4YUDA 3R9LA 2W7OA 3DC2A 1UWBB 1RHQB 1PYTA 3GJSB 3ZC4A 3DRRB 2PMZD 2N82B 3K57A 3C66A 4I67A 1T3OA 3PCOB 1RHRB 2YNGA 4KIAA 3KLFA 2HLTA 5B0BA 3Q8PB 1RBAA 5KFNA 5KT4A 1MU2B 2X1AA 3MMCB 2G2OA 1YDLA 4BC9A 1XMOF 3QSIA 2J0QD 5KOWA 2W8KA 4PR6A 1D0EA 5GVQA 4ZA1A 3S8SA 3DXSX 1B0VA 1RTJA 2CXEA 3HVRA 1KTVA 2HS0A 4J9VA 3BQ1A 5KG1A 3GB0A 3IS9B 4K50A 2ZC3A 1GMUA 5E3CA 2C2RA 4K2JA 4CH0S 3ZZUA 3HCXA 3MMBB 4C8NA 1QSLA 2WOMB 2CRLA 2OD6A 4F26A 2QL9B 2KYXA 4ZLLA 4BWMA 4TKTA 3TUIC 1RWVB 1CSJA 2XZWA 3NNCA 1M5HA 2YWWA 4ZP9A 5KFVA 4Q44A 2DHXA 5A6PA 1CC8A 2CPJA 5B0GA 3G9CA 4UOCA 3OTBA 1HFEL 1KVKA 4JP8A 3TAPA 3J7Z5 2MKSA 1NHUA 2AT1B 5D0HA 1Y5LB 4A4JA 2HHTA 3TEGA 1M5VC 1RAIB 1VQ6S 4DV3F 3MAAB 3C19A 1QUVA 1HQUB 2XZDB 1K8AT 4FNIA 3OUYA 1ZTTA 2AZ1A 1KLMB 2VBXA 3ISNC 2Y1LB 3GIMA 3CMAS 2MGZB 2HHQA 3HSDA 2W8LA 3ZXWA 2CG4A 4USHA 2R7RA 1WEZA 4U7UD 5KG5A 4ID5B 5DQIA 5AXKA 1R6VA 4D3GA 1F3VA 1NAQA 2CADA 2PE8A 2WVCA 5KFGA 1HI1A 1DQAA 2U1AA 4ECWA 5EX3A 1SC3B 4FKYA 1RP5A 2EC2A 2QIFA 3TQ1A 4DPOA 3VALA 4OX8A 2M5YA 3FFIA 4DX8H 3CDWA 1H73A 1I94J 1CS4B 1GH8A 3I6PA 4F67A 1SKRA 4RW7B 3PZPA 3ISZA 1IBLF 2NREA 3QJJA 5L1LA 1KD1T 1LW2B 2D69A 2IC3B 3EPGA 5ETRA 1K1SA 3MM8A 4EMDA 1K44A 2FHJD 2AJFE 3OQ2A 1FD8A 2Z30B 2DR9A 1UEVA 3IMQJ 1X0PA 5K9FA 1URNA 3C16B 1RTIA 3PRDA 2AX0A 4NI2A 3MUVP 2A6OA 1FDBA 4CNZA 3HHNB 2DISA 3ELHA 4X84A 1SXLA 3RUBL 5HQ8A 4B9SA 1JLAA 3OLAA 5DRKA 4DPYA 5D6GA 2MTLA 2C2MB 4ZJLA 1TVRA 2NR0A 2WVEA 5EWEA 1T9UA 3M8PA 2VC0A 3K8VA 4CLWA 3EZOA 5L9XA 2F65A 5D4NA 2CVIA 1F5AA 3BN7A 2G2ZA 1HWUA 3M8YA 3UFCX 2AEJA 3QNWB 4ZVOB 3EE3A 4C2MA 1T02A 2C2OB 5LMUJ 1Y3JA 1ZYQA 1MG7A 3M6XA 5GAEU 4UUWA 1TKDA 4LBIA 5F8MA 3QT5A 2A6MA 1TV6A 4B9UA 2YNHA 4RW4A 4J9QA 1RB0A 2E1RA 4NCAA 1CLFA 3K5PA 2P5VA 2V8DA 2AYBA 2HRYA 1HHQA 3HZEA 3QO9A 3TX8A 4PABA 1HWLA 3PACA 3KLIB 1VDHA 2Z58B 1W2IA 5B7WA 1VJQA 3IBCB 3PW4A 1XMQF 1BD6A 3MM9A 1VQSA 4G1QB 3TARA 1JLFA 3G82A 5D15A 1VQNS 3OFEA 1N52B 4RNFA 3C15B 4RU9A 4IQXA 1SH2A 1BLUA 5ETVA 1JXVA 4MKBA 5I4MA 4DFPA 3BB5A 1AB8A 1PJ5A 3ZZPA 1HBMB 4ECVA 2FVCA 1X60A 1XNRF 1ROFA 4OZ2A 4B3TJ 1X5OA 2HAFA 1LWFA 1UVLA 4LFCF 3DDKA 4NXMF 3BS9A 2FD2A 3BO2A 4GKKF 4IDKA 4Y65A 3MMJA 4ZPWR 1KQGB 1S12A 5C7PA 4DS4A 5IT4A 4RX6A 1DQ9A 4K7QA 1EP4B 4K4ZA 4CLTA 2ERRA 1PGZA 1WC4A 3V6DA 3OR2B 3KYLA 4IFVB 3VV2B 4K4TA 3T1HJ 2V67A 4KB7A 2VQFF 1C0UB 1FJCA 1VI7A 3N5BA 2J0WA 5D4OA 1UVMA 3BEGB 1AUDA 1M0SA 4JI8F 3X3UA 2HFVA 2ASYA 4H4KC 4CLKA 1YRTA 1T03B 3KK2B 2DNLA 1LWCA 2UVWA 2GVDA 3MUMP 1CULB 2IPOB 2FLOA 1TK8A 2UXDJ 4AXJA 1VIOA 5ETQA 4UQTA 2YQ3A 3PNIA 1NK4A 3SQGB 4XDCA 2BE2A 3GCWP 2OPRA 4TQRA 4I68A 1RWUA 1EKSA 1Q5YA 1Q16B 4KR0B 1JJ2R 4GVLA 2H3EB 4QR2A 1HLWA 3PXGa 1XWLA 3Q8VA 2NYIA 4R8UA 1UFLA 4CLSA 2B5JB 1JX4A 2ZHAA 4KC5A 4P72A 4FYXB 2NPFA 5E2QA 4Q2MA 3OSNA 5CAAA 5FJ4A 2R7XA 1BGXT 1ZM3A 2PA3A 1DHMA 1OO0B 3EUNA 1VLOA 4X4QA 3TVKA 4R0JA 2KVQE 4X64F 2GV1A 4NRTA 1GX6A 4I7FA 3W63A 3N6LA 3MM6B 4Y34A 1HYSA 2W9CA 1T05A 4I1TA 1APSA 4OHXA 1N6QB 3M9OB 1N34J 5E5NA 5K8MA 2HHHJ 3UDLA 1O5JA 2WW4A 1RISA 5SUHA 3KDOA 5LJ3Y 1HBOB 1M90T 1UFWA 3RRKA 4KBIA 4U7UK 1BQNB 1TUVA 2E7WA 3VVTA 4NYOA 2VH7A 1J5OA 3ZZTA 1YHQS 1T9VA 4K4UA 4F3OA 3RB3A 1CC7A 4U67Q 2UV8A 3JSRA 4ITSA 2BACA 4PZVA 3SCJE 4UF4A 1QM9A 2CJXB 4CO1A 2ALZA 4RUBA 2HRUA 2DKOB 3EXCX 1VIXA 3LAMA 1RT6A 1X4CA 1IKYB 4ES3A 3W1YC 5ETLA 3FRZA 3IC1A 4X4VA 3DXBA 5D0RA 1GMWA 2RE1A 3F41A 1RT3B 3RZAA 3IRXA 3RRGA 2UXCF 5KG2A 2MHNA 4DU7A 4RNHA 4DPTA 2OPPB 2BQUA 3RBXA 1S6QB 2O66A 1FWLA 4N41A 1RLDA 5IZHA 3T1YJ 3BBBA 4ZKAA 3GP9A 1FFWB 3GFYA 2ATLA 3RU0A 1YZ6A 3HFVA 2H4YB 2F3JA 4HR2A 5EN1A 1WSVA 3KKFA 3C14B 1HNWF 1NDKA 2D74B 2D41A 4DV7F 