3TNVA

Acylphosphatase with thermophilic surface and mesophilic core
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
90
structure length
90
Chain Sequence
AIVRVHYKIYGRVQGVGFRWSTQREGRKLGLNGWVRNLPDGSVEGVLEGDEERVEAMIGWLHQGPPLARVTRVEVKWEQPKGEKGFRIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein surface is a preferred site for thermostability engineering
rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase
molecule keywords Acylphosphatase
total genus 25
structure length 90
sequence length 90
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2011-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3tnvA00
1TUVA 2LXFA 3FRYA 3HHLD 2GCFA 2ROPA 3QGPA 4OJ1A 2XMKA 3HDSA 2XMUA 2BBEA 3GZ7A 1SI9A 1Q8BA 2HLTA 2OMOA 4HL9A 1TR0A 1AFIA 2G9OA 2FB0A 2GA7A 2BJEA 2OD4A 1X8DA 1FE0A 2HFNA 4ZA1A 1P6TA 2PGCA 3VTIA 2W4DA 2LQBA 1N5TA 5B0BA 3MCSA 1FVQA 1JK9B 1MWZA 1Q53A 2K1RB 4DN9A 1CPZA 2L3MA 2OD6A 1YRXA 2RILA 1MWYA 2IFXA 3FMBA 4U9RA 3CJKA 1Y0HA 3KG0A 1VQSA 2OAUA 3DXSX 3CJKB 1Y3JA 2KYZA 1FE4A 3BN7A 3F44A 1OQ3A 1S6OA 3KG1A 2HFOA 2CRLA 2BUNA 2HQIA 5A6WA 3BB5A 3FGVA 4YDXA 5T7LB 1FD8A 1LQ9A 5B0AA 2VV5A 5B0EA 3HFKA 1N5VA 3HX9A 5KAKA 2K1RA 4ZOSA 1YG0A 5B08A 3BGUA 4Q2MA 3K7RA 2AJ1A 3LGMA 4YEAA 2K7JA 2ROEA 3LGNA 3KNGA 3KKFA 1W2IA 1WD6A 2GFFA 2XMTA 3UDCA 1APSA 4OJHA 1U7LA 1YJTA 2RSQA 1FVSA 4Y2MA 4Q2LA 3MZIA 4OJGA 5B0DA 2RMLA 1YJVA 2QYCA 2N4DA 3BR8A 1TL4A 4HI1A 4NL5A 1URRA 5T7LA 4FNHA 3IWLA 1CC8A 3BF4A 4A47A 1GXUA 1OQ6A 1VQYA 2ASYA 5F0WA 3QMQA 1X0PA 2ACYA 4F67A 2LQ9A 3TOQA 3TRGA 3HF5A 1Y3KA 1AW0A 5B0GA 2EW9A 1JWWA 2JDJA 4OJ3A 3BM7A 1R6YA 1KVJA 3E8OA 1AFJA 2FTRA 3T9NA 2XMWA 1SQEA 1IUJA 3HHLC 4HI2A 1FEEA 4A4JA 4Y2IA 2GV1A 1KVIA 3HHLA 2FIUA 2PD1A 2K2PA 2VH7A 1YJRA 2GGPA 1K0VA 2QIFA 1RJJA 2HLUA 1TZ0A 2N7YA 2OFHX 4DPOA 2AP6A 2KT3A 2XMVA 1KQKA 5B0CA 2XMJA 3BDEA 4EFAC 4HH1A 3IWXA 2QLXA 2N4CA 2AJ0A 4Y2KA 5K9FA 4A46A 3DCAA 2GO8A 1XBWA 2KT2A 3HHLB 1YJUA 4NPOA 1P8GA 1X7VA 2Q3PA 1FESA 2QLWA 2OKQA 2GGPB 5IXUA 2ZDPA 1Y9OA 1N5SA 1S6UA 2AW0A 1OSDA 1TL5A 1GXTA 2HIQA 2ROGA 1SB6A 1OPZA 4HH0A 1V3ZA 4FNIA 2BYCA 5A6PA 1ULRA 2OFGX 5B0FA 2IYGA 2RU9A 4A48A 3I9ZA 1N5QA 4QOTA 3TNVA 1Q4RA 2FHMA 2W4PA 2K7KA 1Q8LA 2XMMA 2LDIA 4DL0C 1CC7A 5F0UA 4OIXA 3WDOA 1QUPA 3LO3A 5B09A 2OP5A 2KKHA 2BJDA 2IYIA 2W4CA 2ZDOA
chains in the Genus database with same CATH superfamily
1KONA 2QA4S 2M0GB 1SUQB 1U8SA 2VPXB 2J9EA 2LEPA 3QZ7A 2KXHA 2ZKTA 2AZ1A 1TR0A 5CHCB 2G9OA 2IVMA 1HNVA 2J9DE 2YKMA 3P3DA 4ZCLA 1F3VA 4M94A 2B9EA 3HVTA 3EVOA 3JXOA 5CYMB 4BCAA 2DY9A 5DG9A 3GWCA 2PFDA 4NLTA 3WIUA 4DCJB 5FD1A 3VAMA 2QV6A 3E2EA 1UZDA 5DS7A 4RW8B 5IT0A 5J2MA 1QSLA 3ITHA 3PJ9A 5KT3A 4RUHA 1TFWA 4KGZB 3D6MB 3KLFA 4JI2J 1FTRA 3IGVA 4C7QA 3IBFB 2NREA 4U7UD 4BWMA 3TVYA 1IR2A 3OD2A 2OPPA 3M9MB 3DXSX 4C3MA 1KP6A 4ECQA 3I5AA 1WG5A 4LBPA 1LW0A 4DFMA 3MMBA 5CZVA 3HJFA 4CTAB 4NLUA 1PKUA 2J0XA 5HMYA 1YBUA 4GKJJ 4LF6J 2V69A 2XSFA 3CJQA 3VWSA 2KVQE 2F65A 1RTIB 3N6LA 3BYPA 3P45B 4KT0C 4ENOA 5LOQA 4OYAA 3BJYA 2MQQA 4PEOA 1RHKB 1N32J 2IDLA 3KK1A 1H6KX 2HGMA 3W60A 1YJTA 3NGTA 2DNQA 1FVSA 2VG6B 4TU7A 4DFPA 1HBNB 3KHHA 3FVYA 2CNLB 2CVIA 4IG0B 4RPFA 5RUBA 1WUUA 2J5AA 2PMHA 4DBQA 4IR1A 2BRKA 1LWFB 4NX9A 4CLTA 3A8IA 1TL4A 4YQWA 3SQOP 3D6FB 3Q0AA 1RTDA 2UVUA 2A0FB 4B3TJ 1YRTA 1U1OA 3JSBA 2AWZA 4WE1B 4BC9A 5HROB 1JLBB 3K5MA 2E9RX 4URQU 4DSEA 3MM6B 2XGPA 4N41A 2FVSA 2UUBJ 1VLOA 1NZAA 2GIQA 1AZSA 5KFFA 2FJVA 1KVJA 1IBKJ 1RAFB 2FZCB 4AL7A 1RWKB 2HNYA 2CJKA 2ZJQQ 3AJDA 3PVXA 1FK9A 1X4DA 4ID8A 4L76A 3FQKA 4O3QA 1NH7A 1DTTA 1HD0A 2QMWA 3AOAA 2PD1A 4O3OA 2QLFB 3Q8SB 4K4YA 2FZGB 4M5MA 4B3RJ 4BC7A 4UY8T 1DZ5A 3WX4A 4J9SA 1JXLA 1VBZA 2DCLA 3NNAA 3D3BJ 3JSYA 2KO1A 3MD3A 4YHHF 1HARA 1U26A 1TK8A 1HWKA 3JTPA 1T9UA 1WHVA 5CCMA 2CPHA 2B6AB 2DNNA 3DHWC 1RAJA 3V4IA 4BLGA 3PX6A 1J2VA 2I9SA 1DHMA 2HG4A 4NLDA 1U6FA 4O3NA 3J7ZT 3ZC4A 5KFMA 1G4CA 1S9GA 2DGQA 1HNZF 2ILZA 3R7BB 1WOPA 3T41A 4CO3A 1RWWB 4E2FB 4ELUA 4MK9A 4LFAJ 3QIPA 3HHKA 4QR0A 2L48A 4QQBA 2RD5C 4A8YA 3HVTB 2WTFA 3M2UA 2H4WB 3UR3C 4PWWA 5EGYA 4LF4F 3R1HA 3BGLA 1JLBA 2M8DB 1H0HB 3G6YA 1YJWS 4XPEA 2V9WA 1RE1B 2XZTB 2PFFB 3DRPB 1C4AA 2QE5A 4P2XA 3CDUA 4DPYA 2KL8A 2L9WA 2QN6B 3CJ0A 4QOTA 1Q86T 2HBYB 2K7KA 1GMWA 3S1TA 1TAUA 2HZAA 2Z4PA 5IQQA 3FMWA 3QYYA 4P6QA 3KLVA 2B56A 2ZDOA 4U7UK 3DLGA 2LXFA 4Y00A 2F4FA 2MZSA 2ZM6J 1RAEB 3DOKB 3ZZ0A 1VDHA 3QJJA 2V8VA 1D1UA 2V4QA 2O1PA 3J7YU 1NB2A 2IM1A 4P7TA 4EMDA 1AFIA 2BJEA 1X4BA 3CCRS 1Q5YA 4LF2A 4ZA1A 3LQVA 1JJCB 2Z0GA 4GO5X 4R25A 3UDLA 3HSJA 5GAEU 3SV4A 1U1RA 3E3XA 1PC5A 1B99A 2KRBA 3MPVA 2Z57B 2W4DA 3ULHA 3M8QB 3MCMA 4I6YA 4NYPA 3TUIC 4DLEA 1AUDA 3GG1A 4NLGA 2N3OA 4KO0B 5JJBA 2BOAA 5HK4A 3U7JA 1F5CA 2AF6A 2R4FA 2A6MA 4TVAB 2JEJA 2L3MA 5C42B 4PRFA 1YGYA 2C2MB 2J8SA 2DEJA 3DU6A 2FUG9 3DGPB 5IM0B 2MZ1A 4AT1B 3HO1A 2G0CA 3QGGA 3IN5A 2J7WA 2PA3A 4A46A 5E3PA 5EX3A 1Q8KA 1GQEA 2HFOA 5T7LB 1IKVA 1S0OA 4YDXA 4F3OA 2G4BA 4CYUB 4KH0B 2AJFE 2I5JB 4KGXB 1O5JA 2ZNZA 3GJSB 1KS2A 3CJTA 5H9FK 1PSDA 4CH1A 1JQGA 1F3FA 1I51B 2HPUA 2CQHA 4USJC 2DISA 5K8OA 5BR8F 5DM6Q 3LWLA 2GAHC 1VBKA 3O1LA 