3TNYA

Structure of yfiy from bacillus cereus bound to the siderophore iron (iii) schizokinen
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
280
structure length
280
Chain Sequence
EVVTVEHAMGKTEVPANPKRVVILTNEGTEALLELGVKPVGAVKSWTGDPWYPHIKDKMKDVKVVGDEGQVNVETIASLKPDLIIGNKMRHEKVYEQLKAIAPTVFSETLRGEWKDNFKFYAKALNKEKEGQKVVADYESRMKDLKGKLGDKVNQEISMVRFMPGDVRIYHGDTFSGVILKELGFKRPGDQNKDDFAERNVSKERISAMDGDVLFYFTFDKGNEKKGSELEKEYINDPLFKNLNAVKNGKAYKVDDVIWNTAGGVIAANLLLDDIEKRFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parsing the functional specificity of Siderocalin / Lipocalin 2 / NGAL for siderophores and related small-molecule ligands
rcsb
source organism Bacillus cereus
molecule tags Metal transport
molecule keywords YfiY (ABC transport system substrate-binding protein)
total genus 98
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3tnyA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3tnyA02
1M34B 4FILA 4WZAA 4B8YA 2AFIA 4CL2A 2XV1A 3ZTTA 1H1LA 5GGYA 3ZKAA 4TKVB 3AEUB 2O1EA 3BE5A 1N4AA 4INPA 2PS3A 3ZK7A 4NNPA 3R5TA 3EIXA 3U7QA 3MWFA 2ETVA 4HMPA 5B58T 4LS3A 3HH8A 5M34A 2WI8A 4PAGA 1QH8B 4TKUA 2PHZA 1N2CA 3GI1A 1KAEA 1MIOA 3K1AA 4MO9A 1FP4A 1QGUA 2XUZA 3AERA 3AESB 1N4DA 1N2ZA 2R79A 1QH1B 3AEUA 4DBLE 5KHLB 4MLZA 5CX1B 4UDNA 5JJ5A 3AEKA 4XPIA 1PSZA 1G21A 5BVHB 5M29A 2AFHB 3AESA 5AFSA 1QH1A 3EIWA 3MINB 1K0FA 1QH8A 4WZBB 3UJPA 1TOAA 5JOQA 4WESB 5JG7A 4WZAB 3PDIA 2AFIB 1KARA 3BE6A 3TNYA 2YNMD 2OV3A 1G20B 3G9QA 5FLYA 4WZBA 3PSAA 4N01A 3HJTA 2AFHA 5I4KA 3AEQA 2PRSA 4OXQA 5M2QA 1FP4B 1QGUB 2YNMC 1G20A 3AERB 4INOA 4IRMA 4NNOA 4WN9A 5KOJA 2WHYA 2QI9F 4GICA 2Q8PA 2PS9A 4G09A 4PM4A 2OSVA 2X4LA 5JPDA 3LI2A 1L5HA 1K75A 4G07A 2M6LA 1N2CB 5M3BA 1K2VN 1KAHA 3TLKA 5HX7A 1EFDN 4WN9B 5BVGB 3MINA 3ZK8A 3MWGA 5CX1A 2XQVA 3AEKB 4M7OA 3HXPA 4OVKA 4XPIB 3CX3A 4OXRA 1M1YA 1K7SN 5CR9A 4H0FA 5BVHA 4BBPA 2Q8QA 2MINA 5KOJB 4HN9A 3MFQA 3AETB 5GGXA 3NU1A 2XDQB 5KOHA 3PDIB 1PQ4A 3MD9A 4WNAB 1L5HB 4ND8A 3TEFA 2R7AA 1M1NB 4FI3F 4K3VA 1MIOB 3PSHA 3K1AB 2OGWA 4LJSA 3AETA 4MDYA 4UTPA 2XDQA 5KOHB 2PS0A 2XH8A 4H59A 1ESZA 3R5SA 4UDOA 4WNAA 2OV1A 4ND8B 1M1YB 2M6KA 4TKVA 3ZK9A 4HMOA 4MX8A 2MINB 2RG7A 4UTOA 1M34A 3AEQB 3LHSA 3U7QB 4FKMA 4HMQA 4FNAA 1H1LB 1M1NA 1G21B 2XY4A 5HDQA 5BVGA 4WESA 4TKUB 1XVLA
chains in the Genus database with same CATH superfamily
1PL8A 2PJRA 1Z29A 4MGYR 4JEMA 5EXDA 2W70A 1DRJA 5CBKA 2VR1A 3F6RA 5FAXA 5HF9A 4KR7A 4Y7DA 3DULA 4CMIB 2GCGA 1UMDB 4DCNA 3DEFA 2J09A 1NTOA 5ALUA 4B7ZA 1O94D 2F3UA 1SHUX 3CKMA 4ZODA 2XQJA 2Z9BA 4MYCA 1M9NA 2GKOA 2J7PA 2R4TA 4RCVA 5D00A 2Z8XA 5CB0A 1GNVA 5B6IA 1VE5A 3BRSA 1G7TA 4Q3DA 2O2XA 4WGFA 3KOWA 4XPZA 5FPYA 3RQSA 3PQEA 3V4OA 5B4VA 1Y1PA 1IB6A 4JEIA 4P54A 4IWNA 1T4GA 4QIHA 4ZVMA 4QA9A 1NQ5A 2HPZA 3LNCA 3QWIA 4JQOA 2VJQA 2Z1DA 5BWOA 4RK4A 4F91B 4OB7A 3UT6A 3K4QA 2VT2A 3MGGA 2P9JA 1JAYA 2C8VA 3P9IA 5C7OO 1HT2E 4BVGA 2AJTA 5IUKC 3OF2A 1MQ8B 1RXVA 1T2UA 3ZWKA 1I2ZA 4Y9SA 4BZXA 1G3MA 4C4PA 1P7YA 2OORA 3DCIA 4L8FA 3QWBA 4X61A 3ZQJA 4DPKA 3GWZA 2EZ8A 5SYAA 3VR3D 1DO2A 5DHAA 1ZONA 3JYOA 4YRSA 2AS0A 3BWXA 2QS9A 3AQIA 5BSMA 4ZHQB 1P75A 3DKRA 2GERA 3PITA 4OYRA 5ALHA 3R75A 3IQXA 1FIUA 3UK6A 3N8KA 1EHYA 2SKCA 2W0SA 3TLGB 2GARA 2XADA 3ILXA 3V8NA 3RH0A 2IZ6A 1M72A 2LW7A 1Q0ZA 3MBIA 1AMOA 4ND7A 3ABIA 3FVWA 3GJ7A 1W6RA 2ZQ5A 1HE5A 2XTZA 3DE4X 3KQYA 1CLEA 1JX6A 1GTMA 2VJPA 1SA0A 1RAIA 3ELDA 2I29A 1YB4A 3EG9B 4GOKA 2ZSJA 5GVRA 1A9RA 3FYTA 3RHSA 4BNDB 1I5EA 4EG7A 4MS3B 3CVXA 2JL1A 5B4UA 3K4PA 3CLHA 3J81A 4J0KA 2BM1A 3AFHA 3H1GA 5BV2P 5GTDA 1JWBB 3ESQA 4NK4A 3QEMA 2W2TA 1BJKA 2JZCA 1EDBA 3DLCA 4TQAA 3KQQA 5LUAA 2ZREA 1BAPA 3OM1A 4QREA 2BFEA 3VPXA 4PQGA 3DTVD 1JHAA 1DKQA 2CKDA 3KTOA 5MGBA 1B76A 1R0SA 4FOLA 1KAMA 5TQVA 1K63A 2VNKA 3HN2A 4L76A 4PG4A 3LQ1A 4GECA 1GL7A 4PGMA 1NU6A 5DHPA 1ZNYA 4J4BA 4HNTA 1OZGA 1C29B 1I01A 4DGQA 1GPUA 2RONA 4JJAA 2X1VA 3PPWA 4H59A 2R48A 5ENVA 3IB3A 5KYNA 3TQHA 1YRAA 2QZPA 4EW1A 2XVMA 3PJEA 5KNBH 1KJQA 3DE1X 4ZI7B 1VTKA 2FSHA 4NV0A 4YAOA 3GRPA 3PENA 1H9BA 1ECGA 2INGX 2TMYA 3OTQA 1ZESA 3V48A 3ZXSA 2PL5A 1LBQA 3F9CA 3FVRA 1QGED 1V4NA 3FUTA 4EHKA 4CN9A 4RLSA 4YV0A 3ZCTA 1UDBA 2VF8A 3QIVA 1OB5A 1O0CA 2PGJA 1PGOA 1XVLA 3ZYCA 2JLUA 2VWHA 2V9ZA 4HWSA 1H3FA 4WZAA 3WP0A 2HK7A 4ZYZA 3RF6A 3H4TA 5IEJA 4NYJR 5LQSA 3A6FA 2YV5A 2WJ6A 4D02A 2GF0A 5AKKA 4W1PA 1ZHOA 2GSDA 3ADKA 2CWWA 5IJ0B 5AIAA 3UIEA 1JBEA 8ADHA 4R7ZA 1KMIY 3DT8A 4HGNA 1EK1A 1UMCB 4P98A 3WMEA 2XDWA 4LS3A 3T6KA 1DTWA 2BISA 1XYYA 4OUDB 1VE9A 1LDEA 1E89A 2DQYA 4OP3A 4TKUA 1Z37A 3W3AD 2BEKA 4CKEB 1EXVA 1CUAA 3MGKA 3LC2O 5KDOA 3P9SA 5C2JB 1AF7A 3JD4A 2WU4A 4MVXA 3HDHA 3K6RA 4OQYA 1KI8A 1RBQA 3AHIA 4ZI2A 2VDJA 1PUXA 4IHQA 4WUTA 3OCYA 1Y80A 2PWAA 4RSGA 3EIQA 3O3NB 4U3JB 1T2FA 4ZO8A 5GZ1A 4X0EA 3WGJA 5TQ0B 1V41E 2J6BA 3RQIA 3H5RA 2Q62A 2PMBA 4X3PA 3SIRA 1O96B 2CXPA 4QOEA 1NMXA 2IZZA 3BBPA 1JQBA 3ETHA 3K1JA 3W8DA 4CG1A 3WLLA 1VL2A 1KI1A 1FDUA 1WP4A 4NG5A 2IOQA 4FZJA 4L50A 4TSKA 4AX8A 2G06A 3UJNA 1KF0A 1L5WA 1WF3A 4LZLA 1DJOA 2QZ9A 1U8AA 3OEHA 1UPXA 2MSCB 2A9PA 3Q2OA 4BX3A 3SJ7A 1LBTA 1XRLA 1Y33E 5IJXA 3EFOA 