3V6JA 4RU2A 4G3IA 4DMZA 5KT3A 3QATA 4ZLPA 4HHJA 2M70A 5I3UA 5CZXA 4EBCA 3CULA 2YH0A 3PHTA 5F8GA 5HP1A 1LFPA 4RPFA 5H9EJ 1VGYA 4P6QA 3H7HB 3H5XA 3LPYA 1CJKA 3PIOQ 3P8BB 2DJWA 2LQ5A 4KFBB 2MQ8A 3D6HB 1AZSA 3NKYA 5HROB 1U2RA 3HVAA 1JB0C 4URSA 2KO1A 3J7YI 4Y0FA 4PXDA 3BM7A 1XMBA 2HFOA 2F8MA 4A8XA 3WC0A 4Q0BA 2I2YA 4F8RA 1NK9A 3UR0A 3QBCA 3K58A 2ZKTA 5ETKA 5EGYA 4DV5F 1HWJA 2APOA 1FNMA 1SV5A 5CYMB 3V81A 5CCMA 2COLA 4XTTA 3OFGA 1JLEA 1RU2A 3CJ5A 2OUGA 2ZJPQ 3H98A 3QFWA 4OHWA 1QVGR 4K4YA 4ATNA 4F36A 1WC6A 1S1WA 3BKUA 1NSAA 2XI2A 3OHBA 2AF6A 4DV1F 1K9MT 3B4DA 2C2EA 1SB6A 2Z2MA 4YMEA 2DNGA 1S0OA 3PY8A 5A8RA 1NK5A 4M5GA 4DDFA 1K73T 2GO8A 1VC6A 1TMJA 1YQHA 5KFOA 5KFKA 3JSMA 2G9OA 1N32F 3D0GE 3JSBA 1MW7A 2PT0A 5J2MA 4DOZA 3VZIA 2ZH9A 4AQYF 3D3CJ 4MYTA 1VS3A 2AGQA 4EZ9A 4ZHRB 3DDIA 1RYSA 2F4FA 3T41A 4BDPA 3MEEA 2RKIB 4R5PA 5HL7Q 4DR5F 2WHOA 1VQPS 4KH1B 4C0OC 9ATCB 1GXLA 4ES1A 1FRJA 4ZVQB 1S6PB 4Q8EA 2WSEC 1SJ4P 5DLFA 1P27B 4WZQA 3QRPA 3V6KA 1IBKJ 1ZPVA 2KM8C 1UEKA 2X1FA 4DQPA 5CHCB 1WC5A 1SI9A 2QA4G 4USTA 3VAIA 3ZTOA 3DOMB 1RT5B 3ZTSA 3U7JA 3CCZA 1BQXA 1YJRA 2GAGC 4DV4F 3M1VB 5M2PA 4WWSA 2HFNA 2OGUA 2ZVSA 1YIJS 2B8PA 4PG8A 4NLVA 3CCMS 2DNZA 3KHRA 1P9QC 2DTJA 2HQFA 4N47A 3SXLA 1CQNA 3KJNB 2XWYA 1YJUA 4USIA 4PAAA 3UD3P 5F0UA 5DETA 5D78A 1REGX 1J27A 1WDTA 2RILA 4PWDB 1C4AA 1WHYA 2ILYA 4DL5A 1JQGA 3R2CJ 4ANDA 1TUGB 4Y2KA 5KTQA 4JOUA 5A8WB 3SCLE 3DRSB 4X66J 1G4CA 5F41A 3D4JA 3CCLS 4A47A 3GR1A 3I31A 4KKOB 4RUCA 5F0WA 3GYGA 4Y2IA 2WB1D 4F0KA 3MXHP 4QW9A 4O3NA 5K5MA 4NLXA 2JSXA 1RAOA 1EETA 3QSYB 5B0FA 1H7XA 4LRDA 4ZPTR 2LP4A 5E3QA 3RYLA 2C3MA 3CTRA 1OSCA 1HKAA 3PJWA 4RWXA 4N5SA 3LP2B 1U48A 4B02A 3DLKA 2VASA 5KFZA 4KYZA 3UWTA 4K4VA 4NZ7A 3NLCA 4CQ1A 1PC4A 3U1NA 2P9GA 3PHEA 4CDIA 3R6LB 3S01A 1M5OC 1TFYA 1WEYA 2L9NA 2VPYB 3GPAA 4HYKA 3O44A 2DGSA 4KGMA 2ZOGA 3H5SA 4N8OA 1ACMB 4DCPB 1Q7YT 4QQBA 1UWBA 1M1KT 2DNPA 5L46A 3MAHA 2NSCA 3SYZA 1YJ7A 2DCLA 3DRRA 2AIRB 3LP1A 3OSPA 2OSQA 1QLNA 1OPZA 3N01A 3FUYA 4XPCA 3DM2A 2AZ3A 3CEDA 1CVJA 4CNYA 4WP8A 3R2DJ 3L09A 3D7SB 3E01A 3MCMA 3U27A 4Y3CA 4ZN3A 5BXIA 1HPZA 3NGKA 3I5AA 3PO4A 2R8IA 3SCKE 4B3MJ 3A8EA 3THVA 4WF9Q 2QLJB 3CJKA 3DYAB 3OBIA 3CO9A 4OYMA 2WBMA 4ED6A 2X7IA 1N5VA 2E5GA 4O3PA 2XGQA 4MK9A 2ASDA 2BXJA 5A0YB 2BANA 4O3OA 1VC0A 3NGTA 3HSJA 2RRNA 1KHWA 2HBRB 4DUTA 3M30A 1DQ8A 3BR9A 1NNDA 1ZS6A 3EICA 2NZ4A 2OJ3A 3PFOA 3LO3A 5FIIA 5KG0A 3MR7A 1X0FA 4U9RA 3D28A 4F4KA 3MM7B 3QRQA 3TX0A 4M5HA 2JJ4D 2V2VA 5J2QB 1U0HB 3R7BB 2HVDA 2CQCA 3LOUA 3QIPB 4IOBA 3K5LA 1D9DA 2ZUAA 3MR2A 5D0GA 1H2VZ 3KUHA 3L95X 3CCQS 5J2PA 2MQQA 2AU0A 3TJ9A 2E9RX 1HQUA 3RR8A 2MSSA 4ZPCA 4H4OB 1AXQA 2YKPA 1K0TA 3LGHA 3HVTA 2DHSA 1R8HA 4DR2F 2MQOA 3CPWR 1RTZA 1RQ0A 1UAWA 3W2VB 5F8NA 3SSRA 2XS2A 3OVBA 2OTJS 4OJGA 1OY6A 1MNEA 3AA9A 2M7SA 4JI3F 3O5TB 2E5HA 3BYPA 5DDQC 5ITHA 2W9BB 4M5LA 2DNYA 1FE4A 2K7JA 4JYAJ 2K1RB 4F7VA 2QA2A 3R5BA 4UOGA 4JUZA 4LF6J 2JVOA 7FD1A 3QJLA 1Y11A 3POTB 2IM3A 1GMWD 3J7YU 3L3CA 4DV2J 4F3MA 3LA0A 1NZAA 4OIXA 4CT8A 2W25A 2HRTA 3I55S 3PEJA 1BQMA 3PYEA 5KT7A 4GVBB 3QQCD 2MKJA 5FDLB 2EFPA 1YX2A 2V4JB 1NBEB 1KQFB 4Z7YA 1S0VA 4CM2A 2M52A 1LOUA 2AJ2A 1SBRA 2R3VA 2FB0A 2MLXA 3C16A 3KMSA 3T9ZA 3DGVA 5H9FJ 2OPQB 2HWTA 1NKEA 1B7FA 1ZZFA 2ATCB 5B0EA 1FRMA 1RJJA 3JYTA 4U7CA 4FYVB 2MKIA 2BMBA 1R43A 1HNXJ 3TOQA 3HXMA 1TKZA 1S99A 2OAUA 3HD2A 1ZAWA 2C2KB 1YJVA 2EFOA 4AD6A 4IG3B 4YY3J 2AJ4A 4ZVSB 2ABYA 1MWQA 2BR0A 2G0IA 3N0VA 4I2PA 2GMJA 3G4SS 1KC8T 2VONA 1H0HB 3D67A 2Y8WA 2GGPB 3TJ8A 2N4DA 4I64A 2QRRA 2VICA 2OP5A 1U2FA 3H8YA 2BEFA 2HPUA 1RI7A 3Q8QB 2ZJQQ 1NK6A 2MLYA 4B17A 5JVGQ 4I6AA 2BJ9A 