5HLFB 1GMVA 4X64J 1SKSA 5HSPA 2C2DA 2AD9A 2ZBCA 5EDWA 2J0WA 4Q2LA 4XPCA 4H4OB 2AV5A 1RKIA 3C6UB 4DOZA 2V63A 4BHQA 5KT6A 1YJNS 4V19J 3HXMA 2HS0A 1NK9A 3C46A 3EGWB 4RBTA 5KG2A 2WVBA 3TZYA 1DRZA 3SDEA 5E2QA 5J2NB 1HNIB 4A8XA 4A47A 2AEJA 2WSEC 2HS3A 2PMWA 3MOZA 3Q8QB 2ACMA 2Z56B 5KFVA 1Q8IA 2LQ9A 3NS5A 2WB4A 5E3RA 3LPYA 1Z4UA 3GIRA 1N0UA 4LREA 2J6SA 4IKAA 4C8OA 1AW0A 3Q83A 4ED7A 2C3PA 2P9EA 4RZRA 4JV1A 3E8OA 3MM7A 3B4DA 4L74A 2FLOA 2XMWA 4LF7J 1NDLA 2DPIA 5KOWA 2IAJB 4IQMA 4WZMA 2JRSA 3CDBA 6FDRA 1NKEA 2GC8A 2XG8A 5EUHA 3DOMB 2Y0SD 1S1TA 4DG1A 1YJ9S 4DX6A 1FJEB 1L3TA 2NXEA 2MZQA 3G9CA 5AJ3F 3P96A 2XCPA 4F2SA 2YNFA 4R0JA 2UVRA 3MMBB 3A12A 1MNEA 1JXVA 5G0RA 4EFAC 3IWNC 4HH1A 2XI2A 4ALZA 1J5OA 2JL9A 4CCHA 4IOAQ 1KOHA 2XULA 1K1SA 2H4YB 5KG7A 3HPOA 2F8MA 4OZ2A 2ALZA 3HHLB 4ZVSB 4CI0B 1PBUA 1WWHA 1VQ5S 3MOJB 2GAGC 4YS2A 4C8NA 1U4BA 2MTLA 5F8GA 1C1CA 3I55S 1FXDA 5KFRA 5IXUA 4C8LA 5E7OB 1Y9OA 4DU7A 1TUWA 1UVJA 4NA1A 2WVCA 1FJGJ 4XDCA 1U1QA 2ZD1A 4TU9A 1S7IA 2AW0A 1N5YB 2DNGA 3E01B 3KJQB 3ZZPA 2LFVA 4B3OA 2RRBA 3AAWB 2HBQB 2OFGX 5ETNA 2R7XA 3EMTA 3N6MA 4ECWA 5A8RB 2CDQA 2UVVA 3OSNA 1F0XA 3MMJA 3ONQA 4ANEA 4J5OA 3SQGA 4MKVA 1WACA 4OIXA 4DFKA 1VQ7S 1D9AA 2ZH1A 4ECTA 1B0PA 4MTPA 2XMUA 4AQYJ 4WP8A 4DUYJ 1RTJA 1U2RA 5D4LA 3BPDA 3M9NB 3H5SA 2PMZD 4OFZA 4DR4J 4IG3A 3DYAA 2DO0A 4C3KA 4N5SA 3ILJA 2I0XA 2OGUA 2OSRA 4P10A 5FDLA 1IQZA 1K73T 2QTWA 2COLA 2WOMB 1ZZNA 1G6BA 1FO1A 2AJ4A 2VZ9A 4O44A 3ZTPA 1NJZA 3O2IA 5EN1A 1UJ6A 2HVZA 4DV1J 3W63A 4C98A 3IR5B 2X1BA 2LQBA 3CCVS 4B02A 1U1NA 1TL3A 5L39A 3KK3A 2H54B 4ED3A 1S0MA 1MWZA 2FJEB 1S4FA 2I1RA 4PG8A 3BBCA 3QLHA 3HSDA 3UDEA 3H2VE 4AXIA 4FYDA 5DDOC 1J5OB 2CPFA 2GJIA 2GW8A 3ICLA 2OAUA 2JLFA 1WC5A 2NXNA 3DKDA 2RRAA 3AB4B 2LDYA 1L5UA 1HR0J 6AT1B 1PJ7A 5FIIA 3VQSA 1VHFA 4AFFA 5K8MA 1WG1A 3DLLQ 1HD1A 3BB5A 3QT5A 2HQGA 1Y5IB 2CPDA 2NUUG 4MFBA 4PYAA 3TANA 1T3NA 1RWUA 3UR0A 2E9TA 3MEDB 4ZVQB 3DI6B 3EXYA 3O5TB 4FVMA 4MKYA 4J9MA 4JI0F 4JI5F 4QIEA 2XQCA 3DOLB 2CVEA 3TZZA 2V8PA 1LV5A 1RABB 2WW4A 1RWMB 3BYRA 2AJ1A 2HQ3A 3BPSP 1LKZA 2F1FA 1YJ7A 3KKFA 1S1WA 4KH1B 3R5JB 1U7LA 2W9CA 2UXDJ 2DK2A 3DNCA 2HHQA 2QSFA 1AT1B 4LR8A 1JLFB 4UOGA 2DNRA 1SC3B 2GMJA 2HS4A 3BDPA 2FYXA 4K8RA 4XIUA 4DV5J 4EGLA 1XJWB 3BKTA 2W24A 1LFWA 1VOMA 2VDIA 3NEKA 4F67A 4R8UB 4B9LA 2VOPA 4X4UA 5DETA 5LMNF 3LPEA 4UQGA 3QSYB 1CS4A 3G82B 3PFOA 3U1NA 3Q8RB 1U6BA 3DM2A 5IT9Y 2K8GA 2ZH8A 5MAOA 2OIHA 4F4XA 3A3OB 4UUXA 3FUYA 2RUSA 2HFSA 5LJ3Y 4K4ZA 1CJKB 2FC9A 2QL9B 2IA6A 4OL8A 3HHLA 2R7UA 3A13A 4IRKA 3W2VA 2DNZA 1HIYA 2DH8A 2MLXA 1C0TA 1T05A 5G0RB 4TKTA 1MW7A 1U6ZA 1JJ4A 1RT7B 3FC9A 3OR2B 1QLNA 2CQ1A 2RJZA 3DDKA 1H38A 2QMXA 4R5PB 1IKXB 4QWCA 1FWPA 4PQUA 1JNZB 2V8HA 3IWXA 3LA0A 4P2SA 4ZPCA 1FRKA 1TKZA 4OI0A 4DR7J 1A9NB 2F9JA 4WK1A 2RRNA 3TEGA 1MU2B 4DV3J 2NR0A 2E5GA 4KO0A 4ZITA 5I42B 3BGRA 5IZHA 3MR2A 1RUSA 3CC4S 2SXLA 1CSJA 3BQ2A 4OHZA 4EUVA 2R8IA 3W2WA 2DGVA 4PPZA 4N7TA 5CYQB 1HWIA 4ZHRA 1RBLA 2XTJP 1YVFA 5E3CA 2JH3A 4EYIB 4EK2A 2AU0A 4ZJQA 2F8HA 5H9EK 1TKDA 4ZKAA 4DSJA 2VBYA 5A6PA 4L3NA 2WVFA 1WOSA 3QJPA 2LU2A 1XQIA 5F8JA 1R0AB 4RWXA 1UVKA 3SFUA 3OTBA 2VQFJ 2CWKA 3H2UB 5F0UA 1RTHA 1CULB 4JI8F 1GNKA 2F4VJ 2WONA 3QGPA 3VZHA 2GCFA 1TU0B 2OEJA 3AHPA 4K0KJ 1FDAA 2V4RA 4OZ3A 3CF5Q 2E66A 2IM2A 4ZP9A 3UN2A 4HHJA 4ZPAA 1HR0F 2J0SD 4X4SA 3C6TB 1WHWA 1I5OB 3UI3A 2FJWA 1P6TA 1TKZB 2FGCA 2AMCB 3CB4A 3CCWA 3OL6A 2V5HG 3GSIA 1FA0A 1X4CA 1UPMB 2I5JA 4NYZA 1SVDA 4ZIVA 4ED0A 3CO9A 2W9AA 4OI1A 1D8YA 3BKFA 4OZ1A 4JI6J 5KFAA 1SKUB 4M63A 4HDHA 2E1MC 1ICEB 3D0IE 3NXZA 3CC7S 4DR1F 3B6BA 2F63A 1RAIB 3RTVA 4C4WA 4WWSA 4FDFA 1Q16B 2PEHA 4URSA 4NLQA 1PCAA 4F36A 3GQCA 1FD8A 3CNQP 3FRZA 4ETXA 1S1VB 4F3QA 4PG4A 1JLFA 1KQSR 1AB8A 4LF8J 1DTTB 5K20B 3D7SB 3CCSS 1SH2A 1WHXA 4QIFA 1BUXA 4KHRA 3UNYA 4CLYA 1UP1A 2F7VA 3GV5B 4DL6A 2I2YA 1HA1A 2ZH6A 2X1FA 1BD6A 3NGRA 3B54A 4NEYA 3P6YC 4U8YA 3N0VA 1G1XA 4W4MA 4ECXA 3KK2A 2ZM6F 1I6JA 1HBUA 1BC6A 2YKNA 1APSA 3HP6A 3GIKA 3I87A 4NXNF 2MKHA 1LWFA 4KRWA 3MZIA 1NKBA 4XTTA 3SCLE 2D3ZA 4QU7A 3UCGA 1HW9A 2QYCA 2VG6A 3BH6B 3TUJC 4WBFA 3DRYA 1FWKA 2PEBA 4FPIA 3TP2A 4X4PA 4FNHA 3OJSA 2H9ZA 1CC8A 1O51A 2X1AA 2GHPA 1R7IA 3AQOA 2ASYA 2EG1A 3DOLA 3HULA 4L3KA 4WXWA 5H1SV 2D3OR 4IUFA 5KFPA 2IBOA 3SIPB 4ZHRB 4K50A 2DHAA 3DI6A 4DV7F 3M30A 2VBXA 2V68A 2VC0A 5B0GA 5KFTA 1RT3B 4RW6A 2BZ2A 3K2YA 3T1YJ 2FC8A 4WFBQ 1RQ0A 4J9UE 4M5KA 2FTRA 4ZDNA 2Y1JA 2EFGA 3OLBA 4CTAA 3Q86A 1RTIA 1YLXA 4HKQA 1VS3A 4F50A 1H98A 4ITSA 4B3MJ 3IAS9 4RW7A 2MY7A 3UQSA 3MMCB 1TK0A 1XNQF 2QIFA 3RBEA 2E1CA 5KFHA 2ZH7A 1CJVB 3GLJA 4NZ0A 4ID5B 3H42A 2PE8A 1NZ8A 4I64A 4X64F 2W2MP 4JI4J 2MYFA 1NEEA 3DLJA 3I4PA 2MLZA 1QE1B 4FKXA 4X62J 2DNMA 4EBEA 1NK4A 2BV3A 4C11A 4YMEA 2XS7A 3TUZC 4TYBA 2RIJA 2H5EA 3GSDA 5GMEA 1JLEB 3NS6A 1TKXB 2AYGA 2AZ3A 3SMZA 3IA0A 2XSJB 5C24A 1T9XA 1UFWA 1N5SA 4NLXA 1T03A 3DFEA 1D9FA 3M8ZA 1RYRA 2M9KA 2ROGA 4QCLA 1C4CA 4E98A 4X4RA 3N9UC 1VQMS 4Z2XA 3CVKA 1Q81T 1NRKA 1H7WA 2FHMA 3RU0A 4I4BA 4U95A 1FFGB 2LXIA 3R8YA 5M2UA 3WDOA 4DCOB 1E6VA 4LJMA 3ZNJ1 1VI7A 1AXQA 2R8GA 2W9BA 4WCEQ 2QC3A 4NCBA 4OJ1A 2FHOB 