3GPIA 2Z98A 2J0SA 2R5FA 1F14A 5JXGA 3UXYA 4H4DA 4RHFA 4NYJQ 3QYJA 3ZLBA 2A4KA 1FVHA 1QVZA 2EQAA 1BVRA 3OUZA 3WWOA 4MYTA 5FPKA 1UBMS 1RHKA 1QHSA 2WYHA 4B40A 3QXGA 4XE5A 2PWZA 2R96A 1S5PA 4BKOA 3BE4A 3SYLA 1P9NA 1KI3A 1V1JA 1Z6TA 1ZM7A 3PEEA 1R2QA 4LMRA 1U9YA 3LI2A 4E22A 5J43A 1TJYA 5AKEA 1OU4A 1I3OA 3K2BA 3H83A 4QQ8A 3GGPA 3LUGA 1CZHA 1A4UA 4U9HS 3TLKA 2X76A 2O5RA 4IDGA 3ETGA 4KN6A 4EG3A 3GEEA 1FUUA 1ZRNA 2V3CC 4RULA 1ZWLA 2JA1A 1A5AB 3O4JA 3RYTC 1C81A 1GKUB 2Q4BA 3LCMA 5KWVA 1CUFA 4Q9IA 4JYZA 2P5UA 2WUEA 3U7HB 1A1VA 1Y8QB 2BONA 1WQ1R 3MFQA 2P6PA 4YMIA 3GPBA 2NXEA 4OKSA 4WLVA 4DMFA 4KQXA 4BS9A 2IKSA 3L7LA 1Y6FA 3CE6A 4F72A 4AI6A 1XZKA 5D01A 5DNDA 2XGSA 1P2UA 1YI1A 1R8SA 3PUXA 1AKYA 1R00A 3A27A 3KLMX 5F3RA 3KT8A 3WQHA 2B83A 1N8SA 5FPTA 1V48A 4KWHA 1P4AA 3LHKA 2EATA 3LBYA 3O4IA 2O3UA 4QSHA 4DADA 2ZXUA 4G5GA 3UV7A 3CONA 5DTMA 3ZQKA 5C34B 6GPBA 3ICVA 3KOMA 1CDZA 1NQOA 3BSWA 4JQYA 1FS4A 1AN9A 4L0QA 3R7DA 4R2MA 4PBRA 3PPIA 2GETA 5COQA 1Z5GA 3BTSA 4ABYA 3NEAA 2B6HA 1L1QA 2O4CA 4C7BA 3GLFA 3BF7A 2P7IA 1Z3IX 2R66A 2YHBA 1U28A 3UHJA 2XAAA 1MPXA 5FUXA 9MHTA 2D8MA 2AWOA 3TZEA 3ZJ5A 1Z2NX 1QYRA 4YP9A 2EFJA 2ONJA 3L82B 8ABPA 1SGWA 3M1IA 3U4IA 3RS7A 5D51S 1BHJA 1Y3HA 2F59A 2O1EA 1XZJA 1VB3A 1WUKS 1TTTA 2V7QA 1ZP6A 5DASA 3K53A 3LT5A 4KMRA 3U16A 5IDQA 3F97A 1NHWA 3UB4A 4EHAA 5ARBA 2XSZD 4CT5A 4D56A 1UM9B 2XOKA 5IJ9A 2P9GA 3WQRA 4LMBA 1XDSA 3R20A 2WI8A 3NHUA 1CQWA 3DTVB 3GRZA 4UM8B 5FNVB 3TI9A 4BCBA 1ZMOA 5E7IA 3HA3A 2Y1FA 3ASYA 1IPFA 1EXNA 1QGUA 1Z6AA 2R62A 4KE8A 4QGFA 4EGCB 3GJQA 1IM2A 4DV2B 1D2NA 1ETUA 3I09A 1SK9A 1VBNA 2DVMA 4YV2A 1DNPA 1LWNA 3NBFA 5FUQA 1QZTA 1ULBA 2JHCA 2LUOA 3BDAA 3RAFC 4QXQA 2BFCA 4QHYA 3GY0A 3OQIA 3RYIB 3P5SA 4ZANA 2BRUA 2W58A 1K3UB 1IPEA 3EDCA 5JT1A 4R1PA 5TLSA 3R1IA 4RKWA 1INLA 1SIUA 1BWQA 1T9AA 3AR5A 3E8MA 1TYEB 3CW2A 3LQ2A 1Y37A 2AJ8A 3DVAB 3RROA 1WBJB 2ZI5A 3MOGA 1I2MA 4UXJA 3K1ZA 2R87A 4RS3A 2H31A 1WKBA 2IZ5A 3PNVA 1N1DA 4I1OA 5FLYA 4A2CA 1WB9A 4F06A 1DAHA 1ORTA 1Q0PA 2WOJA 3BAFA 4J0JA 3MIIA 3UFXB 3G0OA 2FDRA 4FFDA 1PG2A 1U9ZA 1V47A 3RVDA 2B4AA 4HAVA 3IIJA 4BBZA 2IT1A 1XCJA 3HSKA 3T35A 4G09A 1KEKA 3IPAA 4KIJA 3TOZA 1A3CA 1UBCA 5B1DA 4BUJA 4OXXA 3Q8WA 2HJSA 3VKUA 3HGTA 1OKKD 3V9AA 1GRNA 5EIHA 1TIPA 5DX8A 2P4EA 3TM5A 3ZJYA 2DFTA 5LBIA 5TVGA 3WMFA 3ASZA 3TJRA 2BTOA 1KR5A 1VGVA 1O89A 3EVFA 3ZY5A 2C5SA 2F43A 4PHFA 2FFHA 5DTRA 1FPQA 2WIDA 3G0IA 4GE0A 2PX0A 3ESZA 4NAUA 3HVIA 4AJKA 1S8OA 2D1TA 1SOVA 3NU1A 4L5JA 4PBTA 2OBBA 1PR0A 4R8KA 2OD7A 4KXYA 4Z3OA 5AJUA 1WPRA 2HM7A 4MRMB 3EZ7A 5K0CA 2XBMA 3CLKA 4RC9A 5C18A 3PG5A 5GOZA 2B1GA 3F78A 2OENG 4R84A 4H08A 3X3HA 5G40A 4JCCA 1FL9A 3HA5A 2RGNC 3AI2A 4U2FA 4EG1A 3TDKA 4NV3A 5BRJA 4IJKA 1IE3A 1QPBA 4CR6A 1TTPB 2RG7A 2VZEA 2FVXA 3COSA 1U9JA 3E9MA 4MKRA 3TIVA 3KYJB 4GI1A 2VYQA 3FPSA 3RRMA 4KWEA 4R2XA 5EQJB 1LQUA 1DTEA 6PFKA 4FNAA 1V9LA 4P3OA 1UKBA 1Z0AA 2BLNA 4QM7A 1P2BA 3H99A 3PDJA 5F2KA 5LOVA 2L18A 2LRHA 1Q84A 3CRQA 1MV8A 4MGKR 1MENA 1S4MA 2IU4A 3CXUA 3T3MB 3W9UA 4ZALA 5A4AA 1IHPA 1Z4IA 4I5IA 3ZXXA 3JAMA 5JBIA 4IMJB 4MI1A 2X9GA 3PNSA 2I9KA 4B3FX 3GLTA 1L5OA 3D6JA 5G0WA 2GRAA 4EB3A 2JEYA 3ODGA 1NHGA 3D0QA 4JBYA 5LP6F 1POXA 5B58T 4XGKA 4F46A 4D46A 1KZ6A 1QIJA 3CF6R 3N0TA 3P94A 1EJ6A 2JGDB 1ZS9A 2WOOA 3H2JA 4IDOA 4IJMA 4CIWA 1ODLA 2PYZA 3PQFA 3W6PA 2XWBF 1H6BA 3G2JA 1JHXA 2B61A 5I6DA 5JVDA 2ERCA 2KQUA 2DLDA 1WVMA 5EHQA 3V8QA 2IP1A 3IHKA 1E32A 4QO7A 5JJIA 1N4DA 1VZ3A 2A92A 4MRPA 3HCPA 3MMNA 3PGMA 1JR3D 4HEA1 1SWVA 3QVUA 5JJ5A 5B7QA 3U19A 2H7VA 3OJEA 1XQVA 4JVOA 4Y2GA 3KOZA 1EXMA 4IMIB 4MIEA 1AQUA 3DZHA 3M49A 4OFXA 4G0VA 3P97A 4A5OA 4LSGA 1S9DA 1R0XA 3BQNB 3JASA 5C1OA 2YR0A 1CHDA 4WY5A 2OSBA 3IMKA 3U9SA 2IEGA 4NYIR 4PNPA 4BO7A 4CI0B 3ZI0A 5IULC 1MABA 2G63A 5KWEA 1E2MA 1KYXA 4AXBA 4MUBA 2OV3A 2L2QA 3AJRA 3QBVA 4I9HA 4L28A 1FDIA 3R7FA 1R9MA 2XF2A 4LXYA 5FI5A 5K6AC 4OJMX 2PZFA 4OK3A 2FUKA 1S1MA 3AR2A 1NXVA 2Y1KA 4FFVA 4C2BA 4DCGA 4DIMA 4AJOA 2BBTA 1RXYA 5LVAA 4Y6PA 1D8TA 1HA3A 1AC5A 4GICA 3WKAA 1HTWA 2Q8PA 2G40A 3FG9A 1EX1A 2DBYA 1DJNA 1N5LA 1IOZA 2WD9A 3FLEA 4V2IA 5EKUA 3UJ9A 4BKUA 5JEDA 3RW9A 1E5DA 1QU3A 3DFFA 1SHJA 1KPGA 1SCBA 3VKFA 2GLXA 1TJPB 4CZ2A 2JCYA 5FP0A 1IZZA 3TLGA 2EWVA 5LMZA 1CB7A 3MUEA 4IIXA 4HDMB 3PQ7A 4MSUA 3L0IB 1LJLA 1UKYA 3CEPB 2H57A 3KZCA 1XEXA 4EELA 1EWYA 4JLSA 5JV5A 1NP3A 2WNIA 4HKTA 3LWZA 4M1SA 1DX6A 1AHIA 3U49A 4UCFA 4JI5B 1C3VA 1W36C 4YDRA 2VF2A 2WUVA 1QCDA 4NICA 1RM3A 3F1KA 4E0BA 3AOEA 5KMGA 1CUZA 2G77B 2X0NA 3PNYA 5LIRA 4OL0A 4BNHA 4KI0A 6ADHA 1JEYA 3ANYB 3KZXA 4NYIQ 5CG1A 2KB0A 3AH8A 3GNQA 1NRXA 3EOBI 1O8CA 3S68A 1PCXA 2A5DA 2V5AA 5AHRA 1XKQA 3LP6A 3D31A 3KHKA 2BGMA 1WZEA 1LRJA 3A14A 1NDQA 4DM3A 1N32B 1PX0A 1TM7E 3KEOA 4M83A 3FKSD 2VDUE 4G3XA 3UGQA 4LOAA 5IAGA 3FKQA 1IXYA 3VH1A 1OLSB 3WSTA 1CQJB 1EUYA 4XKJA 4D9IA 4QPCA 2FK8A 4HGRA 5ES4B 2X0RA 3HMQA 3F6EX 3GH1A 3I5MA 1R66A 2GO1A 2ZJ3A 2KE5A 4ZOLA 1QVVA 2OFOA 3RYFB 4DCMA 4EY6A 3RYHB 1OTXA 4ZAGA 2BVNA 1CETA 3L0OA 4WDRA 1K3FA 4FBMA 4OLHA 1F4LA 4CQJA 2W4IA 4MVJA 2AHOA 1P3DA 1DXHA 2PCJA 4MQ6A 4U3JA 2BKLA 2J0EA 2ZRPA 2QR2A 2CUZA 3E2IA 2ZBFA 3F5SA 2O3SA 3R5TA 4BN4A 5IXYA 