3TNVA

Acylphosphatase with thermophilic surface and mesophilic core
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
90
Chain Sequence
b'AIVRVHYKIYGRVQGVGFRWSTQREGRKLGLNGWVRNLPDGSVEGVLEGDEERVEAMIGWLHQGPPLARVTRVEVKWEQPKGEKGFRIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acylphosphatase
publication title Protein surface is a preferred site for thermostability engineering
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
total genus 25
structure length 90
sequence length 90
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2011-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tnvA00
2W4PA 1AFJA 2IYGA 2XMJA 1Q8LA 1CPZA 3GZ7A 2GA7A 5B0EA 3HHLB 2RMLA 3BB5A 1FESA 2KT2A 2HFNA 1RJJA 1FVQA 2ASYA 5B0GA 1CC8A 5B0FA 3BM7A 1Q53A 3HHLC 1TL4A 2HIQA 2IFXA 2K2PA 2OFHX 2QLXA 1OQ3A 2XMMA 3MCSA 4DN9A 1TZ0A 5IXUA 3WDOA 1MWZA 2L3MA 4OIXA 4F67A 3K7RA 2FIUA 2ZDPA 2CRLA 1YJTA 3T9NA 4A46A 1VQYA 2OMOA 4NL5A 2ACYA 3KG0A 2KKHA 2KYZA 1YRXA 3MZIA 4Q2LA 1W2IA 2OD4A 2RILA 3BN7A 4HH0A 4OJGA 1SQEA 2XMVA 5B08A 3FRYA 2N7YA 2GCFA 2K1RA 1FD8A 4Q2MA 2LQ9A 3HF5A 3TOQA 5B0DA 1K0VA 2Q3PA 1ULRA 3HX9A 2N4CA 4FNIA 4OJ3A 2GGPB 2BJDA 4Y2KA 1FE4A 1MWYA 3CJKA 3FGVA 1VQSA 1YJUA 2KT3A 1N5SA 1LQ9A 3HDSA 2ROGA 1TL5A 3BGUA 2BBEA 1S6OA 1TUVA 2AJ1A 2LQBA 1OPZA 2VH7A 2OFGX 3KG1A 3TNVA 2AW0A 4YDXA 1JK9B 5F0WA 1OSDA 2JDJA 1APSA 2LDIA 2OAUA 1XBWA 2ROPA 3KNGA 4U9RA 4HL9A 3F44A 2PGCA 1Y3JA 2W4CA 2BYCA 1KVIA 1AW0A 2OD6A 2GV1A 2FB0A 1Q8BA 3I9ZA 5T7LB 2XMWA 2QLWA 1KQKA 2BUNA 3FMBA 4OJ1A 2G9OA 4HI2A 1URRA 3E8OA 2EW9A 2XMKA 3BDEA 1Y3KA 3LO3A 2QIFA 1WD6A 5B0BA 1S6UA 2AP6A 1N5QA 4QOTA 3HHLD 2BJEA 2HLUA 1GXTA 3QMQA 1N5VA 1YG0A 3IWLA 4HI1A 2ZDOA 1Y9OA 3UDCA 2K7KA 2LXFA 4NPOA 3VTIA 3HHLA 1Q4RA 1R6YA 2HLTA 3BF4A 3BR8A 2GFFA 1FVSA 3LGMA 2W4DA 4A48A 2XMTA 3CJKB 1QUPA 5B0AA 1TR0A 4HH1A 3TRGA 1Y0HA 4YEAA 2N4DA 1AFIA 1U7LA 4Y2MA 3QGPA 2FTRA 5F0UA 1V3ZA 1YJVA 1X0PA 4ZA1A 2HQIA 3KKFA 1X7VA 1KVJA 2VV5A 1P8GA 1FE0A 2QYCA 4OJHA 5K9FA 1SI9A 1SB6A 2K7JA 2FHMA 2GO8A 2OP5A 2OKQA 5KAKA 3LGNA 2RU9A 2K1RB 3IWXA 4DL0C 2RSQA 4EFAC 1X8DA 4FNHA 3DXSX 5A6PA 1OQ6A 4A4JA 1YJRA 5T7LA 1IUJA 5A6WA 1JWWA 4ZOSA 2XMUA 5B09A 2ROEA 2GGPA 2IYIA 3HFKA 1GXUA 1N5TA 3DCAA 4DPOA 1P6TA 1CC7A 2AJ0A 4Y2IA 2HFOA 5B0CA 1FEEA 2PD1A 4A47A
chains in the Genus database with same CATH superfamily
4XPEA 2RDJA 2CPZA 4DV1J 2NREA 2GQCA 3RZAA 3H98A 2YNIB 2ASYA 4CCHA 2CQ4A 5IXUA 4UUXA 4DR5F 2FZGB 1U0HA 1RAOA 4DR3J 9ATCB 4KIAA 1T95A 2HGNA 3FEXB 3MM7A 1Y5IB 2F4FA 3PTWA 4KKOA 4FYYB 4YR2A 1C1CB 1TUVA 3I5CA 3IC1A 2GJ2A 2C2ZB 4ZJQA 3MMCB 4K2XA 4WIQA 3ZO7A 5SZTA 3EGNA 4YMEA 1EQ0A 1YRTA 2YKPA 4OYIA 4EBDA 1DTQB 4DV6J 3KLEA 2FHOB 2ZUGA 3RJMB 3R6LB 2DGSA 4NXMJ 4A8MP 3PW2A 3J81Y 2GMHA 4RW8A 1YZ7A 2B4VA 2ZD1B 4NX9A 3OXGA 4CQ1A 1S6QA 1S49A 1VQ4S 4F2RA 3AFGA 4WKYA 3LGHA 1OO0B 4M94A 5JXSA 4RW7B 5AJ3F 5D4PA 2RIJA 3M8PB 1QSYA 2H5JB 2YKQA 3OL6A 4IH5A 3W63A 1IR0A 3KLFB 4OX7A 2XEXA 1TFWA 4IH6A 2VF3A 1NO8A 1F3FA 4MK7A 1H3DA 3ZZPA 1R8AA 2VG5B 2VFSA 3HFZB 4EU0A 1R0AB 3R5JB 2LDIA 1KLNA 2FLLA 3OR1A 1LW0A 1JX4A 4K4VA 3I56S 3L95X 2EW9A 2HMIB 2EKYA 3CD6S 5D3GA 4EO6A 4CH1A 4I6WA 3R5AA 1JB0C 2JHEA 3ZZYA 2V6AA 3RYLA 3M1VB 1HLWA 2UVWA 3GG0A 2K1RB 1KLMB 4DSJA 2CQGA 2BX6A 5KG2A 3POTB 1S1TB 3GIJA 1RTHB 2IC3A 2ROEA 4B3TF 4HEA9 1LWEA 2OJ3A 1RQ0A 3U1MA 3WC2A 1Q78A 2OEKA 2OLWA 3EM1A 3D0GE 5E33A 3IG1A 4NA2A 4RO0A 4PXBA 1HBMB 3UFCX 3P49B 3Q8UA 1RWOB 1NHUA 3SFGA 1KQSR 5I3UB 4K59A 4Q8EA 2OSRA 3KLHA 4LSNA 2OTLS 2JRSA 5CH7B 1KFDA 2C2RA 4LUBA 4UOGA 3DLHA 2LXUA 3SBMA 3D67A 4NLXA 4KAIA 3FFIB 2GO9A 3RU0A 4KR0B 1X9WA 5D4NA 3QSYB 1UVMA 2JFKA 3L4BC 3O1LA 3DRSB 4P74A 4Q43A 4WXOA 4LBPA 1S9FA 3HVRA 1GXTA 3QMQA 1SPBP 1VQLS 2QX0A 5IQQA 2V34A 2V9WA 3TRGA 2WSCC 1KD1T 1U7LA 3NEKA 5KG7A 1B0TA 3OPKA 4OZ5A 1IXKA 5E41A 2FJXA 2QLJB 2AJ4A 4IOAQ 1R8HA 4WP3A 2LFVA 4C9DA 4I2PB 5DG7A 3HK2A 2R9LA 5K8OA 3KLGA 3W9JA 4OHVA 4JI6F 3BGOP 3SCJE 1F5AA 3NWGA 4O4GB 4IRCA 2M88A 1I94J 1LOUA 3T6JA 3QRQA 2XLIA 2F65A 2DJWA 1VLYA 1VISA 1VGYA 2J9DE 4R5PB 5GAEI 1RTDB 3QIPB 2QG9B 2HGLA 4IFYB 2ASLA 4DR2J 2HBYB 3HHDA 3HJVA 1KVIA 4DV4J 5HMYA 4BLGA 3V6HA 1BWEA 2B5JB 2VPZB 3OT9A 2ZNZA 5CYQB 4P6QA 1MN7A 4USTA 5DQGA 1S6PB 2GMLA 3T5LA 3A4TA 1ZPVA 2V8GA 2QA2A 1CG2A 3NAIA 4OZJA 2DISA 2NXNA 2HHTA 1VBYA 1BE4A 4DG1A 4X84A 3K8VA 3A3OB 1U6ZA 2XMUA 4LFAF 4QWDA 1P6TA 3H2UB 4FXVA 2J6SA 3EZUA 3S6EA 4U67Q 4DU8A 1X4BA 2JWNA 5E5NA 2WVCA 3NRBA 1HR0J 4UUWA 1Z2LA 1MN9A 2OPQB 5FLXY 1WEYA 4OZ2A 3OTBA 2CUYA 3QRRA 3VF0B 4ZKAA 4C8NA 4Q0BA 2DRDA 5KG5A 1TP7A 3MEKA 3PX4A 4F0HA 2DYAA 3HT0A 2BQ3A 2JVOA 4LF6J 2M8DB 4DSLA 2AGQA 1ZM4A 4JV1A 1S1UA 2ZBCA 3E8OA 3V2UC 1JJCB 3ISZA 1S99A 2IM3A 3GYXB 3UO0A 1WELA 2BV3A 3W2WB 4DPTA 3IBFB 4U7UD 1SV5B 1AT1B 4GKJF 1A9NB 3N5BA 1C4CA 4B02A 1C4AA 1U6FA 4BWMA 2COLA 4M95A 5KFJA 5D0GA 1FK9A 4A8XA 2AEJA 5F9NA 2WTFA 1Y11A 3EXYA 4KB7A 1EKRA 2F40A 3R5BA 3C6TA 3MEGB 2P5VA 2EK6A 3JS9A 2JH3A 5J2MB 1KDNA 4ZN1A 2MY8A 3VAIA 1PAUB 3CC7S 3A8IA 1LQ9A 2BBEA 2Z2MA 1FKPB 1APSA 4RWXA 3T5JA 4ENOA 4JYAF 2V2KA 4MH8A 1TMMA 2QLWA 1UEUA 1IKXB 3TVZA 3GR1A 2BJ9A 1AYEA 