3FQLA 3MUTP 1RT1B 3BSCA 4GVBB 4KGMA 3OL7A 2DKOB 2WSFC 5D3GA 1VRTB 2XWYA 2J6UA 4F8RA 5IV4A 2D41A 3CGIA 4DR2J 3PYFA 1MU2A 2M4MA 5HJYA 2XY6A 1WTFA 3GPAA 3HKWA 3PW0A 3HD1A 4M5GA 4BS2A 2HFZA 2AT1B 2UV8G 1JJHA 3TR5A 2VFVA 2B9XA 1OSCA 2KN4A 4EZ9A 4Y34A 5KG4A 3FSXA 2KZMA 4UQTA 1IKYA 2EBGA 3UNGC 4B17A 4B9NA 2DGUA 1PGZA 2DIUA 3AQPA 2GX8A 2B8PA 3B8HA 3K89A 1RK8A 1S10A 2KYZA 1PAEX 1S6OA 1TELA 1T9YA 3F56A 4QW8A 3I0SA 3IRWP 3OXFA 4ZIWA 1LEOA 1LQ9A 2CPEA 2FVQA 4JYAF 4P71A 3MM8B 1JLCA 1RLDA 3H2LA 3HFKA 5B0AA 5KAKA 4DV2F 2NZ4A 3R6LB 2NS1B 1S57A 1B0TA 1Q79A 2CJBA 4RNHA 2FHJA 1HNIA 4DUYF 1HBOB 1W7WA 2R2TA 3MFHA 1FNOA 3IM8A 1VJQA 2CIMA 1NKCA 2DO4A 1LXJA 3M8WA 2CJYB 4N8NA 4ZK7M 3M4XA 4YB1P 4YDDB 1SJFA 1KHVA 1X4HA 4H4MA 4NLWA 1RU2A 2EC2A 2HWIA 4YUDA 2FY1A 3EJMA 1QAXA 2BQUA 2RQKA 4X4OA 1FEHA 3ISND 3MGJA 4QZVB 2CQ3A 5T7LA 3QRQA 4I68A 3EM1A 1ZPVA 5C2CA 4B3RF 1RI7A 1GXUA 2XY7A 4MK7A 3FJ2A 1HQUA 4OYXA 3VAIA 3HK2A 2IPOB 1SKRA 2EK6A 3H59A 4JBCA 5ETPA 2E5IA 2L08A 2EW9A 1NJXA 1HHTP 2LA6A 3AFGA 2A3JA 2POKA 1HI1A 3LALA 1A7GE 1IUJA 4NA3A 2D9PA 4A4JA 3OTOJ 3J7AN 2RB7A 1VRUB 3GFXA 2VIHA 3QJLA 2CPIA 3AH6A 5D15A 1ZA2B 1HNZJ 2VG7A 2VH7A 1YJRA 4IYQA 4LIWA 1R43A 2CG8A 3WC0A 4ZMMA 4UOCA 1RT4B 1ZA1B 2HVDA 4ES2A 4QU6A 1FXRA 1PYTA 1RHJB 3BGOP 2OHDA 2P9GA 3MM6A 1S1TB 3QBCA 3NAHA 1FDNA 4ANDA 2X1GA 2I38A 3G2XA 1TMJA 3QATA 1UWAA 4USWA 4DDFA 3V6JA 1S6QB 3PYEA 3NS7B 5D0EA 4H4KC 1N0VC 2KU7A 4UW2A 5U47A 2B9YA 4ECYA 2IAJA 1R0AA 2M2BA 1VK8A 2V2QA 4KV8A 5D3GB 1YJUA 2F4VF 5ETVA 3W64A 3KOAA 1U2FA 5CABA 2IHR1 3UN5A 1UVLA 2HGNA 3PKMA 1LWCA 2OTJS 1VYAA 2ZOMA 3KK2B 3EGZA 4PUOA 1C0UA 3C16B 3JTOA 3M2RB 1OS5A 3NKYA 3GONA 4NI2B 3R97A 5J1PA 1GXTA 4HH0A 4BWJA 5E3QA 3G71S 2KG0A 2OH2A 5D8HB 3B78A 1KLMB 2G2OA 1XK8A 5ETKA 5SZTA 4DS5A 3OHBA 2J9CA 1U45A 4B3SJ 4F4KA 1U2CA 2C42A 3DLKA 4K5SA 3G8SA 3A4TA 1Q8LA 2JJ4D 3RJMB 2VONA 2X3GA 5B09A 1QE1A 5BYSA 2AX0A 2VKRA 2IYIA 1GX5A 3CDWA 5LMUF 2HGLA 5K5MA 2YWGA 2XMKA 3MCNA 1F2GA 2CQCA 4DUTA 3AD9C 2UUBF 4ID5A 1T9VA 3DRRA 3IR7B 4J9VA 2LQ8A 2VFUA 1B64A 1KRPA 4KJIA 5DG7A 1JXEA 4PR6A 3ZZUA 4RU2A 3MEKA 2EI5A 2ZOGA 3UO0A 4CYUA 1SKWA 5L8RC 5F8HA 3VCDA 4GMKA 2XO6A 2DBBA 3TJAA 3BKUA 3ZXWA 4HVZA 1IR1A 3PG9A 3HD2A 2OMLA 3CJ3A 2DPJA 3ZZZA 1WDTA 3G6VA 4R8UA 5KFZA 1XR6A 1UCNA 2LEBA 2BJ7A 5CXTA 1FNMA 3SYZA 2D1CA 5DG8A 3GYGA 2VL1A 4OYZA 1VQ9S 2NYHA 3EVMA 4WK3A 2MQ8A 3LGHA 4GKKF 4LFBJ 2JC0A 4TNOA 1S4EA 5AXKA 3HVAA 1GMUA 2B5JB 2BABA 4Y2AA 5KFDA 1TVRA 3VALA 3CDEA 1RT2B 3WZ0A 3JYTA 3C19A 3M1VA 1N5VA 2C2ZB 2MZRA 4Y0FA 2MXYA 1S9EB 2FY8A 1N8RT 5IC4B 2ZJRQ 1KOOA 2RNEA 2CPZA 3BGUA 4K59A 3KJVB 4K0KF 2BACA 1I94F 2B9WA 2ZC4A 3LGMA 1M90T 1J5EJ 2XLJA 2VA3A 5KFKA 4LRFA 1C1BA 1FX2A 2RSQA 4USTA 1FRHA 1KVKA 1YZ7A 2W2QP 4NLVA 2XYHB 1WG4A 1VC6A 3OPKA 1S1VA 3FEYB 1XC9A 4ZCMA 1PYOB 3IFEA 3NGSA 2BXJA 5JXSA 4CT9A 2QA4G 4DV4F 3EDRB 3MEGB 1S6PB 3L7PA 4KY3A 4OQJA 4RJVA 3TWZA 4JOUA 1GT8A 2LQJA 2W8KA 1VQPS 4HYKA 3TJ8A 3TX0A 3UD4P 1G7CB 4CO0A 3M2UB 1VK3A 4ECRA 4EYHB 1OYDA 3TRGA 2XEXA 9ATCB 2YQ0A 3M7VA 5ETTA 3EUNA 3OR2A 3QIPB 4EO8A 4QPTA 4MAKA 4J9OA 4OZ0A 2MKCA 2OUGA 3W8PA 3PW7A 1GX6A 1PIEA 3THPA 1AFJA 3HLUA 3DMJA 1PG5B 4HI2A 4DX8H 1V9OA 4GKJF 2RDDA 2EK1A 2GMLA 2WVDA 3POTB 4DHVA 3GFZA 1R8AA 3OFFA 2V50A 3CW2C 1H2VZ 4MT1A 3Q8VA 4OV1A 5D0GA 5D4PA 4ZVFA 3THTA 3W1YC 4U8VA 3OL8A 1M5OC 2Y0BB 1RXOB 3F0NA 4LSLA 4Q5VA 2BM1A 3T3FA 4F02A 2OFHX 3PJWA 2AP6A 5ETMA 3O44A 4DR5J 1U0HA 1QSSA 2FQQB 2ZHAA 4KE5A 4C8ZA 4X65J 1EHWA 4B3SF 1R27B 1FKAF 3I5BA 1UPPA 4NPOA 1XBWA 2OPSA 4FN5A 2JFDA 4B9VA 5L1IA 3KUGA 3TAMB 4WIQA 3MM9A 1C0UB 2E44A 2HK2A 1IR0A 3RBZA 3BZQA 2MB0B 4ILMA 5IT9U 2ZBRA 5F3ZA 3OW2R 3GTYX 2H5IB 5THWA 2RKIB 3LP0B 2MKKA 1S9EA 2ZNYA 4JI7F 3BGFA 2DXFA 2J6TA 1WSRA 3TA2A 3L9ZA 3ZO7A 3PV8A 3PHTA 1S1UB 3UCZP 3HI9A 1I3OB 3Q24A 2HMIB 2DIVA 4RUCA 4QR1A 2UP1A 4C2MA 2VA2A 2MKSA 1WJ9A 2B5JA 3R7NB 4C0HA 2KYXA 1QSYA 1HMVB 4ER8A 3RR8A 1OY9A 1S97A 3W5XA 1IWAA 3MEDA 4UF4A 2CPJA 4K4TA 3EZUA 2PI5A 1U1MA 5KFWA 2DHHA 1QUPA 4B3MF 4JI3J 1RA7A 1R8BA 2C1EB 4HT5A 4WKRA 1V3RA 3W2WB 3FBFA 3HHLD 3AODA 4JV2A 2J7KA 3PW4A 1RT7A 2HNDB 2YNGB 4ECZA 1IN0A 1ZM9A 3O3LA 1S9GB 5DGAA 2LKZA 4YHHJ 3TI0A 2UU9F 4F4AA 2VBZA 1EKRA 1Z1ZA 1IBCB 1FNXH 4KTQA 2M8HA 5IV3A 1KEKA 2NZCA 3VAGA 4AE5A 2BE2A 4WZQA 5JVHQ 1SJQA 2DNYA 1O0PA 1JB0C 4P72A 4RX6A 4X84A 3MTJA 4OI2A 4ZVPB 3MCSA 5DRKA 2MQPA 2K1RB 3W5YA 1CPZA 1P1TA 1Q53A 1UA0A 1RTJB 4LR9A 2ZBIA 2W2PP 3W62A 1BY9A 3BSNA 2PDAA 2EFQA 2JC1A 2YKAA 1SH3A 3SEOA 5FLXY 1NM2A 3W3SA 2ZZTA 1HYSA 3TVKA 1F1BB 2V8DA 4C0BA 3NGDA 3OL9A 2R7TA 2XCAA 4DSIA 2Q6CA 1NU4A 2VQEF 3M8YA 4B9SA 2EKNA 4I6WA 2EVZA 4NCGA 1M5KC 2MZJA 2HW3A 3W9HA 4DEZA 3SFGA 1UJ4A 5EHHA 2RE1A 2J76E 2NYIA 4LRCA 1YG0A 9RUBA 4CT8A 5IFMA 3KLHA 3R3TA 3RZAA 3CTRA 4DV5F 3ZTOA 4ETZA 5LJ5Y 2BDPA 8RUCA 2CZ9A 3D9BA 3MURP 4G1QA 3Q8PB 4NOHA 3G86A 4WFZA 2RDJA 1N33F 2AYEA 1WD6A 4YN3B 3LUYA 1R8CA 5KFEA 1OO0B 3L09A 4ZLPA 1VBYA 1YITS 4Y2MA 2DRAA 1EQ0A 1SV5A 4H54A 1NDCA 2BRLA 3I4HX 4I2PB 4KC5A 1N34J 1DLOA 3EZ5A 2A2DA 2PC6A 2QT7A 1IBMF 2CADA 5JMNA 2BW2A 1T03B 3ADAC 1M5PC 2E5LJ 2FLNA 1S12A 2OPRA 3LTOA 4OX8A 1BGXT 4TXSA 