3TO4A

Structure of mouse valpha14vbeta2-mousecd1d-alpha-galactosylceramide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
292
structure length
289
Chain Sequence
YTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Vbeta2 natural killer T cell antigen receptor-mediated recognition of CD1d-glycolipid antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 77
structure length 289
sequence length 292
ec nomenclature
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3to4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3to4A01
3HZVA 4X0KA 3S35H 5ACLA 1OP5H 4IIQB 3RX7A 4WFGE 4Y4FA 3JWOH 4F7CB 2P49B 3TBVB 3RRQA 3MLYL 5ADPH 4ZS7H 1EFXB 3UZQA 3OJMB 1ZT7B 4EBQH 4NHUA 3OF6A 3FO2A 1G6RL 5E2VH 1ORQB 2ZCHL 4FG6C 4H26B 3U79A 3MLRL 4LCCA 4LCUB 2OCFD 3QIBB 1DDHB 3GJFH 4APQA 3V4VH 4K9EH 2PYFA 3IKCB 3KLDA 5IMOB 5AZ2H 4LDOB 1NCDL 4PRIB 3F8UB 4NPYA 1FDLL 2YZ1A 1TENA 2EYSA 1P4LB 5BO1L 2KL6A 4NKMA 3U2SB 4MXWH 5CP3A 4OT1L 2EYRB 4Y19D 1XGYH 2Y07H 5JLZA 3QXAB 5HHMD 3LCYA 5CBEB 5B3JE 2X4OB 4YHNA 3BZDA 4NM4H 4WO4A 4UIMB 1JHLL 3UBXG 1CU4L 1IGYA 1DBJL 1MCKA 2B1AH 3QRFM 1T0NA 1CFNB 3V6ZA 2DTMH 3G6JF 4FQCH 5F7UA 4UINH 4JCLA 3O4OC 4MD5A 3NIGF 4FS0A 1ZT1A 2R29H 4JGJA 5KSBA 3C6SB 5TGBA 4E41D 5TDPB 4BSVB 4HKXA 3H7BA 3IGAA 3K74B 3MUJA 3QUYD 3QO0A 2XYCA 4CBPA 1FVEA 2HFGH 5GGRY 1Q9KA 3D87B 4KJYB 4U6HA 3QXDA 4WY7L 2JCCB 4WTZG 4U1MB 2HFEB 4NT6A 2Z92A 4FFYL 5H94A 1UA6L 2E7LE 3QI9D 2R0LH 3IAPA 1W0VA 2FIRT 3CFEB 4J1UA 1UWGH 5ESVB 3MRRB 1JPTL 4NC2B 5BRZA 3CH1B 3V5DB 1WSST 5FECA 1D9KD 5FKPA 3DTXA 2J88L 1P7QD 4MX7B 1RURH 4JQVA 2HT4D 2W9DH 4O5LL 1JPGB 4Z5RB 4L8BA 1NDGA 5B39B 1C8PA 1QLEH 3I9GL 3UJJH 3OG4B 3WNLA 1IL1B 4F3FB 4U1JA 3SDYL 1FAIL 1BMGA 3T0XA 1RZJH 1ZT4B 2J8UE 2ZSWA 4PJ8D 2OM5A 5EO0B 3D5OF 3DGCR 2LABA 4U3HA 1FNLA 1UM5H 1OF2A 2PW2B 2AJYH 5FFLA 2ESVA 5DSCA 2VLKE 4HS8H 1SVZA 2OMBA 5J13B 5L6YH 1K8DB 5SWSA 3BZEA 1AO7D 4RNRA 4X6CB 3QG7H 1EEUA 5KJRH 4TTGA 5DVOA 1KJ3H 3U0WL 2QBWA 3QJFA 4I5BA 4NFDA 5CINL 2ZOLA 5IB4B 4LLYA 4FXLA 5GGTL 1A0QL 1KB5H 4LSVL 2ORBL 5JOFB 3ARVA 2VYRE 2P7TA 4PB9L 5GGSA 5I1AB 2VZVA 1RZ8A 1A22B 4WW1A 4OGXL 1LO3L 1LQSR 1PLGL 2XQBL 5F44A 1WK0A 4LDLB 5JUEH 3BW9B 2VISB 3WFBL 4YFEA 3EDJA 1LE9A 4KMQA 3NFSL 1HZHL 3RP1A 5BJTA 2B1HH 4OZFG 2DQTL 1RFDH 4NQDD 4NO0D 4Y19B 2XFXB 5GGVH 1QSFA 1R5VA 4HDIB 4PJ7F 5CGTA 5E6ZA 5HHMB 4YBHA 4NJ9H 2C3XA 3RHWK 3T2QA 1T7ZA 5F7NC 5I6XB 3MROA 1G9MH 2GTZB 4Z95H 3T4AB 4TUOA 2XG5A 4YHIB 1MF2H 5HHNA 1IM3B 4P23B 4O2EA 5DQDL 2FX8L 4PLOB 4NKDB 1RZKC 2Y7QB 4MQSB 4LSDA 3D25B 4CUCA 3QEGH 3TN0D 3KJ4B 4XVUC 5GRJL 4UDUB 4Y89A 4PJAE 3CUPA 4XXDA 4KRPD 4Q74A 1Z9LA 2VDOH 4WO4C 4E41B 1YY8A 4MNQE 1BQHB 1UWXK 1A4KA 1Q9WA 2YPKB 2CIIB 3GBNH 3IF1A 2ATKB 3QUYB 2P1YA 1ZSDA 4GKZB 3FQWA 4OBRA 4RFEB 2HKFL 5EWIH 2ICWJ 4ZPTB 5ABDE 4XTRD 2JF1A 4LNRB 1FNSL 1XFPA 1CD8A 3IU4H 4R4FL 5I8CA 5DGQA 1J8HE 5EU5A 1RUKH 3DRQA 3QI9B 4JB9H 3LKNB 1BZ9B 3HR6A 2CKNA 1BECA 2ZUSA 5K59E 4GW4B 1U91B 2B20A 2CR6A 3H9HA 1D9KB 4QCIB 5JHDE 5I1IL 1P7QB 3NCMA 2W07A 5ADPL 3JWNC 1BLNA 3IDIA 3QDMD 3EYOB 3EOYG 3L5JA 5EZIL 5E2VL 3K46A 4M03A 1YEEH 2BY1A 1LK2B 3ARGC 4OZGA 2E9JA 4QRRE 4GKNA 3VXRA 4F15B 3V4VL 4PJ8B 4HH9B 4KY1H 4P9HC 4K9EL 2M8XA 2E9WA 3D39E 5DEZA 1JNJA 4KI1A 5AZ2L 4YEFA 1SYSB 2BNUA 1QLFB 4MD4B 3C5ZA 3R8QA 3O45A 5AG8A 3UCRA 1YN7B 4JQVC 1FZKA 1AO7B 3O6FC 4MXWL 2A2QT 1CD9B 5GIRA 1XGYL 3K1KC 32C2B 4XBPB 2AAVA 4HS6B 1JPSH 4NM4L 1GL4B 2RGSA 4OFVA 4D9QD 3RUGF 5DK2A 1AFVH 4CKVX 5T3ZE 4WU5A 4X6BB 4IOIB 3IDNB 1UXSA 5FGRA 5SX5K 2B1AL 4B41A 5F93C 2WQ8A 3MJ7A 3GHEH 4FQCL 3STZA 4DKAA 2X4UA 3K2UL 4XXCA 2R29L 4BQBA 4YHPB 3ZDZE 5FUZH 4NQDB 4NO0B 4ODXA 2L7UA 3AMKA 1KYOJ 5EU4A 4HUNB 3PQYE 3F6LA 3HRZB 3LKOA 4LLUA 1T22B 3KJ6H 3OR7B 2HFGL 3WN5B 1BVLB 2DBJA 3CX2A 3IJHA 5CP7A 4YJZL 3BJ91 2DDQL 1M1SA 2W0FA 3ZE0F 3QAZB 4G7YH 1EMTH 2F9BT 5JW4M 2R0LL 3PP3K 2RIKA 3B3IA 2XN9D 1D5XA 1UWGL 5LGJB 1N8ZA 5EFIA 3PGDB 3L3GA 4M5ZH 4LSRL 2CLRA 3RWEA 3TN0B 1D9KC 5I2IA 5IIEB 2NXYC 1NEZA 1NBYA 5DVLA 3GSUB 1U8PB 2HT4C 4X5XA 3ZE1F 2W9DL 2H1PH 4FXKB 4U1KA 1QA9A 1QLEL 3UJJL 1R5WB 5EUKB 2VO5A 1ZVHA 4WFFE 2HP4A 3VFWB 1RZJL 3DWTA 1MFEH 2YD7A 3GRWH 1UM5L 3JXAA 3UPRB 5EPMB 4XCFL 2Q76A 4HS8L 4X4ZA 3MLXL 3OJDB 5L6YL 3P9MB 2EEAA 1I7UA 1DUZA 1LE5A 3QG7L 1BAFH 1PD6A 1XCTB 5KJRL 1KJ3L 4UT7L 4BSWB 1KB5L 3ORJA 1IAKA 3QDMB 4H8WH 1EH9A 1OWRM 3FQTA 5ADOH 2GKIA 4YH6A 1ERNA 1A1MA 4PBXA 5ISZA 3MRGB 1A14H 2R8SH 2XA3A 3PL6D 4OZHF 3N85H 4TUJA 4N0UB 3E8UL 4JFEA 1HHJA 3BIKA 1W2KT 5BVPH 2AJ3A 5GZOC 3E6FA 5IFAH 1CS6A 1MFNA 3O41A 1S9WA 