4F4WA 5GMEA 1M90T 1SJFA 2BKPA 2KG1A 2LU2A 4ER8A 3PHEA 3C15A 1NHVA 3T6BA 2XCPA 1CULA 2C2DA 2PIIA 5T7LA 3LH2S 4RNMA 1X5SA 2VFTA 4JI7J 2K8GA 1CQNA 3C3LA 5B0EA 5DZ6A 5MAOA 4ZJOA 1OJ4A 1JJ2R 4MKAA 4C4WA 1JLQA 3MMAB 4I7FA 3SYZA 1TKTA 2DGUA 1U1QA 4DV7J 1L3TA 2GX8A 4LRCA 1S6QB 3BREA 2HZAA 4C6AA 3IP0A 2DITA 1UVNA 1M0SA 3Q8RB 3KMQA 1N56A 2Y0SD 4WP8A 2AJ1A 2YQ3A 2IM2A 2H9ZA 4NA3A 2BW2A 3ZZ0A 1S0MA 2NUUG 3FJ2A 2NUHA 2BQRA 2LU1A 2DH9A 1VJWA 4EBCA 3QJLA 1RA6A 8RUCA 3MM6B 3CDBA 2EWHA 5FDLA 2AYEA 1BWVA 5HBMA 5CCLA 5ITHA 2M2BA 1MROA 4CNYA 4NA1A 5C24A 5F8GA 3B82A 2NZCA 3ADAC 3K8WA 4KH1B 2IJNA 3R2DJ 1LW0B 2VFUA 3RGIA 4LF5J 3GMGA 4B9MA 1RE1B 1FRKA 1NAQA 5CAAA 2J9EA 2JLGA 1WC3A 1YRUA 3ZTQA 1GTHA 2VDIA 1Q8LA 1CPZA 5HLFB 2I8EA 3D28A 2QMWA 2XYGB 2ZE2A 1D3WA 3KK2B 4URGA 3MFHA 3DOKA 2LXIA 2PA8D 4AL6A 4ICLA 4NXNJ 3R27A 4G1QA 1NK0A 2JZ5A 2UUWA 1S1XA 4OI4A 2MQNA 2NPIA 3TUIC 3W65A 1BY9A 2DNOA 1FDAA 2RRBA 3TNVA 3IG1B 5A8KA 3SSSA 2XYPB 2YX7A 2QJ3A 2UUBJ 2CNOB 2P9GA 4Y0FA 2V8HA 3IXQA 2XG8A 1NSQA 1S9EA 1LFWA 2HLTA 1SKUB 2XMTA 2VFRA 4X66J 4KBIA 3O8WA 1D9FA 3RB0A 3A8KA 2Y8YA 1HBUA 2BM1A 3KKFA 2KZZA 2V4JB 2C1EB 1OS5A 1K73T 4DR1F 2AJQA 1RDRA 4ZPVR 3KUHA 3ENVA 1WHYA 3VQSA 4YB1P 1UTAA 2QA4G 2KT5A 2XMMA 1VIXA 3EVMA 1S1VB 1HQEA 1RA7A 2PDAA 2RQ4A 2R7QA 5I42B 1MLAA 4NCAA 4C11A 5CHCB 3BS9A 3DMJA 2ZKUA 3KLGB 3VAGA 2AW0A 2X7IA 2KJWA 2IVFB 2EC2A 3CGIA 4F3QA 4AL5A 5L1JA 3EGVA 3TYTA 4F4YA 2R7OA 2ADBA 1UA1A 1O8BA 5KOWA 1N54B 4LRDA 2ZH7A 2XI2A 1TR0A 2WB4A 3W60A 4X4QA 3CCRS 3I9V9 3HHKA 1NK6A 4PXDA 3BSNA 5K9FA 3CJQA 4MYTA 3PG9A 4P75A 3OTEA 1JLFA 1H2TZ 4ZS6A 5HI7A 5KT6A 3KFWX 1SH3A 1CC7A 3DFEA 1RYSA 4ZN3A 3CCSS 4NLSA 1H38A 2CFXA 5DQHA 2DGVA 1RTIA 3LALA 3M8YA 1HNWF 3DLGB 2N82B 2OMOA 4ZPWR 3IRXA 2HEKA 4WYLA 1SQEA 1HNIB 2UVRA 3VAJA 4IOCQ 5JUMA 4MFBA 2G2YA 5KFGA 1TL5A 2G1DA 1Y3JA 1TQLA 3W5XA 1XC9A 4QYZK 2FLNA 1YKWA 2AJ2A 2E9RX 3ZTRA 1WD6A 4Q0BB 3U7JA 4ZP7A 2E1PA 4AYBD 3SXLA 4K5RA 1HD1A 4CWBA 2W7AA 3DLEB 1S7HA 5T14A 4P2FA 2MTLA 3CJTA 5DDQC 1VQPS 4JOUA 2GJFA 4WU2A 1B70B 3BPDA 4XIUA 4JUZA 4K5SA 4LR9A 3MPVA 1YGYA 2BMBA 4LREA 1D8YA 4Q2LA 5E3CA 5HMWA 5DRKA 3VWSA 3BSOA 1C1BA 2RS2A 1NUEA 3C8YA 1RHJB 5F8NA 2QL5B 5LMNJ 4OI0A 2CVEA 3H0PA 4Y28C 3CD5A 3Q86A 2OIHA 4HKQA 3EE3A 4U8VA 1HHQA 2FC9A 1REVA 4N7TA 2IM1A 2O67A 1XR5A 4ED2A 4DS4A 3B8HA 1TKXA 4QBUA 4KO0A 4TU9A 1MWQA 6AT1B 2PMZD 3IBCB 5I3QA 1FE0A 5THWA 1GMWD 7FDRA 4B3MJ 4NEZA 4V1Ak 2KZMA 1U0SA 1YWXA 2NQPA 4AQYF 3NMAA 3AA8A 4PEOA 1DFDA 1QLNA 2JC0A 1HWJA 3CIMA 2YX4A 4TKTA 5DJBA 3KHHA 1CULB 2UV8A 4FS2A 2CADA 5A0YA 1NPPA 2V67A 3UDVA 4ZVRB 5EUHA 3G8TA 4K50A 3I82A 3H42A 4OL8A 5IT9U 3G6ES 2E5GA 1SH0A 2B4OA 2RF2B 5KFOA 5H9FJ 1PKUA 4PUOB 4QIVA 4RBVA 1UPMB 2CQ3A 3PCOB 1PIEA 1UZDA 3I6PA 1KQGB 2PI4A 2VBWA 2WBMA 4DV5F 1SI9A 4R8UB 3QNWB 4CO3A 2KFNA 3UR0A 1U8SA 3TEHB 3DI6B 2CPXA 5DZ7A 4FF4A 5FDLB 1VCTA 2FYXA 4DEZA 2WHOA 3H25A 4ZIWA 1MROB 1TKZA 2RMLA 1VJQA 3CJ2A 4PWDA 2HRYA 3M2VA 3IS9B 2D3ZA 5C24B 1NJZA 2ZH8A 4HVZA 1FEHA 2CJKA 2PMWA 2CNKB 4ZP8A 5DM7Q 1I51B 1N33F 2LQ8A 5L9XA 4WE1A 4OQJA 3MM9A 3P8BB 2W9BB 4OYXA 2QMUB 2ZE2B 2CPJA 2G0CA 3DOKB 2FHKA 3M8SA 1IKVA 4Z37A 3V5RA 5KG6A 2VPYB 4HT5A 2K7KA 4F4XA 1RT2A 4USJC 4QR2A 1JLCA 5A8KB 2HQIA 1J5OB 3IMQJ 4DR3F 3JTPA 1PBUA 4EZ6A 4I6YA 3MPYA 4MKBA 3ZNJ1 2VA2A 4NCBA 5A6WA 4QIGA 4FF2A 3E2EA 4PG6A 1HPZA 1IM6A 1X5OA 1WDDA 3GCXP 4KGKA 3WDOA 1HBUB 1VRUA 3J7AN 2R8GA 2ZJQQ 1S10A 5D77A 3Q89A 4ZHRB 2RILA 4DV6F 2H51B 5EN1A 2GC8A 3KTQA 4NXMF 4M5MA 2B6AA 5KG4A 1IJEB 1P27B 2C2MB 4RL1A 2G1HA 1EQMA 4YP3A 4ELVA 1WG4A 3DRXA 4LSLB 1X4FA 5KG0A 4URQU 5D6GA 4F3MA 3LP2A 2M7SA 3HLUA 4LMZA 5CZVA 5LM7E 4KE5A 2AEFA 1HQEB 4M5GA 1Q79A 1Y3KA 4Z7CA 5A8WA 3VHQA 4F36A 3GCWP 3I55S 3TQEA 1M5PC 2V94A 4PPDA 2I6WA 3LP0B 4RBUA 2DNQA 4CO1A 2R2UA 2RU9A 3R1HA 4JI3J 5CYMA 1TVRB 1NCLA 1F9HA 3RBZA 1ZA2B 2IYGA 3NGKA 3MAAA 3CCVS 2DGQA 3UE2A 5ETLA 3SDEB 2EK1A 1SKRA 2W8KA 2HAIA 2OFHX 3PJ9A 1PO6A 1YK9A 1NEEA 3I87A 3UDLA 3BN7A 2DNLA 2FJDB 4A8SA 5C5JA 3CD7A 1BD6A 5KFPA 2J0WA 3A8JA 4LIWA 1T03A 2X1AA 1VFJA 1NNDA 2UXDJ 2LQJA 3M30A 3WQPA 3FQLA 1HWUA 1NBEB 3QQCD 1KC8T 1SJRA 1RTIB 3G87A 1L3KA 1QVFR 3KDOA 2JX2A 4WK1A 1FFSB 1BQMB 3HKZD 4EBEA 4HHHA 2WK4A 1Q4RA 5KG1A 5IT0A 3BR8A 4A48A 1J5EJ 4DR4J 5BYRA 3RR8A 1WHWA 3CEDA 1HNVB 3B6BA 1XNRJ 2GVZB 3OR2A 3JSYA 1N6QA 4LF9J 4I4BA 2R7WA 1IR2A 3I0SA 3GV8B 1NKEA 4OX6A 2HHWA 1ZPWX 5L1LA 4DDFA 2GHPA 1JLBA 1B64A 3BBBA 2Z4PA 3W9HA 5IM0A 2DTJA 4PG5A 2ZJRQ 2JC1A 3ULHA 1MU2A 3GZ7A 2XWXA 4DV3J 1W25A 2IFXA 5GAHU 2OPRB 3GR0A 4M5NA 3OL9A 1YX2A 2RE1A 1DARA 2YWGA 3CIZA 1SKSA 1GMVA 3UD4P 1F2GA 3BKTA 3G71S 3A3NB 1WC0A 1X9SA 4L73A 3G9CA 2Y1JA 2VH7A 2J76E 3BYRA 3KG1A 2OPPB 1RHKB 2JDJA 1WOPA 2IMOA 2H4YB 2CKWA 2EFQA 2V8VA 3D66A 4ED6A 2IIHA 4YR3A 2BUNA 3FMBA 3UVJB 3IA0A 4B3SJ 3V81B 3UDCA 3EVOA 1N36J 4N47A 2DNGA 1O5JA 2RQKA 4B3OA 3FKBA 3D5MA 2XSFA 5L39A 2XMAA 1H7XA 3TA0A 4QIFA 2FTRA 3IGVA 1I94F 1HL6A 2NS1B 4ZVTB 1HQUA 5G0RA 3PM9A 4DOZA 4J9QA 3M2RB 3DXBA 1FDBA 3H59A 4M5DA 2DNHA 1VC6A 4OZ1A 1JWWA 4LFCJ 4OI1A 4DR2F 2IHR1 5AXNA 4QR0A 4LVOP 1TKXB 4DV4F 4F7VA 1OQ3A 4C2MA 2QZ8A 3FZ2A 4EGLA 