2EFQA 4F2SA 3VZHA 1N56A 2DH8A 3W5ZA 4DSJA 1BMQB 4F50A 2HFSA 5E7OB 4OYOA 3MOZA 4DV6F 2EG2A 2YWFA 3KLIA 2CVEA 1KOHA 2BKPA 2W4DA 3CDAA 2RAQA 1XMOJ 3H2UB 1RTDB 1SL2A 1HQ2A 3KJVA 3VWSA 4G1QA 4MKYA 3GYXB 4LFBF 4ED5A 2A1BA 3NGRA 2MJNA 3W2WA 2YY3A 4LIRA 3TAMB 1HBMA 4PRFA 1FX2A 1Q4RA 5G4DA 3DFEA 2WBRA 1NU4A 3VQTA 1Q79A 5GMDA 4PCQA 2CA9A 2R7UA 1H2TZ 5L9NA 5E3PA 5BYRA 1EJ7L 3HMJG 1QD1A 2UXBF 1XQIA 5CD4H 1HNVB 3UNGC 1ULRA 3QGGA 1F2GA 3GE9A 1TU0B 2ILZA 2HNYA 4TU9A 3RB6A 2GQ2A 1IQZA 1KBRA 2ZH1A 3M05A 2E7VA 3CCWA 4K8RA 2F8EX 4QR0A 3CCTA 4DV3J 1C0UA 1R7IA 1UA0A 3EMTA 3SSQA 2J7KA 4M8LA 2B9XA 2OEKA 2YNGB 1EKRA 3KLFB 3N6MA 2I0XA 3Q2TC 1Y5NB 4USMA 4KHRA 3AD9C 1CULA 1KLNA 1HL6A 3VCDA 4DPUA 3UI3A 1HR0F 4NLDA 1NPKA 2DYAA 4ZCLA 2ZM6F 5KFXA 2C3PA 4ED8A 1KHVA 1UETA 3SQGA 5DO2A 6FDRA 1HNIB 1RTJB 5D3GB 1OY8A 3NWGA 3UE2A 3H2VE 4I69A 1B4SA 1WOPA 1KSPA 4LR8A 2BQ3A 2Y8YA 1TK0A 5ETNA 2B4UA 3ZZZA 1IBLJ 2EVZA 5JXSA 2AQ4A 1H74A 3OFHA 2FJDB 3DOKA 2CJ9A 5KFBA 4FF4A 2R7WA 2XCAA 2GO9A 4XDDA 1IQTA 5LMNF 1GNKA 4W92B 2XMKA 2BYCA 4RBUA 4C8KA 4BCAA 2CJQA 2PN6A 2NUHA 4QIFA 2ZITA 1YJWS 2DY9A 3NMAA 2XMWA 1RSCA 1TK5A 3ZTRA 3CB4A 3PX4A 1QAYA 2MEWA 3GYNA 4QYRA 1NB2A 8AT1B 2LVWA 1MWZA 1MN9A 5AE2A 2DGOA 1FF2A 3HKWA 1Q5VA 3NP5A 3MD3A 2M8HA 4MAKA 1U09A 2VBZA 4NASA 1NSQA 5ETSA 4CLLA 3DCAA 2LFVA 2POKA 2XLKA 2UU9F 3NGDA 4IUFA 2HSEB 1VHFA 2R7VA 2HFUA 1X5PA 3Q22A 2IVMA 2H54B 1FDNA 1LW0B 1RT3A 4WK3A 4L75A 2NPIA 4K5RA 3MTJA 2VC1A 3DU5A 1S48A 2QL5B 2RDJA 1G3OA 3CDEA 1YJNS 1FE0A 2YWKA 3TP2A 3D68A 3P49B 2GFFA 3CD6S 3FFIB 1IKVB 4LF7F 3M8QB 3FKBA 4KY3A 1R8BA 1U45A 2RUGA 2IFXA 1P8GA 2FVRA 2QE5A 3UQSA 1XMQJ 2IRYA 5ETPA 3NL0A 2DGWA 3IP0A 1TL3B 3MM8B 1VOMA 3R5DA 2GIRA 1E6VA 3CJ2A 1X4BA 5HK4A 1ELOA 3C14A 3IR5B 5RUBA 1S6UA 1WTBA 1RTIB 1WG1A 4F25A 4DR3F 2KTQA 3JXOA 4KT0C 2HZAA 1UVKA 2LXUA 1U0SA 3HLUA 2Y0BB 4DX6A 1XNRJ 4QOTA 4OYZA 2JZ5A 3F56A 2DGTA 2KVIA 3AY0A 1W26A 4WP3A 4LFCJ 4NXMJ 2DNQA 2GC8A 1JLAB 1RAAB 4GKKJ 5EDWA 2R8GA 1B64A 3EDQB 3BO4A 5HROA 4ED7A 5CYJA 4OJHA 2DT9A 3C8YA 3TA2A 3RGIA 1KR4A 1GQEA 4NEZA 8RUCA 3K5MA 3M8PB 1UW4A 1M5SA 1NJIT 1FRKA 1OQ6A 4USUA 2ZZNA 3AJ2A 4O4GA 1JK9B 4KJIA 4WYWA 2VD3A 2VQFJ 1SKSA 2ZOFA 4MIAA 2QG9B 5KFQA 4JI8J 1TV6B 1Q86T 4DZDA 4RW4B 3OXFA 3MGJA 3BDPA 1RHUB 1VQ5S 2FPHX 2ZH2A 3H0PA 3RAMA 1MMDA 4PG6A 4MMOA 3QO9B 4H4KA 1Y7PA 3BO3A 4DL0C 4Z7CA 5C5JA 4ELVA 2K8GA 4LRAA 1SH3A 2HBQB 3MM9B 1U6BA 1NJZA 2J9CA 2E1CA 3P5BP 3SCIE 2F63A 2Y9HA 4ZCIA 3ZFVA 4HACA 4U6PA 2H5IB 4C11A 1VK3A 3KTQA 3ITHA 3NWRA 2YPZA 2MQNA 5IC4B 2KYZA 1DZ5A 3G87A 2CQ0A 5KOXA 4LF2A 5L1JA 4X4SA 4X64J 1LWFB 4DQSA 3C3LA 3ULHA 4IDKB 4M5KA 1KVIA 1LEOA 2I5JB 4DN0A 2D3UA 3X1LB 2ASJA 4B3RF 4C98A 2HQ3A 2H5JB 3AODA 4J37A 3RTVA 4ECZA 4DL7A 2U2FA 4QW8A 1RAGB 1T9XA 4F4YA 4X2BA 2DNMA 5E3RA 1JLBA 1UPMB 1YTYA 4CCHA 2VDIA 2AHOB 2ROEA 1RACB 1RT5A 2XM3A 2ZNZA 1XJWB 5C25A 4CLFA 3A1YG 2RQKA 2DH7A 4CP5A 2RNEA 4OMFG 1NLKL 3CCVS 2OH2A 2DK2A 2GVDB 2D1CA 5DG8A 1J5EF 2JNJA 1AA1B 5DG9A 1X4FA 5AXNA 2YKNA 3TEHB 5KG4A 1UZHA 3M8RA 2PGCA 2L3MA 2AWZA 2UXCJ 4B9VA 2CPFA 2LEPA 3HSGA 2UUBF 1H3DA 4PYAA 2OPRB 5HMYA 3ENVA 3NG8A 4AL7A 4LF5F 2KJVA 1GT8A 1U1KA 3GONA 2DRDA 2DNNA 4QU7A 2HS3A 3I32A 2J9DA 3JAMY 2CPIA 4KKOA 3IG1A 2YPYA 2CPHA 2BABA 4YDXA 2GX8A 1FTRA 1WG5A 3H4DA 5KT5A 1WOOA 5HBMA 2QGFB 3VAGA 1HNWJ 4UOHA 3U02A 4I7FB 4DV7J 2ZEJA 3IWXA 1HYSB 3KK3A 2CAJA 2W9CB 3E2EA 3WBZA 1Y4ZB 4DEZA 4HH0A 1CJUA 5BYQA 2IJNA 3RW6A 1AFJA 4YOEA 2OD4A 4ZS6A 1QAIA 1Q0NA 1R27B 2HIYA 4DUYF 2XY7A 1WF1A 2VB6A 4QCLA 1Z2ZA 2XI3A 3QT8A 2KT3A 3MR3A 2BM0A 3HT0A 1NHKL 4NLWA 4FF1A 2ZKUA 3IR7B 3W3SA 4CH7A 4C8ZA 2PIIA 3RB4A 4DV5J 4M5JA 