2B1HL 5IB5A 2KZ1B 3CGTA 4EIZC 1RFDL 2B8OT 3FOLA 2VLRE 5GGVL 1AGBB 3CU1A 2NXZD 3JV6A 1HXMA 3MREB 1BJ1H 5FA4A 5CIPA 2P8LA 2Z91B 2Y36L 4NJ9L 5EO9B 2E7HA 1MH5B 3Q3GA 2FWOB 3KYNA 5IB2B 4MVBC 1DQMH 4PP1D 2BVOB 3JTSB 3V4PL 1MAKA 2VN4A 2MKLC 1WBYB 4KV5E 4Z95L 3VGGA 2NX5E 1EFQA 3QPQC 5AG9A 4PJDE 1MF2L 5JO5B 2NLJB 4TNWK 4KVNL 2UYLA 4JLRA 1YPZF 1ZGLM 3DXAA 4HCRH 1CFBA 1BZ7B 1MLBA 2PN5A 4KC3B 4PJEF 1F4AA 4TNVF 1FYTD 2XKNB 4KRPC 4R0LA 2CUIA 1FZJB 4U1IB 4CRPA 4D3CH 2JJWA 2X89D 1JZ8A 4N5ED 3BPNB 4QHMA 1HSBA 2FB4L 5CJBA 2Z4QB 3LSOB 1FN4A 5D6CB 5EWIL 1CG9B 1N0XH 2YC1B 4HFWB 5D96C 4N0YH 4NQTA 1H15B 1UFUA 1RUKL 4JB9L 1EZVX 2ZUYA 2XN9B 1H0DB 4TTDC 3OKDA 5KG9B 4FABH 3SGEH 4DGYL 3LKPB 1NH6A 4QEGA 4Z78B 3E2HB 1KENL 4X4YB 3WFHA 5E6IC 1LP9F 4E42B 3GM8A 3P4NA 3KS0H 3QQ9D 3S8WA 3L3OA 2X4TA 4WEMB 3BZ4A 1OTSD 1QYGL 1Y6NR 2IPTH 1KIQB 3G6JA 4I0CC 4MB3A 2XNAA 3VWKD 1CE6A 1QFWL 3ILQC 4KY1L 3UBXI 4ZDHB 1U8OA 2BOCB 2ITCB 5I8KH 5H37H 4HHAA 4HK3J 2YWZA 4YGVB 2QQQA 5DVNA 3MV7A 4YEEA 2XWBB 2NY2C 3KPOB 3LB6D 3ZZ1A 3IU3B 5MHSE 3BHBB 4NWTH 4FNLH 3L5HA 1RJCA 2P8MA 4J3TA 4C83A 4H0HB 3MNZA 2FO1A 3L3DA 1JPSL 1P7KB 3WSQH 4W70A 4JM2D 3BKMH 3CAFA 1AFVL 3GMRA 2R15A 1E4KC 1K6QL 3F5WB 3VW3L 1OB1B 5JDSA 3PL6B 1ZVSA 1HNGA 5C09E 5C0FA 2AJUH 5IB3B 1TCRA 3SO5A 4IMLA 3T0WA 3LKSB 2Q20A 1FO0A 3GHEL 5C7XH 3VFGH 2I07A 5FO7B 3X12B 1LO5B 3WEXA 5FOBA 4YK4B 5FUZL 2V2WA 1UWXH 1X5IA 4IRSD 4G43B 2NXZB 3AU1B 2R69H 1M71A 1LO0L 2HH0H 3K4DA 4MJIE 4YFLF 3WNOA 1SMOA 3SDXF 3KJ6L 5IHLB 1QFOA 4LAJH 5D7LA 1FL3B 4MS8A 2CD0A 3RWGB 3OKLB 1UJ3A 5C07A 1QBLH 1AGCB 1T21A 2FEDC 4G7YL 1EMTL 4K3HA 5T3XE 1B0GB 5IVZB 1A7PH 4RZCA 1K9TA 2X1WL 4M5ZL 4EOWH 4LF3B 4L29B 3LN4B 3BMWA 1FYTB 1H8SA 5F1IB 3I50H 1S7RB 2CLZB 3BD5A 5GS0D 3SY0A 3P73A 3FN0H 1FG9C 5J4MA 5IMMA 2H1PL 4YNYB 1I3UA 5IW1B 2BSTB 4OQTA 2GFBA 1HHKB 2YXFA 4YPGA 3S3SA 1J86A 4NQUA 1I3GL 3JWDC 2YPLD 4I3SH 1BQSA 3RX5A 4NUJB 5F9JA 3NCCB 3GRWL 5FUCC 5JORB 1DBMH 2Y6SC 4MA7H 1I7RA 4R0LC 5GJSH 5A2IH 1MRFH 2O5XH 1PKQE 3W9EA 1BAFL 1MY7A 4KK9C 3QO1B 1A7OL 1DLFH 3ULUF 5CMAB 5IOPB 4U33A 4UB0L 2D7TH 5DFVC 4ZFFB 3LAFA 5C6PB 4DK3A 2DJUA 4GSDH 1MFBH 4RGMB 4M4RA 3LD8B 5J11C 1WC7A 4GXVH 1A14L 1CDUA 2B4CL 3VWKB 4XNZB 3N85L 4HAFA 3DX6A 5E95B 1NCTA 4XPFH 5ANME 1KCVL 1U3HA 5IJVB 5J12C 5BVPL 3VFSB 4IRZH 3RVUC 3VRIB 4FXGB 4WDIB 1N5AA 3RWIA 5IFAL 3QWRA 4XZUB 5F96L 2LQRA 4KGLA 2J4WH 1IKFH 5IUSA 2R4SL 1JNNH 3I6LD 1ZAGA 5DI8A 1HSAA 1VPOL 1HHGB 4JFDE 1DQML 1E4WH 1EBPA 4JM2B 4YE4L 2BRRH 1PGRB 4ZUVA 4KZDH 3WHXB 2NY0C 2VE6B 4UT6H 3VI3E 3EJYC 5GXBB 4XP9H 3PP3H 2QV2A 3VDCA 3WJLC 4HCRL 2ZPKH 3RBGA 1XH3B 1XGPB 2WBKA 4C4KO 4C54A 4K8RC 5FO9B 2PO6D 3BDYH 2VABA 2FIKA 4QHLB 1HIML 4I2XB 4D3CL 4F9PA 4IRSB 4JVUA 4ISVA 4UNTA 1MLCB 4HWEL 3VE0B 4KK6D 5D7SH 5DVMA 3CLEL 3LKQA 1JWUB 4JZNA 3UO1H 3G08B 2RQ8A 3TT1H 1Z2KA 2FLBT 1JYVA 5JW3H 1A2YB 4MLSA 3DMMC 4IM8A 4Y4KC 4JKLA 1J1OL 4MCZB 2AXJA 1YNKH 1MCIA 3QCTH 4PJHF 1HWHB 1T1WB 3RWHA 2P45B 4ODVH 3KPLB 1K4CA 2R2CA 5CS7A 4FABL 4KH2A 4YXKH 5FYKU 3QQNA 3BP7A 1QPPA 4MS8C 1GGBH 1MPAH 2E9BA 2NNAA 3QA3A 3SE3C 4K94C 1UJ3C 2IBZY 5I30H 1QKZL 2VZSA 1OTSC 2IPTL 2YPLB 3N1QC 1G84A 1N2RA 4JFZH 1A6ZB 3WD5H 2OJEB 4NQCB 3VWKC 2RCSH 4KROD 1R5IB 3IXTA 4ODSL 3FONA 1JRHH 4P4KA 4E5XA 4QF1B 4CVXA 4D2NA 1HYSD 3I6KB 4IMKA 4F9LA 4NWTL 4FNLL 4RGND 4M93C 4HKZA 1F3JB 4EN3C 3D3VD 1JGDA 3D69A 3C2SA 4C57C 5FYJD 5FGSA 4F7MB 5IESL 1WCQA 5KN5A 2GJ6D 3WSQL 4OIIH 4WWKA 4JM2C 4WHCA 3BKML 5D7KD 4WRLA 1WFTA 2ZG2A 4QHUB 4PBVC 2WY3A 2PW1B 1VSCA 3E6HA 4OGYH 5EU6D 2WINA 4I0PA 4RAVA 3OXRB 2H9GA 3IJYB 3TYFB 1QVOB 5MERB 4F37K 1T0PB 1MCLA 1U3YA 2AABH 2HJKB 4I8DA 3JVGA 1WICA 3U7AA 2R69L 2HH0L 4D8PA 1X6LA 4HGWB 5HHPA 2FO4A 4DAGH 4KRMB 1HXYB 3GB7B 1A9BB 3QFJB 4BELD 3PXJA 5DS8A 1QBLL 4MJ6A 3MYZA 2VDPL 2A0LD 3MV8D 4OD3H 5E1AA 4PD4J 3HUJE 5F1KC 2N7AA 3BYTA 1HDMB 1M6OB 1MCCA 4EOWL 3FCTA 2OMNA 2DBLH 2FNBA 4P3CH 3FFCA 5F7FA 2QSCH 3I50L 2PO6B 4LNVA 4WUUA 1S9XA 2BY0A 3FN0L 4ZSOA 2ARJA 4Y16B 1T6VN 3K80A 5IG7B 1MVUB 4TN9A 1FJ1A 3TGXA 4I3SL 1KPUA 2GT9B 1T4KB 3S36X 3VXSE 1DE4B 4WHTA 1EHXA 5LKNA 1NFDA 1CGXA 1T20A 4Z7VB 3QH3B 1EEZB 1PEZA 2KZWA 5LCVL 2XWTB 5GJSL 5C0GA 1MRFL 2O5XL 3ZYIA 1BD2E 4PRHA 4YBLB 3TBSA 3LY6A 5DJCA 5CSZA 1PJ9A 1DLFL 3QUKA 2AK4E 1YQ2A 1U95B 4K3GA 2HJFA 5J06A 5ELIA 5DRNA 2XPGA 2D7TL 1DTUA 1IM9D 3O0RH 1S7UA 4GSDL 1MFBL 2AGJL 5EG6C 1S9KC 3AM8A 5T1KD 1YPZA 3BIBX 3STLA 1I9JH 2UWEB 5GRVK 4YX2H 4LU5H 3RBSA 2V9RA 4KROB 4PJEA 3FT2A 1KJ2H 4HJGB 3G9VA 4JFPA 4L8SC 4PV8A 3RPKA 5L2JA 2ZSVA 1AH1A 4OIAA 4Q9QH 4IRZL 4ONFL 2K7QA 