4G6VB 1NK8A 1NJYA 2ACYA 2ZVIA 2VPZB 4PXCA 1HQ2A 3HF5A 4X4NA 2GVDA 3NG8A 4Q43A 2YNFB 3BEGB 2YXLA 5M2RA 4ANCA 4P73A 1KKHA 2E5HA 2YNGA 3M32A 2BKPA 3M8QA 3NP5A 5GAHU 1NSQA 3ISZA 2JSXA 4X66J 2V67A 2ADCA 4P52A 1M0SA 2FPHX 2XI3A 2ZE2B 4CO4A 3K58A 3VGSA 1SJ3P 4IQXA 4FF2A 4LF5F 3NOGA 1URNA 3OTEA 3G8QA 2PT0A 1RHQB 1MLAA 3N5BA 5I3UB 2H1YA 5CAAA 2F40A 3BBBA 5D78A 4J9QA 3KLFB 1RHRB 5K14B 2XMVA 4G1QB 1HWJA 3BDEA 2ZH2A 4Q8EA 1L3KA 1DAXA 1RWVB 3DN9A 2Y3YA 4C97A 3I9V9 1ELOA 2K3IA 3AOCA 3IP0A 1D9DA 1NJWA 2E7WA 5GVQA 4RLEA 1RWNB 2OO4A 3DYAB 2F3JA 4JP8A 2HAIA 4JI0J 1FESA 2XSJA 1VIXA 2BE7D 5C24B 1QTNB 3HVRA 1LFPA 4KHMA 4TN2A 1HPZA 5GAHI 2IMWP 1HQEA 4ELVA 4P75A 4OMFG 3IBCB 4CRJA 1HFEL 4WKYA 2D3O1 1PAUB 5KG0A 1TUGB 3JSRA 3GCWP 4FS1A 5A8RA 2EFNA 1HNWJ 1FT8A 2DNOA 2RU9A 3K17A 4PYDA 4LSNA 2E7XA 4DU8A 1WC0A 3Q2TC 3N28A 1Y11A 3FCHA 3CCMS 4WF9Q 1VCTA 2EBEA 2LDIA 3UCUP 5ITHA 2MMYA 3POTA 3T5JA 4QIVA 2HQCA 3OSPA 1Z2ZA 1SL0A 1HNXF 4DI6A 4DN0A 2YKQA 4MIBA 3PX4A 4ERDA 2DHXA 2KXNB 1AUSL 1NAQA 2Y1LB 3DHXA 3M6WA 3MAHA 4M5LA 4PG6A 3V6HA 3CD6S 2AHOB 3A3PB 2R9LA 1OY8A 2XZWA 3FCWA 3GB0A 4G65A 1LW2A 4FYVB 3ZTSA 4K4WA 3NBPA 2Y1IA 2DNKA 4DSKA 4DV0F 4PG7A 2VDHA 2PGCA 2BA9A 1XR7A 2QO3A 4DR3F 3TQ1A 1YBTA 2BJ8A 3C14B 4DQQA 5AT1B 4UOFA 3ZNUA 3W9JA 2KHCA 2LEAA 4Y3CA 2HFVA 4CNYA 4ZLJA 4RNMA 1QTMA 2DR5A 4MK8A 3LP1B 3HCXA 4DPUA 1L3UA 3FMBA 3CJKA 2MJUA 4CIOA 4WP3A 1Y0HA 5L1LA 1E6VB 5K8NA 5HAOA 4N8OA 2U1AA 2IVFB 3KLIA 2IY5B 3CT9A 5GMKa 5C25B 3T5HA 2Q79A 2DR8A 3P4UB 3IRXA 3HMJG 4LF9F 3FGVA 3LP2B 2W2NP 3PW5A 2XLIA 1VQLS 2K06A 2C22A 3KFWX 3N01A 4I2QA 5L46A 3H90A 1RU1A 3KLEA 1LOUA 5J2QB 1RLCL 2BJ9A 3FFIA 2BQRA 4DR6F 4HEA9 3JSMA 2C2EA 1YKWA 2ALYB 1TL1B 2CDRB 2WCXA 5FJ4A 4I69A 4KPCA 2Y8YA 2XLKA 5BYRA 1BQMB 4NE9C 5BYQA 4FF3A 5CA5A 1X4FA 1F5BA 3PXGa 2DTJA 2ZH3A 4DR4F 2J7UA 3VAHA 2Y1RI 1X4EA 2G1DA 5KOXA 4OX9F 4WFAQ 3T1YF 1RACB 2M5YA 1XMOF 3OR1B 2AX1A 3AJ2A 3F41A 4DX5A 4J9NA 1D8ZA 4HI1A 1VFJA 1U49A 3O6QA 3L7UA 2BJ3A 3H5XA 2J9DA 2M52A 2BVZA 2O01C 3QRPA 3PCOB 2X51A 1U02A 3QMQA 1FFSB 2G13A 3RGIA 3QFHA 1N52B 3M8SA 1ZAXA 1F60B 1Y3KA 2E5JA 2QG9B 2CJXB 4HHUA 4ILRA 4CLSA 4QYRA 5CD4A 4LF7F 1BQNB 3KDOA 4OZNA 2XC9A 5LT5A 4LFBF 5A8KA 4GKKJ 2BMBA 1RHUB 2QGFB 1CBKA 2DVIA 4C9DA 3BO2A 2NXCA 2QLBB 3HHLC 3UD5A 3AD7C 2Z2YB 1IBKF 2GV1A 1CQMA 1WSVA 2RH3A 1VC5A 2NQPA 4OI4A 1GH8A 5J1NA 1G3OA 2GGPA 4NMXA 1SJ1A 1CVJA 3DLKB 2FZKB 2D3UA 2L9NA 4LR7A 5HP1B 4FS2A 2N7YA 1T95A 1BLUA 2LVWA 1RP5A 2QFIA 3UVJA 1KQKA 4TQRA 1QM9A 2VPWB 3AJ1A 5E33A 3DLGB 4D3GA 3CCJS 1N36F 2R7RA 1NK0A 4WE1A 3FZ2A 3GU0A 4ZVGA 3BQ1A 3P49B 1C1BB 5K9FA 3L3CA 1HBNA 4F4WA 2HEKA 4WJBA 4USKA 3QZ8A 4FZVA 5L1KA 1ROFA 5F8NA 3CSKA 4UTGA 3OXGA 2LCWA 5IWAJ 1K8AT 1TVRB 3RB3A 1FKOB 4A8WA 3D3CJ 2CNNB 5CCLA 3TUPA 1Q7YT 3BGRB 2P2CB 3C14A 5KFGA 2KG1A 5CZXA 1NH8A 3ILLA 3TA0A 1WEZA 2UXBF 1IKWA 2KZZA 1UETA 3OJUA 1OPZA 2HFUA 3OFHA 1NSAA 4KKOA 2FJDB 3GCXP 4W92B 2IYGA 1S0NA 4DR2F 1N5QA 1RAHB 2CAJA 4HTIA 1UW9A 2F9DA 3DRSA 4WTYA 1FHTA 2HSEB 3I0RA 4RBUA 3PO5A 3B4MA 5IC6B 2Z2ZA 1WEXA 2ROPA 1T05B 3QWPA 4J90A 1NK7A 1C2PA 1T94A 3MR7A 3PEHA 4WU3A 3RAXA 2KDOA 4CLFA 2FB0A 2HZVA 2CQPA 1X60A 2YVSA 4H4MB 3T1HJ 1UWBB 1XN9A 2CJAA 3MM5B 4DV1F 1FJ7A 4ZPBA 1HQEB 2R3VA 2V4JA 2XHCA 3FDSA 2AGQA 4NCAA 4DUZJ 3J7A1 3GIMA 4DR6J 1ZAVA 2DEIA 2VBWA 3KLHB 1JK9B 2V6AA 5DQGA 5T41A 1XTZA 1TL1A 2OD6A 1YRXA 2C2KB 4RKUC 2C3MA 1VQSA 2A18A 4I6AA 3J7Z5 1MN9A 3Q8YA 3OTCA 1RGVA 1FI4A 3VHQA 3F44A 3QO9A 1DQ8A 4MIAA 1R0BG 2ZC3A 4NASA 2OPQB 3PFEA 4NLOA 5J1EA 4JI1F 3QNWB 4DL4A 2KI2A 4NLRA 4LFAF 3R5BA 2KVIA 2KFYA 3JAMU 1LWXA 3NCRA 2AEFA 2K1RA 4PXDA 2GQ2A 3CMQA 4Z7CA 3R1LA 5F9NA 4K4XA 2HNZA 3MXHP 2YX1A 1UMJA 3C15A 4M5JA 3CO0P 1HWLA 3HHEA 1WOOA 4ZVTB 2HKEA 3UE2A 3V4MA 1X5SA 3J7YI 2FGOA 1QJHA 3D54A 3PRBA 4DL5A 3UDCA 2MGZB 1XNRJ 2BR0A 1HI8A 2XY5A 2M7SA 3EX7B 4WYWA 5E0OA 5DLGA 1GFWB 2RMLA 2VASA 5A76A 1K1QA 3MPWA 4O0NA 4OZLA 5LSLA 5KFXA 1F9FA 4IO1A 1HLWA 4I7FA 1WF0A 2MHEA 4IH5A 3EDQB 2Q1LA 3GJQB 4PPDA 1LXNA 1JLQA 2B3TB 4NRUA 3TOQA 1E6YB 3W66A 3NBPB 3AXKA 2IDEA 3BH7B 4GVBA 2DNPA 1S49A 1OMSA 1SPBP 1MMLA 3MPDA 4LSNB 4OV6A 3EWGA 2FJXA 4F2RA 1YHQS 4YB6A 2IMOA 1P1LA 3CIMA 3ETMA 4RWWA 2RKIA 5FDLB 2VUGA 1S99A 4KBIA 2GHVC 4LBHA 5I3PA 4ZJLA 1R6VA 4ZPDA 1H72C 2GNKA 1HPZB 3ENQA 4W98A 2OTLS 4DLGA 2Q43A 2WBMA 4J7CA 2XGQA 2V94A 2ZVSA 1TZ0A 3GR1A 4ZVOB 2UXBJ 1TV6A 4DPOA 4DJBA 4EU0A 1FCAA 2XBPA 1M1KT 2UVWA 1UVIA 3HJVA 4QWEA 4B3OB 4PXBA 1D0EA 3WBZA 1TL7A 3EPGA 2V2KA 2CQDA 2PA8D 1CJTA 4C48A 2VJUA 2HHWA 1ITPA 1B4SA 5CQGA 2YKOA 4CP5A 5HBMB 3DLEB 2YTCA 3MAQA 1P8GA 4NEZA 1X7VA 1RA6A 1NHVA 2MQOA 1EJ7L 1YI2S 2XNRA 2VFTA 3VGVA 3I32A 3IM9A 2R8HA 5LL6d 4J9PA 4LF6F 1RAAB 4RW9A 1T11A 4DSFA 2P5VA 1YX2A 2Z58B 3UWTA 3MMCA 3RAQA 4ICLA 1AROP 2ERRA 3RB0A 2JFKA 2R8JA 1SB6A 2ZWOA 4M5NA 1XMQF 5B0FA 3NGKA 4OYIA 2EWHA 3U1LA 1HKAA 2O5DA 3M32B 4QBUA 4A8SA 3EICA 3T1HF 4GVLA 3PIPQ 2PI4A 2VB6A 2Z8QA 3I0RB 1S7HA 1AA1B 2GZOA 2WW8A 4OLOA 3CULA 1RCOB 1U0SA 3K0JA 5MLCV 3M6UA 1UFLA 4DZDA 3MR3A 2KKHA 2XMJA 3PRDA 4DUZF 1QAIA 4AUKA 3CE8A 5B0EA 2XHWA 3U1MA 3QAEA 4RL1A 2HLTA 1JNRB 4KYZA 3MAAA 3N5FA 