3T4EA 3MWFA 1RIIA 4P35A 4RD1A 1ZQ9A 1X15A 2FPUA 3Q40A 1UKVY 4LMPA 4O3FA 4A3SA 5BNFA 5A62A 5HUHA 5K7SA 1QB7A 3NKLA 5C0OE 3BD8A 4UHHA 1EUQA 2XLBA 5AW1A 3RJ9A 3NEYA 1KA9H 3HSYA 1UM9A 5BQFA 4QYXA 4OXKA 4YMHA 5K3AA 3GFBA 4TSFA 3AP2A 3QITA 2Y3IA 2ZIFA 4KE7A 1WUHS 2FYTA 4B4KA 2CLDX 2NSJA 4DHEA 5B7PA 3VUFA 4BATA 1DCKA 2BGGA 4I5GA 1ADCA 1AGNA 2IOYA 1EGMB 1YZGA 3BGSA 3E5HA 3OE7D 3WY9A 2QMQA 2BGTA 1HPLA 2JAUA 4I4NA 4PC6A 2VA9A 4TLEA 1KEZA 5DM4A 4UU7A 2GHTA 3KJZA 2ZJ0A 3QVGA 4AZ3B 2OCLA 1TK9A 2ECPA 2QRMA 3ZHQA 3QXXA 1RAHA 1ANKA 2HRZA 2VHQA 2N47A 3JQ6A 1XTBA 2FR1A 3G9QA 3K8QA 2HEIA 1O0BA 4JYAB 2VO1A 2QUAA 2MIIA 1FJXA 3KJEA 5GWXA 2WWIA 3W78A 5ICMA 4NIMA 4MW6A 4QAJA 4YMLA 3ZG6A 1D8AA 1E2KA 2V5UA 4XWOA 1MCZA 1WETA 1C0IA 4Y9RA 2H92A 1ADFA 1E1CA 1Q95A 2PS9A 3C5VA 4KJZA 4DA4A 5D87A 4HNUA 2X4LA 5DNWA 4PLHA 3HRKA 3LA8A 3DZCA 5JSKA 3SI7A 1EX6A 3SZGA 2C1ZA 3C85A 3GT3A 1P5RA 3G2HA 4FWBA 4RESA 1WO8A 2BELA 1MX5A 1WEKA 3FF1A 4QBKA 4RH3A 5CEJA 1T43A 1IN5A 1GGVA 3NZEA 2O7VA 1H8HA 3QUQA 1N3BA 1Y98A 2D00A 2Q07A 2CDBA 1ACMA 4OXRA 3SF0A 2GFHA 1HDEA 1K7XB 3G8DA 5B3LA 4O4HA 1JSRA 3I05A 3D59A 5K09A 7MDHA 3OT4A 2EX1A 1JHQA 2Q3MA 3N2NA 4YMTA 3SR3A 3EQ8A 1BJRE 4OJQA 5C4IA 1IM5A 4F2HA 2GPYA 2AB0A 2PS1A 2H5LA 3OQBA 1RZRD 2BOVA 2ZE7A 4WCFA 4YAWA 4K9MA 2OYCA 4DL9A 4TWRA 5BNZA 4PG6A 4MP3A 4A10A 4IVRA 4DBZA 1E79A 2W6ID 1G20E 1D5WA 4PLWA 2BKXA 2YRWA 1YRWA 4N65A 3R41A 4X45A 1E94E 3ZS8A 3KSBC 2AOUA 2ZRJA 4ZOBA 5KYYB 4JB0A 4RSHA 1W0KD 4P3NA 1E4EA 2W90A 3KDPA 1V7PC 4IHJB 3R5HA 1B26A 3A32A 1VPWA 2SCUA 1QQ5A 1J9GA 3RIYA 3C5HA 3IA2A 4B4DA 3MVEA 5HG0A 3ZW7A 4B2LA 5KNBD 1ZL0A 3OCCA 4AWXA 3K8ZA 2EKQA 1GXSA 4HWRA 2ZPTX 3P9ZA 3OCWA 3UEOA 1M34B 2UZ4A 1GDHA 1N6IA 2LVBA 2FZLA 1UJ4A 5EJIA 1ZD8A 1S2GA 3R2JA 2QZSA 1AKQA 2BSXA 2WM2A 4UZEA 4QRIA 3DVQX 2JJQA 2ZT7A 3I9LA 5BN5B 1HWYA 3WIOA 1F8YA 1GU7A 1H3NA 2F3SA 4R0VA 4HLDA 4TKLA 1QQAA 2QE7A 1C0LA 2E2WA 3FCCA 5I4CA 1NVVR 2SKDA 4HMPA 3WRYA 3UCEA 3WRXC 2I3DA 1PLLA 4UNRA 2O54A 4GS5A 4FFWA 5IWCA 4Z53A 2NU8A 3HN6A 1DAGA 4UUQA 2KHZA 3C6KA 2O14A 5K6RA 2CXTA 1SRQA 3HJBA 3KEMA 1N2CA 3SSAA 4AP9A 1Y5IA 3CXRA 1GAWA 4R3NA 3SKVA 2BBOA 4MAAA 4Q82A 1NBWB 3L9WA 3HE3A 2B4YA 1CY0A 1OILA 2VBGA 2NZYA 3EXHC 4OHUA 2V65A 2XECA 3F5DA 5JCXA 1LDBA 3J7TA 2FGJA 2OGZA 5CFLA 5CCEA 4CKCB 1MEJA 1ZPDA 4M37A 1XXLA 1IN4A 3H1EA 1BW9A 4IQ4A 1TT5B 4KGDA 5D85A 3KZVA 1OX4B 2O8FB 4Y0AA 1CU1A 4F6RA 1RT9A 1NJSA 4DQ0A 3ML1A 2R1TA 3GVIA 1S8AA 1XD2B 4FHCA 4UKDA 1V5FA 1VSQA 3TFOA 3HYRA 3JASB 3H16A 5IF9A 3UV3A 2QMEA 3ZHCA 3LCUA 2XJ4A 2QLFA 2QJWA 1T4BA 2FV8A 1ZI9A 4HUJA 1UMBB 4A16A 4AK9A 4ANFA 5CXUA 2W2KB 4CDGA 2HAEA 5AK0A 5IVKA 1FP4B 2Y93A 5IJWA 1RCFA 5EUBA 1O4WA 1U3TA 3TOCA 1O58A 5LD2C 2NM0A 2DPXA 4DQLA 6REQA 3TAXA 5M3BA 3A0RB 1O08A 4DLPA 2ZT8A 4D9EA 1EFDN 2ZTUA 3CPSA 4LJAA 1FDOA 2QORA 2QENA 3DEHA 3X1DA 5HK9A 2VK4A 4BBAA 4MQMA 5IRCD 2JBAA 4B47A 2WZCA 4OXYA 5FTWA 3NWPA 3JZFA 3OJWA 2OFPA 3R24A 4CLEA 4N6OA 3T15A 2FI1A 4RZIA 2Z2YA 4TT3D 2RHTA 3ANMA 1Z83A 4DV1B 1HZZA 1YDFA 3DEIA 2GK7A 4UASA 4F85A 4DMCA 2GH1A 3OC0A 2P6OA 4EA7A 1GNQA 2CGEA 4K40A 1JIUA 4J3FA 3NHWA 4PYMA 1RWQA 2J31A 2QQ0A 4IJUA 5E0KB 2H1OA 1DP4A 5JD3A 1TO2E 3LXXA 4QXAA 2B37A 3LCJA 4UW9A 4C3OB 3NKFA 1DG1G 1LVHA 1VYHA 1WMEA 3N6VA 5BWLA 3GRVA 4O0MA 1OAOC 3C3CA 3KLOA 1TJ4A 1JMVA 4FEGA 1F9EA 1N9KA 1TVMA 1Y81A 4HFRA 4O02B 4QRHA 1L4FA 2BM0A 2EW1A 4RPCA 4US0R 2FMIA 3LP8A 1PLKA 4Z1MD 4P3PA 1QF6A 2LIPA 4LAFA 2FXVA 1U7TA 4MPTA 2D54A 4NQZA 1RE0A 1JDBC 4YASA 4BIIA 2FPGA 5LQMA 1Y42X 3HWSA 3ED1A 4G9EA 1CEEA 4CV3A 4QGGA 2PH3A 3I5YA 1UZNA 2YDYA 1VMDA 1IHYA 4S1WA 5A1TA 1OJ7A 2IPLA 1RAFA 2E4YA 3KKPA 3O26A 4PANA 1BDMA 1OLSA 5CDFE 1X14A 2ZGVA 1FFBA 2WWGA 4DYDA 3BL6A 3QNMA 3ZZUA 4EG4A 1WSBA 3PEFA 4BMVA 4F7WA 1U4SA 3GEGA 1UP4A 4MVJP 4KR2A 4K2HA 3SYMA 3G0DA 4Z4QA 2AR7A 5I9MA 3NHKA 4D0RA 4F2WA 5I48A 5JZSA 4Y8VA 6YASA 3D54D 1VL5A 5LQNA 4XCVA 4IFTA 5AWFC 4REMA 4FN5A 1A7JA 2Q5FA 3ZHUA 4FQ7A 3T38A 1OU0A 2HCRA 3D6VA 4Q48A 2ZIUB 2PX5A 4W8GA 2J0UB 2ZTLA 1QK5A 5JH7A 1PJAA 4QZVA 1LW7A 1JEAA 4YMGA 4X1YB 5ALEA 2FEXA 4RM2A 4S35A 2AI1A 2IHVA 3SE0A 3PFFA 2O48X 1H4VB 2V7EA 2VK1A 3ESRA 3EQ6A 4CL3A 4F3KA 1EVZA 1DJPA 2YCLA 1JSZA 3NI2A 3P20A 5KTKA 1ZINA 2UYGA 1UBTS 3RM3A 2QDXA 3ENVA 3WV4A 3DMPA 1HXHA 1XKLA 5IVPA 3W3ZB 1RM0A 1KZ4A 2PDAA 3U13A 1E2LA 2L42A 2AG0A 3AUXA 1V26A 4PY2A 1U11A 3ZTYA 4BVKA 4NZYA 2BGNA 3F47A 1PDWA 3UJHA 3O5AA 2G1KA 3K09A 4URYR 3GLIB 1XCLA 2C92A 3WOHA 4PPYA 3LXUX 1W4BA 4B6QA 4H1WA 3BB1A 2QUZA 3I12A 4M1QA 4RDHA 2QRVA 5KHAA 1IDN1 4KU4A 3UPTA 1AKUA 4A0HA 3OO0A 2BFWA 3ZGNA 3SHVA 1NQTA 3FFXA 5IS2A 1PJRA 1N3LA 2C4KA 5E4FA 5JFGA 3NC4A 1IYZA 2HRCA 1E2IA 4OQXA 4W5WA 5LKRA 2WWYA 1E98A 2HTFA 4RW0A 2RARA 1QO0D 2VJOA 4BRZA 4JLBA 2G5GX 3FTEA 1KAHA 1BFDA 1Y48E 2BFAA 1BROA 2EJTA 3BXXA 2OAQ1 3A10A 4FGSA 2ZSEA 1MAWA 3MINA 5LCXA 3TLCA 1FLDA 4V0OA 1QK4A 3KTAB 3HJAA 4EMUA 5K8UA 1VL8A 5FPQA 1X92A 2X8LA 1NXOA 2B25A 1X0VA 2BEUB 4ESEA 2JJ2A 5ICSA 3PDHA 4C30A 1J5XA 4N03A 4F9GA 5IEBA 3K1TA 5H68A 1SXJD 3A36A 4G4GA 4ZZ0A 4Z9YA 2R44A 2K6GA 3L6EA 4D9NA 3WNBA 4LOKA 4D4MA 3QZUA 3HLYA 4HH1A 4JODA 3SEAA 3LUPA 4H7EA 5JQGB 1O87A 2Q5OA 4JNKA 