2MYFA 3MR2A 2M3DA 2FGOA 1AUDA 1LWCA 4NMXA 2ROGA 4RKUC 4F26A 5DS7A 3MD3A 5KFYA 4OI6A 2NCKL 2RDDA 2BYCA 3EUNA 4AUKA 3HVTA 2GVDA 1LK5A 4OV6A 4HI1A 4QPTA 3J80U 2VJVA 3LUYA 2ZH2A 1QUPA 1IWAA 1HR0F 4B9UA 4HH1A 5F41A 1Y0HA 2V2QA 1WORA 2N4DA 2CQPA 5ADZA 3AD9C 2W2PP 1AZSB 3JSRA 1KVJA 2N7CA 2K7JA 3CMAS 3GFZA 2LEPA 1DLOA 2ZHOA 4WK3A 3P45B 2ZOFA 3PHTA 2GQQA 3FUYA 3JAMU 4RW9A 4USMA 5F8IA 2DNPA 4CLUA 4LF6F 4PXEA 2H54B 4DLGA 2YKNA 1LXNA 4QWEA 2DVIA 5KFAA 4I6AA 4GKKJ 4W4MA 3HXMA 4GC7A 2KFYA 3PRBA 5BXIA 4DL3A 3FRYA 2E5JA 2OPSA 4ZCKA 1IM4A 2GHVC 1FJGJ 2DKOB 5H1SV 1U4BA 1YJUA 4KV8B 1QE1A 1FA0A 2JEIA 3O44A 3HHNB 3QWUA 2DR8A 5K5MA 2CQ0A 5KFSA 3BDEA 4N8NA 2CDQA 1NDKA 4Q7AA 5HANA 4DX8H 4K4SA 4ZLLA 3PDNA 1Q5VA 3OXLA 3T1AA 4R0EA 2V2ZA 1J2VA 1TFYA 1VS3A 3FDSA 5MLCV 2RH3A 5HROA 1T3OA 1VQ5S 4ZPBA 4NYZA 2XMJA 2HBZB 1VRTB 2KG0A 3HFVA 4XDCA 2FVCA 3I31A 2GAGC 2QE5A 3QGGA 3LP1A 3D68A 2F9JA 2CQHA 2GW8A 2Q66A 5M2UA 1SCJB 3TA2A 4O44A 1WTFA 4DSKA 1FI4A 5I3PA 1TUWA 5JJBA 4TYBA 2DR7A 5T41A 3SIPB 3W7BA 4JI7F 4LF8J 4H4OA 2UUTA 1FJ7A 1JLAB 1CJUA 5HJYA 4QPXA 4WZQA 4MT1A 4EWTA 3QT8A 1U26A 1Y10A 3ZZOA 2MY7A 4UQGA 3LP2B 4DV7F 3VGUA 1B4SA 1VQOS 3UNGC 3DXSX 5A6PA 1A6LA 1U47A 4KGMA 2FVQA 1HMVA 2BW7A 3NGUA 1T9UA 2MKSA 4DX5A 4PWWA 1T3NA 3D0IE 5LJ3Y 1XMQJ 1UL3A 4TLRA 4LRFA 2DCLA 1C0UA 2YNHB 3MOJB 4R25A 3C66A 4RLEA 1CVJA 2OEJA 2QLBB 4ID5A 2GIQA 4LR7A 3GFXA 4DL4A 1WSVA 2KHCA 1RISA 1LW2A 3TVYA 1NB7A 4KRWA 2E5LJ 3ETMA 4J9LA 3US5A 2BQUA 1UJ4A 4LF5F 2RKIA 2DIUA 3AB2B 2M5YA 3C14A 5B0BA 3P5BP 3KLIB 4C3MA 2J6UA 3D2WA 3IN5A 3D3BJ 4NXNF 2ZWOA 2H48B 2EFGA 4BS2A 2V8PA 3S01A 2VONA 4QWBA 3PW5A 2ZBRA 2BM0A 1PJ5A 2APOA 2X3GA 3PXGa 5IOLA 1RLCL 2IYIA 3T19A 2V69A 2EPIA 3OUYA 2CNNB 1K1QA 1JXLA 1RUSA 2J6TA 1XIQA 2MSSA 3HO1A 2UUBF 2C22A 3OR2B 2IY5B 1H73A 2CJXB 1S57A 3R7BB 3Q8QB 2Z0GA 5BJRA 3E51A 3H5SA 4X66F 1RSCA 5IM0B 4IRDA 3DU5A 3NWRA 5LXRA 5LSRA 3RAXA 3ILIA 3KUEA 5E3QA 1JLGB 2YVSA 2MKIA 4UQTA 4L74A 3U27A 4WIIA 3ITHB 1PBAA 4MKYA 1TK0A 5CD4A 1WOOA 2XHWA 3KK3B 4LRAA 3RB4A 3M8QA 2RB7A 4FKXA 2BJ3A 4R0JA 2MJNA 4YB5A 4IR1A 2C3YA 2B3TB 4A8KA 4V19X 1S4EA 3GIIA 2HPUA 1KEKA 1AB8A 3J81j 2ZNYA 3SQGB 2AGOA 2VG7A 4ITSA 5KT2A 3GIRA 1XR6A 4ZPAA 1E6YB 4M1KA 2VODA 3DOLA 1EIYB 2HG4A 4OIXA 5CABA 1ZAVA 2QA1A 1K0VA 3QT5A 3NXZA 1Q0NA 1NJXA 2WW4A 1RCOB 3UQSA 1KSPA 1AUSL 1D09B 1BQNB 1ICEB 4C3LA 3KNGA 2YNIA 3B78A 3D6TB 2HK2A 2G9OA 4HI2A 3CVKA 4K7QA 5C7PA 3HHEA 2F3JA 4X64J 3ET6B 2HVEA 1GFWB 4IDKB 2I38A 3LWLA 4ZMMA 3AD7C 1HW9A 4FF1A 1DQAA 1X7VA 1FJEB 1S9GA 2XULA 3MMCA 3OXFA 4C8ZA 1R7IA 2FJAB 3WX8A 3DCAA 3BQ0A 1SIZA 4E98A 2DNRA 2FPHX 1DTQA 4ECQA 4M5JA 4C8KA 3CO0P 3KK1B 4F67A 4LSZB 2FIUA 3T9NA 1KS2A 4B9LA 1Z4UA 2WVFA 2NXCA 3UCZP 3MECA 3W64A 4S0MA 3TOQA 1MWYA 1P1TA 1SXLA 4DPWA 2MJUA 3RR7A 1SJ1A 3HJFA 1FKOB 2HFZA 4RW7A 2G0JA 4ECSA 1IR1A 1HD0A 1ZAWA 4FYXB 3BGRB 1FTCA 3M8PA 1WNEA 1VBKA 2EFPA 4QWCA 4CNZA 2ERRA 3IR5B 3H2VE 3MM5B 4CLZA 5CCMA 2PFDA 3KLFA 2O5DA 3BF4A 3BBCA 4IO9Q 1YJ7A 3R5GA 3KYLA 3HVWA 2VG5A 1WDTA 1R0AA 4B17A 2VJUA 2R2RA 1UWAA 2DB1A 4RZRA 1KTQA 4OYAA 4DL2A 3DM2A 4J37A 1GXUA 3PYFA 5LMNF 3IR7B 2DH8A 4J9SA 4LRBA 2ZHAA 3UCGA 3M1VA 2IVMA 2WOMB 2WAQD 4RR5A 4KJIA 1U1PA 4YB7A 2F8HA 2C28A 2M9KA 2A2DA 3TX8A 2K1RA 3CCZA 1NKBA 3POTA 3L09A 1S1TA 1RTHA 3OJSA 4B9SA 1GQEA 1NU4A 4WTYA 4K4XA 5KOXA 3N6NA 1HBMA 3LP1B 2HVDA 2ZH5A 5I3UA 3FK4A 4A8FA 1EZZB 2FLPA 1XJWB 3KJVB 4IQXA 1RXOB 3DRRB 1YJVA 3CF5Q 4IKAA 3H40A 5ETSA 2B43A 2OO4A 1OMSA 2HKEA 1IBLJ 1RT5B 4OJHA 2ZM6J 1U1RA 4ZK7M 3PX6A 2F63A 1RYRA 2KXFA 3F73A 3L7UA 1BMQB 5KFWA 4P7VA 3TJAA 3EPIA 1WTBA 4CH0S 4RNOA 1U25A 2HFOA 4OYZA 2D3UA 2CA9A 2MHEA 3OSNA 3OTCA 2IRXA 4PPZA 4BC9A 5GADI 3V6KA 3K58A 1TL4A 4KGZB 2QA4S 1Y5NB 1YJTA 2FHJA 3PX0A 4DUZJ 1HMVB 1X4DA 3RAQA 3TAQA 4I2PA 2JJ4D 3NG8A 2A3JA 4MIWA 3PACA 3EZ5A 1C0UB 3FRZA 2XNQA 3OFHA 4O4GA 2CZ9A 4FBUA 4JI2J 1NDPA 1YVFA 1O51A 1B0PA 2RDIA 2HQGA 4R5PA 1RTDA 3QIPA 3H5YA 4IFYA 3J81U 2D9PA 3AOAA 3IBWA 2RKIB 3G2XA 4OHWA 1LXJA 1IVZA 1IKYB 4WF9Q 4C8OA 3PY8A 2B4PA 2B5JA 4JV0A 2AGPA 3TAPA 4KH0B 3N4WA 3DOMA 3JQKA 3RTVA 1F9FA 1S6PA 4JI0F 1RT3B 1T05B 3THPA 4PG8A 4NZ0A 5IWAJ 4K2JA 5J1PA 1VR6A 4LQ3A 2MZQA 4WFAQ 4IQMA 2QL7B 2XQCA 4DFJA 1NB2A 1S4FA 3MUVP 5EDWA 2XY7A 2E7WA 5DGBA 2JLFA 2KT3A 2LECA 3NNAA 3CPWR 1FXRA 4M5LA 3CCWA 2UZAA 2C2OB 4ES1A 2HNZB 1QDUB 4CYUB 3D0HE 4FBTA 3GONA 1SQGA 4LQ9A 5ETKA 1KVKA 3L7PA 1MMNA 4NZ7A 3L7OA 3R3TA 3TUJC 3E01B 1DZ5A 2LKZA 2BKOA 1YJWS 1HKAA 4GVBB 3OTDA 4N56A 1FX4A 1F2HA 2C42A 3NS7B 1WEXA 5L38A 4PRFA 2KB2A 2Y0BB 2A1BA 1RI7A 4C0HA 2BEFA 2HFSA 4CO2A 2QN6B 2WVDA 2NLWA 4MJKA 2WW8A 2VQEJ 2Z30B 4ECRA 1FF2A 3BM7A 2R8IA 3W2WA 3H4DA 3TZWA 1SV5A 1RKJA 4L3KA 4XAKA 3WHIA 2XMVA 2J0SD 2KTQA 4C0BA 1ZS6A 1NH8A 3CJKA 4TVAB 5JMNA 1RACB 1GTEA 1S59A 5HVHA 1VQKS 2NSCA 3CJ5A 4X4VA 2IA0A 5AE2A 4JI3F 4NE9C 1JLEB 2EG2A 3CCUS 3PW7A 1XTZA 3D54A 2RAQA 2BJ7A 1K44A 4C8MA 3M9MB 1T0TV 5J2MA 1QUVA 4K4TA 2V4RA 4YN3B 4KHPJ 1KP6A 1BLUA 3M7VA 4ECYA 1FKPA 1FRXA 4ECTA 5K14A 1TUGB 1L3UA 1XMOJ 3AJ2A 2XS5A 1IKXA 4TLQA 3MWBA 2UXDF 2XS2A 4YUDA 3LA0A 4RPFA 2O1PA 3ETOA 1BXNA 3FBFA 2VBXA 1S9GB 2AX0A 