4WPAA 4K5RA 1MSWD 3THVA 4PWDB 2HHVA 1VRTA 4DQPA 5F41A 2JHEA 2VD3A 3JAMY 1VJWA 5A8WA 7FDRA 2HNZB 5G4DA 3IGNA 1VC0A 2MDAA 2DY1A 1FVQA 1FWLA 3P5TL 4PCQA 3H7HB 1FRLA 1TMMA 4X4VA 5HVHA 4NA2A 3CCES 3SBMA 2EXUA 4HR2A 2A2CA 1W26A 2DGXA 5D4NA 4O4GB 2YQ3A 2YWWA 3C66A 1Y3JA 4WIIA 2ZHOA 2P8IA 2RU3A 3NLCA 3CDAA 4P2FA 1D3WA 2HQIA 5A6WA 3G87A 3TQEA 1S5ZA 3C6UA 4Q8FA 3IAM9 5H9EJ 1H2UX 3A3NB 2X3DA 4IH7A 3IG1A 4K4UA 2FD2A 2V0NA 3HX9A 3MM5A 1XNRF 2ZD1B 2GQCA 2MSSA 1JLCB 2HHUA 3Q89A 3I82A 2I8EA 1GXLA 1U8WA 3CC2S 3R5CA 2N82B 1R8PA 5E5NA 2BE2B 2XMTA 2W01A 3K5PA 4OJHA 2CYYA 5D6GA 4CH0S 1Y7PA 5BXIA 4QYZJ 4OJGA 5DO2A 1M5SA 4AQYF 3TEHB 1JKHB 1ZTWA 2ZE2A 4LBIA 5FLXU 4A8QA 2ASJA 4I0WA 3H8YA 1FF2A 2NUHA 4AYBD 1T02A 2JX2A 3M9OB 3D6TB 4ES1A 2CQ2A 1WDDA 2PIIA 1ZM4A 2QRRA 1X0PA 2YX4A 2W2OP 2AGOA 3NL0A 3VV2B 1GEHA 1X5TA 3ELHA 4UY85 1NXIA 3EGNA 4P2MA 3HM9A 2VICA 4DR5F 2VODA 1FERA 4RW4A 3T9ZA 4NLYA 5EWFA 2CPXA 3T5KA 1JLAA 3CWJA 4BDPA 2YWEA 4HLBA 5HMXA 4JYAJ 1XNQJ 3A1YG 3WX8A 1FFWB 3KLEB 3GIJA 3BV8A 3M1VB 2EEYA 5KFUA 3UN3A 2XB2D 1LWCB 1S79A 2LP4A 3KLGA 3DOKA 2UUAJ 4C0OC 2XS5A 5IS2A 2RQCA 2RUGA 1SJ4P 4Q0BB 1SIWB 4JI4F 4O0IA 1Q82T 2ZH9A 1RT5B 4PXEA 1TQLA 4KHPF 4HTJA 1SIZA 2LMIA 3AXMA 1Q7LB 5HVFA 2YH1A 2LECA 4P9SA 1JMTA 1RZMA 4DR7F 1VQ4S 2W8LA 2CQ4A 4F04B 5LSRA 2OKQA 2GGPB 3MI7X 4KGKA 3EPIA 4J9LA 2AJQA 4AL5A 3KDNA 4CZCA 1EETA 1FRMA 2YX7A 1WKKA 4XAKA 1RWXB 3H0PA 1XWLA 1MROB 1U0HB 1F2HA 3R7SB 1KFDA 1OYEA 4KFBA 4DPXA 1SL2A 1WI6A 4IR9A 1ZH5A 2QJ3A 3QAUA 2DJWA 1IKVB 4QIWD 2KM8C 1SC1B 3HFZB 4RO0A 2RF2B 4ECUA 3SSQA 3Q23A 4AD6A 1S0VA 1HQUB 2DH7A 3LO3A 3MPUB 1X9MA 2AKWB 4NYOA 1MWQA 3P5BP 3TX8A 5D4OA 1WC3A 1FDDA 1FRJA 1TUVA 3D1HA 1EETB 1SC6A 1MMNA 4IRCA 3D0GE 1FXLA 2HHTA 3WQPA 5I3UA 4NLSA 1VGYA 1FRXA 1X8DA 2WAQD 3FBCA 2HFNA 2IRXA 1FK9B 1HHQA 2U2FA 2XWXA 1NSKL 3IG1B 4KSEB 4CLZA 1RBOB 1VIOA 3PHEA 5I4MA 2ZH5A 3PZPA 3S01A 1N56A 1DQ9A 3C16A 3M2RA 4FVCA 4NI2A 7FD1A 5LSOA 2FLLA 1K44A 4FPRA 2MPUA 1S6PA 2R7OA 3TZXA 5B0BA 1WF1A 2BEFA 5DM7Q 4QPXA 2C2OB 2E1AA 5AXMA 4CM2A 4QR2A 3JSMB 2UXCF 2HZCA 2R2SA 2RILA 4DZ6A 3FBBA 5KFBA 1RKJA 3KMSA 3PJXA 1S6QA 4Y2CA 4IDKA 2O3DA 3CJKB 1YSJA 1T3OA 2UUWA 3QT7A 2M88A 4PQAA 1BWEA 2YKNB 3PY8A 2CRLA 2BUNA 3KLIB 3VQTA 1R3NA 2NXUA 1SC4B 1YZ6A 2ZKUA 4NMLA 2WSCC 1RISA 2L41A 3VF0B 2GIFA 4QJVA 2IJRA 4PWDA 3CJSA 5CYQA 3LP1A 4MKAA 4LF8F 4ZOSA 2JNJA 2M3DA 2DGWA 7AT1B 3CUNA 1HI0P 3M2VA 1LW2B 4PWUA 1GTEA 1VQ6S 2MY8A 4RW4B 5DDPC 4YEAA 4R5PA 3CPWR 4JUZA 1YTYA 8AT1B 4PKDB 1S76D 1UEVA 2R2RA 2IRYA 3V6KA 2PN6A 1HWUA 1R0CB 3G6ES 3QSIA 3PYDA 3BN4A 4JI8J 5DZ6A 2CQIA 2KXFA 4MIWA 2N4DA 3BR8A 2XYGB 1ZETA 3DLBA 1DTQB 1EX8A 3R6GB 3NWRA 1PC4A 2HHHF 2XYPB 4LF5J 3GFHA 3BSOA 2NPIA 3W2VB 1VQYA 1U48A 3O8WA 4TY8A 4ICLB 2D74B 4LSZB 2JEFA 2YBVA 5GAGU 1DQAA 1NHKL 2UUAF 3FEZA 4XO0A 4K4VA 4ECSA 1ZPWX 1M5HA 1KR4A 1SQGA 3GG0A 4WFYA 3M8PB 3V81B 1I1GA 1XEZA 2D9OA 2MZTA 4QW9A 3UPFA 1NCLA 3BO4A 1ZZFA 2H48B 4LQ9A 5CYMA 4IOBA 4Z37A 3MECA 4Y6IA 3FSIA 1L3SA 2WONB 2V2VA 2EFOA 4DPTA 2K2PA 4DQRA 5HO4A 4D3HA 1OY6A 3RUBL 1TKXA 4PUOB 1N6QA 4OHYA 1RT5A 1KNZA 2HLUA 2DGTA 4B9MA 4HACA 4IH6A 3LAKA 4YR0A 3K59A 4JB8B 4IRDA 2VHGA 4OHVA 2QZ8A 3GP9A 2W9CB 1RT6B 3DU5A 4MMOA 2QA1A 3CD0A 3D6HB 3DCAA 2UV8A 3H20A 1M1HA 2H65B 5L38A 4C6AA 5HVGA 4X62F 2W7OA 3TO8A 4EBDA 1A6LA 1U1LA 1Q78A 4JI2F 4DG1B 3BSAA 5GAEI 5EWEA 4ZPVR 1YBAA 1VHIA 2FHKA 2B51A 2WVEA 3AB2B 3ENWA 3OHAA 5J2PA 4KQZA 1SL1A 2HHSA 1X5PA 4GC6A 4OI6A 2B0GA 3R27A 1NPPA 4RUAA 3SV3A 4FBUA 2P6SA 2CXEA 3LF0A 4FNIA 3MM7B 3MMAA 4DXLA 3KYLA 2CUYA 4NWBA 4UUWA 3RB6A 2VOOA 5KFSA 2HRTA 2W9BB 1FRIA 3UW1A 2E5LF 1X9WA 1T9TA 5C2GA 2OP5A 2QL5B 4WYLA 3FRYA 2VG5A 3AY0A 1V3SA 2DXEA 4RW9B 5KFYA 4ED1A 2HRYA 5F3TA 3KJFB 1SI9A 2ZITA 1S1UA 1S48A 4K7QA 1U1KA 3NGUA 2CWXA 3PYGA 2GA7A 3D2WA 5LMNJ 3LP0A 1FE0A 1UVNA 1IBLF 3G82A 3UDVA 3UD3P 4C8YA 1WC1A 2UUCJ 5JVGQ 3PR5B 2CQ0A 3AA8A 2OPQA 5K8PA 1VISA 5I3QA 4XK8C 2WK4A 3MM9B 2HAFA 1JLEA 1WEYA 2XZDB 2MQMA 1RHMB 4DL7A 1MWYA 2DNHA 3MR5A 2ZHBA 3A8JA 2KHDA 3RW6A 1BMQB 3E01A 1V5VA 2KT5A 2VF3A 3RRKA 4V19X 5HLFA 3X1LB 3NMRA 4DPWA 4UOHA 4CLUA 5K14A 1XMOJ 4OX9J 1HYSB 1JLGB 2V4JB 3A8EA 3HT3A 1SCJB 1WTBA 1JX4A 2DR7A 1UWBA 4KGVB 2B7CB 3VZIA 3MHYA 4KV8B 4G1PA 1W2BR 4TU8A 2MLYA 2VC1A 2XM3A 5B08A 2RQ4A 1H2TZ 1WI8A 5KFJA 4KFBB 3K7RA 1WELA 2HNDA 5CD4H 2MKIA 4OLPA 3KHGA 2ASLA 2GFFA 1OWXA 1RT4A 4F26A 4EO6A 1TKTA 1IKYB 3BBFA 3DRSB 1KBRA 2X7IA 5HQMA 1NPRA 4QWBA 1DY3A 3AOBA 3DDNA 3TJ9A 4E0DA 1RWOB 2YWFA 3GYXB 3MMAB 2RT3A 4URGA 3PX0A 2FVPA 2YQ1A 2UUTA 1KD1T 3DOMA 1VMBA 3OVBA 1RTHB 1ZYQA 4UZBA 5E3AA 2FJAB 2B7BB 1OJ4A 2MKYA 1Q95G 2APOA 1G2EA 2NSCA 5A2QY 4OJ3A 4LRDA 1R6YA 1SH0A 2M70A 4WP9A 1U24A 3T9NA 4DR3J 2D7SA 2WBRA 4IFYB 2KTQA 3CJ5A 4K4SA 4HDGA 5HN0A 3OTOF 4I67A 5HBMA 4DCPB 5T14A 4KAIA 4KB7A 4L6V3 2CJ9A 4OYWA 1Q5VA 4JI6F 4X4TA 2ZUGA 1CEZA 2XNQA 2YNIA 4WTOB 3NNCA 2AIRB 4DV6F 2YKPA 2CFXA 8ATCB 5AJ3J 4LF9J 2IJNA 2BANB 3MF5A 1Z2LA 2YY3A 3RW7A 1LWEA 4TLRA 4DV3F 4DR1J 2DR9A 3B82A 3V2UC 1TTHB 1UKUA 2CA9A 5DLFA 4NXMJ 3QGHA 4J37A 1UAWA 2N3LA 4RNFA 3V5RA 5KFNA 1KN6A 1XR5A 3RBXA 3T1AA 4MJKA 1W25A 2ZUAA 