1RABB 3TVZA 3J81U 3IRXB 2EPIA 1VRUB 1UZDA 2QSFA 4L3KA 3BGOP 4PKDB 3J80U 5IT9Y 4Y00A 4DV1J 4KHPF 1WC0A 2N7CA 3GFHA 4M5DA 3N4WA 2CPYA 3PW2A 1VQYA 3ISND 4ILMA 2CJKA 2HS4A 1FXLA 2VQEF 4DQRA 3T3FA 3QGHA 2D9OA 3DYAA 3P4UB 4W4MA 4RJVA 4OZ0A 2PI4A 1N32J 4PUOA 5DDOC 2DNKA 3G8QA 1RBOB 4NCGB 4F02A 4J9SA 1RWKB 3TVYA 3BREA 4B9LA 2GQCA 1ZH5A 1AT1B 2UUCF 4OYWA 3I56S 5I3UB 2X51A 5A0YA 1M5KC 4C8LA 4FXVA 4QWCA 4RO0A 3QYYA 5HP1B 1K47A 1SC1B 3CJQA 5B0AA 2VFRA 1FFSB 3DMJA 5A2QY 1CJKB 5C2GA 3P45B 1U2CA 4M63A 4DR5J 2HQGA 4NZ6A 1AZSB 1WEXA 3KJFB 1C0TA 5HSPA 2LU2A 2V2ZA 2XLJA 2G13A 2V4QA 1IBCB 5J2QA 1ZTWA 2ZDPA 2MY8A 3QIPA 4Q0BB 3KNAA 3DU6A 3TNVA 4C6AA 2QEXS 1ZA1B 5THWA 2XS5A 2V9WA 4JI1F 1S6OA 4Y2MA 4FXWA 2XC9A 2CPEA 4YS2A 4TQSA 1SV5B 1SH0A 1UP1A 3V81B 3SFUA 4DV4J 1JLEB 4RW8B 3S7RA 2ZBPA 4YP3A 2GQQA 4CLZA 2W2QP 3W2VA 1RKJA 3ET6A 3GJQB 4CM0A 4DSKA 1RUSA 5J1NA 4TU7A 1WC3A 1MMNA 2VUGA 1DTQA 1N5YB 3MI7X 4CYUB 2N7YA 3LPEA 2K1RA 4GO7X 2HHWA 2X3DA 2YKOA 3OTEA 2J7UA 3FEZA 4EBEA 2G1DA 2OI2A 3AB2B 5KG7A 2ZH6A 1S49A 3AT1B 2XTJP 5FDLA 1VC5A 4ZOSA 2I1RA 4DR4F 2XSFA 4Y2CA 1YRUA 2PMWA 4V19X 2VKRA 3OJUA 1SJ1A 2W2NP 3AFGA 1Y0HA 2OPQA 4R5PB 3MCNA 2BJEA 4YB6A 3MDFA 4TY8A 2CZ9A 2LLZA 4TLRA 1RT7A 4KHMA 4J90A 3J7A1 2HMIA 3ZZOA 4P73A 2P8IA 4KE5A 4M5IA 2CJAA 2BVZA 2A10A 3EJMA 4U8VA 3BPSP 1TMMA 1GXTA 3JB9k 2VJVA 3MEGA 3W62A 2HWHA 1Y9OA 1BHNA 3N9UC 2ADBA 1N33F 1N48A 3NS7B 2R4FA 1G6BA 2Q79A 2PD1A 2DBBA 3Q8UA 1YRXA 1AFIA 3PR4A 1C2PA 3GV5B 4JI0F 4IRCA 4RL1A 3PX6A 2OFHX 5D77A 1U1NA 5C24B 3GIRA 2I8EA 3K2YA 4K0KF 2BX6A 2AKWB 1QY7A 2KKHA 2B9WA 2DNOA 4ENOA 1JWWA 3KG1A 4DR6F 3QZ7A 4CTAA 2AYGA 2B6AB 3EX7B 2PEBA 4AL5A 1RTDA 1LXNA 3CIMA 4AUKA 1L3UA 4LVNP 3VTIA 1AW0A 3AD8C 1AUSL 1SL1A 3EGZA 1Q8IA 2K06A 1F9EB 1SKUB 3BBCA 1C1BA 1EETB 3TZZA 1P9YA 1BC6A 3TAMA 2FJAB 2CQDA 2D3ZA 2QLXA 2EBGA 3VVUA 3SI8A 2ZH7A 1S5ZA 2KB2A 1T7PA 3NRBA 2E9TA 2MDAA 3R8YA 1TL1A 3G2XA 4FBUA 2FC9A 1HNVA 1PILA 4J91A 3CT9A 2ZBIA 5B08A 4KGZB 2MY7A 3PIPQ 3R27A 3H2LA 2FC8A 3EXYA 4IKAA 1S9GA 2MKCA 3K17A 4J9LA 2WAQD 2XZTB 3KG4A 2GJIA 5DM7Q 2P6TA 2GAHC 2HEKA 5FLXY 2AEMA 2LEBA 2L48A 2B8QA 2IM2A 1VCTA 3W65A 1ICEB 3BGRB 5KFWA 3LP1B 3O8WA 3IXQA 2ZZMA 3S1TA 3I87A 2IBOA 1UJ6A 4I6WA 4DR2J 3UN2A 3DM2B 2OTLS 5JMNA 1NK7A 2O1PA 2ZJRQ 1PYOB 1FJEB 2VF3A 1WD6A 2QMUB 3E01B 3DN9A 3T1AA 4ECQA 4JI3J 2XNQA 2NZCA 5DLGA 4WFAQ 1N36F 2LDYA 1HPZB 1RYRA 2FIUA 2B7BB 1PC5A 3RAXA 4KGXB 5BR8F 4PWUA 2H1YA 4CH1A 1HNIA 5D3GA 3CJKB 4UT4A 2VODA 4USKA 1U47A 2YQ1A 2V2KA 4DQQA 2YNFA 2KG1A 3VGTA 3T5LA 2DNHA 4I2QA 4WYLA 1O6XA 4X4UA 4USWA 2E44A 2GNKA 1I6JA 1X8DA 2EK1A 2BANB 1HW9A 1M5PC 3N79A 2F4VF 4MFBA 1KVJA 3M30B 1FXDA 2CQ3A 4IYQA 1ITPA 4IH5A 3VGVA 4CO3A 4FF2A 2RF2A 3A8IA 2W7PA 1D9AA 1CEZA 3DLGA 1RAFB 2IA6A 4FVMA 2BJ1A 2WK4A 2OSRA 2MKHA 1IM6A 3SQOP 4QYZK 2ZDOA 1RHKB 3UN5A 3I0SA 2W4CA 3WIVA 5H1SV 5J2PB 2VPZB 3W5XA 1RT1A 3D1OA 2PC6A 3D1HA 3LW5C 4OYAA 4J9MA 2WSFC 4LF9F 2F8HA 3NCRA 3HJFA 4F4AA 4KV8B 2E1PA 2ZVIA 3EVWA 1LXJA 3FZBA 3HVTB 3RAQA 2R7OA 2MJUA 4EFAC 5MAOA 1TL7A 3MCSA 4TY9A 2GMLA 3H90A 1LW0A 2AJQA 5CH7B 4X4TA 4J9UE 2KXFA 4MKVA 2M9KA 3ILLA 2WZ1A 1IKVA 1IWGA 4JI6F 3M8QA 3BH6B 4DV6J 2V63A 1FK9A 1HBUA 2J76E 4PWWA 4QJVA 3D6MB 4LSNA 2V34A 1LFWA 1BQMB 2QJ3A 3SV4A 2J0XA 4OFZA 5KT6A 3J7AN 3P6YC 3CJRA 1SQEA 2J6SA 3IA0A 4OV6A 2IM1A 1TL3A 3DLLQ 4LFBJ 4DI6A 3QT6A 3M9NB 4C8YA 2C42A 3I4PA 4ID8A 5HMXA 1IJFB 2DO0A 4DG1A 4PQAA 2FJVA 1IWAA 3TW0A 1AYEA 3QLHB 5G0RA 1DARA 2E9ZA 2O67A 2A18A 2HVEA 3GG1A 3FCHA 2EW9A 4EK2A 3SMZA 1Z1ZA 3JYTB 1S4EA 3EVMA 2UXBJ 3VF0B 3MZIA 4OZ5A 1FCAA 5LSOA 5T7LA 1TKZB 4BHQA 2MPUA 1IR1A 1WHVA 1TKXA 2CDRB 