1XWLA 1NSAA 2GIFA 4HACA 3G6VA 5B08A 3HD2A 5B0DA 1J5EF 2ATCB 1PILA 3FBEA 4IG3A 4DR4F 1A7GE 4ZLPA 4DCPB 2R8JA 1XNRF 4CTAA 5DLGA 3RB6A 4LF9F 4J9UE 3QT6A 2SXLA 2YH1A 5J2NB 2WRMA 1KNZA 2MZSA 2W9CA 5GADU 3MMAA 3MECB 2C2EA 2R4FA 5HJXA 1WOSA 4AT1B 2HLUA 4NPOA 2F1FA 3GLJA 3AQPA 4DV3F 4F4KA 4NCGB 3FBBA 3B4DA 4NEYA 2M70A 2X51A 4OYBA 3MAQA 3M9NB 2YNFA 2F9DA 1RWKB 1UW9A 1D0EA 3ZTOA 1CQMA 2PFFB 4G6VB 4DR7J 2G13A 3MM6A 3D1HA 3I4HX 4PZVA 4PQUB 2PMHA 2DCUB 5IC6B 2CAJA 1G4CA 3NGDA 1IKWB 4ED3A 5FLXU 5M2PA 5HN0A 4B3SF 1VQYA 5IQ6A 2XLJA 1N36F 2DGOA 1GAOA 4NI2B 1JXVA 3SQOP 1QD1A 1U1OA 2Q3PA 2DHGA 2N4CA 3AHPA 3DM2B 4D3GA 5IT4A 1R6VA 3DLBA 4RBTA 3BDPA 3FGVA 2M8HA 5SUHA 5KFCA 4CLLA 1AXQA 4F2SA 5HQMA 5HLFA 4K4WA 3KK2A 1IBKJ 1OIAA 4LFCF 5E3RA 2CPYA 1R3NA 2XMKA 5KFVA 1OYEA 5KFXA 1FVSA 1Q81T 1Q8KA 2PI5A 1Q8IA 5HVFA 3AXKA 1SL2A 2HFVA 1V3ZA 4J9MA 2HRUA 1WACA 2HYIB 4C98A 3HSDA 2RVJA 3RW6A 4JI8J 3TO8A 1YZ6A 2HS4A 3C16A 3EMTA 1ZAXA 2DEIA 1NHKL 4DPOA 4ECZA 2B8PA 4FPRA 1UVKA 2R2SA 5DM6Q 2QSWA 3CJ8A 4X4RA 3SCLE 3DGVA 3THTA 2V4JA 3MDFA 1VOMA 3ZFVA 4O0NA 1U48A 2UP1A 4FNIA 3FCVA 1X9MA 1M5VC 3HM9A 4XDDA 2B9WA 4KTQA 1ZTTA 3DU6A 3NBPB 1EP4B 3QLHB 4ES3A 3EZOA 2G0IA 1S1VA 4QJVA 4XK8C 3PIPQ 3J7A1 2KDOA 5I42A 3HHLA 2OUGA 3CO9A 3J7Z5 2Z58B 4GKKF 4NRTA 3CCMS 1PGZA 3QIDA 4QW9A 4DV0J 2Z2YB 4DR6J 2KI2A 1V9OA 2LCWA 1SB6A 3HPOA 2ZZNA 5C25A 2EFOA 4F4AA 2YWWA 1FJGF 2BVZA 2MPUA 1RWVB 3J80Y 2R42A 3B54A 1UEKA 5EX0A 1UVIA 2W4PA 3KWMA 3AAWB 4J9PA 5BR8J 1R8PA 5DG8A 3M9OB 5KTQA 3TWZA 1BC6A 1H74A 3HSZA 3GJQB 2YNGB 4X4OA 3JAMY 2GS8A 2MB0B 4O0IA 1DHMA 4KGXB 4Y65A 4KY3A 4DX7A 3DOMB 4NLYA 1FXLA 3IM8A 3FSXA 4DL7A 2DPJA 1S6OA 3NNCA 2VD3A 1PC4A 3BKUA 4OV1A 4OYWA 3CMES 2W7OA 2OD6A 1SVDA 2QSFA 3DLGA 5A76A 1QSLA 1CJTB 3Q0AA 3I0RB 3EDRB 2IBOA 2ACMA 2CJAA 1HNIA 5J2QB 1R0CB 3V4MA 3AT1B 1NK4A 2EI5A 1K47A 1OYDA 4WPAA 4J9RA 1M5KC 1WI8A 1B7FA 2B9YA 2C2KB 2Z57B 2QYCA 4ILLA 1D8ZA 3OHAA 1RT1B 4YY3J 3VCDA 3N28A 1X4GA 2GZOA 3K5PA 4ZOSA 2R8KA 2PA3A 1G1XA 3ISNC 1VQ6S 5CA5A 4DQIA 1HYSB 1FVQA 3MURP 3NOGA 4LF8F 1WI6A 4W92B 4B3RJ 2CQBA 1SBRA 3A8EA 3HZGA 3KUGA 5K8NA 3J7ZT 4E0DA 1FE4A 3DC2A 4HTIA 3ENAA 4CM2A 3DLEA 1YJ9S 5AXKA 4UZCA 1RU2A 2CQCA 3MR6A 2ZBIA 2PGCA 4X2BA 2PEBA 4OFZA 2Q79A 2XGQA 1NSPA 2KVIA 4BC7A 4L76A 4TY8B 1HHSA 3NLCA 4UZBA 3RBEA 2BXJA 3TUPA 1N5QA 3HSJA 1F6TA 4Y34A 1XMQF 2E1RA 3QFWA 1KRPA 3CJKB 1RHMB 3EWGA 1YI2S 3CT9A 1YJNS 1TU0B 3W8GA 5KT3A 4QCLA 3ZZUA 1CJVA 3FCWA 5E3PA 1LEOA 2QL9B 3CJ0A 4P71A 2E5LF 2GGPA 3V6DB 4CO4A 4I1TA 5DO2A 1ZM2A 1D9AA 1Q53A 4UOHA 4DPXA 2CJ9A 4WKRA 5IV4A 3MCSA 3J7YI 2PSZA 5H9FK 2FY8A 1T02A 5M2RA 2VL1A 2AD9A 2QO3A 2NYHA 5K14B 2GCFA 3NGTA 3M32A 4M5HA 2CQIA 4I2QB 5KFZA 1YQHA 4PWUA 2R7TA 4ZVUB 3G6XA 2VDHA 3WX4A 1QAIA 3TZYA 1RBLA 4HACB 4Y00A 2QFIA 5KFFA 1SL0A 4DR1J 4WFXA 4G1PA 4IG3B 1FKAF 4DBQA 1X31C 4GO5X 1DAXA 4JI5J 3FEZA 4CTAB 2HWHA 4ED8A 2E9TA 4B9NA 2GIRA 5HSPA 2PE8A 2W9CB 4QIEA 2RF2A 1TK5A 2XB2D 4PUOA 1FD2A 4Z7YA 5B09A 1CSJA 2L9NA 4ELTA 3OVSA 2AHOB 3FMWA 2YQ0A 4UF4A 4ECWA 2B7CB 2YNFB 3VGSA 1Q95G 1NJIT 5EWGA 4JI4F 1YRXA 1RADB 4R8UA 1EKSA 3S7RA 1RWMB 1NDCA 3GQCA 3DI6A 4H54A 2BANB 2DXDA 2OFGX 1X5PA 4U9RA 2C2NA 3IS9A 4RW4B 1HBNB 4WWSA 1HQ2A 3R9LA 4FYVB 3I32A 4WFYA 1ZH5A 4CH7A 1IBMJ 2MQPA 1HARA 1K0TA 4NRUA 4DFKA 2LA6A 4Y2MA 3U02A 2W9BA 4CP5A 2WVEA 1RKIA 1S72S 2OKQA 1P9QC 4ECVA 4Y2CA 3PYEA 1NJWA 1Z2ZA 1IQZA 2DO0A 4WZMA 5J2PB 3EICA 1MMDA 1RK8A 1X4CA 2OSQA 1DURA 4IYQA 4J91A 2DXEA 2KU7A 2NSBA 4TU8A 1J5OA 4X64F 3C16B 1R8BA 1VI7A 2LYVA 4J7CA 5ETTA 4ZVQB 2OH2A 1NPRA 2E7XA 4CLFA 1N5SA 2DH7A 4ANDA 2W8LA 2YPYA 4P72A 3MR7A 3CSKA 2IM0A 4KSEB 2JLEA 4C3KA 2Y1IA 1WC5A 5LMUJ 2QV6A 2ADCA 1U09A 3TVKA 1SC6A 4B9TA 2QIFA 4DCOB 1MSWD 5F8JA 2FJVA 4ZHRA 1URNA 3PEJA 3AQOA 3SZ2A 1AFIA 3BYPA 2CG8A 4BCAA 3TW0A 2VICA 4LF1A 4V19J 4LSLA 1FJCA 2W01A 3Q22A 3JSBA 3OL8A 3IRWP 2GQ2A 1DJ0A 5B7WA 1IBCB 3H5XA 1Z1ZA 4DL5A 4ZIVA 3HHLB 1R8CA 4TQSA 1NH7A 2B51A 4CT8A 1TV6B 1RBAA 3F0NA 3LP0A 3K7RA 5C25B 2CPIA 2W9AA 3ILOA 2BOAA 2ALYB 1FD8A 3QSIA 4QYRA 3DLLQ 3NOCA 1TVRA 3KJNB 2XGPA 2H3EB 3KDNA 3DYAB 2BE9B 5C42B 2CPFA 1CJKB 2W4CA 3SDEA 2DHXA 5E3AA 2E1CA 5HP1A 2LEAA 3C19A 3AJ1A 3J7YU 4HR2A 4M8LA 4RU9A 3LPYA 2HHQA 2BE2B 2B8QA 6FD1A 1W2BR 1K9MT 3QWPA 5B0AA 1TMJA 2RUSA 2DT9A 4Y6IA 3SI8A 2VV5A 4UW2A 4F8RA 2BACA 5EWEA 3IWXA 5HMZA 2VB6A 4CLSA 3BJYA 2MKJA 1BQMA 3V4IB 4ZLNA 3M6UA 4YHHJ 4ED0A 2ASDA 1EETB 3FQKA 1RT7B 3W61A 3ENQA 3BSCA 2HVIA 1UFLA 5IFMA 3SCIE 3PVXA 5CQGA 2L3MA 1HNVA 2L48A 3TI0A 1WG5A 2GVZA 3KG0A 1RABB 4K0KJ 3AD8C 2LMIA 1YTYA 4MTPA 3NKYA 5AE1A 1RCXB 1IBLF 1A0OB 2ZM6F 5F3ZA 2XO7A 2OAUA 1RWNB 4Q45A 2UUCJ 2AJFE 4AE5A 2L41A 4YDDB 2N3OA 1ZZFA 4ZLJA 2OPRA 5K8MA 3BBFA 1BQXA 1KONA 2J9CA 1FX2A 3VAFA 1S48A 2VKZG 1FFWB 1DTTB 1XQIA 2OPPA 3UR3C 3RUBL 1CS4A 4OX9J 2DY1A 3MCNA 2MXYA 5JVGQ 2V0NA 2H5IB 2XM3A 2ZJPQ 3UVJA 1N33J 4C8YA 2XHCA 3V81A 1VYAA 4WBFA 1X0FA 1FERA 4H4MB 5L1KA 1UAWA 3KMSA 2BJ1A 2MDAA 3R5CA 4NZ6A 4JI2F 1CJVB 3TX0A 4GRSA 1ZYQA 3K5OA 3MMBB 3ZZZA 4ZCLA 3RW7A 2B56A 2YY3A 3QRPA 5GMKa 2Q43A 3M2RA 2MKHA 1DQ9A 5GAGU 3Q8VA 2GGPB 4HDGA 3MMJA 3HDSA 1GH8A 3T9ZA 