2I6WA 2LU1A 3LWMA 1S6UA 1X0FA 1HBMB 2JEGA 1N48A 1JIHA 2CNOB 3DGPA 2HK3A 5IM0A 4L72B 3GV7B 4A8FA 4FXDA 3DRRB 1M5VC 2W7AA 1IM4A 3GR0A 2PO4A 2C2RA 4O3PA 2A6OA 4P74A 1IJEB 3CCTA 3C8YA 5KT5A 2C28A 3QWUA 4RBVA 1VQKS 4ELTA 5ETQA 2JVOA 3CEDA 5KFIA 1CQNA 1KSPA 3L95X 4ED6A 3R5DA 3CMES 4CQ1A 2RHSB 4RW7B 5KFOA 3TARA 2B8QA 1Y10A 2CPYA 2IRUA 3OBIA 3V6DA 3MEGA 4EEYA 4XDDA 1B70B 1PBAA 1QVFR 2ZZNA 2OLWA 2BBEA 4IFVA 3RYLA 3OUYA 3WIVA 1Y4ZB 2OMOA 4HL9A 4KKOB 4RUBA 1WHYA 2HMIA 2HRUA 3D28A 3M30B 2E29A 2KH9A 3FCVA 2YNHA 2ATLA 3EZOA 4TYAA 4LFCF 3VGTA 1ZS6A 4A8OA 1IQTA 1F9HA 5SUHA 2NCKL 1NUEA 3LP2A 5B7WA 1UJ5A 4U6PA 3KJVA 5HQLA 3JTNA 3GILA 4Q44A 3CD7A 3SDEB 3S8SA 5J2NA 3TW0A 2GHWA 2OSQA 3CJ8A 1CLFA 3NMAA 1FKPB 2DH9A 3KTQA 1N36J 3NNHA 1VQ8S 2DGSA 1Q1KA 2OEKA 3K8VA 3MPYA 4O23A 2MHNA 1U25A 2DHSA 2GJ2A 2Z2LA 3QIDA 4ED8A 1U09A 1B7YB 5IT4A 1FE4A 2XMAA 3G8TA 1YWXA 3W65A 4DL3A 1LK5A 4RNOA 2E7VA 4FYXB 4MKBA 1S59A 2DITA 2CNKB 2W25A 2YWHA 5AE3A 5KFQA 4Q7AA 2K3KA 2R7WA 3J80U 5F9LA 3OFGA 1IM6A 1BHNA 2EKYA 1UEUA 4F4ZA 4ED2A 4CLPA 1SQFA 3GYNA 5A8KB 1WNEA 1GK8A 3KUHA 1VQNS 5A2QU 2CZ4A 3DGVA 4Y28C 1I94J 1GTHA 1UZHA 2B6AA 1CJVA 3V4IB 3JB9k 3SI8A 1IXKA 2W1BA 4EZ6A 4OYMA 1X4GA 1YJVA 3IBWA 4WFNQ 2PSZA 5ETLA 2HHXA 2VU5A 3BF4A 2KRRA 1YK9A 1J27A 4O4GA 1KQFB 4DV7J 1FJGF 2JEIA 1S77D 2BANA 3SZ2A 2UXCJ 2J0QD 1RT3A 4RW6B 2JVRA 3PM9A 4CO2A 3H4DA 1KFSA 3OQ2A 2CKWA 1KLMA 1JWWA 2DRDA 1IJFB 3W7BA 3HT0A 3ET6A 2A1BA 1FKOA 4YB5A 2QYGA 3OTDA 5HATA 5M2PA 4B9TA 4Y2IA 5KTQA 2GJFA 4V1Ak 1EZZB 3T19A 4B3TF 4LVNP 3R5GA 4IFYA 4DL2A 3IC1A 4S0MA 1K0VA 4M1KA 2E1PA 2HHPA 2MQLA 4DFJA 3N6NA 3P8BB 3ZTRA 3EXCX 4RNNA 4L73A 3KLGB 1TFYA 1OIAA 3NRBA 5AE1A 3V6DB 1BXNA 4DWIA 4FYYB 4OHXA 3H5YA 2RVJA 4ZP6A 4FBTA 2GS8A 1KHWA 1Y00A 4ATNA 2HYIB 2Q3PA 4RU9A 1TL3B 3OUYB 3KK3B 3RR7A 1Y5LB 4GRSA 2ZDPA 3MCOA 1S1XA 1BQNA 5LM7E 4CLWA 5DQIA 1RTZA 4C8KA 2LLZA 4CM0A 2WOMA 2AYBA 1OSDA 2HIQA 5ADZA 4L75A 4OZJA 1IKXA 4PQUB 1V3ZA 3C15B 4DSLA 4IG3B 3PEJA 2RAQA 2ZFHA 1L3VA 4Q45A 1JLGA 4ZN3A 2ADBA 1REVB 2HWTA 2R42A 4F4YA 4GO7X 2GO9A 2RS8A 1SXLA 5DGBA 3DLEA 2W4PA 3K8WA 2IC3A 1SV5B 4I2PA 4ZVRB 3CIZA 2WB1D 1NB7A 1ZAWA 1HL6A 4H4KA 2HVHA 2BJDA 5AE2A 2BKOA 3K5OA 1CJUB 2J8AA 4F7VA 4JI3F 3DRXA 1IVZA 3J80Y 4FKYA 1QUVA 1RADB 1HNVB 3GZ7A 1U1PA 2G0JA 2YNIB 1UA1A 1FD2A 4BBYA 1T7PA 1Q8BA 2DYAA 2EPIA 2ILYA 3HZGA 4CNZA 2O67A 3G6XA 2RS2A 4FF1A 1P9QC 3SSSA 2B4UA 2OD4A 5EWGA 2ASDA 2IVYA 3FNNA 4QYZK 1R89A 2OELA 5L9XA 1N5YA 2YKMB 3R2DJ 1QVGR 5C5JA 1S1WB 3HVWA 3ZTQA 1HBOA 4MYUA 1N5TA 3JQKA 3RBDA 1FDBA 1CJUA 3G96A 4Q0BA 1EP4B 2C3OA 2VG5B 3HKZD 1TAQA 4YY3F 4IOCQ 2YH0A 2ZBQA 1E6YA 2FJBB 2HURA 4IG0A 2DR6A 4LRBA 2EFPA 5KG6A 4F0HA 2ZZMA 2B43A 1VBXA 4F25A 1NLKL 4I7FB 3PR4A 1NK6A 4MFBB 4K2XA 3SXLA 3ILIA 1B0VA 1DTQA 2ZBPA 3KG1A 4F0MA 5JUMA 2HBZB 3CCQS 1B3TA 2XS2A 5ETOA 1QD1A 3CJRA 2VKZG 5A8WB 1DURA 4DV2J 5DDQC 4NRTA 1PJ6A 4FP9A 4YFUA 1REGX 2YPYA 3L4BC 3H25A 2VQEJ 2VG7B 2GVZB 4JV5J 2ZWPA 3K5NA 3RG6A 5C7PA 2BX6A 1EAYC 1VRUA 3EVWA 2V34A 3FEXB 3U27A 1NBEB 1NDPA 5HMWA 5BJRA 2RDIA 1QDUB 4N77A 3H98A 1RT1A 1T0TV 3PW2A 3KNGA 2Q66A 2G2ZA 1W2IA 1NO8A 1LW0B 2H3EB 3Q8UA 3QQCD 4CO1A 2RQMA 5A0YB 1C0TB 1ACMB 4UT4A 3CCUS 4ED5A 4ZP7A 2IM0A 3SSRA 1IBLJ 1NDKA 5B0DA 3QLHB 2JLGA 2ZEJA 4WU2A 2F8EX 1ZM3A 3CJ2A 1CJKA 1URRA 1Y5NB 4MYTA 3TZWA 3EYZA 5I42A 3FBEA 1DLOB 3ITHB 1RT6A 4IDKB 2QSWA 1YQHA 3I5CA 3HFVA 5F0WA 2MKJA 2C3UA 5LMUJ 3DM2B 3T5LA 1T9WA 3W5ZA 3G4SS 3UVJB 1HBUB 1HW8A 2H51B 2Y8WA 2DRBA 1GMWD 3I31A 2P6TA 4LQ3A 5AXLA 4HHHA 1V5IB 3H4BA 2EG2A 3M8PA 5HMZA 4EBCA 2Q6BA 4CWBA 3V81A 3DXBA 3IMQJ 3NOCA 2FIUA 2FDNA 5LXYA 1ZOTA 2W7PA 4J9RA 4TY8B 1MN7A 3TYTA 5H9FJ 1WORA 4TQSA 1RJJA 2IIHA 2MJNA 5CH7B 3T6JA 3QT6A 3BREA 5F8IA 1NK5A 2V2ZA 2MSTA 3KJNB 5ETRA 4A8MP 3KHLA 3LANA 2LA4A 4LMZA 3M8RA 2ATCB 4DX7A 2C2NA 1X9SA 1TP7A 3WHIA 2KB2A 2EC0A 1REVA 1KTVA 1Q0NA 1S1XB 4J91A 1NMEB 3D5MA 2VPYB 4M5IA 3QPIA 2R7QA 3RAMA 1BQXA 4ED4A 3W9IA 3QFWA 4FYWB 5F8LA 3MR6A 4DQIA 2HWHA 4WFXA 4QWDA 3IO1A 3S6EA 3KMQA 1N88A 2V8GA 1JLQB 3X3UA 4ZVHA 4JI5J 1DFDA 2HNYB 3CD5A 3D1OA 5J2PB 4QWAA 4PG5A 4TY9A 3LH2S 1BQMA 3ZFVA 1H7XA 1S9FA 3D1QA 5L9NA 1AZSB 2B4PA 1N34F 1J5EF 4A48A 2R7SA 2XO7A 2G0IA 2AYMA 1IWGA 2KJWA 3EGVA 1SBRA 3I9ZA 4GC7A 4FF4A 1D09B 3D4JA 3ILOA 5J2QA 3VAJA 1QAJA 5KG1A 1NSPA 2WZ1A 4N47A 3AD8C 5C25A 2JOQA 3HDSA 3BO3A 1T8EA 1N32F 3ENVA 5HL7Q 2O66A 5HP1A 2C3YA 1O8BA 4PAAA 3H40A 2JWNA 3ET6B 3DRPA 3PIOQ 4DV6J 4KPYA 2WHOA 1FTCA 2KFNA 4X66F 1BWVA 2DHGA 4B08A 3MDFA 3MECB 2HBRB 1CJTB 1MG7A 1X4AA 3D67A 3HHDA 4TLQA 4X2BA 1P27B 3PNIA 4NCGB 3SQGB 4HT7A 3GV8B 4ZN1A 4B9UA 3TAMA 4JV5F 3MEEA 2Z30B 2N7CA 1F5AA 2GQQA 3CJ4A 1H73A 1DBDA 1EKSA 3T6BA 3KG0A 3ETOA 4USVA 2GMHA 3VVUA 2R2UA 5LXRA 3ENAA 2QL7B 2IC3B 3OT9A 3QT8A 5E41A 4LIRA 4C8MA 1JKHA 3BN7A 1CG2A 1OQ3A 1RBAA 2B4OA 4JI1J 3OVSA 3DMJB 3I56S 5HQ8A 2QMUB 3IS9A 3IR6B 2G1HA 4QIGA 4X65F 1H74A 3OR1A 5HI7A 4UZCA 3AT1B 2VV5A 4ZLNA 3JS9A 3GIIA 5GADI 3AA9A 1O6XA 2IBKA 1H3DA 1KTQA 5C42A 2OJ3A 4G3IA 1RSCA 5DZ7A 3RRHA 3OFEA 5D77A 4USHA 3LW5C 5ETSA 3KXDA 5KFLA 4O4RA 3PRVA 2V9KA 4CDIA 5D0HA 4YR3A 4DF8A 4ZPWR 4CO5A 2K7JA 