4IIDA 5IAKA 3NH6A 1OH7A 1GQFA 2EFGA 1D6JA 2WAXA 1QQ7A 3AT1A 1BH2A 1YR7A 3UUEA 4JJEA 1SD2A 2AE2A 3E3LA 1ZMXA 2WDZA 2XNCA 2CNKA 1ZK2A 2J59A 3NIFB 3HRIA 3NH9A 3QLEA 4MI6A 1XTZA 3WWDA 4D3SA 2ACWA 3BRWA 4DAEA 5KMGB 2X13A 3ZGZA 2NN3C 4BNVA 1LVGA 3L18A 4C22A 3QOWA 5DX1A 3FPBA 1ZXBA 2ZJBA 1WCIB 3K8OE 2SCUB 3EH1A 4X6UA 1H4TA 4WOCA 1B41A 2GKSA 2JPDA 5AQ1A 5I3CA 4YJ2A 2IPNA 2C04A 2ZUDA 3M8KA 2OZPA 3OG9A 4GPD1 4NAHA 4O59O 4P31A 5CCXA 2CFCA 3HK2A 3EK2A 3SSMA 1QS0A 2PX6A 1A8PA 2CVFA 1SCIA 1VMKA 4ID3A 3RJMA 4MP8A 3IR5A 5DNVA 4YONB 2HQBA 3RFVA 5CEFA 4EB0A 1G8JA 1FFHA 1YOVA 1ZIYA 2WFLA 2WQZA 3AF1A 3ZWYA 4B46A 4K9PA 3RS5A 4DXAA 1JQ5A 2NVUB 4RPKA 4LYGA 3SXJA 3MQ4A 4MV6A 3K9LA 5IH7A 1MZPA 1PJSA 5FA8A 4CCAA 2BGIA 5J1TB 4KXLA 1OTYA 1NXWA 3RBZA 1NFFA 3GJ3A 1VMIA 2M98A 4I6JA 3RVSA 4EJFA 4ZOLB 4M38A 5GONF 3PIDA 4NBVA 4BN0A 1SKBA 1RQXA 5K1ZA 4NMHA 4Y2XA 2Y1CA 2WTBA 1Q0QA 1QV6A 2EWMA 1ZM9A 3HEBA 3H5IA 3GZJA 4GMGA 4NJMA 5AI9A 3PA8A 4UUOA 3UMGA 4GGPA 3ZBPA 4AZSA 3D6MA 2E5FA 1EEHA 2VHWA 3BS4A 5AI4A 2LR0A 4MR9A 1JQLB 3C3JA 3RSLA 2VAXA 1VHLA 3GLSA 2Q6KA 4KSBA 2QOEA 2P2NA 4KDFA 4B74A 3H0CA 4P4GA 1E1CB 1QV7A 5IT9A 2CLHB 3N28A 2AUMA 3UVEA 221PA 3HKCA 2AX3A 2XEDA 1XRRA 3MMPA 2GCOB 3DXXA 1PBTA 2YJZA 3IOYA 1F8FA 3LWBA 4DLSA 4KHPB 1H1DA 1R16A 2HWKA 2PXHA 4N6NA 5IJ0A 2EOAA 2C4UA 1OHHA 1QANA 3P4XA 3QLJA 1EINA 3DLBA 1E2QA 1HNWB 2ZRCA 3C3XA 2QD4A 2SICE 2RH8A 1WOMA 4WACA 5H3HA 1G7RA 3HY3A 4IRMA 2FUG6 2NPIA 5CLGA 5KAPA 5A06A 3OHMA 3IT3A 4NS4A 4XM0A 4YCDA 4CT0A 1FE8A 5KC9A 4QHTA 2ENUA 4QU0A 2VUTA 4L4UA 5DWDA 3II6X 4FXPA 4AN4A 5KVVA 1E9VA 1Q0LA 2ZT5A 1NNLA 3KSUA 1TMYA 1E7MA 2LIVA 3DOEA 3QLTA 3ZCVA 3KQVA 1J25A 1V6SA 1OD6A 4MAFA 1EUCA 3AY7A 4RV4A 5DYWA 1XMQB 3R3XA 2EEPA 1P7VA 3M89A 5G2OA 3UG7A 3G5MA 1RCUA 4CKXA 2GYWA 1YA6A 2GVNA 2X23A 3JQFA 5TDHA 1FU7A 3VSBA 4BFTA 3I52A 1R0RE 1TQDA 3L06A 2FPLA 4EEZA 2Y0BA 4C4RA 4R0NA 5TQJA 2D0DA 1FVOA 1VBMA 3LGAA 2HD4A 3SZMA 3V9PA 3ZHZA 3SBOA 4IYRA 1YHYA 3UWOA 4LJSA 2HK9A 2QUKA 2C98A 2JD2A 1E0AA 3W1VA 1P7ZA 1THMA 3BG5A 2ZOSA 1ZSYA 2P2DA 3DMRA 4RK6A 5C5EA 2YYSA 1HQYE 2JGRA 1XTSA 5TMDA 1W85B 2BCGY 2X8JA 1XXHA 4QT0A 4F86A 2OHGA 2WJIA 2X1MA 1GCAA 5AKXA 3ZCRA 5IKMA 3G82C 3AFOA 4CQLB 4BO4A 3CSDA 3E7DA 4BO2A 5HJEA 3NHRA 1UT5A 4HQKA 5JAZA 3WWZA 5ABPA 2IS6A 3B7GA 4U2KA 5DW3A 1LC3A 4D4IA 4NR0A 4F12A 2XE4A 3UJ7A 2QV0A 4ZCRA 1O95D 4LRWA 2GBGA 3FAKA 2XA1A 2ZROA 1ZEMA 2B92A 2I99A 3BF8A 4A0GA 4EF6A 4S05A 4UPVA 3R6TA 1MQAA 3UMJA 3WHPA 1T29A 1XRMA 2B2XA 1FTQA 1OIVA 4HTAA 5EWJA 5KAMA 4WNIA 2YFQA 5IM4A 3GPLA 3BT7A 2ATIA 3C3EA 3T7AA 1QWOA 2JJ2D 5TY0A 1X8KA 1EUDB 3IP8A 2R47A 1Y5LA 3VO1A 1D7OA 1EB9A 1F5NA 1O4VA 2FUNB 3ZS9A 4NCJA 4FFBB 3PGVA 3TI7A 3QY0A 4M1WA 1R64A 4P4LA 4G85A 1E7YA 1L7XA 3PJFA 3QHPA 1SXPA 5CA1F 1KYWA 1W4AA 2G71A 4FFNA 1SQSA 1M5RA 2B99A 3K70D 1V7ZA 1YZFA 2D62A 2AZTA 3TQTA 1NF2A 5AM2A 1BXRB 1ONSA 3IP5A 3LQ4A 4LRQA 3QFSA 2QL5A 3D4LA 3VPHA 3ZDYB 3DR3A 3GVPA 4MJXA 3K0CA 4UMFA 5HUJA 1QUFA 3E0XA 3W8NA 4EIWA 3AOGA 1JH8A 3ETDA 1V7QA 3LK7A 3EUAA 3PKIA 2HREA 5KSPA 2P2ZA 3CEMA 4NEGA 4EI7A 2ID9A 1VP9A 3HL0A 4XVHA 1E2HA 1UEIA 4WY2A 2WWVD 4F21A 1V95A 6REQB 3FY4A 1X7YB 2FDXA 2Q5EA 1XQ6A 3RUAA 2I6UA 2PZEA 2ZTMA 2R8RA 5CEEA 4Q9HA 1NW3A 1SN7A 3IAXA 1X7ZB 3E58A 1BGWA 5LXTA 1NUHA 4Z9XA 4NULA 2FPMA 3G2PA 2YXNA 3THRA 2XYVA 1Z4MA 1UPCA 5JNUA 3OU2A 5IDWA 1ECFA 4FFMA 5K6TA 1N6OA 4AN1A 4BEJA 3FWPA 4G07A 2R6DA 1ISSA 4J0DA 2YWCA 3SK0A 1L3IA 2W6QA 4FSHA 3VHXB 4F1WA 2FSIA 1DCTA 3DL4A 4XD7A 4BNDA 2G7MC 1TRKA 3GJZA 2AGVA 4N8DA 1FZQA 2A1UB 3GYBA 3UKDA 1Z5VA 2VKQA 4O1HA 5KZMB 1ZC3A 2B4KA 3L7NA 3G9UA 4HN9A 1NJGA 5B6JA 4D42A 2D3TA 3H3FA 3ZHRA 3HVHA 1BXZA 1G8SA 3OICA 1REQA 1N2GA 3ZEAA 4UPDA 5J23A 3U4GA 3DKKA 3OBIA 1U2DA 4N3BA 2F8TA 1RRCA 1LBEA 4NE7A 3GMDA 4N0EA 4MRAA 5HOQA 2UYHA 3R3ZA 5AJVB 3UMMA 1IEVA 2DUUA 1T4CA 2PLNA 3VMMA 2A7QA 2AQHA 3CVJA 3GLIE 1RRGA 1RYBA 4J94A 4O2BF 4GOLD 2NTYC 3P5BA 4DT1B 2Q5CA 3ESCA 4AQDA 3N8DA 4X1IA 1NQUA 1KVQA 3JAWA 4GMXA 4S1VA 5JQGA 4RVDA 3DBIA 2UUBB 1WSAA 2VQSA 1VYVA 4G0ZA 5CYOA 5FOVA 2XY4A 4DCVA 1VOTA 2VSFA 3R74A 3ZJ4A 2D8AA 3PCTA 3MJVA 1R1DA 4S1OA 1OR8A 2PR7A 4FGUA 2BCJQ 4IHAA 1W7AA 1WU7A 2NO0A 1B8OA 1T35A 4OHCA 3PFWO 5ECDA 3FOBA 1FK8A 2AW3A 4MP6A 3R9KA 4BNXA 1LDMA 1HQCA 3BH6A 4WASA 2PVCA 5HFNA 2D2XA 1I13A 2ODTX 5JR3A 5LOVB 1DRWA 1ML4A 5E1BA 4BZWA 2QRKA 2WYVA 1KI6B 3DVLA 2Z58A 1NRJB 2MYTA 1QH8B 2QM3A 4RNDB 4MQBA 3HU2A 2HXGA 4K9QA 3ZDEA 1BDHA 4BEWA 1VLJA 2XZTA 5TPWB 2OBYA 3TSAA 2NVUA 3LTNC 2WINI 2R68A 1DBVO 3EZGA 1UK7A 3AM3A 3FWNA 3IVCA 4M87A 3JQBC 1CRZA 1MX3A 4QVGA 1ZOSA 4YMVA 5BQXA 4ZAXA 3OOSA 4FR2A 4LXHA 1CZLA 1T9KA 1GKYA 3CU5A 2PEZA 2QP4A 4R3UC 3COYA 1UAGA 1SUDA 1TCUA 3K1YA 3B3GA 5AVTA 4JGIA 2VPYA 5EFZA 1C4WA 2ATCA 4NK5A 3CEHA 4ETIA 1YF3A 4PXSA 5JOQA 3JQ7A 2AQ8A 3RR2A 1P8AA 4LTDA 3FNHA 4DG9A 1NW7A 2PL3A 1UDXA 3L79A 5L7YA 1O96A 2CZCA 5T8KA 4EYGA 4M0LA 4R16A 3WYFA 1T9ZA 1TF2A 2AC2A 1NXTA 2HMAA 4PPNA 5EFOA 1QMGA 3GC6A 4YUWA 3HJTA 1BS1A 5DHQA 2P4UA 4L8WB 2JFBA 2WYUA 3TRJA 1HEUA 2V59A 4CG2A 3D0RA 4WCVA 5DRTA 2QBYA 4NNOA 4WKGA 1E3LA 4DC1A 3SYNA 1U0JA 3P2YA 3TECE 3JS5A 1U0NA 1G66A 3EFBA 1E0DA 3EMKA 1RYFA 3UC5A 