5I1DB 4YDVA 4H88H 1OAKH 4RGNB 1FCCA 1YEFH 1IKFL 4NCC2 1JK8A 4P3DB 1JNNL 3D3VB 2VXVH 2BNQA 5E4IA 3TIEA 5D2LF 2C3VA 3HG1D 3DROA 4AYFA 3ULVL 2GJ6B 2SEBB 1E27B 1KCUH 2F58L 4Y1AA 4P57B 1NUGA 1E4WL 2BRRL 1FQ9C 1EVTC 5IQ9A 2BERA 4UT6L 4ENEC 5CEXA 3U0PB 3RZCD 4XP9L 2PF6A 2B7DT 4F9LC 1J0ZA 2L4OA 4PJBA 2ZPKL 5D5MF 4MNGB 1DVFB 1LP9A 4N0CD 5E8OB 2IPKB 4JDTH 2P8PA 4I77H 4DN4H 4RRPG 1MQKH 3MBED 4JANB 4PJAF 3BDYL 3SBWA 4DK6A 2AXFA 2CIKA 4MXVF 1B2WH 5DC4B 3PDOA 5KAQG 5T3XH 4DFHA 3O2WH 1HNFA 5D7SL 5DK0B 1F3RB 4Q2ZB 2V5MA 2VXUH 2XQYK 2DRUA 4I0PC 1K8IA 1XGTA 3TT1L 1G7MB 5JW3L 2CGRH 1TPXC 1DEEB 3MV8B 3BP4B 2LU4A 3MRNB 3MCLL 2D4DA 1YNKL 3A6CH 4UZGA 2IH1B 1RUAH 3QCTL 5CUSH 4A6YH 3DO7B 1RZGB 1X5YA 3JVGC 4GXUM 3V79C 1ONQA 2ADGB 2Z0BA 4YXKL 4HKBB 1BP3B 2GI7A 3T65B 3MV9E 4NO3B 3DVNB 4KJPC 4M7ZB 4XX1E 5AD0A 3HNTH 1GGBL 4Z7OE 2GCYB 3U30C 1B9ZA 4ZS6D 3S37L 4Z7WF 3QHZH 5CZKA 4Y5XA 4JFZL 1XEDA 3WD5L 2RCSL 4RQQB 4ONOA 3GNML 2IANE 3SEPA 4CAGA 1JRHL 1G7JB 1I9RH 1DQDH 4MDIB 5ERWB 2LVEA 3SDAC 1MI5E 1HYSC 4MQXD 4Y5VB 1KTKE 1EFXA 1AHWB 2VZ1A 3MODH 1J11A 4LLQA 3S3JA 1F2QA 3C87A 1ZT7A 2X40A 1J0YA 1FGVH 3LN5B 2ZJSH 5F9WB 1UVQB 4OIIL 2C5DC 4QTIH 4DKFH 4LCUA 5T1KB 3SO3C 4L3CB 3DOSA 5I75B 4FTVD 4GBXD 1HQ4A 1GXEA 1N0LA 4YO0A 4OGYL 3U36B 4HG4K 3IKCA 5IMOA 1E4JA 5GGVY 3CMGA 1IZKA 1P4LA 3U2SA 2F5BH 3JZ7A 1C08B 2EYRA 3WLBB 4OZIE 5E2UH 3BUYA 2AABL 1F90L 5D7IF 1JF1B 4X7SH 1PW3A 2IQAB 1DQQA 1WWWX 4CADB 4S10A 1N59B 5EZOH 4RSVA 3TA3C 3V5KA 1I75A 1CFNA 3RZCB 1NCCH 3VFNA 1OAZH 3B9AA 2JB6B 5L8KB 4R4NC 2DBLL 3MBEB 2QSCL 3C6SA 5KANG 4X9BA 1EBAA 4NSKB 4J23A 4BSVA 5DT1H 5TDNB 5ESAA 1FIEA 1QR4A 4WFGD 1X5AA 3LEXB 4HSQA 2Y06H 2OK0H 4UQ2B 3GMQB 4U1MA 5FKAA 2HFEA 5HI3D 5GGRA 2DIBA 1GGCH 2BXZA 1GIGH 1RIVL 4RDQF 3CFEA 5ESVA 3IDXH 1MHEA 3CH1A 1S7XB 4LPWA 1MFAH 2OSLA 4P9MH 5FYKE 5HI4D 1UCBH 3V5DA 3BPOC 1FNEB 4JN1L 3O4LE 3FMGH 3BGFC 2R2HA 1NMAH 4Z5RA 5B39A 3PGFH 4F3FA 1IL1A 4ZFZB 4O51B 2L0DA 3O0RL 3I02B 5MP6H 1EVUA 1MREH 5J8OA 4QRTA 1I9JL 4XHQA 1MFCH 4LU5L 2GHWB 1K2DA 1NC2D 2PW2A 3L7FB 2WP3O 1NCAH 5E70A 1CFQB 3BGAA 3W11C 1OAYH 1G9NH 2Y4SA 4Q9QL 4X6CA 4PTUB 2AQ2A 1A8JH 2YRZA 3QISA 43CAB 4H88L 1I4FB 2A9ML 3RQ3A 2IC2A 1YEFL 4RFNB 1G7LB 4KK5C 3BP5A 1V7NL 2OL3H 4O00A 2ATPB 1JL8A 2VXVL 4GW1B 4CDGC 5I1AA 1S7VB 3QDHA 1KCUL 3HE6A 3BW9A 1T1XB 2VISA 2WLZA 3LEVH 4TSAL 3DVIA 1JCKA 1OP9A 5GISL 4GBXB 4NC1C 3RZCC 3X11B 4PGCA 3GMLB 1I8LA 4JDTL 5CD5D 4DN4L 3ARBD 5EN2B 2GSIB 1ODAA 4AT6A 3RY5A 1QRNA 1F6FB 2O5YH 4HDIA 4MHHG 5HHMA 5KSUB 1B2WL 1KXQE 4P46A 3GBMH 4CDHA 3TNMA 5ID1B 5TE6H 3GK8H 2GTZA 5JIKA 2VXUL 5EBLA 3T4AA 1INEH 4YHIA 5HYSB 3EIFA 5FV1L 3TM6A 4P23A 1LO4H 3MOQA 2CGRL 4G8GA 4DVBB 2XT1B 5HYEA 1S9VA 5J1AB 3HAEH 3A6CL 3BESR 1HI6B 1JTPA 1RUAL 2Y7QA 3VGFA 4A6YL 1ZHKA 4HUXA 3UTZB 4MSWA 3EKCA 2G5RA 4TULH 4L9LB 3B9VA 3LRGA 3GSQA 4E41A 1BQHA 2VLKD 2NMSA 3ARUA 5EH1A 3HNTL 3MRFA 3MA9H 2ATKA 3QUYA 4WTXA 4NDMB 1NSNH 3QHZL 4GKZA 4DTGH 1N5YL 4I18C 1D5MB 3ULUC 2NY7H 4LNRA 3GSRB 1MJ7H 1H3WM 4KU1A 3EYQC 4HAGA 1QFUL 1JV5B 3QI9A 1DQDL 1XF3B 3FAXA 4X7DC 2DQEL 5I1JH 5IVXF 5E7FA 4PRDA 1AI1L 3NCYS 1XR9B 5DGRA 1P7QA 4ZYKB 1OGAA 4BZ2H 3GFUA 3MODL 4AH2B 3SKJH 3EYOA 4JG1H 2H2SD 2ZJSL 3KHOA 4TUKH 3TF7A 1QHOA 1BBJB 1TNNA 3Q6FA 3TH4T 2E7CA 1IQWH 1G7IB 4QTIL 1LK2A 2VDLH 3QUMH 1K3IA 2A6DA 4HH9A 4LSQH 1BREA 4QXTA 1NC2B 2MQ3A 1SYSA 1QLFA 1VEOA 4MD4A 1YN7A 5HY9B 2F5BL 6FABH 1ZKAA 3ZHDA 1HHHA 1Y18B 5E2UL 1I85A 5I1CH 2IF7A 3HI5L 32C2A 4XBPA 3U9UA 1VCAA 1WISA 4GG8A 4X7SL 3KPNA 2DICA 3DV4A 4I48B 3U83A 3C5SA 1FBIH 3NGBB 4KGJA 2BXYA 5EZOL 4O2FB 4X6BA 4IOIA 4XHJD 4UOJA 4ZNEA 3IDNA 3N0PB 4KKBC 4MNQD 4LLWB 5F1SA 1NCCL 2N4IA 4X8XA 4MWFA 1OAZL 3DETC 1PQZB 1W72B 3P0VH 2KBGA 4NOFA 3HZKA 4P5KB 2R2BB 3ARBB 2XG4A 1SVCP 4YHPA 3G5ZB 1PYWB 3UP1A 2GY5A 4NQDA 1Q9LA 3HE6C 5GRWA 3GJEB 1J8HD 1AXTH 3IFOB 2J8OA 3SDCC 5L9DH 3MV11 5DT1L 3HRZA 2RHEA 3WN5A 3OR7A 2GK0B 1BVLA 4K7FA 4XI5D 4WHYG 2Y06L 2OK0L 5JHDD 2P5WE 1H5BB 1BWMA 4GRWF 35C8H 2GQHA 4Z7QF 1GGCL 3WS6C 3BD4A 1J0IA 1GIGL 4P4RB 4YZFE 5BW7A 3ROLA 3M8OL 3IDXL 3KPQA 3EO0B 3PGDA 5F3HB 1MFAL 4P9ML 5D2LA 2DMKA 1UCBL 3EOTL 2Y72A 3TN0A 4QRRD 1S8DB 5I71C 2VN7A 3JV4A 2J8UB 5IIEA 5CJQH 2FBJH 2VUOA 4P46C 1CGSH 4UV4H 4F57L 1NMAL 3FO9B 3GSUA 4EZMA 3D39D 4FXKA 3RJQB 3SE9L 5C3LD 2VLKB 3PGFL 4OFDA 4OF5A 1A9EB 5MP6L 5EUKA 2HG5B 1MREL 4XP1H 4V1DE 4OD2A 1MFCL 1U8QB 1T83A 5DUPL 1BFVH 1H8NA 1NMCB 5I16A 1TJIL 3UPRA 1NCAL 3MO1B 4NHCH 4U1GC 1G9NL 4PRNA 1WTGT 3P9MA 5T3ZD 3UX9B 4C55A 1XZ0A 1K5NB 5BQ7B 2OL3L 2C3GA 3QDMA 4PB0H 2XRAL 4ELME 1G0DA 2VQUA 