1HNWF 2JZ5A 2YPZA 1CS4B 2BKNA 3KG4A 3CCLS 3Q2SC 4LUBA 4USMA 3C6TA 1LWEB 3DDIA 3MWBA 3TA1A 5L1JA 4LFCJ 2HQFA 1CULA 4DV4J 4I2QB 2L9DA 1ZTTA 1N4LA 5HANA 3NAIA 2YWKA 3HZEA 3VVTA 2CQGA 1HMVA 5KFCA 4USIA 3Q22A 1FJCA 1NPKA 1NNDA 2HVEA 3IWLA 3D66A 3M2VB 1P9YA 3JQMA 5DDRC 1A0OB 1RWPB 2DCUB 1IKWB 3LAMA 1FKPA 3FFIB 4IO9Q 4OX7A 4OZ5A 4LF4J 1XIQA 1PILA 1WKJA 1KLNA 1RT2A 2JDJA 1JLAB 3A8KA 4I1TA 3MUVP 3JYTB 1PO6A 2NLWA 4DMZA 1MMDA 3OLAA 4ILLA 1SQEA 2UU9J 1YRUA 1QY7A 3GJTB 1FEEA 3I96A 4CH7A 2OI2A 2YNHB 3TVZA 1KVIA 2OPSB 2BOPA 3MUMP 3MFIA 4ZS6A 4H4OA 3L7OA 3FZBA 2OEMA 3US5A 3VR1A 1JJ2R 5KG3A 5DQHA 4IFVB 3C2PA 4KIAA 2CG4A 3H5UA 2Y9HA 2GVDB 3UFCX 2KT3A 3W61A 1VR6A 4M5DA 4LSLB 2NSBA 2IA0A 3N79A 4J9KA 3DC2A 3J81U 1U47A 4Y2KA 1EQMA 2HVIA 3QGIA 4KR0B 1KQGB 2GO8A 3R9LA 1RB0A 2NPFA 2QX0A 3IS9B 4LT6A 4ZPTR 3S7RA 3K5LA 3RRGA 4U7CA 1SJRA 3TAQA 1K9MT 1OPIA 2RHQB 5IWAF 4OYPA 1MROA 1NJIT 4JI7J 2QLJB 1FX4A 4O3RA 4AXJA 3QRRA 3J81j 4N76A 2IM3A 2P9CA 4EI2A 1X5OA 2JLEA 2UZAA 2FVCA 5GAGI 2RF2A 2QFJA 2E1RA 1N33J 1UEKA 1ULRA 4F3MA 2DT9A 2ZH4A 2HHHJ 2ZOFA 1Q4RA 1WC4A 3D0HE 3TNVA 4ZP8A 2XMMA 4DL0C 1M1GA 2BW7A 2CQBA 3NCQA 4DF4A 4O3SA 3IXQA 6FD1A 3MTKA 1XERA 2W4CA 4M8LA 2VFRA 3MEEB 3SCJE 2ZJPQ 2VFSA 5BR8J 3ISNC 2QEXS 2AJ2A 5KT4A 1VQOS 2F5GA 2HQDA 1DJ0A 1KC8T 4LVOP 4R0EA 3FK4A 2DB1A 3K57A 1RAOA 3KNAA 4OI3A 3I6PA 2BM0A 3OXLA 2FVRA 3M05A 1S72S 2FLPA 2VQFF 5GADU 1B7FA 5D0RA 3VTIA 1WF2A 2R7VA 1UTAA 1RAGB 2DNLA 3KHRA 4DN9A 3EE3A 3R2CJ 4U96A 4FXWA 1RDRA 2IFXA 1R31A 1F6TA 2WRMA 4U9RA 3VGUA 4NLPA 2DGOA 4DQSA 1GAOA 1UVMA 2H5JB 3PDNA 3KK1B 4YOEA 2EFVA 5B0CA 2ABYA 4NZ7A 2BQ3A 3BS9A 3GJRB 3BQ0A 2VJVA 3VAKA 4OYOA 4Z7YA 3HSGA 3ZZRA 3W8GA 2QA2A 1HBMA 3LOUA 1EP4A 3JQJA 3CMAS 4ZVUB 4WXOA 5KT7A 2OPRB 2CZVC 3RB4A 4PZVA 4A8KA 4W90B 4Q2MA 5J2MB 1V6HA 1XMBA 2GIRA 2MEWA 2IJFA 2ROEA 3LGNA 4O44B 4EWTA 1QAYA 4Y65A 1WKLA 5AXNA 1TK5A 3D68A 5J1EB 4LRAA 3J81Y 5CYJA 1RYSA 4HACB 1LNQA 4I56A 4G1IA 3OV7A 1IBMJ 1VLYA 2KM8B 3QO9B 5KG5A 3FSYA 4RW8A 1TV6B 1SUQA 1WC6A 4USUA 3GMGA 3FKBA 1OQ6A 4K2JA 5EX0A 2MQNA 3M6VA 4X4QA 4YP3A 2KFZA 4N56A 3U02A 1EARA 3GFYA 4YY3J 1HNXJ 5KT2A 1LK7A 1ZM2A 2G2YA 4ECVA 3DLHA 1YDLA 4AL6A 4DS4A 4JV0A 5HROA 3KWMA 3BM7A 2UUCF 4NXNJ 3HSZA 3VAFA 3C3LA 4OX6A 4CLKA 1YIJS 3WC2A 1R8HA 3I0SB 3IRXB 4NZ6A 4CLLA 4C11B 4DV0J 2D69A 1RTDB 4ZCKA 3NCPA 3N4WA 1ZBTA 4MH8A 3ZZTA 3MM8A 4NXMF 1N54B 1K0TA 1EIYB 3PTWA 2KJVA 1C1CB 3GE9A 1KWMA 2Z2MA 5IQ6A 3ZZYA 3CCZA 5F8MA 3CXCR 2AQ4A 1UFKA 3F73A 2BJ1A 4FXVA 2CJQA 1PYSB 1K47A 4KHPJ 1UL3A 2A10A 2DD8S 2FHJD 3NY0A 3SCKE 4OHWA 3ZZOA 3PKYA 4C3LA 3TAPA 4LF1A 2QLXA 2AGPA 4YB7A 1RCXB 2N4CA 2AJ0A 3KUEA 4M5DB 5A0YA 3HHNB 1TKTB 2HIYA 2KT2A 2E9ZA 3MAAB 2AEMA 3M6XA 2B4VA 4P7VA 1EB0A 1NHUA 2LXUA 3PO4A 3SCIE 1F9EB 2QLWA 3R5AA 4M5HA 1UW4A 4ZCIA 2GVZA 1KDNA 2BE9B 2MGZA 1VRQC 5GMDA 4ZJOA 3PACA 1TL5A 2OPPB 4ZVEA 2NXJA 4PABA 1PJ5A 2UXDF 1HHSA 5DJBA 4ZLLA 2LYVA 2BYCA 4F0KA 1DARA 1X31C 3OVAA 1BE4A 3NWGA 4OYBA 1XMQJ 3BR9A 5HJXA 4RR5A 5IOLA 4ES3A 4U67Q 1N6QB 2R8KA 2DXDA 1AYEA 1CC7A 1TL7B 3MD1A 4M95A 2LQ5A 4YR2A 4E8UA 4NL5A 3E51A
chains in the Genus database with same CATH topology
1KONA 2QA4S 2M0GB 1SUQB 1U8SA 2VPXB 2J9EA 2LEPA 3QZ7A 2KXHA 2ZKTA 5CHCB 1TR0A 4ZCLA 2G9OA 2IVMA 1HNVA 2J9DE 2YKMA 3P3DA 4M94A 4BCAA 3HVTA 5DG9A 5CYMB 3GWCA 4NLTA 3VAMA 5FD1A 2QV6A 3E2EA 5DS7A 5IT0A 4RW8B 5J2MA 3ITHA 5KT3A 4RUHA 1TFWA 3KLFA 1FTRA 3IGVA 4C7QA 2NREA 4BWMA 3TVYA 2OPPA 3M9MB 3DXSX 4C3MA 4ECQA 3I5AA 1WG5A 1LW0A 4DFMA 3MMBA 5CZVA 4CTAB 4NLUA 2J0XA 5HMYA 2XSFA 3VWSA 3N6LA 1RTIB 4KT0C 2MQQA 3KK1A 1H6KX 2HGMA 1YJTA 2DNQA 1FVSA 2VG6B 4TU7A 4DFPA 1HBNB 3KHHA 3FVYA 2CVIA 4IG0B 1D8YA 4DBQA 2J5AA 2PMHA 4IR1A 2BRKA 1LWFB 4NX9A 1TL4A 4YQWA 1RTDA 3Q0AA 2UVUA 1YRTA 1U1OA 3JSBA 2AWZA 4WE1B 4BC9A 5HROB 1JLBB 3K5MA 4URQU 4DSEA 3MM6B 2XGPA 4N41A 2FVSA 1NZAA 2GIQA 5KFFA 2FJVA 1KVJA 4AL7A 2HNYA 2CJKA 2ZJQQ 3PVXA 1FK9A 1X4DA 4ID8A 4O3QA 3FQKA 3WX4A 1NH7A 1DTTA 1HD0A 2QMWA 4O3OA 2PD1A 3Q8SB 4K4YA 4F02A 4BC7A 4UY8T 1DZ5A 4J9SA 1JXLA 1VBZA 2DCLA 3NNAA 3JSYA 2KO1A 3MD3A 4YHHF 1HARA 1U26A 1TK8A 1HWKA 3JTPA 5CCMA 1WHVA 2CPHA 2B6AB 2DNNA 3DHWC 1RAJA 3V4IA 3PX6A 1J2VA 2I9SA 1DHMA 2HG4A 4NLDA 1U6FA 4O3NA 3J7ZT 3ZC4A 5KFMA 2ADBA 1S9GA 2DGQA 1HNZF 2ILZA 4CO3A 4ELUA 4MK9A 3QIPA 3HHKA 4QR0A 2L48A 4QQBA 2RD5C 4A8YA 3HVTB 2WTFA 3M2UA 5EGYA 3UR3C 4LF4F 3R1HA 3BGLA 1JLBA 2M8DB 1H0HB 3G6YA 1YJWS 4XPEA 2V9WA 2PFFB 3DRPB 1C4AA 2QE5A 3CDUA 2L9WA 3CJ0A 4QOTA 1Q86T 2K7KA 3S1TA 1TAUA 2Z4PA 5IQQA 3FMWA 3QYYA 4P6QA 3KLVA 2B56A 2ZDOA 4U7UK 3DLGA 2LXFA 4Y00A 2MZSA 3DOKB 3ZZ0A 3QJJA 2V8VA 1D1UA 2V4QA 2O1PA 3J7YU 2IM1A 4P7TA 1AFIA 2BJEA 1X4BA 3CCRS 4X4OA 4ZA1A 3LQVA 4GO5X 2Z0GA 4R25A 3UDLA 5GAEU 2QA4G 3SV4A 3E3XA 1PC5A 2KRBA 3MPVA 2W4DA 3ULHA 3M8QB 4I6YA 4NYPA 3TUIC 4DLEA 1AUDA 3GG1A 4NLGA 2N3OA 4KO0B 5JJBA 3U7JA 1F5CA 2AF6A 2R4FA 2JEJA 2L3MA 5C42B 1YGYA 3DU6A 2FUG9 5IM0B 2MZ1A 3HO1A 2G0CA 3QGGA 3IN5A 2J7WA 2PA3A 4A46A 5E3PA 5EX3A 5T7LB 1GQEA 2HFOA 1IKVA 1S0OA 4YDXA 4F3OA 2G4BA 2AJFE 2I5JB 1O5JA 2ZNZA 1KS2A 1PSDA 4CH1A 4USJC 2HPUA 2CQHA 5BR8F 2DISA 5K8OA 5DM6Q 