4MTPA 4DPWA 3AXKA 4NA3A 2HHSA 2V8PA 4ZVTB 4CI0B 2GZOA 5E41A 3CIZA 4I2PB 2L08A 3OVAA 1RTHA 2HK3A 1EQMA 1B3TA 1D9FA 2QSWA 4NMLA 1W2BR 2BOPA 3QFHA 3OL7A 3N28A 1EQ0A 2RU3A 2KT2A 2EK6A 1JLGB 2VFSA 1OIAA 2GHVC 3BYRA 5D4LA 2DIUA 2IDLA 4F04B 3TUJC 4RW6A 1U02A 3QAUA 5AE3A 1H72C 1HHSA 2D3OR 4DR7F 2DR6A 1HR0J 4HLBA 2ZM6J 1LV5A 3JTPA 1NUEA 4W90B 1VHIA 3LF0A 4RUAA 1SJRA 3A8JA 3PM9A 3KJVB 3ILJA 2JEGA 1SQGA 3DGPB 3M6WA 2FLPA 2W01A 1T0TV 3NXZA 2EI5A 3KLGB 2NSBA 1D09B 3ZO7A 2GJ2A 5IWAF 3W2WB 4N7TA 5A8KA 2R2TA 2VHGA 3CDUA 3JSYA 4UOFA 2RS2A 3B54A 5ADZA 2HWIA 1U1LA 3U1LA 3VAKA 2OFGX 4B08A 4ZK7M 4C7QA 5F3TA 5LMNJ 2I5JA 5ETOA 2E29A 2RUSA 4NLUA 1HWIA 1J2VA 3TRGA 3HHLC 2HNYB 3D54A 2IAJB 5L1KA 3QRRA 2KRRA 4O44A 3WZ0A 5GAHI 1REVA 3KHGA 3FVYA 3PVXA 2VG7A 4KTQA 2DPJA 3H42A 2CQHA 3ENQA 3OXLA 1ZAXA 5J2NA 4JI5F 2CKWA 4X65F 4MIWA 3OL8A 3CUNA 1FWKA 3QZ8A 4RW9A 3THTA 1CJVA 1KP6A 1Q8BA 3I4HX 2Q66A 4HVZA 2BRLA 2HHVA 2DXFA 2B4OA 1S76D 3NEKA 3QWUA 3SV3A 1PO6A 2GVZA 2YWHA 2WB4A 2UU9J 4CWBA 3ILOA 2LA4A 1PKUA 4N76A 1VBXA 5KFTA 1S9EA 4PXEA 1U6FA 3W60A 2R2SA 1FWPA 1VFJA 3C2PA 3QIDA 1S1TA 2QFIA 2CDQA 1FJ7A 4LF7J 4LBHA 2EEYA 1DTTB 3FMWA 2VZ9A 2V2QA 4QYZJ 3EVOA 3BBFA 5KFEA 2M8DB 3CF5Q 1KN6A 2MB0B 2ROGA 3DOKB 1A0OB 1WDDA 4ANCA 4MT1A 4C3MA 3N6NA 3NBPB 3B4MA 1FVSA 1PBUA 1T9WA 3FEXB 4DR3J 2J9DE 3CJ4A 2UVVA 1RT4A 4QWEA 3UO0A 3UVJA 5T41A 2H51B 3OL6A 2GIFA 2BV3A 3GZ7A 2LYVA 1EIYB 4AYBD 2BUNA 3CJSA 4G1PA 4AL6A 4F4ZA 3CW2C 1X7VA 4ZIWA 3OFFA 2DXDA 3KUGA 3PJXA 3Q83A 2JLFA 4GKJF 4ANEA 2QA1A 1U26A 2VG5A 4WK1A 1FJGF 4PPZA 2B4PA 2DNRA 4MH8A 1OSDA 3KLEA 4HTJA 1IBMF 2CG8A 4QZVB 4OL8A 4HKQA 1IVZA 7AT1B 2FTRA 1RAHB 5KT2A 2B51A 2XQCA 2XMAA 2Z4PA 1VQ8S 2AYEA 3AA8A 3HSZA 3GJRB 1EHWA 1YKWA 1V3ZA 1TZ0A 4JI4F 2QYCA 1VRUA 5D0EA 1NRKA 3VAHA 4KH0B 3OTDA 4DFMA 1QVFR 3RG6A 1Z4UA 1FDDA 4ILRA 3GSIA 5KG6A 1X4DA 3HKZD 3MEDB 4N77A 3NCPA 3H59A 2DRBA 4YR0A 3LP0A 2V8VA 1NMEB 2CPZA 2XYPB 2I6WA 5DGBA 2ZFHA 2Z8QA 4OX9F 1X5TA 1E6VB 2RH3A 4IO1A 4NCGA 3KLHB 4LSLA 3GR0A 4J9RA 2LEAA 2RJZA 1YITS 4WE1A 4H4MA 5LSRA 2XMTA 3SZ2A 2BKNA 3K7RA 4ZVEA 3IAM9 2EWHA 4IH6A 1HARA 4X4OA 3CMQA 3US5A 2ADCA 1FDAA 2IYGA 2DIVA 2UUAF 2L9DA 4M5NA 3G71S 3ZTPA 5K8OA 4B3RJ 3IWLA 1F1BB 3DI6B 4X4NA 2ZD1A 5DZ6A 4NLSA 4AE5A 5LOQA 4PEOA 3TAQA 3IGVA 2R42A 1H98A 3WHIA 2ZZTA 2HHUA 3K89A 1I3OB 4WJBA 3WX4A 1Q82T 5LM7E 4O4GB 3PRBA 1XC9A 5HO4A 1D1UA 4ER8A 4UZBA 4A46A 5KFUA 4DL6A 1W25A 3DLBA 4A8FA 2GW8A 1V5IB 4RW8A 2QFJA 2HFZA 2I38A 4EU0A 4JV0A 1RHJB 2LXIA 3H4BA 3GFZA 4QIWD 2DXEA 1J5EJ 2CJBA 3DRPA 4A48A 1N5YA 2EFGA 4CYUA 4OLPA 3AQOA 1H7WA 2ZH3A 3IBWA 5F8JA 2UUBJ 4HDGA 5B0DA 1GAOA 2RDDA 4L76A 2ZHOA 3BSAA 3G8TA 3LGNA 2XO7A 1M1HA 3AJDA 3MM5A 1UPPA 3RJMB 2EXUA 1VQ4S 3R7NB 5F9NA 5DQGA 4LSZB 4LF5J 2HQIA 3CSKA 1FO1A 2LA6A 4HACB 4WU2A 4C11B 4P2FA 3ITHB 1VR6A 2Z0GA 3PYDA 2LDIA 1VQ7S 3VGSA 4LR7A 3V6HA 5LJ5Y 1V5VA 1S7IA 1M1GA 2V69A 2FYXA 1U25A 4WFBQ 3SSSA 3MR6A 1PAEX 5D4PA 1X5SA 4X4RA 1MROA 3UD4P 1KOOA 4QU6A 4KGVB 2DITA 1NDLA 1FNXH 2HQCA 1LWEB 2ZBQA 2E1AA 4XPEA 1NJXA 4DUYJ 3HZGA 3OW2R 3D5MA 5C2CA 4A8SA 5T14A 1JLBB 4YB1P 3PKMA 1VRQC 2QYGA 3RBZA 4PXCA 4ZJOA 3MECB 4P2MA 2WONA 2W2PP 1YBUA 5C25B 1FKPB 2F9DA 4UY85 3NS5A 1QTMA 4UQGA 3KHLA 4DFJA 3NS6A 5IFMA 4Z2XA 2HNZA 4ZVPB 1ZAVA 3ZNJ1 5DS7A 4F4XA 4DX5A 4OQJA 1N5TA 5C24A 2YKNB 3HULA 4YR2A 3IRWP 2FJWA 2CYYA 2VOPA 3LH2S 1R0AA 4XO0A 4NLYA 4WFXA 1URRA 4ZP6A 3FMBA 1VLYA 3MMAB 4A8YA 2UVRA 2Q6BA 4ZPBA 2B6AA 1RWWB 4FDFA 2HG4A 2DGXA 4KHPJ 1N54B 1QAJA 2W1BA 2QX0A 1DFDA 3DLJA 5HN0A 5GAHU 2VQEJ 3MCOA 4LQ9A 4Q2LA 3W64A 1F5BA 1DJ0A 2DH9A 3AOCA 3IG1B 3UNYA 5KFPA 4WTOB 2QN6B 2IA0A 5HBMB 2NYHA 