3IRPX 4NBZB 4UT9L 3HZMB 3LEVL 2V17H 3MRGA 3FB7A 4TVPE 5C9JB 3KWWA 2XZAH 2VDNH 1EK3A 3O8XD 2E3VA 2BNRA 2H3NA 3PQYD 3RL1A 2AEQL 4H1LA 1HOCA 4OLVL 4AY0A 1RZ7H 2A77L 2YD4A 4LIQL 5CD5C 1KEGH 2IFGA 4N90E 1JIBA 3QIUD 3TF7C 2O5YL 3BX7C 2W38A 5DD5H 5DYOA 2DD8H 3MREA 2E7LC 4XPTH 4OKVB 1U8HA 4G8EB 3MRPB 4Z77B 3GBML 2FWOA 3QUXA 1LGVA 4JPVH 5TE6L 1JVKA 3OX8B 3GK8L 4AL8H 1QEWB 4ODWA 1T0MA 3MGTA 3JTSA 4PJAB 1I1RA 1WBYA 1INEL 1VACA 2V7NB 4MNQB 5SX4I 4N1CA 4XNQA 4P59H 1JHKH 2VDRH 3BGMB 4WFFD 2WBJA 1QLRB 4HUKB 2XKNA 1OW0A 4TULL 1IEBB 1D5ZB 1MFDH 3IDYB 3U4EB 1KUMA 1UKSA 2X1OA 4HIJA 4U1IA 4HWNA 4XRCA 2EIEA 1F11A 1J8HB 5ILTH 2IBBA 1CWVA 2YBRB 4Z7UE 5GRVL 2Z4QA 1NSNL 3LSOA 3S35X 4DTGL 5D6CA 3ZKMD 5FYKH 2NY7L 3B43A 3V5HB 1CG9A 2YC1A 1NMCC 1MJ7L 2I25N 4UUJA 3RVTC 1F6AA 3ZT7A 1F3DJ 2XTLA 3DURB 2WNGA 5A1AA 1ZHNB 1T66D 4W6XB 2XN9A 5C1MB 5I1JL 3FT4A 5D7IA 1QP1A 3WDIA 4QRRB 4Z78A 3E2HA 4BZ2L 3V2AR 4X4YA 5HGAA 5CGYC 5FXCH 5IW6B 3D39B 5I19H 2ADIA 4BK5A 3VFMB 2J5LC 3VMPA 3BVNB 4NM8H 1IQWL 4ZD3H 4RIRA 3PGCB 1IAIM 1KIQA 3H0TB 3QUML 4KKNA 1KCGC 4DUWA 1ZVYA 2UZXB 2VLRD 2BOCA 1CYGA 4FFZH 2ITCA 4M9PA 3UAJD 1YEDB 1YECH 4BH7B 1FRGH 2WAHA 2XWBA 3FO1B 5LGHH 5B3NA 6FABL 3IU3A 3EYUH 1OARH 5F6HI 5CEZE 4Q9RL 2NX5D 4OM1H 4YIQA 5I1CL 1MCEA 1N4XH 1I1CA 5KVEH 5KANI 3EDDA 3RPIB 1P7KA 1I8MA 1RVFH 1FBIL 2J1KA 2GW5A 3RTQC 1EAPB 1F4XH 5IB1B 3F5WA 1MAMH 4HZAA 4UAOB 3PL6A 2FSEA 4NZDA 1CT8A 4MDJB 5IB3A 4NO2B 1EUTA 3LKSA 3PQYB 4I9WE 1XF5B 3G5YB 3PE9A 3P0VL 3ARRA 2YR3A 1R3LB 3DX9B 5FO7A 3L5WB 5T1MB 1AP2A 4LCIH 4NQVB 1WAAF 3QIUB 3QWQB 4WW2F 3UZEA 2D7PA 4G43A 2NPLX 1CXKA 1YY9D 1AXTL 5L9DL 4IOSD 1YEKL 1JTTA 4OF6A 2LTQB 1A7QH 1XGRB 1GGIH 2Q8BH 2OP4H 4NN7C 4JZJC 1JTOA 3GIVA 1FL3A 5IBUB 4PJ9D 1HILB 3T8XB 5FGBC 3KR3L 5HYSG 1X4ZA 3OKLA 4X9GA 4JPKH 3U46B 3GDBA 2XY2A 5JIIA 3ZKNC 4CVZB 5F97E 1AJ7H 3K0WA 1J1XH 5D1XD 3BN9D 5L88H 4B50A 1OTUC 5E8PB 4D0DA 1UZ6E 2EXWD 3Q5OA 4L29A 3WO3B 5EUOF 1T7VA 2J7LA 1BGXL 4PJFE 5CJQL 1QOKA 1YN6B 2CLZA 2FBJL 4UV4L 3QUXC 4F8TA 4YNYA 5GGUA 4N5EA 3Q1SH 1ND0B 2BSTA 1HHKA 2NY3C 3Q48A 4UBDD 2X5PA 3MOBH 3NPZB 4XGZA 3P4MA 3UTPE 5MHSD 1KACB 4MJ2A 4XP1L 2J8HA 3DX8A 4M48H 4LPUA 3ABZA 3TZVD 1F45A 5JORA 2VIRB 2WBJC 3JTTA 2X70B 4NHCL 1LQVA 4OFKA 4F7TA 2WSKA 4E0RB 1A1NB 5ID0B 1V3LA 3ZTJG 4NWUH 4AIXA 4EI5D 2DQUH 3QO1A 4PJCE 5IGXL 1CK0H 5CMAA 4EQ3A 4GKSB 4QYOB 1ZWIB 3K8MA 5IOPA 4GG6F 1IZJA 4ZFFA 2ZCKL 5C09D 4XMPH 4MHHI 4OZFH 4OZ4B 5JW5A 3UTTE 4NYLB 5IV2A 4Z0XB 2P5EE 3BAEH 5IJKC 2UVFA 2YXMA 1HKLL 4UAOC 2A73B 2VLRB 2XZAL 1CZ8L 5EA0H 4MJID 3WKNA 3O8XC 3UDWC 1IC7H 5IJVA 5C9KA 3T3PF 3VRIA 1AGDB 1RZ7L 4HK0A 5EORH 3UTQB 1KEGL 1GJIA 4X6DE 4XZUA 1HINH 2C26A 4YWGH 2FZ3B 4YHYB 2XZQH 2NX5B 5DD5L 5KSAD 2DD8L 4PJDB 4M4PA 1EHNA 5TH2A 5T3XD 4LCYB 4MJ4A 3MRLB 2EYTB 3FQUB 5BVJB 4S1RH 4PJIE 4L4JA 1FH5H 4JPVL 3ME0A 3N06B 5E6YA 4W4OA 5ICXB 4AL8L 3C6LA 1NANI 4HX1B 4OQTL 1TFHA 2VE6A 3WHXA 2CR3A 3RDTD 2NZ9C 1A4JB 4MLIA 5CFHA 3HC3H 5F88A 4PDCE 1WFOA 4P59L 1JHKL 2VDRL 1XGPA 3WO4C 3D2UD 5C6TL 3VDAA 1HQRA 1UM6H 1RZFH 2ADFH 4JREB 4PJGE 1MFDL 4PGDB 5C0EB 4QHLA 4I2XA 4IRSA 2GUOB 1ITCA 1F02I 3OHXA 5K9OA 3U7WL 3R0MA 1MLCA 3ARED 3FJTA 1HEZA 4QTHB 4UQ3B 1DLHB 5B8CB 2XXMB 2FJHB 1QSFE 4KKAC 4PJ9B 5FYKL 3O6LH 3O6MH 4ZUTB 3RVXD 1A2YA 1F4HA 5IF0B 5I1GH 5DQ9B 5DHVH 2V9QA 1EIBA 1MEXH 4V2CB 4R97B 5D1XB 1FYHB 5C0RH 4EKXA 1B6UA 3OBAA 3RFZC 2NCMA 4YDLC 4G6KH 1R0AL 1CICA 3KPLA 5IEKA 1M7DA 1BPVA 1O7SA 2QTEA 2YA1A 3HC0B 3T0EA 3ULSB 1TITA 4CVWA 4HXAH 4P5TC 5FK9B 1AKJA 4PGEB 3VG9C 5I19L 1TVDA 3WUWB 5IFJB 4LKXB 1QFWM 4ZD3L 3HE7B 4AIZB 3SKMA 2YPLA 1UKQA 5H37G 4NQCA 3C09C 3MRIA 3QP3A 4M5YH 1KJ2B 4LSPH 4HPOH 4FFZL 1DR9A 4HUMB 3TZVB 4JKWA 3OKEB 1IGMH 1OSZB 1P53A 4ZAKD 1FRGL 1J10A 4JFDD 5LGHL 4ZQKA 2CH8A 3EYUL 5GGTA 4L8CA 1XF4B 3ETBF 1OARL 4EI5B 3IJSA 5C0IB 2MHAB 4OM1L 4TVPH 1N4XL 5F7HA 1RJYB 5KVEL 3VD5A 5C09B 4IRJD 1RVFL 1S3KH 2I9LB 4OLUL 2ZG1A 3QEQE 4QHUA 4BKLB 4UTAH 1F4XL 1L0YA 1MAML 2PW1A 1NBZB 1P69B 5C0AE 2H26B 2OI9B 3PHQA 2DQFB 3QEUB 3CLFH 3DUUB 2GJZA 4MJIB 4POZC 1HE7A 4JHAL 5DJZB 2VL4A 3U82B 4OZGE 4HG4J 3MNWA 3IJYA 5MERA 3MRQB 1NCWL 4JDVA 4LCIL 4X6EA 4Y8DC 5A2FA 4TOYH 2IH3B 2HJKA 4FHBD 1CDCA 1YY9C 3EYFB 4X98B 4HGWA 1RK0B 4J3XA 1A7QL 4NRXA 1GGIL 2OP4L 3IFNL 2YUXA 1YMHB 3DNKA 3OTTA 3T0BA 3RY6C 3QFJA 2DQCL 2HN7A 3B9KB 1FNGB 1EV2E 4HD9A 4RCAA 1AJ7L 1J1XL 4NNYA 4P0DA 5L88L 4L9DA 1U8NB 2IALA 4A6YB 1HDMA 1M6OA 2IFFH 2EXWC 4DGVH 3D2UB 3R8BB 1JF5A 5DRZB 4NKOB 3EFFB 5TFSH 3CPLB 4FFEX 2EDHA 4JQIH 3QZWG 4Y16A 3C6LC 3Q1SL 1MVUA 3Q2CA 1N3NB 3ZHKA 