3FOZA 1SOUA 4RZUA 2JFUA 2XVZA 4LF9B 4MMYB 4ENRA 3ZV4A 3VU9B 1SVNA 4LJKA 4L7QA 4INAA 4K46A 1JIJA 4HDKA 4R71A 4WINA 4Q9KA 5HIKA 3HBLA 1A9XA 4N47A 4MNTA 2OQVA 3K6SA 2O57A 5IJAA 3QTTA 4FSDA 1KE1A 1VHQA 1OFTA 1KRHA 4PN3A 2NYVA 4LJYA 4BFYA 3SWWA 4DR4B 2B1IA 2PXAA 1PFQA 1B23P 2H08A 4LRTB 1XU4A 4NPAA 4CEIB 2FFRA 3K92A 4C7OA 2ZUCA 3DZIA 2AR9A 1RWWA 3CZCA 1JZQA 2MT9A 1FNNA 3AR6A 1GYQA 3EIHA 1RXUA 3LA6A 2VSXA 3FSGA 5EHIA 2X0FA 3TOVA 1BX1A 2BGUA 3H2KA 4DSUA 3USZA 2XCLA 1H2XA 2GK3A 5ADVA 5KNLA 5BN1A 2CXOA 4B33A 4ZC8A 5H02A 1PZNA 1J24A 3IH5A 1KBOA 2R6GA 5HRAA 3RYCA 2GM9A 2OPHA 1M73E 4N5LA 5BUQA 3DWGA 5TXGA 3WDLA 4B45A 1E92A 2RGWA 5K2OA 5FADA 9ABPA 3KEFA 5SZHB 3BQMB 4MUAA 3HB9A 1Q1QA 3EEBA 1C9JA 3DMTC 1GZSA 4OB6A 5U4XA 2RDMA 1D6SA 3CN9A 5EVCA 4LECA 2XYPA 4PCUA 1GLVA 1BSVA 3I6QA 4WESA 2O3TA 1U3GA 3A6HA 1DELA 1TQ2A 1AH2A 2DWOA 1FVFA 1XLWA 1UXKA 2R84A 4IGFA 1THZA 1RKVA 4X63A 5EJ2A 2HA0A 1HFWA 1OXKB 1TVKB 3INNA 4KLNA 4JH0A 4UHCA 4D9HA 2HX1A 2QHXA 1NVXQ 2VT6A 3AX6A 4RA6B 5D1HA 1U8CB 5EZYB 3GH3A 3OLVA 4J6EA 3WGQA 4GBGA 4RGBA 4CV2A 5C1BA 1XCGB 1V25A 2XIQA 3WB0A 3QUTA 3DHYA 1ADGA 3BH7A 2PYDA 1R50A 4F2GA 3ND6A 5KX5B 4YQEA 3GFQA 5EWJB 1H22A 1NVFA 2QTFA 1X13A 1FBNA 4QJIA 1XMOB 2VDOB 4HDSB 3LT2A 1DB3A 4GOJA 4EG6A 3CLSD 1VMAA 3CZRA 3GXOA 4J43A 3TF5A 3D7NA 2WT4A 4RIFA 4DUPA 9GPBA 1T8PA 4BGDA 1EWVA 5EJ4A 5KNDH 1PNTA 1Z2PX 3DHEA 3NEPX 1M1YE 3OIFA 4FFBA 4AD8A 2WD7A 4CHGA 4TLBA 5FNVA 1WDLA 4WECA 2HSWA 2IUYA 5KTPA 1OH5A 1PNQA 3HB1A 3IV7A 2RC5A 2X8BA 2BFBB 3OT5A 4CNBA 4B84A 5FTLA 2J6CA 4IVQA 3KYCA 1U3VA 4L0CA 1AQJA 2CV0A 1Y9AA 1BXRA 2NO6A 5ADHA 1ZHFA 5FWXA 5F1KA 1KMCA 1YVDA 4G9BA 5B30A 1X0XA 1QG0A 1TTQB 2Q3DA 5LLSA 3A4IA 1PGNA 4R8MA 5SY6A 1EHIA 3NRBA 2Q2QA 2JVIA 4ERXA 4ZT5A 1H8EA 2WB2A 2AOTB 4E30A 3FYDA 2WTUA 3OOEA 1IM8A 4AKTA 2R1ZA 3OJOA 4KGZA 2AI3A 3BWYA 1IJEA 3S7TA 1IBMB 1YB5A 2JBHA 3OTIA 1NN1A 5CT9A 4H6WA 4NCIA 1J0CA 1NBOA 3C7AA 3H8VA 2FX2A 3HB5X 2BKAA 1ST2A 4GGOA 1CW2B 3CB2A 4KYUA 4M7RA 1NKVA 1P1IA 1AZLA 3CTPA 4CXMA 1O6GA 2DQ4A 2A84A 1DKOA 1D6NA 1U0LA 5BV8A 2NUAB 2WLSA 2CFRA 1A2OA 3R3HA 2P90A 3E81A 4MPPA 3V1MA 4ZYWA 1MHPA 3MQFA 5T3YA 2WABA 3QWFA 3U5TA 2DBQA 2JLZA 3LUJA 4IM7A 3JYQA 4CDRA 3UXMA 1RZVA 4JXXA 2N9UA 1E4YA 2FFBA 1IBKB 1VE7A 4TTJA 5KTYA 1CQZA 3QVGB 4HI0E 5BSEA 3RUHA 4HDQB 4OOEA 5DNEA 5SZJA 2VQ6A 1T8SA 3I5UA 4GNRA 3LRPA 1XRPA 3OZDA 2J6HA 1JHDA 4LNAA 1EFUA 1I0IA 2YVQA 3FNEA 1SKUA 5I7RA 1MGOA 2FMUA 1RLUA 4XUCA 1PUJA 4F1KA 1OUMA 2ZU0C 3BA1A 3NP9A 2UZIR 2P91A 1KEPA 2KBEA 3G2QA 3WLJA 1L4UA 3ZVRA 1Y9EA 1RJDA 3IRVA 2Q29A 4DTCA 3DP9A 5J4HA 1CIJA 1MW9X 2IHJA 4MPRA 3IIKA 2QP9X 1SOAA 4GPTA 3E5NA 1JG3A 5BY2A 2MOKA 2O8EA 2O3RA 2CHUA 3BMCB 1YD7A 4GW3A 5AK5A 3OE4A 2DWUA 1D2HA 4CMJA 1BXGA 1NOIA 1DUSA 1HQKA 2GN9A 5J47A 2VDMB 5JPCA 3S28A 2J9YB 3ZHSA 1X94A 3C4VA 3UKOA 3OZEA 2W5UA 4MVCA 5FCDA 1DADA 2Z4TA 3LDAA 4NZMA 4RJKA 5KPJA 1W93A 1J0DA 2VBFA 1JR3A 3EQ7A 3HACA 4J0FA 5SYNA 1IAVA 4CM4B 4IMRA 1CNEA 1YZTA 3LG2A 2IWRA 4CWAA 1G5PA 5BW6B 2DJIA 3W7VA 5JMTA 1PEYA 1MVOA 4BVLA 1SY7A 4D9JA 1SKAA 2GBPA 4LJ6A 3ZC3A 2L17A 4I9GA 1G5QA 3GA0A 5ALVA 3UJCA 5L6LB 3B9PA 5KINB 2O2GA 1N6PA 3QWAA 1M2KA 4E5DA 4P7KA 4FYWA 2CE2X 4INJA 1JEYB 1PEAA 2PQ2A 4PRYA 2A6PA 3KZOA 5CT6A 3ZX4A 4BFUA 1F3OA 1RBZA 3QE0A 2CLCX 3LE8A 1A9QA 4QGHA 5CYPA 2MCFA 1HT3A 1AS2A 2BGKA 4O4LA 4BE4A 4RFVA 1X7ZA 4DLZA 1BHQ1 2I54A 3GJSA 2W2MA 4XOIA 3S2EA 5BWCA 4A8JC 3PZBA 4YJ2F 2C2BA 2AN5A 1M6EX 2HA5A 3QBTA 3RFXA 1CUWA 1E61A 4I4TF 3DDWA 2HMTA 4KXUA 4EA9A 5J58A 4D9FA 1N0VC 2QAJA 2YWXA 3PFCA 2ECQA 4TM8A 4FXOA 3A2KA 4Z5XA 2YNMD 1VE1A 3RU3A 1KSHA 2DULA 1SQ0A 2IITA 3ISVA 3U1TA 5IM4F 2CLEB 3ZKWB 2RAFA 3GLVA 4HDNB 4HNHA 5EKDA 1MAVA 1MEOA 4F11A 3VR5D 5IJZA 4O2LA 1MIHA 1L5QA 1Y1TA 4PFJA 1ZFNA 4YP6A 1D03A 5CCDA 3V6MA 3W2GA 5LQJA 1TU4A 3QA9A 1E64A 1HDZA 1NBMD 3HDYA 4MEBA 5EC8A 2C2WA 3DS8A 1XNQB 1DEOA 4LDZA 5P8WA 4M99A 3SC4A 5T4FA 1QIMA 4BWFB 1H4SA 4QNMA 2NADA 1MOQA 4ND2A 1Y6GA 3OZFA 1E63A 3PXGA 4B7CA 4B48A 3OE5A 1J1UA 1C30B 2CMKA 3UWPA 2QR3A 4YVFA 3ZE6A 3I72A 2H8GA 3FCUB 4UTNA 4NMXB 1GOTA 3W5CA 2H59A 3W4JA 1P2TA 4I4TA 4AMYA 2VNJA 4LA4A 4DT1A 5JZBA 4PFKA 2Q6OA 4R7GA 4V0NA 3GRRA 4HVLA 5HHTA 1PT8A 1XZDA 4Q0MA 4EPXA 2OMKA 3KU1A 1MV5A 4YAFA 4NBSA 3IC5A 1L9XA 3X1ZA 2FMHA 2AMVA 4J2HA 2FU5C 2JGJA 3PIIA 4PSCA 5DBOA 3DO5A 4PC1A 2XE7A 3MYRA 1EFVA 4YMSA 5EMLA 2NW6A 3AVUA 4M6WA 3D2CA 4GEGA 4CEIA 1G4UR 1L7AA 1H8ED 4MYUA 3HJGA 5LQKA 4B43A 1UPUA 1J97A 2X0IA 3QU7A 2IL1A 4WJKB 2XYQA 2P2SA 3FPKA 3PRHA 4MS3A 1JAHA 3Q8MA 1X9GA 2QVGA 4ZAWA 4XWKA 4OYLA 1UKAA 4PLFA 1I7DA 1XL0A 3S6JA 2VQ3A 4DCCA 1XRNA 4EENA 4WV3A 5GOTA 2BHSA 2EGGA 2G5PA 2OVFA 2C0QA 2QDKA 4L6AA 2QG4A 3ZWCA 2BFPA 4LXGA 4BX9A 2HA4A 2QJFA 4AG5A 4UJ5A 2CL0X 1A97A 4G97A 5IMBA 2GZHA 2VP6A 3FOFC 1CUSA 4YRFA 2C5FA 4AO7A 5BMVF 2K4MA 5JRZA 2A33A 1LWOA 4L4RA 3T3GA 1F0YA 3KV3O 5JJCA 3MSXA 4G0PA 4EK9A 3NTRA 1GAJA 4X1IB 3TLAA 3PPYA 1F8GA 1NJ6A 4BNMA 4QUEA 1SCDA 3B7WA 1QFMA 3GJ6A 4PSDA 1K4MA 1RXSA 3EFEA 1OBOA 3RYFA 1A2KC 1JNYA 4RF4A 1KEWA 2BMEA 4L3WA 2DR2A 1HT1E 3OBBA 1IBRA 3C8DA 3EGCA 5KTOA 3JWPA 4ZI7A 4YJHB 1T3SA 3JWGA 4A82A 3HO1A 3NJRA 4YJDA 3EB9A 3K4HA 