4OYBA 1VQ9S 3CD5A 2XYGB 2YKMB 2DR7A 1UCNA 4O3QA 3KK3B 1CJTB 3W61A 1VQMS 2UUCJ 5E33A 2YWEA 4CLPA 3HFKA 2GS8A 1XR7A 1CJUB 3TR5A 4QWDA 2HBYB 2CPDA 2VV5A 2HHXA 1GTHA 5JVHQ 1SL0A 3HM9A 2JDJA 2KXNB 2FJXA 2V0NA 2B3TB 3MD1A 2HKEA 3LQVA 4RR5A 3L4BC 3VQSA 4WP9A 5KFHA 2FJBB 2RU9A 4KSEB 3TQEA 3CC4S 2KI2A 2XG8A 4CRJA 1VK8A 3K5OA 1DURA 4OI0A 2XSJA 2LCWA 4MJKA 2K2PA 2RMLA 3E8OA 2R7SA 3B8HA 4ED0A 1F3FA 1QUPA 2ZNYA 4JI1J 3QMQA 3LANA 4A8QA 2JL9A 2YBVA 3BGRA 2FDNA 1WELA 2LKZA 5E0OA 5DZ7A 2V6AA 2FHKA 4C3LA 4DV0F 2SXLA 3T19A 2D9PA 3E3XA 3MPYA 5U47A 3JTOA 5GAGI 2VPXB 2D7SA 5CABA 3MEKA 4C8MA 5C42B 4DS5A 1RBLA 3UW1A 2V50A 5HLFA 2KN4A 2N3LA 4M5DB 3W8GA 4AT1B 2R7TA 1X31C 4S0MA 1S59A 3L7PA 4HT5A 2MQMA 1F60B 2B4VA 2MQPA 3FQLA 2FGOA 4KO0B 2R8HA 2VG6A 3NNHA 1WF2A 4PUOB 1X9MA 1SC6A 2OLWA 2PFFB 4L3NA 2ZBCA 1F9FA 3D66A 1EARA 4OHYA 4HEA9 2E5LF 1VQOS 2EC0A 4DN9A 4DR4J 2DHGA 4AFFA 3PYGA 3G86A 1FEEA 1HWKA 3DMJB 4LF8F 2GA7A 3VAMA 4BBYA 4BC7A 2BE9B 4ZN1A 3V5RA 1RT2A 4CLYA 2HBZB 2FQQB 2V9KA 1C0TB 9RUBA 3I5BA 1LK7A 2K3IA 3KJQB 1P1TA 2RQ4A 2ALYB 2NS1B 2WVBA 3CXCR 2IMWP 4CO5A 4O0IA 2V8GA 2UVUA 3HHEA 3UN3A 1UJ4A 3I9ZA 1YG0A 2LQBA 1XEZA 1U8WA 3MPUB 1JNZB 2KM8B 4OI1A 1N33J 3RRHA 4KV8A 1NJYA 3CMES 1U49A 4YN3B 1JIHA 2B43A 2NCKL 3BF4A 3ET6B 1RA7A 1OJ4A 3Q89A 4JI0J 4YR3A 2Z2ZA 4QPTA 1Q81T 2VJUA 4A8KA 1DTQB 1NEEA 5EWFA 4K0KJ 2X1BA 1RLCL 3M32B 1KDNA 2F5GA 2DVIA 2KH9A 3MAQA 4DR6J 4WFYA 4YHHF 4P2SA 1EX8A 3NAIA 4IRKA 4CLUA 2AW0A 2RD5C 1X9WA 2QO3A 4MYUA 4DJBA 3MPVA 1L5UA 3V4IA 1PAUB 3KLVA 5L39A 1XERA 2N4CA 3PEHA 4RWWA 1I5OB 2QLBB 2QMXA 3W9JA 4K4SA 3QLHA 1X4GA 2RB7A 2RRAA 1ZM9A 3NGUA 4TY8B 1PBAA 2HK2A 3MWBA 3ETOA 1HA1A 4DZ6A 1TL4A 1RT7B 1ZZNA 2Y1JA 2HMIB 3OTOF 1JKHA 5H9EK 2C2NA 3MUTP 1HBNB 2ZHBA 1RDRA 2CQPA 2KHDA 5DGAA 4CT9A 3DLEB 5KFAA 3BSOA 1YK9A 4FYDA 3GV8B 4OX7A 3MEGB 2DGQA 1B0PA 1Q8KA 2JLGA 4FYYB 1S1XA 4URGA 5F8HA 3NMRA 4C0HA 1WOSA 2DO4A 3DOLA 3HHDA 1DLOA 4ZLNA 2HQDA 4W98A 2WW8A 4K4WA 4IG0B 3RBDA 1VYAA 1YBAA 2XS7A 4CZCA 4L72B 1GFWB 1FX4A 5HMZA 2ZWPA 3MPDA 1JLGA 4CO4A 2HZVA 4NE9C 4PG5A 5MLCV 4ZVUB 3HDSA 4USVA 5KFSA 3O6QA 2VKZG 2B56A 2IY5B 3SFGA 5HVFA 2MYFA 2PFDA 3C6UB 4CTAB 2VBYA 1U1RA 4OJ1A 1V3SA 1N36J 1HD1A 3AOAA 1FKAF 5KFDA 4LT6A 5BR8J 4ALZA 3DGPA 4IOAQ 4G65A 4IRDA 2ASLA 4Q5VA 4OJ3A 3ZZ0A 3C6TB 3KLGA 2R2UA 1S1VB 4I0WA 1C1BB 2XULA 1H2UX 4ZVFA 3UDEA 1S79A 4KPCA 4OZNA 2QLWA 3FCWA 5KFMA 4E0DA 4FXDA 2HAIA 2VPWB 4C4WA 2F4VJ 1TL1B 1TTHB 4ZLJA 3BDEA 4IR9A 2BKOA 5KFYA 2OMLA 3TYTA 1NK8A 1WHXA 2IYIA 3DLHA 3D6TB 2ROPA 5F8IA 1L3VA 3UR3C 4WKRA 2V8HA 5F8LA 2IAJA 5I42A 1VRTB 1UFKA 2L41A 4QWAA 4WFNQ 5DDRC 2HNDA 5DG7A 3DHXA 3G6XA 1IKXA 5I3PA 1S9GB 4DWIA 1HQEA 5HMWA 1WSRA 1NJWA 2IVYA 2NXUA 2DD8S 5IQQA 3P96A 4DX7A 2FZKB 4DQIA 4LF9J 3PYFA 3K5NA 4JV5F 3GIKA 4EEYA 2RQCA 2HLUA 2AMCB 2FVSA 5HANA 1Y3KA 1L3KA 4LRBA 1RWMB 5SZTA 3TA0A 4N56A 2Z56B 4FZVA 5CQGA 1NH7A 2R8JA 2NUUG 4J9NA 2NXJA 2AJ0A 2IJRA 1RK8A 3FQKA 4B3SF 2P9CA 2C3YA 4FYWB 1R6YA 3Q8RB 3T5JA 5IV4A 4JI6J 2WRMA 4QPXA 3PKYA 1DTTA 1IN0A 3HFZB 2YNFB 3TWZA 2FY8A 2X1GA 1HMVB 2LECA 4I2QB 4PYDA 3L7UA 1RCOB 4P75A 1D3WA 4O3SA 4MFBB 4DCOB 3NBPA 3QGPA 4A8OA 3FSIA 4OZ3A 1HW8A 2WSCC 3TZWA 3CDBA 2RF2B 3OT9A 1Y10A 5GAGU 4C3KA 1TKTA 3DLGB 1V6HA 1B7YB 1S4FA 2WCXA 1YBTA 2IRUA 2F7VA 4R0EA 1KONA 4L73A 1UVJA 3FRYA 3A3NB 3RR7A 1JNRB 5L1IA 1G2EA 3I0SB 5EHHA 2RIJA 1RT1B 2OPSA 1U1MA 5CCLA 2CWKA 3DNCA 2Q43A 3R7SB 5GMKa 2QT7A 2DHAA 4PXBA 1SQFA 3D0HE 3NNAA 2UZAA 2CNKB 1X9SA 3UDVA 2ACMA 3T9NA 1U1QA 5B09A 4DSEA 1TL7B 5EWGA 2BW7A 2CZVC 3UCGA 3WIUA 2ACYA 2GHWA 1U1OA 3CGIA 3VAJA 5KFIA 4OZJA 4EYHB 4DR7J 2DB1A 1FK9B 1HBUB 3MEDA 3I9V9 3IO1A 1RKIA 4LSNB 4R25A 4NYZA 1X4HA 1K0VA 1S10A 2JEFA 2DHHA 2ZWOA 1QE1A 1NHVA 2R7QA 4TXSA 2W2MP 2IM0A 1JJHA 1NO8A 1R3NA 4L74A 3OL9A