3AREB 1PKQB 3MOBL 5IQ7H 4PJXF 4TRPH 5DEFB 3CSGA 4M48L 4PFEA 2NY6C 1DE4A 1ZLUK 5HGBA 2ILLA 4KUZH 5MI0C 2WLYA 1EEZA 1J0JA 2DQGL 3FFDB 4K71B 4JFYB 1JUFB 4ODHH 2BOBA 5IMLB 1R3HB 5LXGL 4MAYC 1XGQB 4EVNA 3DBXB 2Z93B 1CK0L 4M1CC 1U95A 2I26N 4LHUG 2WIIB 4XMPL 5ANMB 3S4SA 1UM4H 1OOAA 3BAEL 3GJFA 4P48A 4LPXA 2UWEA 4HULB 1N26A 4OCMC 1CLYH 1J88A 4BH8A 4F7PA 4MA3B 5EA0L 5E1HB 3CXHK 3RVWD 2DKSA 1IC7L 2DLGA 3ZTNH 2DN7A 4ZAKB 4Z6AT 1KTDB 1CTOA 3T0EC 5EORL 5I1DA 2IADA 4JFDB 4JVPA 4KPHL 4LLDB 2R0KH 1NAKL 1HINL 1WF5A 2XZQL 4P3DA 5KSAC 1IFHH 3TBYB 4JPWH 4YR6B 3WIHL 4EI6B 2J6EH 1B0RB 4IRJB 2SEBA 2X10A 1E27A 4KKLD 5EU3A 3GMOB 5J56B 3HZYA 1KIRB 4P2RE 3ZKXB 3E3QA 4M1GH 4PG2A 3AS2A 2YN3A 5EC2A 1HKFA 2V7HB 4KDVA 3RDTC 5CLWA 3U0PA 4OV6F 4GO6B 1OVZA 3KYOA 3ARZA 3HC3L 1JWMB 3MJ6A 1H3TA 3N9GL 4NKQB 1DVFA 1IGCH 3QUZC 5E8OA 1V8HA 2IPKA 1P2CB 1RZFL 3CZFB 2ADFL 1OLZA 4JANA 3VXSD 3W39A 3FQXB 4HKJA 4XCNB 4KK8D 3TV3L 4JG0L 4JFEE 1U92B 3MRJA 4NQXB 1JFQH 4MCYA 5DO2D 2BSRA 5FOJA 1QO3B 4MXQC 1MHPH 1X7QA 4Q2ZA 1NUNB 3N1FC 5L0QB 2AK4D 3O6ML 1G7MA 5I1GL 4KZEH 1MEXL 4KHTH 1DEEA 3MRNA 2D03L 5C0RL 3FAWA 3DO7A 3QEHB 1RZGA 1RJLB 4G6KL 2AJXL 3O6KH 2VQ1B 3WFCH 1AC6A 4H20L 4WUKH 5FF6B 2W1NA 2AK1H 3EZJB 4X9HA 4PY7B 2EE3A 4HXAL 1E0OB 4M6OH 4R4BA 5A16A 1G7QA 1KTLB 4B7IA 1SY6L 5FUCE 3ILPB 3MGAA 4HLJA 3UTOA 5E4EC 4I4WB 3ZYZA 1I9IH 1LVEA 5BCAA 4M5YL 5GSVB 3PWJB 4IOFD 4LVOB 4RQQA 3GEWB 4LSPL 4M7JH 4XCCH 4HPOL 4PY8I 1L9NA 3PJSB 1MWAH 3RGVC 1Z5LB 4NBXB 1G7JA 2VOTA 3KDMA 3MYJB 4WW2A 1A02N 5A43C 1SYVB 3W5MA 3CDYA 2D7MA 4RMRA 4Y5VA 1BQLH 1KB5A 4DZ8B 3VWJD 2BFVH 2X4QB 8FABA 4NN5B 4JN2A 1VGKB 3EO1B 4PJ5E 4KMTH 2QQLH 4P2OD 1LDPL 2UUDK 1UVQA 2RFXA 3VFVB 2HFTA 1S3KL 5FM8A 3PDGA 4UTAL 4V3EB 2F53E 4M6ML 3U36A 5EUOA 1PY9A 3RVVD 2XKSA 1KCRH 4N8CH 1MCRA 3G6JE 4MJ5B 5HBBA 2B5IC 1C08A 2GAZB 1I1AA 1QSZA 4TOYL 2C1OA 5H2BA 3OV6A 3VGBA 1JN6B 2IQAA 3MV7E 3HUJB 4P3WA 1PFCA 2D3VA 1N59A 1H3XA 4YBQD 3MV9D 1F00I 4S0TD 4KXZH 3EYVB 3KLHD 5F89B 2JIXA 2HT3C 4XH2B 3LS4H 15C8H 4RX4A 3INUH 1TIUA 4DGVL 3T2OA 4GG6A 2V5TA 3M07A 4N0CA 4NUGH 3MBEA 5TFSL 3VXSB 2Z31A 3SE8H 3QFDB 2VAAB 2FR4B 1JNHB 2IAND 1UKTA 4JQIL 2HVKA 3VH8B 1KT2B 2XXCB 4AEIL 1GYAA 2BSSA 1I9EA 5JPMB 5L8LB 1T89C 4EIGB 1MI5D 1BD2B 2DLFH 4Y4HD 5IQ7L 4TRPL 1OTTC 4RMSA 1WBZA 5HGHA 1ZA6B 2CDFB 3ULVF 2AK4B 2C4FT 4F2MB 4O58H 5IT2H 4L4VA 4HFUH 2NW2A 3HFMH 4MA8H 1S7XA 4ODHL 4LVHB 2E9IA 1FNEA 5DD1H 3VDBA 4F58L 3B5HA 1KPRA 2W60A 1TJHL 3CDFA 5ACZA 4HV8A 1RI8A 1UM4L 1EEQA 1INQB 2Z8RA 3K8KA 4QRQA 3ARFA 2OQJB 4R3SB 3T1WA 1EUUA 2ZNWA 5HGDA 2CJUH 5ETUA 2FGWH 1WEJH 3RVWC 3ZTNL 5INCB 1GOGA 3F58H 1Q8MA 1M7XA 2R0KL 3V6BR 1K4DA 4KKCD 3VWJB 4G3YH 5T5NF 2GTWB 4U1LA 1TTUA 1G7LA 2FX9H 1IFHL 4GW1A 4PJ7E 3FB8B 5F9OL 4Z18A 1RUMH 1MCDA 3FL7A 3M17B 4JPWL 4P2OB 2J6EL 2FHFA 1OQXA 3NFNB 4LMQE 1T1XA 3ARDD 2Q87A 4M1GL 4ZFOB 1HCVA 3T1FB 2YWYA 4WW2C 3L3JA 4XMLL 4U3XA 4LBEB 4X7CC 5FB8B 3LQMA 2PYEA 1N6VA 1RIUH 4KJQD 5JXED 1IGCL 5DK3A 1M7IA 4P2CG 2F74A 2GSIA 3SGEI 3FB5B 4NKIL 1MCNA 4KDWA 3KXFA 4JEGB 2R23A 3RWFB 2K9UA 3SJVA 3ET9F 4G6AC 5KSUA 4YPJA 5HHQB 3FB6B 1DQJB 5ID1A 5FYKD 1FL6B 4QXUH 2W65B 1MHPL 2PTTB 1ZLUH 2MCPH 3O4LD 2R9HD 3BYYA 4EDXA 3MXWL 4J3OC 1XAUA 1NUFA 3QG6B 2P4AB 4H0GA 3LHPH 1XIWD 1I1AC 4KHTL 1TQCC 1FZMB 5J1AA 2DI8A 1KFAL 3K2MC 3UTZA 3RIFF 4HUUB 3EHBC 4L9LA 3WFCL 4WUKL 2FYYA 2DWDB 2LE9A 4R6UA 2AK1L 1KXVC 4XP6L 3MR9B 3QIWA 5JIHA 2IANB 5I9QB 4LSTH 4M6OL 2YK1L 3VD3A 5B4MC 1NLBH 1MI5B 4Y4HB 3GRWA 3MRKB 4DN3H 3TJHD 1D5MA 1I9IL 3VCLA 1GHFL 4ONHA 4XCCL 4M7JL 3H6JA 1JZ2A 1MWAL 3IDMB 1FFNB 4LDEB 2MWCA 1XF3A 2P42B 4FOMA 5E8NA 2Z31C 5ITFB 2D31B 5E8EA 5J3HD 1OHQA 3LPFA 5K9QG 2BFVL 1WV7T 4ZYKA 4Q6IA 1CDBA 4GXUN 1T04B 4GAGL 3NA9H 1FV1B 3TH2T 4KMTL 4X5WA 4JM4L 2QQLL 1BBJA 5ICZA 1SEBA 2ZUQC 5GS1C 3QDJA 2F8XC 5IKCA 3WNPA 4LQFL 4WI9A 4OZIB 4U6XB 3RUGE 5EIQA 1TDQA 3PWPA 5EBMB 3O9WD 1KCRL 2AV7B 3CFDB 1TQBC 4N8CL 3TVMA 5HY9A 4DQOH 4FFVD 3SCMA 4PJXA 2Q6WA 5K9KB 2G75B 2M26A 1ED3B 2ZG3A 3ARFC 3MQIA 4I48A 1HYRC 1F58H 5HVGB 3PWVB 5D7JD 2HAZA 2CRZA 3O11B 3FKUS 4G6FD 4UU9B 3ARDB 2VXSH 2F5AH 4IJ3B 3P30H 1HHIB 3VJ6B 5C0ND 4HCRA 2HYMA 3LS4L 15C8L 3INUL 5F1NB 4JR9H 1TZIB 1J0KA 5HI5C 2R1XA 2EDTA 4NUGL 1WT5A 3RY4A 1HH9A 2R2BA 3ARBA 1P6AB 3N50A 5DWUH 5DJ6B 4CN4A 4KJWD 3GJEA 4QWWD 3ZE1E 3C60A 3QQ4B 3IAQA 1SJHB 5B22A 5E7BA 2QR0B 4Y4HC 2DLFL 5DEGA 5JDJA 1RULH 5D2NC 5KSBF 4FQJH 3O4LB 2DQIH 3MCKB 1YMMA 4XBGB 5E8DH 4LP5A 4O58L 1F4WH 5IT2L 1ZXQA 1MY5A 3Q5TA 3JWDH 1J05B 5GS3A 4CJ0A 4HFUL 4ZTOL 4W4NA 4MA8L 2H2PD 3EO0A 5A3ID 5F3HA 