1U1FA 1CVLA 3W5JA 5KYGA 3SX0A 3NTLA 3LPLA 4ZKDA 3T5AA 3HVKA 2R85A 4L85A 1N6NA 2IXDA 4LW8A 2PX8A 4ZI3A 4AXXA 1NJ2A 4EY8A 1JTVA 1VE6A 1ND5A 3S27A 1WUYA 3DE2X 4KO3S 1WTAA 2ZI9A 4KV9A 5FL7D 4WLUA 2Z4RA 3GZ4A 3I5AA 1WTCA 4D9KA 3KJFA 4FFOA 2WSIA 3RBAA 1PWYE 1QH8A 3UJPA 2QYOA 3ETEA 1XYGA 3BWDD 1TJ5A 1PT5A 4G9GA 1SG9A 1VCMA 1PR5A 3IO5A 4R8LA 2IY7A 5B1IA 1AHNA 3L8GA 4AS3A 4DR3B 2EERA 3HCFA 1ZGGA 1YJCA 4OV6B 1Y6QA 4MUNA 4TYQA 3TB4A 1KH1A 3UAWA 3A70A 1YB6A 4B34A 1Q1ZA 2FR8C 4C88A 2ZWMA 1YFZA 3KIPA 3O4FA 4GBMA 4I4CA 1IWPB 2X4GA 5DTQA 1U2QA 3QX8A 5EHNA 5F7JA 3E23A 1M76A 2AG5A 5DP2A 3ABZA 1BOFA 2QY9A 2WG1A 4L74A 3SIPA 4BUZA 1SVLA 2ON6A 1SXJE 3AJ8A 3AFIA 1HL3A 2XLCA 2M1XA 3GGCA 3L6RA 4HQOA 4IDPA 4NYMR 1E1QA 4TRMA 2P41A 5DSZA 4I50A 5EG5A 3WLMA 4CUZA 5TQ0A 3WGVA 2C2ZA 4JLNA 3BWCA 4RTJA 1E2GA 2AV6A 4B4UA 3LZ6A 4J8PA 1L7OA 4MR7B 5CXQA 5EJEA 1VZ2A 4NZ9A 2WU1A 1WV1A 1ZBDA 1C3EA 3V2GA 3PQ6A 3NHPA 4NCHA 4QL3A 2ZJYA 2HT1A 1PHPA 3FCEA 4WJZA 3RK4A 5F3WB 2G25A 1IPHA 2PWBA 2DERA 1HMPA 3IAUA 1NPYA 1NW8A 2BMJA 4EFKA 2WZBA 1YJXA 2PANA 3ZXIA 1KHTA 3K70B 2O4UX 1OWLA 5G0SA 1M67A 3TYXA 2OE2A 3NKVA 4F84A 5GZ6A 1P5ZB 4PTZA 3VYVA 4DY6A 4RD0A 1KRXA 4Q4HB 2B5VA 1MC4A 2BC9A 3F5MA 1AXRA 4LDAA 1VKHA 2OR3A 2V7VA 4HWKA 1RPZA 5IXJA 1Q0RA 1R6XA 2JFGA 4UARA 1CTQA 3C8UA 2C4VA 1CPYA 1IWOA 2A3NA 4LSWA 5D5QA 5HJ2A 1T2DA 2QIOA 3QA3E 4GBED 4WSOA 5CGZA 1F17A 1KFKB 4CM8B 4YREA 4MW7A 9LDTA 2F4NA 1CR6A 2JFHA 3H5TA 1EB8A 1RI3A 3HSSA 3WLOA 3AF4A 1L0BA 1Q19A 4ECAA 1LU9A 3TAHA 3B3AA 3ZTTA 4NYMQ 3B3FA 2CBZA 1IG3A 3OETA 2A86A 2FFQA 1Y4DE 2I3GA 2X0KA 3EZXA 3L0ZA 4M1EA 3T99A 3UK1A 4Q7QA 4MA0A 3I04A 5IT5A 5KOIA 3RRJA 3HV2A 1WXGA 3COWA 5SZIA 3SJUA 1XQWA 1NM5C 3U7QA 2HPHA 4OM7A 1DPFA 4WPGA 3VOBA 1KZ7B 2ZAMA 4P36A 3TUJC 2QQEA 3ZLJA 1ZH4A 4KZKA 4GM0A 3ERCA 4JVLA 3BHNA 2EP5A 3VVLA 2JAQA 3CX8A 4QJ5A 1MF7A 3ELWA 1SZJG 5T6MA 5BSKA 2Y76A 2QN8A 3KKNA 4POOA 2ARKA 4ALJA 4OHMA 3RVRA 1C3OB 3GLGA 1J21A 2R8OA 4XM2A 5TT0A 4XJXA 2XUAA 3M2PA 3K70C 4BKQA 1YS6A 1JEOA 5HMLA 4ZCLA 2Q1WA 1T1EA 2C7VA 3KKKA 4OMCA 1E3QA 5CD1A 3ZWOA 2BF7A 5DSTA 2XEXA 3B2QA 5TMEA 1DMSA 1KGDA 1NFQA 2YW9A 2WU8A 1BVUA 3CF4G 4BNNA 4A5SA 1Q0HA 1TZCA 2AXEA 3ZVMA 3TTXA 1XZIA 1DUVG 1FBTA 1Y5RA 4QDUA 4LFCB 3U4DA 2PBFA 4L1KA 1G2QA 2GNPA 3I9V1 4Q9NA 2IXBA 2PKWA 3G5AA 5JFOA 1G63A 4ZU6X 1SZDA 5KJCA 3CJRA 1PR6A 3L49A 3N7AA 5JZOA 1WDMA 3A9RA 5FUBA 2FRVA 4C6SA 3KYDB 1BWSA 2G9ZA 4UM7A 3K9CA 1EGQA 3HHPA 4WN9A 1QZ3A 4JB2A 4DKXA 4PEVA 1PZHA 4TWZA 4KIWA 2BBSA 4OUDA 4HYQA 4C06A 3DHWC 1W44A 2XMCA 1VC2A 4DR5B 1CLUA 3ZZ0A 2CHVA 2JHPA 3IUJA 4OXIA 5BSVA 4NBWA 5DKFA 5CW2A 5AKIA 3Q2KA 1T3LA 5BVGB 1LNSA 3DC7A 3GDFA 2NUBA 1W5EA 4FGZA 4DARA 5DM0A 4D96A 5KNBA 3CLRD 1ZMBA 3O47A 1RI2A 2O1SA 4P4UA 2P4HX 4JU9A 3VBEA 1ADJA 3F2VA 1Z0KA 2OQRA 5CDTA 1B1CA 1OXTA 2FW0A 1I4WA 1FLAA 1UQUA 3P52A 4JJ4A 1J0BA 3A06A 1ICIA 3PX7A 4TZ6A 1HQDA 1P61B 2UZ1A 3P9YA 2AA3A 2ZS7A 3AHJA 1H0KA 4Y1RA 5CX4A 4FOTA 2C9ZA 4O2AA 4PX5A 4QBIA 1V8BA 2E37A 1PR1A 1A8UA 4RZSA 2FQ1A 4LY6A 2WMDA 2QRZA 2PD6A 3MZ0A 2VJCA 4RHCA 2CF6A 1WXQA 3B5EA 3CKYA 3M33A 1LRKA 4BO6A 4D79A 4J9UE 3KXDA 1JP7A 2ZI6A 4L6IA 5JFTA 2GNOA 4LY9A 2O7QA 4BZPA 1RQ7A 2AG8A 5K4HA 4KN5A 1KR2A 1C2YA 1NONA 1GZDA 1B42A 1NULA 3GGSA 3NJ4A 4GYKA 4Q1AA 3EMBA 3HL4A 2WSYB 4B9EA 5LQCA 1A5ZA 2PMEA 4C7VA 5A4DA 4ZEOA 3OZIA 4PXAA 1A8HA 4FLMA 4UM5A 3DYBA 3EF1A 3WA6A 1A9YA 1XJ0A 4EF4A 5IT0A 2NP7A 3WMGA 2X5OA 3A9UA 3R7AA 4G63A 3E9EA 2OGUA 3LYAA 4HDOB 2RMKA 2WF7A 1C9DB 1KJ8A 4H6XA 2PTGA 4KGVA 4RJIA 5B1SA 3WK7A 4CF6A 3PUWA 2EEZA 3KJHA 4OBEA 2GZRA 3MTIA 3UG6A 1T5LA 3SEQA 3Q87B 2VHXA 1AK1A 1SC6A 3PGKA 4I2NA 1KS9A 3O3OB 1MHTA 1MJGA 4DSAA 4MQ5A 1P9WA 4TM7A 3M82A 4U7WA 2WWXA 3WI7A 4UNPA 1AG9A 1OVGA 3WJ7A 5DCWA 4TLDA 4TUYB 1RYZA 3D5TA 3I3SR 1IULA 2V9CA 3BMCA 3W79A 2ZUFA 1ACJA 1UIRA 1NI3A 1MIOA 4RK1A 1GSOA 4E09A 3K0KA 3WTCA 4QELA 1GTJ1 4P83A 5CVCA 5A6SA 2BFFB 5K51A 4J07A 4J0HA 4CMCA 1QFJA 4GRDA 3WLHA 1X70A 2WUFA 1KY4A 3SF8B 4CIXA 1C4OA 3HYCA 4A2PA 3W5HA 1DBQA 3I0ZA 1V3QE 1Q0TA 1USKA 4UUAA 1BU8A 1AHHA 3VZRA 4P92A 1E7QA 3DPUA 4LGYA 3HFGA 1KJIA 3D2LA 3GLFB 2AYXA 4F56A 2HXYA 1NMZA 3EDRA 4ZKEA 3WISA 3TINA 1KU0A 4BWYA 5HM8A 1WQ4A 1FQWA 1PZXA 2PT5A 1NSFA 1BCRA 1E1KA 3O21A 4FOSA 5KYKA 3DCYA 4KI7A 3IXLA 1DMRA 4GQAA 5E9AA 1V35A 1H9AA 1Y89A 2HSJA 2ZRQA 1G20B 2MHCA 3C98A 5REQA 3UPUA 3AVTA 3ZWPA 1PJLA 1U0SY 2XKBA 3N2IA 2JGDA 3QU5A 1QR2A 2EGHA 3EVBA 2JIRA 2Q1TA 3OQOA 1OC2A 1EK5A 1OZFA 2D2IA 1E59A 2R2GA 2VH5R 3G59A 4LK3A 4LF8B 4EJ0A 1CUGA 1ZH2A 3LVBA 4L4YA 4RE6A 1GQSA 1FNCA 2H1CA 3Q10A 3MT7A 2HW8A 4YYZA 3LO5A 3T0FA 4CLDA 3VR5H 4BE7B 5DPMA 3O31A 1UP6A 5CIWA 2D5BA 2YN0A 2WG0A 1G5IA 4OI1A 2ZYSA 3KQTA 1U0TA 2HZBA 3I6MA 3ZV7A 1BEEA 3ASUA 1QNLA 1RQGA 3A9WA 3MA0A 1O95A 3KT0A 4F9TA 1YBFA 2FZCA 4OQFA 5F2NA 1GL9B 1MAHA 1UQRA 4OVKA 4X20A 1TYBE 1T4MA 1MDFA 3NORA 1XB2A 5BVHA 1XNJA 5B2EA 1FP7A 4E2YA 4LDRA 1G3IA 1P5JA 4TQ9A 1ISHA 2JCBA 2B94A 4AZ0A 2GTHA 2QTVA 4XIGS 2JRLA 2I55A 4MCJA 1E62A 3BK2A 3WBBA 4EHNA 4YXWD 1DKUA 2DR0A 2O0LA 5MDHA 5HSGA 3NCHA 2PSDA 2MYNA 3HJHA 2FK7A 4O4IA 5DWVA 1U1CA 4I9FA 5IYZF 4U00A 4GYJA 1JAIA 1M83A 4PTLA 4K6HA 3LPDA 4HP8A 2AFRA 