3LWLA 1XNRF 3O1LA 5HLFB 1SKSA 2C2DA 2AD9A 2ZBCA 5EDWA 2J0WA 4Q2LA 4XPCA 4H4OB 2AV5A 1RKIA 3C6UB 4DOZA 4V19J 4BHQA 5KT6A 1YJNS 3HXMA 2HS0A 1NK9A 3C46A 3EGWB 4RBTA 5KG2A 1DRZA 3SDEA 5E2QA 5J2NB 1HNIB 4A8XA 4A47A 2WSEC 2HS3A 3MOZA 3Q8QB 5KFVA 1Q8IA 2LQ9A 3NS5A 2WB4A 5E3RA 3LPYA 1Z4UA 4C8OA 1N0UA 1AW0A 4IKAA 4ED7A 2C3PA 2P9EA 4RZRA 4JV1A 3E8OA 3MM7A 3B4DA 2FLOA 2XMWA 2DPIA 5KOWA 2IAJB 4IQMA 4WZMA 2JRSA 3CDBA 6FDRA 1NKEA 2GC8A 2XG8A 5EUHA 2Y0SD 1S1TA 4DG1A 1YJ9S 1FJEB 3G9CA 1L3TA 2MZQA 5AJ3F 3P96A 2XCPA 4F2SA 2YNFA 4R0JA 2UVRA 3MMBB 1MNEA 5G0RA 4EFAC 3IWNC 4HH1A 2XI2A 4ALZA 1J5OA 2JL9A 4CCHA 4IOAQ 1KOHA 2XULA 1K1SA 5KG7A 3HPOA 2F8MA 2ALZA 3HHLB 1VQ5S 4CI0B 1WWHA 3MOJB 4C8NA 1U4BA 5F8GA 1C1CA 3I55S 1FXDA 5KFRA 5IXUA 4C8LA 5E7OB 1Y9OA 1UVJA 4NA1A 4XDCA 1U1QA 2ZD1A 4TU9A 2AW0A 1N5YB 2DNGA 3E01B 3ZZPA 4B3OA 2RRBA 3AAWB 2OFGX 2R7XA 3N6MA 4ECWA 5A8RB 2CDQA 2UVVA 3OSNA 1F0XA 3MMJA 3ONQA 4AL5A 4J5OA 3SQGA 1WACA 4OIXA 4DFKA 1VQ7S 1D9AA 2ZH1A 4ECTA 1B0PA 4MTPA 2XMUA 1RTJA 1U2RA 5D4LA 3M9NB 3H5SA 2PMZD 4OFZA 4IG3A 3DYAA 2DO0A 4C3KA 4N5SA 2I0XA 2OSRA 1FHTA 1K73T 5FDLA 1IQZA 2WOMB 2COLA 1ZZNA 1NJZA 1G6BA 1FO1A 2AJ4A 2VZ9A 4O44A 2E9RX 3O2IA 5EN1A 1UJ6A 2HVZA 4C98A 3IR5B 2X1BA 2LQBA 3CCVS 4B02A 1U1NA 1TL3A 5L39A 3KK3A 4ED3A 1S0MA 2F4VF 1MWZA 2FJEB 1S4FA 2I1RA 4PG8A 3QLHA 4AXIA 4FYDA 3H2VE 5DDOC 2CPFA 2GJIA 2GW8A 3ICLA 2OAUA 2JLFA 2RRAA 1L5UA 3AB4B 2LDYA 5FIIA 3VQSA 1VHFA 4AFFA 5K8MA 1WG1A 3DLLQ 1HD1A 3BB5A 3TANA 1Y5IB 2CPDA 2NUUG 4MFBA 1RWUA 3UR0A 2E9TA 3MEDB 3DI6B 3EXYA 3O5TB 4FVMA 4J9MA 4JI0F 4JI5F 4QIEA 3DOLB 2CVEA 1LV5A 2AJ1A 2HQ3A 1LKZA 2F1FA 3KKFA 1S1WA 1U7LA 2W9CA 2DK2A 3DNCA 2HHQA 2QSFA 3BDPA 1JLFB 2DNRA 2GMJA 2HS4A 4XIUA 4EGLA 2W24A 1LFWA 1VOMA 4F67A 4R8UB 4B9LA 2VOPA 4X4UA 5DETA 5LMNF 4UQGA 3PFOA 3U1NA 3Q8RB 1U6BA 3DM2A 5IT9Y 2K8GA 2ZH8A 5MAOA 2OIHA 4F4XA 4UUXA 5LJ3Y 4K4ZA 2FC9A 2IA6A 4OL8A 3HHLA 2R7UA 4IRKA 3W2VA 2DNZA 2DH8A 1JJ4A 1C0TA 1T05A 5G0RB 4TKTA 1MW7A 1U6ZA 1RT7B 3OR2B 1QLNA 2CQ1A 2RJZA 3DDKA 1H38A 2QMXA 4R5PB 1IKXB 4QWCA 4PQUA 1JNZB 2V8HA 3IWXA 4P2SA 4ZPCA 1FRKA 1TKZA 4OI0A 1A9NB 2F9JA 4WK1A 2RRNA 1MU2B 2NR0A 2E5GA 4KO0A 5I42B 3MR2A 3BGRA 5IZHA 3CC4S 2SXLA 1CSJA 3BQ2A 4OHZA 4EUVA 2R8IA 3W2WA 2DGVA 4PPZA 5CYQB 1HWIA 4ZHRA 5E3CA 1YVFA 4EYIB 2JH3A 2AU0A 2F8HA 1TKDA 4ZKAA 4DSJA 2VBYA 5A6PA 4L3NA 3QJPA 2LU2A 5F8JA 1R0AB 4RWXA 1UVKA 3SFUA 3OTBA 3H2UB 5F0UA 1RTHA 4JI8F 1GNKA 2WONA 3QGPA 3VZHA 2GCFA 3AHPA 1FDAA 2V4RA 3CF5Q 2E66A 2IM2A 4ZP9A 4HHJA 4ZPAA 1HR0F 2J0SD 4X4SA 3C6TB 1WHWA 3UI3A 2FJWA 1P6TA 1TKZB 2FGCA 3CB4A 3CCWA 3OL6A 2V5HG 1FA0A 1X4CA 2I5JA 4NYZA 4ED0A 3CO9A 2W9AA 4OI1A 4OZ1A 5KFAA 4M63A 4HDHA 2E1MC 3D0IE 3CC7S 4DR1F 3RTVA 4C4WA 1Q16B 2PEHA 4URSA 4NLQA 3GQCA 1FD8A 3FRZA 4ETXA 1KQSR 1S1VB 4F3QA 4PG4A 1JLFA 1DTTB 3CCSS 1SH2A 1WHXA 4QIFA 3GV5B 4KHRA 1QSLA 1UP1A 2F7VA 4DL6A 2I2YA 3HJFA 1HA1A 2ZH6A 2X1FA 1BD6A 3P6YC 1G1XA 5F8NA 3N0VA 4ECXA 3KK2A 2ZM6F 1I6JA 1HBUA 1BC6A 2YKNA 1APSA 3HP6A 3GIKA 3I87A 4NXNF 2MKHA 1LWFA 4KRWA 3MZIA 1NKBA 3SCLE 2D3ZA 4QU7A 3UCGA 1HW9A 2QYCA 2VG6A 3TUJC 3DRYA 3TP2A 2HVHA 4X4PA 4FNHA 3OJSA 2H9ZA 1CC8A 1O51A 2X1AA 2GHPA 1R7IA 3AQOA 2ASYA 2EG1A 3DOLA 4WXWA 5H1SV 4IUFA 2D3OR 5KFPA 2IBOA 4ZHRB 4K50A 2DHAA 3DI6A 4DV7F 3M30A 2VBXA 2VC0A 5B0GA 5KFTA 1RT3B 4RW6A 2BZ2A 3K2YA 2FC8A 4WFBQ 1RQ0A 4ZDNA 2Y1JA 2FTRA 2EFGA 3OLBA 4CTAA 1RTIA 4HKQA 1VS3A 4F50A 1H98A 4ITSA 3IAS9 4RW7A 2MY7A 3UQSA 3MMCB 1TK0A 1XNQF 2QIFA 3RBEA 2E1CA 5KFHA 2ZH7A 4NZ0A 4ID5B 2PE8A 4I64A 4X64F 2MYFA 1NEEA 3DLJA 3I4PA 1QE1B 2DNMA 4EBEA 1NK4A 2BV3A 4C11A 4YMEA 3TUZC 4TYBA 2RIJA 2H5EA 3GSDA 1JLEB 3NS6A 1TKXB 2AYGA 3SMZA 3IA0A 2XSJB 5C24A 1UFWA 1N5SA 4NLXA 1T03A 3DFEA 1D9FA 1RYRA 2M9KA 2ROGA 4QCLA 1C4CA 3N9UC 1VQMS 4Z2XA 3CVKA 1Q81T 1NRKA 1H7WA 2FHMA 3RU0A 4I4BA 5M2UA 2LXIA 3WDOA 1E6VA 4LJMA 1VI7A 1AXQA 2R8GA 2W9BA 4WCEQ 4NCBA 4OJ1A 2FHOB 3FQLA 3MUTP 1RT1B 3BSCA 4KGMA 3OL7A 2WSFC 5D3GA 1VRTB 2XWYA 2J6UA 4F8RA 2D41A 3CGIA 1MU2A 2M4MA 2XY6A 1WTFA 3HKWA 3PW0A 4BS2A 2HFZA 2UV8G 1JJHA 3TR5A 2VFVA 2B9XA 1OSCA 2KN4A 4EZ9A 4Y34A 5KG4A 3FSXA 2KZMA 4UQTA 1IKYA 2EBGA 3UNGC 4B17A 2DGUA 1PGZA 2DIUA 3AQPA 2GX8A 3B8HA 1S10A 1RK8A 2KYZA 1S6OA 3F56A 4QW8A 3I0SA 3IRWP 3OXFA 4JYAF 1LQ9A 2CPEA 2FVQA 3MM8B 1JLCA 3H2LA 3HFKA 5B0AA 4DV2F 5KAKA 2NZ4A 2NS1B 1B0TA 1Q79A 2CJBA 4RNHA 2FHJA 1HNIA 4DUYF 1HBOB 2R2TA 3MFHA 1FNOA 2CIMA 1NKCA 1LXJA 2DO4A 4YB1P 4N8NA 4ZK7M 3M4XA 4YDDB 1SJFA 1KHVA 1X4HA 4H4MA 4NLWA 2HWIA 4YUDA 2FY1A 1QAXA 2BQUA 2RQKA 1FEHA 3ISND 3MGJA 4QZVB 2CQ3A 5T7LA 4I68A 1ZPVA 4B3RF 1RI7A 1GXUA 2XY7A 4MK7A 3FJ2A 1HQUA 3VAIA 3HK2A 1SKRA 2EK6A 3H59A 4JBCA 2E5IA 2L08A 2EW9A 1NJXA 1HHTP 2LA6A 2A3JA 2POKA 1HI1A 3LALA 1A7GE 1IUJA 4NA3A 2D9PA 4A4JA 2RB7A 1VRUB 3GFXA 3QJLA 2CPIA 3AH6A 2VG7A 2VH7A 1YJRA 4IYQA 4LIWA 1R43A 3WC0A 4ZMMA 4UOCA 1RT4B 4QU6A 4ES2A 1FXRA 2P9GA 3MM6A 4PRFA 1S1TB 3NAHA 1FDNA 2X1GA 2I38A 4DDFA 3V6JA 1S6QB 4E98A 2UXDF 4H4KC 1N0VC 2KU7A 4UW2A 5U47A 2B9YA 4ECYA 2IAJA 1R0AA 2M2BA 1VK8A 4KV8A 5D3GB 1YJUA 3KOAA 1U2FA 2IHR1 1UVLA 2HGNA 3PKMA 1LWCA 2OTJS 2ZOMA 3KK2B 3EGZA 4PUOA