chains in the Genus database with same CATH topology
1IJEB 2OTJS 3M8QA 4OJGA 3AA9A 1MNEA 3OXGA 2M7SA 3R5AA 2YKAA 5HI7A 1FK9A 1HBUA 2J76E 3VR1A 4JI3F 3O5TB 1TFWA 4QJVA 2E5HA 4OHZA 3KLHA 4H4OA 1JJ4A 5DDQC 5KFCA 4X62F 4LSNA 5ITHA 1T95A 1IKWB 2RRBA 4DG1B 2W9BB 1KQSR 1LFWA 3EPIA 1BQMB 2DNYA 1XTZA 2CQBA 3SV4A 2J0XA 4OFZA 5G0RB 5KT6A 3CCSS 1FE4A 3P6YC 2K7JA 2IVFB 1SQEA 2J6SA 2K1RB 3IA0A 2WTFA 3H20A 4Q8FA 2IM1A 2QA2A 2W24A 2FHOB 2XGPA 4ECTA 1TL3A 2BRKA 1S1WB 2P9EA 4OLOA 4DL3A 1SJ3P 3DLLQ 3R5BA 4ECSA 4DSLA 4JUZA 1JLQA 3M9NB 4C8YA 2JVOA 3B82A 7FD1A 3QJLA 2C42A 3POTB 2MZTA 2IM3A 3HHLB 3I4PA 4ID8A 5KFFA 4YQWA 3J7YU 3L3CA 3M2UB 5HMXA 1IJFB 3R3TA 2DO0A 4F3MA 3CJ3A 2PSZA 1NZAA 5T7LB 4OIXA 4CT8A 2W25A 4DG1A 3KK1B 2W9BA 4A8MP 4PQAA 2FJVA 3I55S 3PEJA 1BQMA 4B9NA 1TKXB 3K0JA 3TW0A 5KT7A 4HI2A 3QLHB 5G0RA 1DARA 5A8RB 2E9ZA 2O67A 2A18A 3OV7A 4B3MF 2MKJA 3K5MA 3DI6A 3CWJA 3FCHA 2EW9A 3GG1A 2KZMA 2XBPA 5FDLB 4K4XA 1S77D 2EFPA 2V4JB 3SMZA 1FERA 1KQFB 1C1CB 1VJWA 2GIQA 1Z1ZA 5J1PA 1S0VA 2M52A 1LOUA 3JYTB 4GO5X 2HVZA 2PEHA 3POTA 3JSMB 1IXKA 3HHLA 1KFSA 1SBRA 3VF0B 3MZIA 3PW5A 2HVIA 3M2UA 2FB0A 1FCAA 3F44A 4OZ5A 3CJ0A 5LSOA 5T7LA 3KMSA 3T9ZA 1NB7A 1TKZB 4BHQA 2MPUA 4O4RA 4KAIA 5H9FJ 5J2MB 1WHVA 1RTHB 2OPQB 3IWNC 1TKXA 1X4EA 2HWTA 2ZH4A 3M2RB 1NKEA 2AYMA 5JJBA 1H38A 2E5JA 5GAEI 1B7FA 1T94A 1ZZFA 2H9ZA 3GMGA 3T6BA 4YB5A 4MTPA 3FDSA 2HYIB 5B0EA 1ZETA 2V4JA 3BGUA 2EFVA 1FRMA 1RJJA 4IFYB 1C1CA 3OTCA 4NA3A 2HHSA 1BY9A 3JYTA 4WCEQ 4UY8T 4U7CA 2MKIA 4F2RA 1WACA 4CI0B 1R43A 2IRXA 3QGIA 3HO1A 2AP6A 5E41A 1XBWA 1ZM4A 3CIZA 2QV6A 2L08A 4I2PB 2HHPA 3TOQA 1F0XA 2AGOA 3U1MA 3HXMA 1TKZA 4ILLA 1TQLA 3MEEB 4RW6B 1S99A 3OVAA 1RTHA 2RS8A 2OAUA 4DSIA 1Q53A 1D9FA 2KRBA 3M2RA 1FHTA 1ZAWA 3ZZRA 3HX9A 2PO4A 2QSWA 4NMLA 2PA8D 4RNMA 1YJVA 1W2BR 3C46A 2BOPA 2GMHA 4NPOA 3OJSA 1FD2A 3OL7A 4XAKA 2EFOA 3N28A 4IG3B 1FXRA 4DR1F 2AJ4A 2KT5A 4IFYA 3CCRS 5GADI 2RU3A 2ABYA 2KT2A 2EK6A 2Q3PA 2BR0A 4ELUA 1D8ZA 3TUZC 1JLGB 2HGLA 3N0VA 2VFSA 1JLCB 1OIAA 2GHVC 5D4LA 1TP7A 4I2PA 2GMJA 2DIUA 3CE8A 2RDIA 3TUJC 1FRXA 4B3OA 4RW6A 3G4SS 1KC8T 2VONA 2KU7A 2UUWA 1H0HB 4G1IA 1V3RA 3QAUA 4I56A 1RAJA 3I0RB 4WIIA 5AE3A 2DRAA 2GGPB 2N4DA 1HHSA 3I5CA 2D3OR 4IG3A 4DR7F 2PMHA 1UL3A 3BGLA 4IO9Q 4ICLA 2DCUB 3M2VA 4I64A 4O3RA 2QRRA 4HLBA 2OP5A 2VA2A 1U2FA 3H8YA 3KNGA 2M2BA 4CO0A 1LV5A 3JTPA 4W90B 2HPUA 5EUHA 3MURP 1R31A 2ZE2B 1RI7A 3Q8QB 2ZJQQ 2I9SA 1NK6A 3LF0A 4B17A 2FVQA 5JVGQ 2ZOMA 4I6AA 2EFQA 5A8KB 2RT3A 4RUAA 3VAFA 4F2SA 2RQMA 1SJRA 1U4BA 3V4MA 5KFJA 3VZHA 1N56A 2IMOA 2DH8A 3PM9A 2XMVA 4RZRA 3KJVB 3PR5B 4NLTA 3S6EA 4DSJA 2JEGA 5AJ3F 2GGPA 3HPOA 4DHVA 3M6WA 2FLPA 4IH7A 4F50A 5E7OB 1OQ3A 5CYQA 3MOZA 4DV6F 4C9DA 2KG0A 2EG2A 2EI5A 2YWFA 3KLIA 2CVEA 1VMBA 3KLGB 1KOHA 2W4DA 4DL4A 3CDAA 2NSBA 2W7AA 1S1UB 2YKQA 2GJ2A 5IWAF 3H2UB 2ZE2A 1RTDB 3W2WB 1N8RT 2J9EA 2PDAA 4EYIB 1SL2A 3CCJS 3BR8A 5A8KA 2EG1A 3MOJB 4ZCMA 2R2TA 1KFDA 4ES2A 4JYAF 3CDUA 3P3DA 1L3TA 3KJVA 3VWSA 2CPXA 4G1QA 4K59A 4MKYA 1FKOB 2NLWA 2CFXA 3GYXB 3JSYA 2KJWA 5BJRA 3IN5A 3H5UA 2RS2A 1LWEA 2G4BA 4ED5A 4LFBF 1UJ5A 4BWJA 5CA5A 4O44B 1REVB 4HL9A 5ADZA 4LF6F 2HWIA 1U1LA 3U1LA 5AXMA 2VG7B 2A1BA 3VAKA 2OFGX 4DV2F 1S1UA 2LMIA 4B08A 4MKAA 4K2XA 2MJNA 4C7QA 4ZK7M 3Q24A 3W2WA 5F3TA 1E6YB 3LGMA 2FJEB 2YY3A 5IQ6A 5J2NB 4LIRA 3TAMB 1HBMA 4ZDNA 2ZH5A 2I5JA 4PRFA 4JI7F 1KEKA 2E29A 4NLUA 3HT3A 1HWIA 3SDEB 2BZ2A 1J2VA 4RW9B 1HI0P 3T6JA 3TRGA 1Q4RA 3HHLC 4NXNF 1G7CB 2HNYB 4TN2A 5G4DA 4KQZA 