1GT91 2ZB7A 2A9FA 3MJTA 2JCVA 3QXCA 4MYRA 5G1PA 3P26A 1SZPA 1X1CA 3E9YA 1F6BA 5DH9A 4KQCA 1FRVA 4OJKA 3S40A 2OQ2A 2MWMA 3LIPA 3ZI7A 4U7TB 1DWPA 3FROA 2RHRA 5CBPA 2P6RA 5FA6A 3B1XA 1D0VA 3A26A 2O2IA 1SQ6A 1SCJA 3S2UA 1Q1EA 4PYLA 4IIJF 4KLRA 4EOGA 1J49A 2VJMB 2MR6A 2OLKA 1FC0A 2QMHA 5F33A 1GPKA 4GMFA 4Q00A 4EHBA 3NBUA 5H7XA 2P4QA 1WSWA 3NNNA 4YAGA 2VF7A 1Z8HA 1Z12A 3I9NA 1UWKA 3QBJA 4ZYTA 2VHUA 2D5LA 1F4PA 2JLCA 3E22B 5AM4A 5FOTA 3VVMA 2ZBRA 1QR6A 3O94A 3OT1A 2W0MA 4KN8A 4LHZA 5ILQA 2XCQA 3HG7A 3RC7A 5KQSA 1H3EA 4MRMA 3F7MA 4C5CA 1QC5A 4WOKA 5JUWA 4G81A 1TMOA 4IOKA 4UNNA 4X66B 1VKOA 3R3VA 5DCUA 3AEUA 2FW6A 4FHZA 2TYSB 3JZIA 3PP8A 2DXIA 3V4SA 3D5QA 1ML3A 4JC8A 2FRDA 4JJIA 1UH5A 2N1BA 3DQQA 3ZNPA 4YWHA 2Q27A 5JCZA 3VDQA 1AQLA 5K3EA 4FONA 3A05A 3I45A 1IVSA 1MRSA 2W98A 4LWPA 3O4GA 1ZD4A 4JASB 4XCQA 3F73A 1F7VA 2YASA 1RHJA 4KXWA 4M49A 3WB2A 5JDCA 4IGAA 3C3BA 3MTQA 4TOIA 4WDQA 2OD2A 4MWGA 2F67A 3DZBA 3AB8A 1P8JA 1YS9A 1OIXA 1F6DA 3MIZA 1XJCA 2GAOA 3CV3A 4U6SA 1ISIA 2IEAA 3O0DA 3COPA 4WERA 4DSZA 2O6HA 4C2TA 3W5UA 1UWLA 1Z2DA 2I6XA 2VOEA 4G8JA 2O8DA 1VIMA 3HI4A 3I2IA 1J1IA 1KQNA 3ZWVA 5L4NA 4Y2TA 3IEMA 1QYIA 2P78A 3DG9A 3KEGA 3U7RA 4UEJA 3QK7A 4H9GA 2IPOA 4TV9B 3OX4A 4HS9A 1ZJ6A 3I2GA 4YUVA 1B0ZA 4FMBB 2GLTA 1T2EA 1W0JD 3PPVA 3FGOA 5B3JA 2IH4A 4ZGBA 4BRSA 3ZK8A 2G1PA 2FR0A 2XKAA 2VZ0A 4J0CA 4FFRA 3JQAD 1G8YA 1RZUA 1DWUA 1KS2A 1T1GA 3CBGA 2CK3D 2VRCD 3B9RA 4EUFA 2VDVE 1HFEL 4KGXA 3DWIA 4POAA 3OX3A 3F71A 3OIWA 4HNSA 4I08A 1P7WA 2YXBA 4HD8A 2YRXA 4L16A 2NPFA 5ITVA 3D8HA 1OPXA 3MJHA 1Y63A 1R3UA 1Z8DA 4RQUA 3PSHA 4L8VA 3QFFA 2ZPUA 5EY5B 3HJFA 1YI0A 4JYPA 4HXYA 1UM8A 2NIPA 2OBFA 4R68A 1TMKA 1RFLA 3SN6A 3WJ1A 4TYNA 4Q93A 3N87A 4B4WA 2CFIA 2ALJA 4C0HA 4UPEA 3EF3A 1Q6YA 3M34A 1ZDMA 3GNTA 3GJXC 3AXTA 3PEVA 4RA9A 2Q0QA 3N8NA 3D1LA 1KL7A 1ULSA 4UAVA 1VFPA 3FHCB 4LCJA 5EIAA 3L0BA 1WWKA 4AROA 4EPYA 1VYUA 2ATVA 5ALYA 2IXTA 1WOYA 4JR2A 5FV4A 1F12A 3BWVA 3LU1A 3Q88A 3V1UA 1KHHA 1Y7PA 1P2GA 1UADA 3AR7A 4LQDA 4CF4A 1H0RA 2OCPA 1XRQA 3K5WA 4CLOA 1YQDA 1N92A 2FE1A 1Q74A 3OIDA 2OBMA 2FLVA 4CL8A 1SCUB 1ODFA 3FYCA 3WAGA 2C77A 1M2WA 5EE9A 3O4VA 4GRAA 4ADSG 5L6MB 3EBLA 1D3AA 3JSAA 5I7AA 1M7HA 3PGA1 5F1PA 4E51A 1CP2A 4D4GA 3K5PA 2ECOA 3EW7A 3OJ0A 4KMOA 2KYRA 1RQRA 4RNCA 4NAVA 3HXTA 1U0BB 3OEED 1PR3A 1TEZA 1PZGA 4EYEA 2FHPA 1CIVA 2XNKA 3PE3A 2ZANA 3TOSA 1NXXA 3KBBA 3L05A 1K8QA 1PTJC 3F1LA 4MGZR 4BQSA 4GDMA 2R00C 2W48A 4LTMA 4P5PA 3X1JA 4IV5A 5F73A 4R2HA 4AY5A 2WTNA 4LI3X 2R25B 4JFRA 5IZCC 3BL5A 2W2NA 1R8JA 3P9RA 3GAMA 3CRVA 1QX4A 4RMHA 4RFLA 5CCBA 4KBFA 5AKZA 1U2GC 4FMDF 1JR3E 4M4SA 5EPUA 4CKZA 1GPDG 5GADl 3WLFA 1D4AA 3VKHA 1WP9A 1CZRA 4RGVA 4DCSA 3W2IA 1GGMA 2YY5A 4NOLA 4Q3NA 5CPBA 1YRLA 5ETJA 1DKPA 4FGLA 1YQWA 4B6SA 1LBSA 2O0MA 1AOXA 3AHDA 2B0JA 2FZEA 2ZRMA 5J2TB 1QLJA 3PVCA 4MEJA 3RG2A 1RR6A 3JTEA 3KPYA 4GZMA 2WA2A 2V98A 2FEMA 3NLLA 3MLBA 3T3EA 1JFSA 1PDOA 4ISCA 1RCTE 1KO1A 4Y6LA 3WZMA 1QMPA 1EIWA 1GG2A 4AURA 2G08A 4P5EA 2OTCA 1FS5A 2PD4A 2UUCB 3BXGA 1XZ8A 2PU7A 2PRIA 4M0KA 5IBPA 1C1XA 2ZI7A 2Q28A 2W2LD 4O4JA 2I8LA 4RQTA 4RZXA 3U1BA 5B53A 3C41J 4DLWA 1G8KA 2CBGA 2C3YA 1YR8A 3IAFA 4ON9A 2Z9CA 3T7SA 4V02A 3UQYS 3P4UA 2N46A 3DD1A 2GBFA 3FNIA 3H9QA 3KUXA 3PC6A 4KSCA 3NDIA 3DV2A 3N0RA 2XZPA 3IUSA 4XYEA 4K9SA 4ZOCA 1JDNA 5IVDA 3NUGA 3DDHA 1VFNA 4LUCA 3IUPA 1DE0A 5KYUB 1U0RA 1EQAA 3SR4A 2VDLB 1WMAA 4U2BA 1WDKA 3LDUA 1KORA 4GGMX 2D59A 2BPOA 5DULA 4HATA 5JS6A 3QU9A 4I5FA 2ISCA 4YRNA 2OCKA 2W2QA 5JECA 1KEVA 4ND8A 3R5JA 4RFSB 2I4TA 5GAJA 1PZMA 3O9VA 3QVOA 4GRIA 5FWXB 3WLRA 2RB4A 3UA4A 1RWNA 1Q6ZA 1XTKA 1IMOA 4H7KA 5IJ9B 2EFHB 1EAMA 2CUNA 2OO7A 2OV1A 1NBHA 1FSFA 1DARA 2Z5VA 3DUWA 3F98A 3RV3A 3STYA 1JTEA 3VC3A 4CMEA 4E3ZA 1N36B 4DV0B 4RTOA 2VP5A 3THYA 5NULA 3LYUA 2DPHA 2G80A 1UOPA 5LZ2A 5BYKA 3V8BA 3EZ9A 5CHEA 2P3SA 4LXUA 1GVNB 2XCOA 3JATB 4UHDA 3WIBA 4L8GA 4QUBA 2NT3A 1ZU4A 4EVRA 4M60A 3AF2A 4U7HA 5IUNC 1HSOA 1BZYA 2VRNA 5ELLA 4YCJA 2QW1A 3MBKA 3JAWB 2RGEA 4HDAA 5ELXA 1Q0SA 3RSSA 2A4MA 3LOQA 3ZDFA 4URFA 9ATCA 1GDTA 1XNGA 3DOUA 1W5SA 4G4IA 2HA7A 2QY6A 4CQNA 4Y1FA 1CUBA 5EQTA 2WYIA 2XTNA 1SM4A 3U1VA 3GUYA 1WEHA 1EE1A 1EFRA 3JQAB 3KHUA 3IKTA 4NBTA 2OOSA 1V2GA 1M6NA 1SJ9A 1R0KA 2RI6A 3DNFA 5KTRA 1OQAA 5JNVA 1SUFA 1S3FA 1L5VA 4JXKA 4TXMA 5AO9A 1O94C 5L3ZA 4UTRA 3HCWA 4IQ0A 2BW0A 4MWCA 5HWSA 1U8FO 1GD1O 1H2WA 4FK8A 4QFBA 1Q11A 4TYMA 3O1LA 3WS7A 4ENVA 3ANNA 3IVRA 4Y1GA 1P0CA 2J3DA 5ARCA 2AOVA 1V8PA 2IODA 1B4DA 2VHJA 1GCIA 2XNHA 5E9QA 2WMOB 2XTJA 4ZICA 3C1TA 1EJBA 4RIGA 4D3ZA 4ENQA 1LTHR 2O2JA 3PFHA 2F2TA 1R6DA 3LQFA 4MRNA 5IN5A 2PIDA 1B6RA 1OWOA 4U7DA 4UZFA 3AUUA 4H15A 2YCBA 3L2OB 4LYYA 1FXUA 1BCSB 1PN3A 1VKNA 5EMNA 4ZDKA 2F43B 2XCSB 3C7CB 1P2DA 4IG9A 2QZJA 4UNSA 1UOEA 3AUAA 3G2IA 3ABRB 3LVFO 5F7OA 5JD5A 2FVYA 3D3NA 3KS9A 3PGLA 4U8HA 4ZV9A 2YFKA 3EC1A 2JNWA 3ZYZA 2QV7A 4NBUA 3D43A 4PGGA 4X24A 4ASUA 1G2IA 1IATA 5K3FB 2J4FA 2Q5IA 3TXXA 4UNIA 1WS6A 3LWDA 4B2IA 5I4KA 1YQGA 4M8LA 3IKVA 2X1HA 3OFNA 4ZQIA 3K9GA 2OWEA 5LZ5A 3WGMA 3YASA 1PFKA 3AR4A 3I4CA 4P84A 4Z6KA 5LN1A 4PZLA 1DBWA 2HIMA 4IILA 2QPOA 1NBIA 4DCPA 1I7PA 4JOQA 2RK4A 3AF0A 