5G4DA 5ETOA 2LQ5A 3R7SB 6FDRA 2NPFA 2I1RA 4UOCA 3N6LA 1KQKA 1P9YA 4XTTA 4RNHA 2BE7D 4ECUA 4KGVB 4NLTA 4FDFA 2AP6A 1T9XA 3DGPA 3DHWC 3M32B 4TQRA 1IQTA 4F02A 1G6BA 3RRKA 5IWAF 3QO9A 2HNYB 2VOOA 2P9EA 2YKMB 2DO4A 2GO8A 3M2UB 2W25A 2BJ8A 2YQ1A 3ONQA 1VQ7S 2MGZA 1G2EA 3MEEB 4EK2A 2ZDPA 3G82B 2QT7A 1YIJS 3K89A 3LF0A 4RNNA 4KFBB 1K1SA 2QLXA 3V6JA 1WF2A 1AZSA 3EGZA 3D4JA 2KYZA 1B99A 1W26A 1H2VZ 3HF5A 2AX1A 2ZOMA 2AZ3A 3ILLA 4NLGA 5EGYA 1QTMA 3FNNA 3WZ0A 3VALA 4LIRA 5GAHI 3MF5A 4DLEA 1EHWA 5C2GA 2R7XA 3DN9A 1U45A 2E9ZA 1HNZJ 2ZH9A 1KHWA 1HBOB 1B7YB 4J90A 3SMZA 4QU6A 2VC0A 3CCLS 3MGJA 3PO5A 5FD1A 3LO3A 1RBOB 3NAHA 5HO4A 1Y9OA 3GSDA 2VQEF 1R6YA 2KXNB 2Z2LA 3AOBA 2DGXA 4ANEA 3THVA 5DDPC 2D7SA 4KV8A 3VZHA 1JKHB 5D0HA 3SV4A 1F0XA 2I5JA 4A4JA 3GB0A 3PJXA 2IRUA 3DLKB 3F56A 2AJ0A 2IAJA 3IR6B 4WU3A 3ZZTA 4NASA 2HNDB 1XERA 1H7WA 1OPIA 3KHRA 3JQMA 2WZ1A 1LWFB 4M5IA 3HD1A 2FJBB 3MHYA 3NNHA 1PJ6A 4KHPF 2VASA 1S5ZA 3GFYA 2A2CA 1VQMS 4DV1F 5H9EJ 2X1FA 1NK5A 2WONB 3CC4S 5F0WA 2HSEB 4USWA 3RBXA 1VRTA 2YWEA 2IRYA 1L3VA 4ZDNA 2I9SA 3MM8B 1XMOF 3AODA 4C97A 2XMWA 1M5OC 3T1HJ 2ZZTA 3VAKA 4DQPA 4FF3A 3ZNUA 1NK9A 2QRRA 1R31A 1YBUA 5LT5A 2PO4A 3Q24A 4ETZA 1NDLA 5F0UA 3BH6B 3O6QA 4OHXA 3Q8SB 2J0QD 3AXMA 3FCHA 4ECXA 3H8YA 1Q1KA 5IV3A 2KO1A 2H65B 3IM9A 4U8YA 2X3DA 1AFJA 2L08A 1JLAA 4TXSA 4X65J 4RU2A 4M5KA 1ZM3A 2HIQA 3DRPB 5GMDA 1MWZA 2V9KA 2QGFB 2OD4A 1H0HB 4ZPDA 5DG9A 4YS2A 3TEGA 3PO4A 4Y2KA 3MOZA 4WCEQ 2AWZA 1SIWB 1RT6B 3RB3A 3HI9A 4I0WA 5A8RB 3O5TB 5DLFA 1HNXJ 3T1YJ 5D0RA 2ZC3A 1LNQA 2R7SA 2FB0A 2Y8WA 4DR7F 1RTJB 3GE9A 2YNHA 1CEZA 2IMWP 5KFEA 3GFHA 3TP2A 2XO6A 3W9IA 3U1LA 4ALZA 2Z2ZA 3T41A 1EAYC 1P1LA 5HAOA 4OLPA 2M52A 5HP1B 1KR4A 2UXCJ 1WSRA 2NR0A 5AT1B 2F7VA 3BSAA 3MTJA 4A8WA 4GVLA 2MKYA 2GA7A 3KLIA 2O66A 1WKLA 1NLKL 1IBKF 1V3SA 2CWXA 1N5YB 3QZ8A 5HMXA 4DF4A 3N6MA 1GK8A 4FYDA 3O2IA 4LF4J 1TL3A 5DGAA 2UU9J 3OBIA 4HHJA 1RB0A 1VMBA 3MD1A 4JI8F 2QEXS 1T8EA 3W8PA 3VR1A 1EJ7L 3M8RA 4X4TA 4ZCMA 1UEVA 1FCAA 3N0VA 5KFRA 3Q2SC 1DBDA 1KKHA 4J5OA 2ZDOA 1U24A 3BQ1A 4UOFA 5IS2A 2ZH1A 3Q8YA 3SCKE 2VBYA 2CPDA 2V68A 1WF1A 4ZA1A 4KHRA 4OZ0A 1JLGA 2V50A 4O23A 4FNHA 3GSIA 3ITHA 4DX6A 1RAHB 4CO0A 2OMLA 2DBBA 2E66A 2JSXA 3KK3A 1X5TA 4TNOA 1B3TA 2F4VJ 1Q86T 4QR1A 3VVUA 4JB8B 1UJ5A 7FD1A 3UW1A 1RWPB 2VQFJ 2EBGA 2C3MA 1CS4B 1Q5YA 1U6BA 1E6VB 2MQ8A 5LSLA 5L8RC 2JEGA 1T7PA 3JYTB 3P6YC 4P2XA 1X60A 3NL0A 3PRVA 3SQGA 4ANCA 4DV0F 2L9WA 1RT4B 3MEDB 4DR6F 3P96A 3TAMB 1N52B 2MQQA 4IRKA 1E6YA 4BDPA 3D7SB 1R0BG 3CJSA 1V3RA 1S1WB 3KJQB 4PXCA 4LR8A 2LXFA 2Y3YA 2E1MC 5BR8F 3EDQB 4WFNQ 5KFNA 2YX1A 4AXIA 4YEAA 4AFFA 1U1NA 3A1YG 1LK7A 4LF7J 1UMJA 2B4UA 1LKZA 1BQNA 2MLZA 1KBRA 2DD8S 1U0HB 2E7VA 4JBCA 3JTNA 3MM7B 3GJTB 2DR9A 4KKOB 1N34J 1NMEB 1JJHA 3DGPB 3UN2A 3PFOA 1UPPA 3ET6A 3L3CA 4IDKA 5K20B 3K57A 4OLOA 2GJIA 3QO9B 2MLXA 5ETMA 3W62A 1U1KA 4KPYA 4OYOA 3HVAA 2DEJA 1U2RA 1L5UA 5KG3A 2MGZB 3KLEB 2EEYA 3JSMA 4URSA 2E5HA 2ILYA 1OPZA 2ZEJA 3GPAA 4YDXA 4RW8B 4HL9A 4YY3F 4NYOA 3UNYA 3I5AA 2AU0A 2WSEC 3KK1A 3Q83A 2KVQE 4TU7A 4DQQA 3RG6A 4DFMA 5K8PA 1UVLA 3LAKA 2KM8B 5IC4B 2D3OR 1VBXA 2DNKA 4EO8A 4B3RF 1WF0A 2DGWA 5DDRC 3CJRA 1FKOA 4RUHA 3C6UA 5LJ5Y 4TY9A 3NP5A 1H2UX 4HYKA 2ZWPA 4KPCA 3BGRA 2VIHA 2FDNA 3I96A 3LGNA 4F25A 3MM5A 3CXCR 4RX6A 4Y2IA 3R2CJ 1FEEA 5CD4H 5GAEU 4K4ZA 1WJ9A 4L3NA 2FVRA 2D9OA 2UUAJ 4RUBA 3KHGA 2X1GA 3OR1B 2HHHJ 3PIOQ 1W7WA 2P6TA 5FIIA 5KFUA 5D3GB 2I5JB 3KXDA 1ULRA 5HQLA 3HX9A 2J0XA 2IAJB 4DSFA 2MLYA 5E0OA 1QAJA 4FYWB 3CNQP 1HIYA 5LL6d 5ETQA 2QLFB 3PR5B 4OJ1A 4DF8A 1G3OA 1LFPA 2WOMA 2J7UA 2IC3B 4PR6A 1FT8A 3M6XA 1LWEB 1S6UA 5F8MA 4X62J 2HQFA 2OEMA 2VPWB 3FSIA 2KFZA 3PEHA 1S79A 4A8QA 1TKDA 2HBRB 3TARA 4K8RA 2V5HG 2EFNA 3BO3A 1N88A 5F9LA 3HZEA 1PYOB 1JXEA 1F5CA 1VRQC 3KLHB 4LSNB 2ZH3A 1Y5LB 2I0XA 2V4QA 1C2PA 2O3DA 1SC1B 3FEYB 5AXMA 3GIMA 2VA3A 4G3IA 3OFFA 1R27B 3KJVA 1JNZB 1M1HA 3LOUA 3DRRA 1GT8A 2ZZMA 4DUYJ 2HWIA 3BH7B 3DDIA 9RUBA 1RT5A 5I4MA 1FWLA 4WFBQ 4CZCA 2BABA 4JI5F 4O3QA 2KYXA 2VU5A 1LWXA 1LV5A 2JL9A 2ZUAA 2BRKA 4FPIA 3K5MA 3G6YA 3EJMA 3D6MB 1TAQA 5E2QA 5D4OA 2IPOB 1FFGB 4DFPA 2W1BA 3BO2A 4QOTA 2DPIA 2R7UA 3AY0A 2YPZA 4USVA 2IDEA 2H1YA 3OD2A 2FGCA 1ACMB 4UTGA 1GEHA 1OY9A 1KOOA 4USKA 2AMCB 2F8EX 2XS7A 1VBZA 2HHSA 3QJJA 2R8HA 1YJRA 3GIKA 3OTOJ 3UN5A 1RAIB 2W7PA 2FVPA 3BB5A 5A2QU 2FZCB 2G2ZA 5HVGA 3KLVA 4ID8A 2HWTA 2AYMA 4N8OA 1IBMF 1ZA1B 1OY6A 1IKYA 2ZBPA 1RWWB 2ZOGA 4P9SA 3MAHA 4QWAA 3QPIA 3RRGA 1HW8A 1F60B 1WUUA 1FNMA 2UVUA 3VZIA 4I68A 1RT3A 1T05A 4DG1B 2C3PA 1M5SA 1TL3B 1VQ9S 2IJFA 3NMRA 2GNKA 2CNLB 2JNJA 3ZTPA 4NLQA 4J9OA 2AT1B 2AEMA 1U1MA 3RBDA 2IDLA 4P73A 4DU7A 4L72B 3ZXWA 3I4PA 1XEZA 2HNZA 3SEOA 4CYUA 1OY8A 4PYDA 5LXYA 2VKRA 4ZCIA 5LSOA 5IZHA 3KJFB 4LFBJ 2PEHA 1WKJA 3E01A 5LMUF 5B0GA 4J9NA 3W2VA 2EC0A 1S1UB 3QT7A 2B9EA 4GVBA 4MKVA 4DZ6A 1T9YA 4D3HA 2ZH4A 1YITS 3H90A 1JMTA 2HZVA 2E29A 2EKNA 3UI3A 2WVBA 2MKKA 2XY5A 1GMUA 1S0OA 3I9ZA 1KN6A 2R3VA 5BYSA 2VZ9A 3PRDA 4IFVA 4PAAA 2CDRB 1O0PA 1UA0A 1FK9B 4DPYA 4ED5A 2J9DA 3TR5A 1T94A 1FNOA 3H5UA 3BGLA 2B9XA 1X0PA 4N5SA 3C6TB 4IR9A 4HT7A 2RSQA 2O01C 2DRBA 