3DFEA 2WBRA 1NU4A 4Q43A 3VQTA 1FKOA 1Q79A 2IAJB 3D54A 2KFYA 4PCQA 1XNQF 2XEXA 3MECA 5L1KA 2R7UA 2KRRA 4MIBA 2HIQA 4O44A 3WZ0A 1REVA 5GAHI 3KHGA 2J8AA 1XR6A 1VBYA 4LFAF 1LQ9A 3FVYA 1H2TZ 5L9NA 5E3PA 3PVXA 5BYRA 2VG7A 3HMJG 4KTQA 2UXBF 2DPJA 3BQ2A 1QAXA 2CQHA 5CD4H 1N5QA 1O51A 1E6YA 1HNVB 3ENQA 1FKPA 2OO4A 1ZAXA 3OXLA 2YX7A 4LIWA 5J2NA 4JI5F 2CKWA 4X65F 4MIWA 4ECXA 4N8NA 2O3DA 3UNGC 5J1EB 2JOQA 2LU1A 1ULRA 1WG4A 3OL8A 3CUNA 3QGGA 5AE1A 4EUVA 1F2GA 3SDEA 3QZ8A 1GXUA 3GE9A 4RW9A 4YB7A 3THTA 4QR1A 2ILZA 2HNYA 1Q8BA 3I4HX 4D3HA 2Q66A 2AX1A 3DLKB 1OS5A 5IM0B 4TU9A 3RB6A 2GQ2A 3RB0A 1IQZA 2JFDA 4HVZA 3BGFA 1UA1A 2BRLA 2HHVA 3Q0AA 4LJMA 4ECYA 2B4OA 4URQU 1WWHA 1X4AA 2FLNA 3TA1A 3DRXA 3QPIA 3M05A 2ZH1A 4JV1A 1HNXF 5K14B 3KMQA 1S9EB 5D8HB 1S76D 3CCWA 3UCUP 3D1QA 4MK7A 3Q8SB 2F8EX 3FZ2A 3QWUA 3SV3A 1PO6A 2JLEA 5J1EA 4QR0A 4DBQA 1S1TB 2YWHA 2WB4A 2O5DA 3MMAA 3CCTA 1I1GA 3BSNA 2C3OA 3MTKA 4LVOP 2V4RA 4UW2A 1C0UA 3HI9A 2DR8A 1R8AA 1ZBTA 3MFIA 2LA4A 1R7IA 4YY3F 4NLPA 4FPRA 2KXHA 5IM0A 4HH1A 3OHAA 1UA0A 4PQUA 1U7LA 3V2UC 5LT5A 3T5HA 4K5SA 4N76A 2JH3A 1YJTA 3SSQA 2J7KA 4M8LA 5E3AA 1VBXA 5K14A 2DGUA 1S9EA 1SUQB 2YNGB 2B9XA 4PXEA 1U6FA 5KFTA 3E51A 4YUDA 3KLFB 2R2SA 1VFJA 3PW7A 3C2PA 3ONQA 2W7OA 3GSDA 3QIDA 1S1TA 2Z2LA 3N6MA 3DC2A 1UWBB 4RLEA 2CDQA 2I0XA 3Q2TC 1Y5NB 1FJ7A 4NLOA 4KHRA 3ZC4A 5I3QA 3GIJA 3DRRB 1KLNA 2PMZD 2FVPA 1XR5A 1HL6A 3VCDA 2N82B 1DTTB 4MK8A 3UI3A 1HR0F 4NLDA 3UPFA 3GWCA 3FMWA 5L38A 3C66A 2VZ9A 3K57A 4I67A 1T3OA 4ZCLA 2ZM6F 3EYZA 4QYZJ 2YKMA 5KFXA 1SUQA 2CQGA 2YNGA 5KFEA 2C3PA 4M1KA 2M8DB 2XNRA 4KIAA 3KLFA 4ED8A 4OZLA 3CF5Q 1KHVA 1KN6A 1UETA 3SQGA 2HLTA 5DO2A 2MB0B 3KWMA 1RT4B 6FDRA 2ROGA 4DLGA 5B0BA 2F9JA 3PDNA 3DOKB 3Q8PB 1HNIB 1RTJB 5KFNA 5D3GB 3NWGA 5KT4A 3UE2A 1MU2B 3H2VE 1SJQA 4I69A 4KRWA 2X1AA 1S0MA 1N0VC 3EZ5A 3OLBA 3MMCB 2MZ1A 1P6TA 4NLGA 4C3MA 1KSPA 3N6NA 3NBPB 4BC9A 4LF4F 3B4MA 2BQ3A 1XMOF 1FVSA 2V94A 2J0QD 5KOWA 1TK0A 3FEXB 2W8KA 2J9DE 3ZZZA 2B4UA 3CJ4A 4PR6A 2EVZA 5JXSA 2VG5B 1D0EA 3RBEA 2UVVA 5GVQA 2AQ4A 4ZA1A 3S8SA 1RT4A 1TL5A 3DXSX 4QWEA 1B0VA 3OFHA 2FJDB 2YNIB 1RTJA 3DOKA 3HVRA 1KTVA 1R8PA 2HS0A 4NL5A 5T41A 4QWBA 3MFHA 3OL6A 4DUZF 1MU2A 3KLEB 1QSSA 3BQ1A 2AJ1A 2BV3A 2M88A 3GZ7A 2CJ9A 2LYVA 5KG1A 4AYBD 3GB0A 5KFBA 2BUNA 3IS9B 3MMCA 4G1PA 2XCAA 2R7WA 2ZC3A 4AL6A 4K50A 5E3CA 2GO9A 1UEUA 4F4ZA 2C2RA 1X7VA 4PG7A 4CH0S 3OFFA 2XCPA 3PJXA 4XDDA 3HF5A 3ZZUA 3CD0A 3MMBB 2JLFA 4GKJF 1IQTA 3BZQA 5LMNF 1GNKA 2QA1A 4W92B 2XMKA 4C8NA 1U26A 1QSLA 2WOMB 2BYCA 2CRLA 2OD6A 2VG5A 4RBUA 4UUXA 4WK1A 4BCAA 1Z2LA 4F26A 4C8KA 1FJGF 2KYXA 4PPZA 2CJQA 2B4PA 4BWMA 2PN6A 4TKTA 3TUIC 2DNRA 4MH8A 1OSDA 3KLEA 4HTJA 2NUHA 4NOHA 4QIFA 1IBMF 2ZITA 4QZVB 4OL8A 1CSJA 2XZWA 1YJWS 3NNCA 3NMAA 1M5HA 2XMWA 1FRIA 2QA4S 4ZP9A 3IS9A 4HKQA 1TK5A 5KFVA 4Q44A 4NWBA 3IR6B 2DHXA 4OHVA 5A6PA 1CC8A 3CB4A 3PX4A 3AHPA 2FTRA 1FTCA 1QAYA 5C42A 3MMBA 3GYNA 2CPJA 5B0GA 3BSCA 3OR1B 4J5OA 4QYRA 3G9CA 2WOMA 4UOCA 3PO5A 5KT2A 2LVWA 2B51A 3OTBA 1HFEL 1MWZA 2Z4PA 2R2RA 3TAPA 2AYEA 1VQ8S 5AE2A 3J7Z5 2MKSA 3AA8A 2DGOA 2M4MA 3LWLA 1NKCA 1FF2A 3HKWA 3NP5A 1HNZF 3MD3A 1NHUA 1V3ZA 3LUYA 1S0NA 2C2DA 3LP0B 1TZ0A 2M8HA 4MAKA 4JI4F 1U09A 3FNNA 2VBZA 2QYCA 2FLLA 1Y5LB 1VRUA 4A4JA 4JI2F 3AH6A 1NRKA 3VAHA 2HHTA 1M5VC 1S7HA 3OTDA 2A2DA 4OI6A 4DFMA 1QVFR 4KO0A 3DCAA 1VQ6S 2POKA 2XLKA 2UU9F 3NGDA 4IUFA 1Z4UA 4DV3F 1FDDA 4ILRA 5LL6d 1VHFA 7FDRA 3HVWA 1QUVA 5KG6A 1HQUB 4Y6IA 2R7VA 1K8AT 4FNIA 3OUYA 4M95A 1ZTTA 1X4DA 1KLMB 2VBXA 3HKZD 3ISNC 1X5PA 3MEDB 4N77A 3GIMA 3Q22A 3CMAS 2IVMA 3NCPA 2J6UA 3H59A 2DRBA 1FDNA 1LW0B 4YR0A 4LSLB 1RT3A 3LP0A 2V8VA