5CD3B 1IGJB 4ORZC 1S8DA 1RUPH 3QCVH 2J8UA 1P84J 2YA2A 2BVPB 2AJZB 1XCQB 2R56H 2WWMD 4XNUH 2VLKA 1VADB 2UUDH 5DZNA 4ZO7A 4X4XA 4GJTB 4ZUWB 5ITBH 1LD9B 1DBBH 5DR5H 1U8QA 3PWNB 4WUUE 3IB4A 3PV6B 2CJUL 2X4RB 4QO1A 4OZHE 4R2GC 2FGWL 4HJ0D 1T1ZA 1WEJL 1GZQB 1BOYA 2C3HA 3QIWC 5JR1L 2YRPA 4AM0B 4JFOB 1DQTA 4KKCC 1NFDE 4G3YL 3ZT5A 3HNVH 4W81A 2FX9L 1QQDB 4OJFL 5F8RC 3T4YB 2QQKH 3WDJA 4PRHE 2D2OA 5SWZA 3REVB 3HZMA 4OCYH 1NC4A 3L3IA 3VFUB 1D5IH 1RUQH 1GAFH 4O2CA 5I17B 4M7KH 1ZLWH 3NH7H 2YEZB 4GRLD 1HH6B 3O9WB 2Y1VA 3FRUB 5DMGC 4HUWA 1ZA3A 2X4SB 2V5RA 1YPZE 1YDPB 5J9PA 4JFXB 4XB7A 5GJTL 4POYA 4PJEE 5E08H 4K7PX 1GC1L 3MLPA 1T03L 5E2JA 3O2VH 5ALCH 4S2SB 3W2DH 2B4CC 5D93B 4OKVA 2OR9H 3DRTB 4G8EA 3MRPA 2D7OA 4HZLB 1DBAH 5DFWH 4K8RH 4G42A 3RWCA 5D8JH 3SGDH 4Z77A 1L7IH 2ZCLH 5D7JB 4QXUL 4Z76B 3OX8A 1P7HL 4G8FB 3VXME 1QEWA 2MCPL 1EXUB 2R9HC 4G6FB 4EUPB 3TVMC 3AB0B 2BNQE 5JQHC 3BT2L 4KTEH 3ERYA 4N9GA 2VDMH 3LHPL 1XIWC 3CX5J 3SCMC 4TNVK 1TXKA 4JAMA 4Y1AE 5D1QD 1S7TA 2BDNH 3PP4H 4I3RH 4V1DD 1BVKB 1QLRA 3NIFF 5SX4H 3NPSB 1OM3H 1FORH 1D5ZA 4ZOEA 3U4EA 2D9QB 1DUYB 4LGPB 5JQ6L 3TFKA 2EC8A 4LSTL 4PJBE 3SKOA 4BM7A 1LP9E 2YBRA 5HYJE 3T2PA 2E8YA 2VKXA 3V6FA 3NCFB 4X80H 4DN3L 4FG6D 4BQ9A 5BV7C 4K94H 3SKNB 1WT5C 2Z8VC 5EZLB 4XPGH 1ZHNA 4WV1A 5MEOA 5GRUH 3K4AA 5HPMA 4QRRA 5CGMA 2XIDA 4TVPD 2PXYA 3OB8A 1KN2H 1Q94B 1S5HA 3KPSA 2FJFB 2JJSA 3MRDB 1GPOH 3NA9L 5IW6A 3HLAB 1OGTB 4OZFB 4YHKL 1CLZH 5I73C 3BVNA 1RHHB 3WMSA 4N90D 2X6MA 1EA9C 4F33B 2AV1B 4LSUH 5IHUH 4OLZH 4FQ2L 5C0BA 1JYXA 3B6SB 3C8HA 4HMCA 2YKLH 3N1MC 5HVHB 1FVCB 3FO1A 1X3DA 4OZGF 4DQOL 2GEEA 2I9TB 3L7EB 1PG7W 4WU7B 5DMIH 3CMOH 1LO2H 3NCJH 2H8PB 4OFIA 5AEAA 1I3RA 4PPTA 1NDMB 2HRPH 4NC1E 1ETZA 2KKQA 3TO4D 5AYUH 1F58L 1KB9K 4YGAB 3SDXE 3TBWA 1EAPA 3C2AL 2DYPD 2F5AL 4B5EA 4JGUA 1BBDL 4ODTH 3P30L 3AAZB 4MDJA 4WNQB 2XA8H 4GRLB 5DJDA 3PQYA 5IMKA 5EZJA 3V0VB 5T1MA 1TNMA 5LG1A 2ZNXA 3P4OB 5TJWK 5KVDH 3VXNB 2P5WB 3QIUA 1KG0B 2LAAA 5DWUL 4R8WH 3LDBC 3T77B 1E6OH 4KJWC 1U8IB 4TQEH 5IWLA 5CHNB 4OI9A 2N56A 4YDKH 1FZOB 1XGRA 5I1HH 5D9SB 5GS0H 3UMTA 1RULL 3T8XA 4QXGH 4FQJL 5ACMA 2DQIL 3U46A 5E8DL 3UTSA 4CVZA 3U1SH 1N7MH 4XX1G 3DECA 2XI9A 1E4XI 5E8PA 1M05B 5GHWH 5D1QB 4WEBH 5F6IC 5B38G 4DWHA 1FL5B 3C5JA 4V1DB 3VFTA 1RUPL 2GIYA 4MD0B 4LL9A 1YN6A 4U6VL 4K2UH 2A9NH 3ULUE 3L3HA 4XNUL 5CEYB 2QJDA 5D1ZD 4ORGB 1CXHA 5B21A 4K3JH 12E8H 5ITBL 1RV6X 5T1LA 2BVUA 4XBEH 3X3FL 4O4YH 1DQLH 3EJZC 5CEZD 3TCLB 2X70A 2W0LA 5GPRA 4HJ0C 2DWEA 4Y4FD 2ZP0T 2ZWLT 1TETL 5ID0A 4GAYA 4ELMB 1V05A 3B5TA 2ZKHL 1H3PL 4XVSH 3NVQA 2CKBH 2W0PA 3OAYK 4GKSA 3HNVL 4LCWE 3OF6D 4FTVE 1PSKH 5EB9A 2F54A 3CFIC 4UDTB 2QQKL 3B2UC 4OZ4A 3F12A 4I9WD 4G9FB 4NYLA 1V3JA 1YZZA 3JBG7 3PWUB 3IYLW 4OCNC 2BSED 1FNHA 2RJMA 4WV1C 1RUQL 1GAFL 1BJMA 4M7KL 2O61B 3NH7L 5DZOA 2PXYC 1AGDA 4OLWL 5C08E 3L1OH 3AMLA 3IFLL 1KC5H 3BH8B 3MLWH 5IM7B 1YEGH 1A6TB 3O4OB 4XVUD 1UH2A 4ZXBC 4PJDA 3O2VL 3MRLA 3W2DL 4MA1C 2OR9L 2EYTA 3FQUA 4WO4D 1VA9A 5BVJA 1DBAL 1LEGB 4HBQA 4RAUB 5D8JL 3TO4B 1L7IL 4KAQH 3ESUF 3WE6A 5JHLH 2HMIC 5ICXA 2FDBP 5KS9F 4QHKI 3BZFB 3DSFH 1U8MB 3G6AB 3K8LA 1NGQH 2B2XH 2DYPB 4JFQB 4ETQA 1A4JA 1T5WB 2AP2A 4KTEL 1NANH 4N8VB 4XNMB 2VDML 3F6IA 1DBKH 2JB5L 3UTPD 2BDNL 3PP4L 4I3RL 4Z7UB 2XACC 1OM3L 2VTFA 4PJHE 3ULVC 1EJOH 3G04B 4X99A 5F1OB 4PGDA 5C0EA 2Q8AH 2DM7A 1J87A 5FAAA 2CXGA 4U0QB 1AD9A 1AE6H 1VKXB 5HD8C 1L0XA 4G6JH 1BEYH 4UQ3A 1DLHA 5T1DH 5B8CA 4X80L 1QRNE 1MJJB 2X1QA 4BUGA 4PJ9A 1KNOB 2BVEA 3ARGD 4ZUTA 3VG0H 1MIMH 4K94L 5DQ9A 4AENA 5D1XA 4PG9B 4ZPVB 3OAZH 4XPGL 3VXUE 5D6DA 3UTTD 3S97C 1UB6A 5GRUL 2P5ED 2X4NA 3WLWD 1KN2L 3O6FD 3HC0A 4MMZC 5FUOL 3LRSB 4G8GE 4WI5A 1GPOL 5EDXA 4PGEA 3CZJA 5A40E 3WUWA 1JZ6A 5IFJA 4NP4H 2A6KB 3N1PC 4BFIB 3HE7A 2HVJB 4AIZA 1H8OA 1U42A 3RNKB 2RBLA 1NL0L 1P4IH 3CFKB 5I15H 1XGUB 4P99A 5FYJH 1JI2A 1KJ2A 3GSVA 4NFCA 5IHUL 4OLZL 3TZVA 1E28B 5HJ3B 4X0KB 1YJDL 1PX3A 1TZGL 3QNYA 5F7LB 5HXMA 3T3MF 4Y4FB 4G9DB 1XF4A 3NBNA 3V4UH 2CPCA 4EI5A 5C0IA 2MHAA 3CMOL 5DJ2A 1RJYA 1RU9H 4PRPE 3KVQA 3FO2B 1Z9MA 1OPGH 3MLVH 3TO4C 2E5EA 3RIAF 5GSRA 4LCCB 3VFOA 1IAII 4NQEE 4DUXA 3MLTB 3MCG1 1SHMA 3S5LA 1OGAE 3ROOB 3RI5F 1EAJA 3OMZA 1LNUB 2PYFB 2H26A 2OI9A 4S0SD 2DQFA 3QEUA 3DUUA 2XA8L 1Q0XH 1SBSH 4NPYB 4WHYH 2DI7A 5DJZA 4NKMB 4RFOL 5FDWB 3TPUA 4XCYB 2EIZA 1VB9A 1FFQA 3OZ9H 2NW3B 1YNTB 1QSFD 1U8LA 5JLZB 1FGNH 5KVDL 3ZT6A 3WCYA 3HMWH 4FRWA 1E6OL 1KPVA 1O7VA 4J3WA 2NXYD 3EYFA 3ZE2F 4DCQB 2AEPL 5ALBH 4TQEL 4YHNB 4WO4B 5I1HL 5GS0L 1YMHA 2AKRB 3M1BB 1IGYB 4QXGL 4EUPG 3RZWA 2E8ZA 