3OL7A 1JLEA 2MSTA 4NLRA 3VAMA 2ASJA 2KXHA 3CJ4A 1PC5A 4HTJA 5B0FA 2K3IA 2IJRA 2HURA 2NXUA 3MTKA 4OYMA 5ETNA 3W3SA 3X1LB 2P6SA 3IAS9 4MAKA 2Q1LA 4Q5VA 1PYSB 3GG1A 4OZNA 3K17A 2A18A 4MIBA 2CJBA 5HK4A 1NZAA 2R7VA 3C15B 3UD3P 4MMOA 2X1BA 1G7CB 4MYUA 4DN0A 5T7LB 3R97A 2LDYA 4QU7A 2MQLA 3T5HA 1V5VA 1ZBTA 4YHHF 3QAEA 4IOBA 1N5VA 3PJWA 4RNFA 1K8AT 4C0OC 3JSMB 5GVQA 4ZVGA 3MR5A 2DHAA 4Y3CA 1JLQB 3DLJA 1WC1A 4I7FB 2AYGA 1CBKA 1TKTB 4K0KF 1HWLA 5J2NA 1PSDA 2CQ2A 5JVHQ 4NLVA 4E2FB 5AE3A 4DSIA 4ZPCA 1VHFA 5L46A 2LA4A 1PYTA 4NOHA 2UUCF 4IH7A 4EYHB 3WBZA 2ABYA 4NCGA 4ZP9A 4ED1A 2XTJP 2FHJD 3C6UB 2RHSB 4NL5A 1NK7A 2OELA 5HBMB 3RAMA 1XNQJ 4LJMA 2HS3A 3QJPA 1RP5A 1NRKA 3GYNA 1NK8A 4OX9F 1ZETA 2LVWA 2DHHA 1RHRB 4PQUA 4DV2J 2F5GA 2M4MA 4OHYA 1HI8A 4L75A 2MZ1A 1IKWA 2HS0A 2YXLA 3T5KA 3UWTA 4DQSA 3G86A 4NI2A 4X4UA 2OHDA 3H4BA 2HVHA 3HMJG 1X4AA 5HQ8A 2CQDA 3BO4A 1UZHA 1HHTP 2RJZA 4PG4A 4BBYA 4ICLB 4WTOB 3OVBA 4JI0J 4G1QB 1M5HA 1N32J 1S1XB 5KFMA 3MCOA 3D1QA 4ZJLA 1YBAA 1GMWA 4I56A 4IG0A 1VK3A 1D9DA 1Q7YT 1Q16B 3TQ1A 5F8HA 1DRZA 1F3VA 1O6XA 5KFIA 2YKAA 3CMQA 2BKNA 4DXLA 2UXBJ 4PYAA 4U6PA 5EX3A 3UCUP 1NPKA 1T9WA 4B3MF 4LF2A 1S9EB 3A12A 5J1EA 2FZKB 2ZFHA 2VUGA 3TZZA 5DETA 2CYYA 4C8LA 2RQCA 3G96A 4ZPTR 1PG5B 4ED7A 4JV5J 2J5AA 3QGHA 4CI0B 2VHGA 3AJDA 1KOHA 1TAUA 2P8IA 4Q44A 1S97A 2DNZA 2DNMA 2Z56B 2MHNA 4O3SA 2HQDA 4WP9A 2DR5A 3TJ9A 4JI1J 8AT1B 2YH0A 1SKWA 4F3OA 2DGTA 2XBPA 2GFFA 3LGMA 1KFSA 3KOAA 1RGVA 2ILZA 1KWMA 1CLFA 4DL6A 1QTNB 2EXUA 2XY6A 3GYGA 4W98A 4ES2A 1GX6A 3NBPA 1EP4A 3QLHA 2H4WB 4U7CA 4WFZA 2A0FB 1BHNA 4HLBA 1MW7A 5D0EA 2AKWB 4C11B 2VBZA 1I1GA 3DMJB 4BWJA 1R89A 4IO1A 3D6FB 1WG1A 1HNZF 2M0GB 2B7BB 2ZVSA 4N41A 4FP9A 3U1NA 1QVGR 4IUFA 2ATLA 3EGWB 1W2IA 3CULA 3QYYA 1PJ7A 3OQ2A 2MZTA 4FVMA 1DQ8A 3QZ7A 4GMKA 2LQBA 1TL7A 3HKWA 2WSFC 2BA9A 3UDEA 1OSDA 3E3XA 4DHVA 1L3SA 5IT9Y 3GP9A 4J9VA 3PW4A 1JLFB 3ENWA 3N01A 3W5ZA 3ELHA 2CIMA 2CJQA 2YNGA 4DR5J 1HA1A 2QC3A 2BJEA 5KFHA 5CXTA 3FBCA 2DR6A 1FDNA 4L6V3 2V8DA 5HL7Q 2MQMA 3GJSB 3EPGA 3BQ2A 1SUQA 3FVYA 3IRXB 1FRMA 3LPEA 4WJBA 3MFIA 4EFAC 2KL8A 4TYAA 3N5FA 4ETXA 4MFBB 1OSCA 1CJTA 3OLBA 4HHUA 3I0RA 1FRJA 2NYIA 2VC1A 5J2QA 1VC5A 4OHZA 3BEGB 1YSJA 1PAEX 3T1HF 4DN9A 1TZ0A 2L9DA 2XSJA 2D3O1 4USIA 3CE8A 2K06A 1TL1A 1UFKA 5U47A 3NCQA 4I69A 3MZIA 3PW0A 3AB4B 1RT1A 3NGRA 1EARA 4LBIA 1NZ8A 1VQSA 1RAAB 3LANA 2GMJA 2ROPA 4KQZA 1HYSA 5AJ3J 3W2VB 1AROP 1SJ4P 4P2MA 1VK8A 2UVVA 3KHLA 2U2FA 1UJ6A 4KT0C 1U1LA 1X4EA 5D78A 4X65F 1JIHA 1HI1A 1H6KX 3MPDA 4CIOA 3R6GB 4RW6A 2CWKA 4FZVA 1UWBA 2DNYA 1RAEB 3S1TA 2CPEA 2OP5A 2FHMA 1U02A 3VV2B 4DL0C 4QYZJ 1C1BB 4IFVB 1IN0A 4RJVA 4TY8A 2DRAA 3KG4A 3HFKA 2PD1A 4JP8A 4ZVEA 1S76D 1HNXF 4DSEA 3T1YF 4U95A 3HT3A 1FESA 1VIOA 1ROFA 1JQGA 4DUTA 1HWIA 4F50A 1FO1A 1REVB 4EYIB 2KKHA 1WHVA 4F04B 1T11A 1NM2A 2RNEA 3V6DA 4KO0B 2YKOA 1S12A 3RRHA 1FRIA 4B3TJ 1RAGB 4PKDB 2UXCF 4NLUA 3M6VA 4P52A 3IGNA 3R5DA 5L9NA 4LT6A 1HWKA 4K4YA 2W4DA 4FXDA 2W2QP 2VOPA 4I2QA 1I6JA 3MUTP 4A8YA 3IWNC 4N77A 4LF4F 5A0YB 4EMDA 4HDHA 2UU9F 2J8SA 1WKKA 3FZBA 1UW4A 3CCTA 3HULA 4MIAA 1NSKL 3CCJS 2C3OA 1CC8A 4P2SA 3CD0A 4ZP6A 2U1AA 2D1CA 1QAXA 1Q7LB 2RS8A 2D69A 3UD5A 3GILA 2W2OP 2HVZA 1XN9A 4DZDA 4FXWA 2G2OA 3BV8A 4W90B 2V63A 2HW3A 3M05A 3VGVA 1IJFB 3PKMA 5F3TA 2RQMA 2GV1A 4NLWA 4JI6J 1QJHA 3TANA 2E1AA 2R2TA 1ZOTA 1NKCA 2F4VF 3HHLD 4ZVFA 4E8UA 1UVJA 2MZJA 3VTIA 1TKZB 3HSGA 5KFKA 4PWDB 2E5IA 3M2VB 2VQFF 3MXHP 2WB1D 2OTJS 3WIVA 2QMXA 3DRYA 2BANA 5KT7A 4ZVSB 3NS5A 2E44A 2HHXA 4DWIA 4QW8A 1X8DA 1NXIA 3Q8PB 3LTOA 3M8WA 4RW4A 1HBNA 1IUJA 4WE1B 4CDIA 4KYZA 2ZKTA 3BR9A 3N9UC 3MM9B 2BOPA 1QY7A 4F0KA 4YB6A 1RJJA 1IKVB 3HHLC 3G8QA 2YTCA 2DY9A 4O3PA 2P9CA 4WXWA 1RHUB 1RAFB 4HH0A 3LW5C 2HHVA 1TK8A 2F8MA 1RT2B 2AF6A 4IG0B 4CLPA 4B9VA 4LF7F 1JLCB 4LFAJ 3D3CJ 3GU0A 1JK9B 4OI3A 5J2PA 2Y9HA 3OFGA 1VDHA 3VGTA 2MKCA 4EEYA 2DNNA 2HGMA 1N34F 3TA1A 1YDLA 1S77D 1AA1B 1H72C 5BYQA 1I3OB 2HBQB 5AXLA 3K5NA 1VQNS 4CLYA 5J1EB 1HPZB 1RU1A 3OJUA 3CDWA 4O3OA 1VRUB 4QQBA 1TELA 2LEBA 3EX7B 2KHDA 1P8GA 1U2FA 1FNXH 2Q6CA 2RD5C 2FY1A 2B6AB 2DK2A 4B08A 3LAMA 2YWFA 2Y1LB 3ILJA 3MI7X 1JNRB 4A47A 4O4RA 4O3RA 3SSQA 2A6OA 4ED4A 3ZTSA 3M6WA 2KT2A 3LQVA 2FD2A 4GC6A 4ILMA 2N3LA 3TZXA 5A8WB 2IBKA 4C7QA 1SC4B 4OJGA 1VLOA 4GKJJ 3EVWA 1RWUA 2LQ9A 2CVIA 2BJDA 2IVYA 1RWXB 4X4NA 3CUNA 1XR7A 4EI2A 4U7UK 3MCMA 3KNAA 2HQCA 3BZQA 2ZH6A 1KHVA 1VHIA 2RRNA 3LWMA 4OI2A 1S7IA 3AOCA 4NLPA 4PCQA 1BGXT 2HFUA 1TV6A 3JQJA 4RUAA 2P2CB 4Q8FA 5CYMB 4QIWD 4ZVOB 3G8SA 5KFBA 5LOQA 5D15A 4EZ9A 3MR3A 3H20A 3MAAB 3F41A 2UUAF 1C0TA 4YFUA 3NY0A 2HHHF 1F9EB 1RHQB 1NJYA 2R7RA 2G4BA 1TL7B 4UT4A 2MZRA 3DYAA 5C42A 4G65A 2VG6A 1CJKA 2KJVA 4EUVA 2CJYB 4Y2AA 4N76A 4XPCA 4JYAJ 1RZMA 1FWPA 1OQ6A 3K59A 1T03B 1Y00A 2BE2A 3M30B 1MMLA 5L1IA 1RAJA 2ALZA 2HFNA 2ZITA 1ELOA 3K5LA 5ETVA 3D1OA 2AIRB 1SUQB 5KFTA 4PABA 3CC2S 4X62F 1MNEA 1DY3A 5KFDA 3Q23A 4GO7X 3ISND 1N8RT 2N7YA 2AYBA 1RTZA 3CB4A 2LP4A 3V4IA 4DPUA 3GV5B 1SJ3P 1UP1A 1EETA 3AH6A 1T9VA 1RT7A 2XZWA 1N6QB 3EXCX 3OW2R 4ERDA 3I0SB 2XSJB 2MMYA 3MPWA 1SQFA 3N79A 3TUZC 1XMBA 3K2YA 1TL1B 3BKFA 