3OPQA 2HDHA 4I55B 2J48A 2VSYA 1UDWA 1NVEA 2XYRA 3K5IA 3PR1A 3R3YA 5DYTA 3ZGYA 2JJ1A 4Q21A 4E6PA 2D6FA 2G04A 3L0DA 1GZVA 5JZ9A 2YL2A 3H87A 1C7FA 1OFGA 2V58A 2VF5X 3P2MA 3PQ5A 1B74A 3UOGA 5EJ7A 5CVDA 1IVNA 1EVKA 3QIAA 2ZCUA 3WYAA 3ZBUA 2Y05A 4CKCA 4CNQA 2FSVA 3DWFA 4ZOAA 1JWLA 2ZJFA 4M1KA 1PR4A 2B7BA 5C5DA 3D8SA 1MMFB 2D4HA 3A9CA 3OEWA 4K6KA 2IYVA 3Q3JB 2JHAA 4DIDA 3SIWA 4DJTA 3K6SB 1SIWA 3MJEA 3RGGA 3JQGA 2R1TB 5ALTA 2ZE8A 3EEIA 3ET4A 3NHSA 1XCBA 4JVSB 4N49A 1AGPA 4WA7A 4Y2HA 3WO1A 1OE0A 1Q3TA 4PLZA 4RD4A 2CVQA 5ILGA 2O20A 3PUVA 4MLDA 1S01A 4A8HA 4FZRA 4ER3A 4RL4A 3DL0A 3HJNA 1XRJA 5HF8A 1NQXA 1Z7WA 3ASVA 3ZKWA 2H1RA 4HV4A 1UBSB 1H2ZA 4L08A 3VISA 4M9XA 5CU7A 1JH9A 4GLLA 2A0XA 4HTFB 4XOUA 3RSGA 3UHAA 5FO0A 4F4IA 2AMFA 2GJ8A 1Y7TA 4HFMA 3BJMA 1YKSA 4O33A 2WF6A 1HE3A 2FWJA 3Q3HA 5FPPA 3GK3A 2EX0A 4E5SA 3WDKA 1J8FA 1JKIA 2XSZA 3N0WA 3CVOA 4XGIA 1QNFA 5G4KA 1MO3A 4W9RA 3ZIUA 3WZLA 1TLLA 2BFEB 2IH2A 1G6Q1 1E6EA 5JJLA 1WUTA 521PA 1EFPA 4MUFA 4EA6A 5BR7A 1OW3B 1EZ1A 2TS1A 3AEUB 5EHXA 5FLEX 2ZUEA 3FHTA 4MRVA 5J59A 1ZNWA 1GCUA 4RTRA 1IB0A 2J0QA 1S2LA 4KAAA 1Z0DA 1ZHHA 2Q3BA 4AYTA 2DY1A 2LCIA 3QM1A 3ZD9A 1Q7CA 2W2XA 2O8NA 3Q9NA 4DZZA 1GA4A 2XUOA 1V8DA 1WPQA 2PA0A 4L07A 4DFDA 4U7FA 1YBVA 3D5EA 2QPTA 3FZYA 1A96A 1PSDA 4N5DA 5C4MA 1X9HA 1Z0SA 1B15A 3R0IA 2V6GA 3AB3A 2YOHA 4XQCA 2V7QD 1V71A 3TZQA 1MRZA 3AIOA 4N9WA 1Q92A 2YXEA 3U6KA 4H35A 3ZX5A 2VJMA 2GXAA 4AY2A 4DLBA 4MLZA 3Q5GA 4BB6A 5JDIC 1GZ7A 2JIDA 1O5IA 4XPIA 4OTZA 1A9SA 3UK7A 1B0PA 3INTA 2F1JA 3BN3A 1TGYA 3HI6A 4IEFB 1IHDA 4MDHA 1T24A 4IJ5A 2FX3A 3FW1A 1N2OA 1PKXA 2P9CA 1L8QA 4IEEA 5ALKA 5DOVA 4HDMA 4D9BA 5KYTA 2OXTA 1GFIA 1E3TA 3MAJA 2R7LA 5JSUA 2MSEB 3FLMA 4G23A 2C4HA 4RPIA 1RYDA 4N18A 1UBRS 4QOHA 1TQ4A 3U7FB 1JA9A 2FJ0A 1Z26A 2W8BA 2CNWA 3NXKA 1IZ0A 2B8TA 1XAIA 4GMKA 1PE0A 4TV9A 5FYQA 5TMPA 3L7CA 3ZV5A 2YJ4A 1UMCA 4KFRA 1BO6A 1LNQA 2PRZA 4HYEA 2Q6IA 3FSEA 3WMRA 1E3IA 3WQQA 3WLSA 3AVOA 3EGDA 2ZI3A 3VV3A 1BFKA 3PDCA 5GJCA 3ROEA 1B14A 1Q2UA 5HZGA 1UBUS 3W7BA 4UHKA 1Z4LA 2WHYA 1L3CA 2W93A 5G0TA 3MTEA 2J4CA 4JOBA 5HK8A 3MTGA 4AJ4A 3QU4A 3N3AC 3AFMA 1WPGA 2JAXA 2RHCA 2XUJA 4RJLA 5JXJA 3V80A 4DSOA 4WKBA 3KR9A 4E5VA 3M81A 1AF4A 1L4EA 3CINA 4NARA 4M0PA 1P5HA 1K08A 2OK7A 2Z8YM 4LDPA 3PT5A 4ZMRA 1KYTA 1FU4A 3VSEA 1N0HA 5T8KC 3ZWMA 4DQKA 4ETNA 3AU8A 5JH7B 4X1KB 3QFCA 1NDUA 3O75A 3F7NA 4URWR 3I4FA 4DAOA 3PC4A 4KNVA 2O8DB 4MB6A 4RA9B 4D1YA 2PZJA 3MWYW 4ARIA 4OBXA 3AW9A 1KVSA 2FZ4A 2NU7A 4FBLA 4E14A 5JROA 3OTOB 3CLRC 2O1XA 3DFIA 5FQOA 4CFYA 1XU9A 3CT4A 2OQIA 2AFIE 5DBIA 4I8DA 5E0OA 1ESNA 4JXZA 3HZHA 4HFJA 4Y2SA 2RGCA 4RCZA 4JIGA 1AM4D 4NP6A 5T67A 1B93A 3TLYA 2FWMX 3UWDA 3ZK9A 3E8XA 2ZTVA 2GZMA 3ICCA 1VHWA 1X1SA 1OXBB 1BH6A 1Z0ZA 4I3HA 3RS4A 3BKXA 3L41A 4UEOA 3OM8A 4GP7A 4F92B 1A72A 2RIPA 4BQEA 4LZOA 1DZIA 2Z3ZA 1VIVA 5AJHA 4ZRNA 1XZBA 2JJ1D 1E2DA 5ICCA 3PEUA 3U6BA 3VSDA 3P0RA 2QYTA 4BP1A 3QE2A 3TSWA 1U5AA 1PTKA 4Z49A 4G0WA 5JE8A 3GEBA 5AICA 1SHZA 1NDHA 3M5PA 3JX9A 4KYVA 2X8WA 4NDAA 4NCXA 3T1OA 4C2AA 5JISA 2H4HA 5HZMA 3ZK7A 3HR4A 3ZIDA 1NVMB 1BRMA 1RRFA 3B1JA 2BZ0A 3IIEA 3TD2A 1P2FA 3D8NA 3L7DA 2UXBB 3WK8A 1DU4A 2E0IA 3HCNA 3NT4A 3QOXA 4N0MA 3CSSA 3F4LA 2E82A 3AEXA 5IDYA 4P9NA 4JEHA 2C9CA 1KAEA 4ZPXA 2SHKA 5JCJA 1URPA 3PC8A 3REFA 4NU6A 1I2CA 3A1SA 5TIIA 1TCCA 1ECPA 4CTMA 3AI3A 3N9IA 3PXAA 3NHZA 1TO6A 3KVYA 2J3HA 1BC5A 3IJEB 4HEQA 2FG5A 3DFUA 4HL6A 4KO1S 4TTAA 2W2VA 1C0PA 1U7OA 5KTSA 1MUUA 3RJZA 4IJWA 1ZAKA 1A9ZA 4D41A 2JGKA 1SBIA 3DPSA 1PQPA 3UCFA 4FIZA 1RXEA 2B36A 1W36B 3ORRA 4NV1A 1D09A 1HRDA 1JEDA 1YHNA 2XOEA 3IJRA 1H5UA 3JALA 3KHTA 2OEPA 2QLLA 4Q3AA 4RS4A 5EUCA 4HZUB 3IMGA 1E66A 4J4HA 4CIAA 1TZBA 2DF8A 3JYNA 2C78A 2JVKA 5JHGB 2VCEA 4RELA 1DWOA 4L9RA 1G8FA 2IA5A 3U37A 1QRAA 3CZQA 3O74A 3P9CA 3ZNQA 3TQOA 4KR6A 3NAGA 5CB6A 3QEBZ 2JFXA 5DHSA 3VPDA 1QGUB 3OLWA 3R4CA 1P74A 2BTQA 1S3IA 3EH2A 3SHOA 2ZSUA 1XTQA 2W6JA 1PI3A 4F0JA 4NI5A 1UPTA 1R6TA 2H17A 1E3DA 1NYQA 3F6CA 3FJOA 3NOQA 3O8OB 3SOPA 3TXYA 4JJKA 3RFUA 5CA1A 1ZZGA 4ZI5A 1OYYA 3HUUA 1E7WA 2XTAA 1GWNA 3NHFA 2HA6A 3F3YA 3GMSA 1HSZA 1TZJA 1LBHA 1DKNA 2YJNA 4F5DA 1T6XA 2NUTB 4BCCA 3VYWA 3O8DA 4MQ4A 5TPZD 4B3HA 3GLGB 1C30A 1K5GA 3N39C 2FE4A 2OKGA 2YV2A 3FMOB 3JPYA 4JYMA 4LBZA 1HZJA 3JCZA 4PYKA 5AVZA 2F17A 2QT9A 4JGGA 2RHHA 3MMZA 2XD9A 4ONEA 1GUBA 3LRXA 4H3HB 4ZIRA 3NBQA 3O8QB 5BSRA 3QEKA 4G4SP 5HIAA 5B57C 2WWFA 1Z22A 3FPFA 1W2WB 4W7SA 3KYBA 4TLAA 2Z43A 3MRSA 5KPDA 3UMCA 4PX3A 5L53A 1P72A 3T7CA 4YMUA 5C7YA 4JI7B 3A1NA 1US8B 1C7RA 2HDOA 2ZRGA 1E20A 4KB5A 4YA6A 5F1YA 3WO0A 1KMNA 4ZAZA 4FDUA 4C20A 3FVVA 4BAZA 1NLUA 1WCWA 3U9TA 3R7NA 4WBXC 4ZEMA 4UEKA 2HFKA 2B78A 1P1RA 2XVYA 1MD9A 2IHTA 1T9GS 5HDQA 4L3OA 3OFSA 2D0PB 1DBSA 4UQLA 3LSTA 3F96A 3V1TC 4JYBA 2YY7A 5HA5A 4J1SA 2WMNB 5KJ6A 3DLPX 3U4CA 3B8EA 3H2ZA 3QUBA 4DRXB 1HKHA 4QHSA 4MJ3A 5FPHA 5JAUA 1R4AA 4PPGA 3PD1A 3TL3A 4JUBA 4YV1A 2CCKA 2BY4A 2LGJA 3NT2A 5C7IO 3ZU2A 4RHUA 4EW6A 1UINA 3CRNA 3DZDA 1RVDA 3LBIA 3ZD6A 4TSFD 4GQIA 3ZTWA 7REQA 4B3MB 2Q8NA 2COUA 4GZ5A 4XW2A 2C3MA 5BOSB 4BTLA 1FRZA 4BO3A 5B4TA 4FZ5A 4CEJB 1CIPA 2VHVA 1KKUA 5AK4A 4ME6A 1RC1A 4MEAA 5C53B