3HS0B 4PJFB 3B9KA 1DN0B 1FNGA 1T0NB 3U1SL 1A7NH 2QADC 4IDJH 4DEPC 4JE4B 4A6YA 2HFFB 1L8JA 2VZOA 5GHWL 4WEBL 3D2UA 5JOEA 1CXEA 4MD5B 4JQXA 3B5GA 5E2WH 3EOAB 1ZT1B 4ZNEE 1UQSB 1U8KB 3EFFA 5IW3A 5TGBB 4NRYA 3FQNA 2WWKT 4K2UL 2A9NL 4HKXB 4NOBA 2ZOKA 3FOMA 1FP5A 3GMPB 5D1ZC 1N3NA 4LHJB 1FVEB 3WNMA 3AREA 1Q9KB 4U6HB 1PKQA 12E8L 2IMMA 1KEMH 2VKWA 3OQ3B 4O02H 5SV3A 5DEFA 4O4YL 1DQLL 3TEUA 3QPXH 4PJCB 5DRWA 4LARH 1F6LL 2Z92B 5H94B 2XV6B 1MWAB 3ARGB 2BRQA 2P24B 5CJXA 4RGOH 5DF0A 4EDWH 4J1UB 4Y4FC 5EC1A 3FFDA 4PS4H 4JFYA 1JUFA 3UTTB 1ZHBA 2FX7H 5IMLA 1IKNA 1FG2A 1R3HA 5FKPB 2P5EB 3DTXB 3QEQD 1ROWA 1QSEA 5GZOD 3DBXA 3CC5B 1I8KA 2CKBL 2CDEA 3O6FB 5C0AD 1A6WH 3E1F1 2CK0H 1T1YA 3QHTC 4X7TB 1PSKL 1XMWA 5ANMA 4U1JB 5HHOA 4LCCC 5D2LE 4ZODA 4QNPF 4OV5A 3OR6B 4APQC 2ZSWB 3EGSA 4X6DB 4AQOA 1P5UA 4XMKL 5D6DC 3VD7A 4XT1C 4MVBD 4ELKA 5DSCB 1FPTH 2HKHH 3KNBB 1RIHH 3CVHH 3QPQD 3BZEB 4QY8A 4PJIB 3L1OL 2F19H 4JFDA 4LLDA 3ZDYF 1KC5L 1MCWM 4IEFB 5D5ME 2ZOLB 2NY1D 5EULV 4LLYB 3MLWL 2BC4A 5EOQL 1IARB 3JSSA 1TTGA 3TBYA 2BY2A 5EOCH 5GGSB 5K93A 5DJ8B 3HB3C 1GZPB 1RZ8B 4MXVE 4IRJA 4KAQL 5GQBA 3DYMA 4OQ1A 4JCMA 5MEPB 4ALAH 4OUUB 1C16A 3DSFL 4PJGB 1ZOXA 4H5SB 3WDHA 4CMHC 2B2XL 7CGTA 4KQ3H 1ZV5A 1WGOA 4N5UA 5E2TH 3OKKA 4IBLT 1LE9B 1TCMA 3KLAB 1TTFA 2MKWA 5T5FH 3NABH 4NZTH 5E99H 3S35L 3BE1H 1EJOL 1QSFB 4TTDD 3JWOL 2Q8AL 4U0RC 5C0DA 2BNRE 3WJJA 1U92A 4NQXA 5FCUH 2FCBA 1AE6L 3GZKA 2NXYB 4HIXH 4ZS7L 3EYSH 5E6ID 4G6JL 1BEYL 4EBQL 5T1DL 5F6HJ 4Z7WE 5DD6A 1R3KA 3VG0L 3GM0A 1MIML 4O2EB 1FLTX 1JE6A 3ILQD 4NNXA 3J7HA 3KPRE 3ULUH 2PCPB 3B8YA 1RJLA 1AXIB 2E7BA 2VQ1A 3W0WE 1Q0YH 3WLWC 2NY2D 3OAYH 5FF6A 3QJHA 5DTFB 5CKGA 3FO0H 2X1XR 4R96B 2Y07L 3IF1B 1KTLA 4QRPE 2VC2H 5D4QA 5DJ0B 3ILPA 4NP4L 3FQWB 1MHHA 4I4WA 4QRUA 4OLYH 1P4IL 5C8JA 5HHXH 3SPVB 2JJVA 3ARTA 5I15L 5FYJL 3JV0A 3H7LA 2GITB 3WNNA 3PJSA 4XB8A 3DRQB 3MYJA 4XVTH 1SYVA 2CUHA 3IDJA 3H9HB 2DTML 2OTUB 4P2RD 3QEQB 4UINL 2OL3A 5BZWB 2APVA 1X5LA 4GQPH 5C0AB 1BLNB 1MCPH 4YDIH 3EO1A 1RHFA 1RU9L 3K7UA 4EXPX 5I8OH 1OPGL 4XNYH 2VR4A 4C4KT 3MLVL 1CFTB 5D7IE 1P9MA 2FHCA 4XP4H 4HWZB 4CW1A 1OAXH 1Z3GH 1NQBA 4BJLA 1IKNC 4JFED 2BNUB 1Q0XL 3O45B 2FEDD 4FFWC 2V2XA 2GAZA 5GIRB 3OZ9L 4XVJH 1FGNL 4XAKE 2HRLA 5HYQA 5J7CC 3L9RA 4KRPB 4OF0A 4URTB 1RURL 5ALBL 2EKSA 1T7YA 4JHBA 4ODUA 3X17A 1NAMH 1LK3H 3AY4A 4WU5B 4Z0BH 4N8VG 1ADQH 1QBAA 1A7NL 3HAEA 5F89A 4IDJL 5FYLE 3HNSH 3STZB 2AJYL 5D96B 2X4UB 2Y6SD 4GMTH 5E2WL 4ODXB 3VXSA 2OR8A 1Q72H 3QFDA 3O3DB 1B88A 4KK9D 4L4TE 1JMZA 5F7YC 1IJ9A 1YUHB 3VH8A 3ZTJH 2QSVA 4OF7A 3MOAH 1ZGLP 3LKOB 2NYYC 2EH7H 5DFVD 5E6IB 1KJVB 1WWAX 1BD2A 3L5IA 3MRBB 4O02L 3LQAH 2MSPA 3QPXL 4LARL 1B4JH 2AK4A 4F2MA 5JUEL 4PGBB 4RGOL 4PJ5D 4EDWL 1EGJH 3IVKB 3B3IB 3WXWH 3MRCB 4U2YA 5EFIB 3L3GB 4PS4L 5GGQH 2CLRB 2FX7L 1CFSB 3WJJC 2G2RA 5I2IB 4RWYH 3PXHA 3RVUD 1A5FH 2NY2B 1NEZB 1NBYB 2F53D 5JA9A 5CCKH 4X5XB 1A6WL 1NFDF 2CK0L 1G1CA 5KS9A 1MJ8H 4C56A 4U1KB 5DRXA 4U6YA 3SDDA 5IHBA 1YEJH 5C86A 3QUMA 3NA4A 5FGCE 3DX7A 3MBXH 3TH3T 2OQJA 5MENE 1JWSA 1G9ML 4OFYD 1FPTL 2HKHL 2NY0D 3C5ZC 1RIHL 3MV7D 3EJYD 3CVHL 3JV5A 1DUZB 5INCA 1LE5B 3PHOB 4GMSH 3VMOA 5F70A 5JA8B 2GSGB 2NY1C 4P2RB 2MJWA 3QEGL 2GTWA 2PTVA 4XP5H 1W72H 3HI1B 5GS2H 4K8RD 4DZBB 1IRAY 3Q6GH 2VDOL 1A1OA 1DANT 3M17A 4P2OA 4WCYH 3NFNA 4ALAL 1VFAB 1WJ3A 2FL5B 3GBNL 4Y5YA 1ORSA 2AQ1A 1P6FA 2NQCA 3GKZA 4FQXA 3MSPA 3BPLC 1UG9A 3TO2A 3T1FA 4KMLB 3BRDA 4KQ3L 4L8DB 5E2TL 5FB8A 5KSVB 4JFEB 1HHJB 4ESKA 2AJ3B 2XTJC 3DMMD 3IU4L 4Y4KD 5T5FL 1EDQA 3NABL 2FD6H 4XXCC 1R3JA 3V6OA 3ZO0A 4DGIH 4PTTB 4MNHB 3FB5A 5DDHA 3FOLB 1FNFA 1QR1B 4KI5F 4DOHE 1HXMB 4RMVA 1P9MC 2X4PA 2G5BA 4LOUD 5CIPB 5GRXG 2P8LB 5HHQA 3B2VH 4PJBF 2X44D 4HIXL 2EDQA 2QHRH 3EYSL 3V7AE 1DQJA 1FL6A 4ZO6A 2W65A 3EFDH 4MS8D 2PTTA 2LAGB 3NACH 1AQDB 1YEEL 3I6GB 3QDGE 2EO1A 2UYLB 3W82A 4HXBH 1MLBB 2CRYA 1P1ZA 2HA1A 2W9LA 4HUUA 4KVCH 4R0LB 5IVXE 1DFBH 2VXQH 2DWDA 3AY4C 2IANA 3FO0L 4QHMB 4PLJC 1Y0LB 1HSBB 1NCUA 4EN3D 3S96A 2Q86A 1MI5A 4OLYL 1FFPA 5HHXL 4YAQA 5J11B 1CF8H 4WJ5B 5E9DE 1YQVH 4PJ5B 1CBVH 4XVTL 2YMXH 4WWID 4OAWA 5ITFA 3OKDB 5J12B 5CILH 2Z8SA 2F53B 1VFUA 4JO4H 1T04A 4JO3H 4QGYA 4I1NB 5I8OL 4XNYL 1WZ1H 2X4TB 4XP4L 4YHOH 3G6JB 4KUCF 1OAXL 1S78D 1G7HB 1Z3GL 5F21B 3T0EE 2JE8A 4U6XA 1U8OB 4OZIA 2EEDA 5BZDA 4HHAB 1U3HD 4JHWH 2AV7A 4J12A 3MUY1 2HWZH 2NY0B 3MV7B 4LRIA 4M7LH 5TE4H 1FE8H 5FM5M 4ZO8A 4NQCE 4N8PA 3SDDC 5FA3B 2E6QA 4XVJL 5LAXA 1ZTXH 5IHZA 3MNZB 5K9KA 3S34H 2VLJE 2G75A 1ED3A 3L6FA 5DC0A 4JRYE 1NKOA 3PWVA 4YHLH 1NAML 4BUHA 1LK3L 2JKXA 