1URRA 3QAUA 1JLBB 3GJRB 5E7OB 1MU2B 2PN6A 2BZ2A 1WC4A 4DUYF 2Q6BA 3R8YA 4USUA 1YBTA 2VFVA 5KAKA 3SFUA 4JI4J 4BHQA 2HAFA 2CG4A 3IO1A 3WIUA 2JOQA 4CLKA 2I2YA 2JEJA 2HQ3A 3CDAA 2RHQB 2AZ1A 2Y1RI 4RW6B 1VQ8S 2WBRA 1UWBB 1M1GA 2K2PA 4OX8A 1DTTA 3MPUB 4H4KC 4P10A 2BRLA 4NMLA 4YQWA 3ZZRA 3G4SS 3PYGA 4Q2MA 2MQOA 4B3OB 4C48A 3A3PB 3CJ3A 3BGUA 1FRLA 1FTRA 1FRHA 1HQUB 2NXJA 4OYPA 3Q2TC 3C46A 1XBWA 4UY85 5G0RB 4H4MA 2XZDB 3CW2C 3PFEA 4M5DB 1JJ4A 3TJ8A 1Q8BA 3FSYA 4NYPA 1GNKA 2JFDA 1PCAA 3MMBA 4G1IA 3OTOF 5D8HB 5KFQA 1RLDA 1UFWA 2DXFA 4ZVHA 2HHUA 4QZVB 4TN2A 2VPXB 1EX8A 4FVCA 3PNIA 2RRAA 4XO0A 2A6MA 3A13A 3C2PA 3DHXA 1ITPA 1LWCB 2CXEA 4DS5A 2BDPA 1C1CA 2CZ4A 2KN4A 5RUBA 1N4LA 4ZITA 3HVTB 4NWBA 1N0UA 2GVDB 4AL7A 2KH9A 1U8WA 2MEWA 2ACYA 2HNYA 2YKMA 2XI3A 3M2UA 5KT4A 1UKUA 2QYGA 2RT3A 2EFVA 1GX5A 1HI0P 5A2QY 2NZ4A 3MEEA 3R7NB 2KRBA 3IAM9 2AV5A 3NGSA 2XNRA 3G82A 4H4KA 1XK8A 2DIVA 2FJWA 4KFBA 1DLOB 2ZD1A 4USHA 3CCES 1QM9A 2FVSA 3PR4A 2KRRA 3M8ZA 1S0VA 4RW9B 3K0JA 4LFBF 3CDEA 1REGX 3DKDA 1YG0A 1Y4ZB 1S0NA 3QGIA 2OI2A 2YKNB 4WYWA 3QGPA 2BR0A 1KTVA 1T9TA 5CZXA 4RUCA 3DNCA 2EG1A 2OPSB 3SSRA 1HBOA 1UETA 4CT9A 1ZZNA 1WHXA 1H98A 4OZ3A 1QE1B 5H9EK 4DI6A 2RU3A 1V6HA 4M63A 4CLWA 4ILRA 5EHHA 4UY8T 4ATNA 3OV7A 3UPFA 2D41A 2HMIA 1JKHA 4NLOA 3SV3A 3WC0A 3QFHA 1SL1A 4OJ3A 4F4ZA 1GXLA 2UV8G 3DLKA 5ETRA 4FKYA 1R43A 4LVNP 1J27A 1EB0A 2HRTA 5ETPA 1WWHA 2HNDA 3W1YC 2H5EA 3B4MA 5KT5A 4KC5A 4P7TA 2IA6A 1KLMA 3FC9A 3BPSP 1QAYA 5HATA 5HROB 1LWFA 1HNWJ 5GAGI 3CCQS 2FLOA 2FQQB 2QFJA 4X4SA 1YHQS 2NXEA 3CTRA 4OZLA 1UCNA 5CYJA 2WONA 3IFEA 4F0MA 2QTWA 4CO5A 3OHBA 4O44B 3MM8A 2W2MP 1SJQA 2V2VA 2DHSA 2K3KA 4DJBA 2GAHC 4AD6A 2YWKA 4FS1A 1U2CA 3FFIA 3O3LA 1N48A 4I64A 2D74B 2XLKA 4K4UA 4H4OB 4O3NA 4A8OA 3AA9A 3DRSA 2FC8A 2GHWA 3MUMP 5EWFA 2JEFA 2YBVA 1CJUB 2CQ1A 2AQ4A 3W66A 1I5OB 2FJEB 2HK3A 5D4LA 3QATA 1WEZA 1TTHB 4RWWA 2J7WA 5KFLA 4MK8A 5DDOC 3VAHA 3DRPA 1MG7A 2RUGA 1WC6A 3NCRA 5F8LA 4ELUA 2W2NP 5J1NA 1M1KT 4CLTA 4CM0A 2ZC4A 1QSSA 3L9ZA 3P5TL 1IWGA 1RT6A 1ZTWA 5A8RA 1FWKA 1BUXA 3M4XA 2PC6A 2B0GA 1D1UA 2XZTB 4ID5B 3OFEA 1XNQF 1RTJA 1LW2B 3R1LA 5FJ4A 2HHPA 3PYDA 4X4PA 5B0CA 1C0TB 4YOEA 4I67A 4DV2F 4KHMA 4MK9A 3I5BA 4CRJA 4OMFG 3P4UB 4DCJB 3CDUA 2CRLA 2VG6B 3C14B 3D6HB 1Q82T 3ICLA 5CYQA 3D9BA 3OVAA 4ZVPB 2C3UA 3BGFA 1F1BB 1SC3B 2A10A 3OSPA 2XC9A 4AQYJ 1N32F 3NCPA 3ZC4A 1N5YA 1V5IB 4PG7A 3CWJA 1VC0A 2HZCA 1FDDA 3T3FA 2CZVC 3PKYA 3OUYB 2YWHA 4FN5A 3UN3A 2UXBF 2EBEA 3JTOA 3JXOA 2OPQA 2WCXA 3HP6A 2XCAA 3QBCA 1Y7PA 4YR0A 1HFEL 3BN4A 3DDNA 4LBHA 4Z2XA 4AXJA 1YLXA 4JV5F 3VQTA 3NS6A 3GWCA 2CPHA 3GV7B 1KQFB 4PQAA 3HCXA 3W5YA 4U96A 3S8SA 4JI1F 3H7HB 3EYZA 2ZBQA 2ZHBA 1X4HA 3DDKA 4DV5J 3M8QB 4J9KA 2LLZA 1F5BA 2OGUA 1ZM9A 2HIYA 3X3UA 1N0VC 5DQIA 3P3DA 3F44A 1AW0A 2J7KA 2W24A 7AT1B 2JVRA 1B0VA 2FUG9 5C2CA 4NLDA 4DMZA 4DUZF 3JB9k 2EVZA 1E6VA 2VG7B 3IWLA 4DQRA 3JYTA 2ZVIA 2Z8QA 1SH2A 2KM8C 3DOLB 4JV2A 1RT4A 3MEDA 2XWYA 2XYHB 1FHTA 1U49A 3TAMA 3PV8A 4A46A 2POKA 3VVTA 3GTYX 1FXDA 3MEGA 3OLAA 3H2LA 2J8AA 8ATCB 1OWXA 1N5TA 1S1WA 3PZPA 2PT0A
chains in the Genus database with same CATH topology
2KXHA 3CJ4A 4XPEA 4I1TA 4QR0A 5DO2A 2RDJA 4LVOP 2CPZA 1ZM2A 2NREA 1PC5A 2GQCA 1TKXB 4HTJA 3RZAA 1D9AA 3H98A 2YNIB 4DV4F 5B0FA 2ASYA 2K3IA 1Q53A 2NXUA 2CJ9A 4CCHA 2CQ4A 4WKRA 5IXUA 3MCSA 3J7YI 1OQ3A 3MTKA 4C2MA 2QZ8A 2PSZA 3FZ2A 4UUXA 3W3SA 3X1LB 4EGLA 1T02A 5M2RA 2MYFA 4DR5F 2VL1A 3MR2A 2P6SA 2M3DA 2AD9A 3IAS9 4MAKA 2Q1LA 2QO3A 4Q5VA 3GG1A 4OZNA 5K14B 2GCFA 4KIAA 1T95A 2HGNA 2FGOA 3FEXB 1Y5IB 3M32A 3MM7A 2CQIA 1AUDA 1LWCA 4KKOA 2A18A 4I2QB 5KFZA 4MIBA 2CJBA 4YR2A 1YQHA 2ROGA 1C1CB 4PWUA 1TUVA 1NZAA 3I5CA 3IC1A 2GJ2A 4RKUC 2R7TA 2R7VA 4F26A 3G6XA 5DS7A 3MD3A 5KFYA 4OI6A 3UD3P 3MMCB 2BYCA 4K2XA 3EUNA 4AUKA 4MMOA 2X1BA 3HVTA 1G7CB 4MYUA 4DN0A 5T7LB 1LK5A 5SZTA 3WX4A 1QAIA 2LDYA 4QU7A 3EGNA 2MQLA 4YMEA 3T5HA 1ZBTA 4YHHF 4Y00A 1YRTA 3QAEA 2YKPA 5KFFA 1SL0A 4IOBA 4HI1A 4WFXA 4QPTA 1N5VA 4G1PA 3PJWA 4RNFA 4IG3B 1K8AT 4C0OC 3JSMB 1FKAF 4EBDA 5GVQA 1DTQB 3LUYA 4ZVGA 3MR5A 2ZH2A 4DBQA 1QUPA 2DHAA 3KLEA 1HR0F 2FHOB 4B9UA 2ZUGA 4HH1A 4GO5X 5F41A 1DAXA 3FEZA 1Y0HA 2DGSA 4CTAB 2N4DA 2HWHA 2CQPA 4Y3CA 5ADZA 1JLQB 4A8MP 3PW2A 3DLJA 4I7FB 2AYGA 3J81Y 4ED8A 1TKTB 2GMHA 3JSRA 4K0KF 2E9TA 4RW8A 1KVJA 2B4VA 2ZD1B 4NX9A 2N7CA 2K7JA 3CMAS 1HWLA 5J2NA 3OXGA 3GFZA 2GIRA 2LEPA 2PE8A 1PSDA 2W9CB 1DLOA 4B9NA 4CQ1A 2CQ2A 1S6QA 4QIEA 2RF2A 5JVHQ 1S49A 4NLVA 2ZHOA 4WK3A 1TK5A 1VQ4S 2ZOFA 4WKYA 4F2RA 2XB2D 5AE3A 4PUOA 1FD2A 2GQQA 5B09A 4DSIA 1CSJA 2L9NA 4RW9A 4ZPCA 4ELTA 1OO0B 1VHFA 5F8IA 5JXSA 4M94A 4RW7B 2DNPA 2LA4A 4LF6F 5AJ3F 4NOHA 3OVSA 2UUCF 5D4PA 4IH7A 2RIJA 3WBZA 3FMWA 4EYHB 4PXEA 3M8PB 2ABYA 4NCGA 2B7CB 2YKNA 4ZP9A 1LXNA 4QWEA 4DLGA 4ECWA 4ED1A 2DVIA 1QSYA 5KFAA 2FHJD 2YNFB 3C6UB 2YKQA 4I6AA 1NJIT 5EWGA 3OL6A 3HXMA 4GC7A 4IH5A 4JI4F 4NL5A 2KFYA 1NK7A 1YRXA 1IR0A 3PRBA 4DL3A 3KLFB 4OX7A 3FRYA 4R8UA 2XEXA 2E5JA 5HBMB 2OPSA 3RAMA 3S7RA 1TFWA 4IH6A 4ZCKA 1NO8A 3GQCA 4LJMA 3DI6A 1IM4A 2HS3A 1H3DA 4MK7A 1RP5A 2GHVC 3QJPA 5H1SV 1U4BA 4H54A 1YJUA 3ZZPA 1R8AA 2BANB 2VG5B 2VFSA 1NRKA 3GYNA 4KV8B 1QE1A 1FA0A 2JEIA 1NK8A 2OFGX 3O44A 4OX9F 1X5PA 4EU0A 1ZETA 1R0AB 2LVWA 2LDIA 4U9RA 3HHNB 4PQUA 1KLNA 2M4MA 3QWUA 2FLLA 4OHYA 1HI8A 3IS9A 3OR1A 1LW0A 4RW4B 2DR8A 1HBNB 1JX4A 4K4VA 5K5MA 2MZ1A 1IKWA 2CQ0A 2HS0A 3I32A 3L95X 4WFYA 3I56S 1ZH5A 3T5KA 2EW9A 5KFSA 3BDEA 4CH7A 2HMIB 2EKYA 4N8NA 3UWTA 5D3GA 4DQSA 3CD6S 2CDQA 4EO6A 4CH1A 4Q7AA 2MQPA 3G86A 4I6WA 4X4UA 4DX8H 3R5AA 1HARA 1K0TA 3H4BA 2HVHA 4NRUA 1JB0C 2JHEA 3HMJG 1X4AA 5HQ8A 4K4SA 3PDNA 2CQDA 4DFKA 3BO4A 3ZZYA 3RYLA 2LA6A 3M1VB 1HHTP 3OXLA 4Y2MA 3U02A 3T1AA 2RJZA 4PG4A 4BBYA 4ICLB 2W9BA 4R0EA 3OVBA 1J2VA 1TFYA 1RKIA 4G1QB 1M5HA 2UVWA 1S72S 1S1XB 3GG0A 2OKQA 1P9QC 2K1RB 1KLMB 4ECVA 4DSJA 5KFMA 2CQGA 1VS3A 3D1QA 4Y2CA 5KG2A 3POTB 3FDSA 1S1TB 5MLCV 1YBAA 3GIJA 1RTHB 4I56A 4IG0A 1NJWA 1VK3A 2IC3A 2ROEA 2RH3A 1T3OA 1Z2ZA 1Q16B 1IQZA 3TQ1A 5HROA 1VQ5S 4B3TF 4HEA9 5F8HA 4ZPBA 1DRZA 1LWEA 2OJ3A 1RQ0A 4NYZA 2DO0A 5KFIA 2XMJA 3U1MA 3WC2A 4WZMA 1Q78A 2YKAA 5J2PB 1VRTB 1MMDA 2OLWA 1RK8A 1X4CA 3D0GE 3IG1A 4NA2A 2OSQA 5E33A 1DURA 2KG0A 4IYQA 4PXBA 1HBMB 3UFCX 3P49B 4XDCA 2FVCA 3I31A 3QGGA 2QE5A 4U6PA 3LP1A 2KU7A 2NSBA 5EX3A 1NHUA 3SFGA 4TU8A 3UCUP 1KQSR 5I3UB 4K59A 1J5OA 4Q8EA 4X64F 4B3MF 1R8BA 2F9JA 1VI7A 1S9EB 2LYVA 2OSRA 3KLHA 2CQHA 4LSNA 2OTLS 2JRSA 2GW8A 5CH7B 2Q66A 5M2UA 1KFDA 3TA2A 4O44A 2C2RA 2OH2A 5J1EA 2ZFHA 4LUBA 2VUGA 1WTFA 5DETA 2E7XA 2CYYA 1N5SA 4DSKA 4C8LA 3DLHA 2DH7A 2LXUA 2RQCA 2W8LA 4NLXA 4ZPTR 3G96A 4KAIA 5I3PA 3FFIB 4ED7A 2J5AA 5JJBA 3QGHA 2GO9A 4CI0B 3RU0A 4KR0B 4TYBA 1KOHA 2DR7A 3CSKA 2IM0A 1TAUA 4KSEB 5T41A 2JLEA 5D4NA 4C3KA 1X9WA 2Y1IA 4Q44A 1UVMA 2JFKA 3W7BA 3O1LA 1S97A 4JI7F 2QV6A 2DNZA 2ADCA 2DNMA 3DRSB 2MHNA 1U09A 4H4OA 4Q43A 4O3SA 3TVKA 2DR5A 4WXOA 1SC6A 2UUTA 4B9TA 2QIFA 1S9FA 1MSWD 2YH0A 3HVRA 1SKWA 5F8JA 2FJVA 1GXTA 2DGTA 3QMQA 1JLAB 4ZHRA 2XBPA 4F3OA 1VQLS 2GFFA 3LGMA 1KFSA 3KOAA 5IQQA 1RGVA 1URNA 2ILZA 3PEJA 2V9WA 3AQOA 4QPXA 3TRGA 2WSCC 4WZQA 1CLFA 3SZ2A 1KD1T 4DL6A 1AFIA 1U7LA 4BCAA 3TW0A 2XY6A 4EWTA 5KG7A 3ZZOA 1U26A 4UQGA 4DV7F 2MY7A 3LP2B 1B0TA 4ES2A 4V19J 4LSLA 1GX6A 3OPKA 1IXKA 4OZ5A 1FJCA 3NBPA 5E41A 1EP4A 3QLHA 3Q22A 4U7CA 1VQOS 3JSBA 4WFZA 3UNGC 3OL8A 2FJXA 3IRWP 3DXSX 2AJ4A 2GQ2A 5A6PA 1DJ0A 4HLBA 1A6LA 1MW7A 4IOAQ 1R8HA 5B7WA 1U47A 4KGMA 2FVQA 1HMVA 4C11B 2VBZA 4C9DA 2MKSA 1Z1ZA 1I1GA 4DL5A 3H5XA 3DMJB 4I2PB 4BWJA 3HHLB 1R89A 5DG7A 3HK2A 2R9LA 4IO1A 1R8CA 5K8OA 1WG1A 3D0IE 1T3NA 3KLGA 5LJ3Y 4TQSA 1HNZF 2M0GB 2B7BB 1NH7A 2B51A 2ZVSA 1UL3A 4N41A 4CT8A 4FP9A 4OHVA 4JI6F 1TV6B 4TLRA 3U1NA 3SCJE 1QVGR 4IUFA 3LP0A 1F5AA 3NWGA 4O4GB 3K7RA 4IRCA 2DCLA 2M88A 1C0UA 2YNHB 3MOJB 4R25A 2ATLA 3C66A 1LOUA 3EGWB 2CPIA 4RLEA 5C25B 1CVJA 3T6JA 2W9AA 2XLIA 1W2IA 2DJWA 1VLYA 3CULA 4ID5A 2GIQA 1VGYA 3QYYA 1FD8A 2J9DE 3OQ2A 4R5PB 2MZTA 4QYRA 5GAEI 3GFXA 1RTDB 3DLLQ 4DL4A 3QIPB 2KHCA 2HGLA 1DQ8A 4FVMA 3QZ7A 1RISA 1LW2A 1TVRA 3TVYA 1NB7A 4KRWA 2XGPA 4IFYB 4GMKA 2LQBA 2ASLA 4J9LA 3HKWA 3HHDA 2WSFC 3US5A 2BA9A 3DYAB 1OSDA 5C42B 3E3XA 2BQUA 1UJ4A 4DHVA 1L3SA 5IT9Y 2CPFA 2W4CA 2RKIA 3SDEA 4LF5F 1KVIA 2DHXA 2DIUA 5E3AA 3AB2B 2E1CA 5HMYA 5HP1A 3PW4A 2M5YA 1JLFB 1BWEA 3V6HA 3ENWA 2B5JB 3N01A 2LEAA 2VPZB 3AJ1A 3J7YU 2CIMA 2CJQA 4M8LA 2YNGA 5B0BA 4RU9A 2ZNZA 3LPYA 5CYQB 1HA1A 2HHQA 2BE2B 2BJEA 4P6QA 6FD1A 1W2BR 3KLIB 5KFHA 1K9MT 5CXTA 3QWPA 5B0AA 1FDNA 4L6V3 1S6PB 4C3MA 5DQGA 2GMLA 2V8DA 3D2WA 5HL7Q 2J6UA 3IN5A 3T5LA 1ZPVA 2MQMA 3EPGA 3BQ2A 2V8GA 2DT9A 1SUQA 4NXNF 4Y6IA 3FVYA 2QA2A 3SI8A 1CG2A 3IRXB 3NAIA 2EFGA 1FRMA 2VV5A 4UW2A 4OZJA 4WJBA 2BACA 4BS2A 4F8RA 3S01A 2DISA 3MFIA 2VONA 5EWEA 4QWBA 3IWXA 4EFAC 5HMZA 3PW5A 1VBYA 4TYAA 2HHTA 2BM0A 3N5FA 2APOA 3PXGa 2X3GA 2VB6A 4DG1A 4X84A 3K8VA 4ETXA 3BJYA 2MKJA 1U6ZA 2XMUA 4MFBB 2IYIA 4QWDA 1BQMA 3V4IB 4LFAF 1OSCA 1P6TA 3H2UB 3T19A 3OLBA 2EPIA 3I0RA 4FXVA 1FRJA 3M6UA 2NYIA 2VC1A 3OUYA 4ED0A 2ASDA 2J6SA 3EZUA 1EETB 1K1QA 3FQKA 3S6EA 1RT7B 4OHZA 5J2QA 1VC5A 3ENQA 3BSCA 1JXLA 2HVIA 2J6TA 4U67Q 3BEGB 1YSJA 1UFLA 5IFMA 2MSSA 3HO1A 1X4BA 2UUBF 2JWNA 5E5NA 3NRBA 3SCIE 3T1HF 4DN9A 4UUWA 1TZ0A 1Z2LA 2L9DA 3PVXA 2XSJA 5CQGA 2C22A 2L3MA 1HNVA 3OR2B 4USIA 3CE8A 2OPQB 2L48A 1TL1A 5FLXY 3TI0A 1WG5A 1WEYA 5U47A 3KG0A 3NCQA 4I69A 3MZIA 3OTBA 3Q8QB 3AB4B 3PW0A 1RT1A 2Z0GA 5BJRA 3E51A 3VF0B 3H5SA 4X66F 2LMIA 4ZKAA 4C8NA 4Q0BA 5IM0B 5KG5A 3DU5A 4IRDA 1VQSA 1YTYA 1TP7A 3MEKA 3PX4A 4MTPA 5LXRA 3NKYA 5AE1A 5LSRA 1IBLF 3RAXA 2ZM6F 3LANA 5F3ZA 2XO7A 2GMJA 2OAUA 2ROPA 5E3QA 1JLGB 2BQ3A 2JVOA 4KQZA 2YVSA 2MKIA 1HYSA 4UQTA 3W2VB 4Q45A 2M8DB 4DSLA 1AROP 2AGQA 3U27A 1ZM4A 4WIIA 2AJFE 1SJ4P 3ITHB 1VK8A 4AE5A 2L41A 4JV1A 4YDDB 2N3OA 1S1UA 1ZZFA 2ZBCA 3E8OA 2OPRA 3V2UC 2UVVA 4MKYA 1TK0A 3KHLA 2U2FA 1UJ6A 2XHWA 3ISZA 5K8MA 1S99A 3KK3B 4KT0C 1U1LA 2IM3A 1BQXA 1X4EA 1KONA 5D78A 4X65F 1JIHA 1HI1A 2J9CA 1H6KX 3GYXB 3RB4A 1WELA 3M8QA 2RB7A 4CIOA 4RW6A 3VAFA 1S48A 2BV3A 2VKZG 4R0JA 4FZVA 3W2WB 1DTTB 1UWBA 1SV5B 2DNYA 2OPPA 3UR3C 2MJNA 4YB5A 4GKJF 3S1TA 1A9NB 2CPEA 2OP5A 3N5BA 2FHMA 1C4CA 4DL0C 2MXYA 4IR1A 2C3YA 2B3TB 4A8KA 5JVGQ 4B02A 2V0NA 4V19X 4QYZ