1NGPH 4PP2A 3CK0H 5JDSB 1T3FB 1KB9J 1BOGB 4UOW1 2DS4A 1ADQL 1HHIA 3FRPA 3VJ6A 3MPCA 1MFEL 1XR8A 4HIEB 4GRWE 4IMLB 4GW5A 3ARSA 3D85A 4UNUA 4Z7QE 2I07B 1TZIA 4HMDA 3DMMB 4H1LH 3RJDA 4Y4KB 1VEPA 1C1EH 3WEXB 4OGAC 1KYOK 3BKYH 3CDGB 4GMTL 4LVNC 1IVLA 1Q72L 1M71B 4Y5YC 3QQ4A 1SJHA 3MOAL 4FQXC 4Y2DA 3ZSTA 3AFLA 4H8WL 4FQ1H 1KXTB 1RSFA 5ADOL 3LQAL 3O4LA 1UJ3B 4FQQB 1B4JL 1CGUA 3OAUH 4XBGA 1AGEB 2HTLC 1PAMA 1J1PH 5SX5H 2R8SL 3QRGH 4XCEA 2A1WH 3WXWL 3HR5A 5GGQL 4KQ4H 1S7SB 2UV3A 1ES0A 2JCCF 3S3PA 1JNLH 2WQRA 3Q0HA 4JJHA 2A38A 2BVPA 3SY0B 5CCKL 3UJIH 1XCQA 4J4PA 1MJ8L 2HLFC 2YN5A 1VADA 4LPYA 2GFBB 5T3ZH 4M93B 4YPGB 4NJAH 1MCOH 1YEJL 2Y5TB 4EN3B 2FGZA 4HC1H 4ZUWA 4WGVB 4ONGH 2EDJA 3MBXL 1FFOB 3DLQR 3KYMB 5F9JB 1FLRH 3TJHA 2A74B 5D71H 5FV2A 3CFBA 3UBXA 3RKDC 1PZ5A 4ENED 1I7RB 1IC5H 4PJ7B 1GZQA 3FN3A 3OKOB 1BQUA 3W9EB 5BS0A 4GMSL 1LEIA 3F7YA 4PLKD 3TWCH 1CGWA 2VAJA 5C0CA 4IDLA 2Q3AA 4LGSB 2KPNA 4JFOA 4LPCA 3LOWA 4YC2B 4N0FA 4XP5L 1W72L 1QQDA 4P2QA 4M9OA 3Q6GL 1FHGA 3T4YA 1HN1A 4WCYL 1WWBX 4WWKD 4X6CF 5K9JH 4J3UA 1GOHA 1WC7B 4HWBH 1D6EB 1MELA 3ZKQD 5I17A 3BQUA 3MJ9H 3G5VB 2YEZA 1U3HB 4I0PD 3O9WA 1N0XL 4WTZA 3FRUA 1BX2B 3BO8A 2X4SA 4N0YL 3RWIB 6CGTA 1YDPA 4HIHB 2FD6L 3S88H 1L0QA 4DGIL 4JFXA 1DZBA 3F7VB 5DMJB 4FMKA 4PY8J 2IMNA 1VESA 4LOUC 4LVEA 1WUNT 2CRIA 1CD0A 1HSAB 1GGYA 3F7RA 4HZLA 1CXIA 1NGYA 3B2VL 4KTYA 4KJPD 2A83A 2QHRL 1UCTA 2DQHH 2IQ9H 4CJ1A 3X13B 4KDTA 5D7JA 3EFDL 4G8FA 3NACL 1EXUA 1XF2B 4LRIC 3GJFK 4GFTB 1X5GA 3VRJA 3C9NB 4FQHB 4S0UC 5GRZA 1KF9B 4HXBL 3STBA 5CWSA 5I8KL 4GUPB 1BVKA 4X83A 4KVCL 4R26H 4JY5H 4JO1H 4WUUD 1DFBL 3SDAD 2VXQL 4HIIA 5I18H 1PX4A 5IBLC 3MMEB 4DKDC 2CUMA 1MCHA 3V0AC 2ICES 3OJVC 4V2BA 2EICA 1RK1A 2YD2A 4X8JA 5BXFB 1A7RH 3UROR 3QYCA 2BHZA 2YHGA 4Q0XH 2Y5EA 1CF8L 1KLGA 1YYMH 3QQ3B 5EZLA 1T5XA 1MJUH 4PRHD 1KELH 2YMXL 4OIBA 1JBJA 2AJUL 1OL0A 1S7QB 4L8SB 2MNUA 2CKBB 1NEZG 5CILL 4YC2C 5C7XL 3VFGL 4X7FC 5J6HB 2FJFA 3RUGB 3BRFA 4Y2DC 3WFDH 3MRMB 2V2TB 3BP7B 4JO3L 4JO4L 3HLAA 4EJ1C 4OZFA 2FJGB 2NNAB 3VFRB 1WZ1L 1X9QA 4BZYA 3CJJA 2I5YH 4YHOL 5DXWA 1S78C 1C12A 4F33A 5E5UB 1AR1C 1CDHA 4W6WB 3IXTB 3FONB 1U3HC 4E5XB 1I7ZB 3B6SA 4JHWL 2FLRT 5BOPA 2HWZL 3CVIH 3TA3D 1FVCA 3BP6B 4M7LL 1DL7H 4CVXB 1IGFH 4G7VH 4J4PC 3VXMD 1A7PL 3L7EA 4MYWB 5ENWA 1ZTXL 4R4ND 3FQRB 2BNQD 3S34L 2H8PA 1JGDB 1WAAE 3WUZA 3WIHA 1G6RH 1NDMA 2PKDA 1VENA 2ZCHH 2EIDA 4Y1AD 3GI8H 4WWKB 4YHLL 1NGPL 2QLVB 3CK0L 4JKKA 3OKMB 1L9MA 1GGUA 3E6HB 4MQ7B 2VXTH 2R0ZH 4HH8A 1BJ1J 1SJVA 1NBQA 3AAZA 2WINB 4I0PB 5BO1H 1AD0A 3BUTA 3NZ8B 4QT5B 2H9GB 1DBML 5HYJD 4MA7L 5DZLA 4OT1H 1A64A 1TPXB 2UZIH 3R1GH 3BKYL 3P4OA 3W9DA 4HPYH 4N68A 1VEMA 2VWEC 1UENA 2P5WA 1KG0A 4F9PC 5EUOE 1BZQK 2PETA 3T77A 1AGFA 4JJ5B 1CVSC 2IPUG 5CHNA 1FZOA 2EH8H 5IP4A 3QT2A 3BQUC 1CU4H 1SJEA 2P48B 4UV7H 4FQ1L 4X7EC 3U30B 4WFHE 5DHVA 2DAVA 3OAUL 4XPAH 3ARQA 1C5BH 5E1AB 5AWNH 4GXVL 1J1PL 3QRGL 2A1WL 3LMJH 5HDLA 2MFNA 5L8JB 1ZGLB 4XPFL 3FCTB 4KQ4L 1FL5A 3W11D 4BSJA 1E4XH 1KIUA 1JNLL 2W91A 4U1NA 2IAMA 4WUUB 1S9XB 3P9LA 3SDAB 1Z0NA 3UJIL 4NIKB 2ARJB 2WV3A 1SY6A 2J4WL 4J8RB 4OZHB 4U1HB 4IHOA 5T3ZL 4ORGA 4NJAL 4AZ8A 1MCOL 4KK5D 4DUVA 4GG6E 3FTGA 5DHYA 4HC1L 2BVYA 4WY7H 1KPUB 4ONGL 2VZ3A 4GKOA 1FLRL 1YEIH 3VGEA 3H9SE 3LV3B 2OX5A 3OB0K 4P4KC 3O2DH 3SO3B 4PR5A 4KZDL 3WFZA 1KCKA 5C0GB 1UJTA 3KS0J 4LLVA 4PRHB 4IMKC 5EU6B 5CJ5A 3T3PE 5DJCB 4ELMA 3H42H 5AZEH 4PLKC 3CCHA 1CFVH 3QUKB 5KVMC 4L4VE 3DVFA 3P77B 4UDTA 1S7UB 4WWKC 1FAIH 4G9FA 1DN2A 3SE4A 3ES6A 3PWUA 1YPZB 1PY4A 4HWBL 2APTA 4UILH 2D7NA 2R1YA 3GHBH 4K7PH 4PJEB 3FT2B 3MNVB 3GMNA 3MJ9L 3U7YH 4JFPB 5DLMH 3UO1L 1II4E 2O61A 5ICYB 3BEVB 2V5SA 4ZUSA 4NNPH 5L2JB 3TA3B 2FBOJ 4KRNA 3A6OA 5DA4A 1NFIA 4PRAB 3S88L 2YSSB 5GGTH 3VXMB 3BH8A 4YFDB 1JK8B 1A6TA 4I0KA 4ODVL 1CL7I 3V52H 3TIEB 3DROB 3B8SA 2DQHL 2IQ9L 1LO3H 4Y1AB 2XQBH 3IS0X 5LJYH 3JUYA 2Y9RT 2G9HA 3G5XB 3WFBH 1MPAL 2OTPA 5IQ9B 1U8MA 3HMXH 5E00B 5I30L 5CEXB 2DQDH 1T5WA 2ADJB 3LEYH 4NQSA 3VXTB 3ULUD 2CK2A 5EBWB 2PR4H 3EYQD 4G5ZH 1LP9B 2P8PB 2EDXA 1EO8H 5HYJB 1G0XA 2DQTH 4K07A 4IIQA 4R26L 3G04A 1U58B 2NR6C 2OS7A 3MC0A 5I18L 4F7CA 3BPOB 5D2NE 3TBVA 2PYEE 3MRHB 3PDOB 2DLIA 5FO8B 3WFEH 3BGFB 4M43H 4XPBH 4F7EB 1B90A 1A7RL 1LDSA 1NFKA 4I13B 1ORQA 1IM9B 3KXFE 3SKUD 1KNOA 5DJYB 4H26A 2OR7A 3SJVE 2HJLB 4Q0XL 5KOMC 3QIBA 4LCWD 1CQKA 1DDHA 3DV6B 4FMFA 4PG9A 4ZPVA 1MJUL 1KELL 2IGFH 5E24E 4PRIA 4GS7C 1F5WA 3EDEA 3GI9H 4OD1H 3WFDL 4JRXE 5I0ZA 5AD0B 3QXAA 3GBLA 4NCDA 5CBEA 3AM8C 5C08D 5F9AC 2HVJA 1ZLSH 2HKFH 2I5YL 4N9OB 3RNKA 1LEKB 2X4OA 3CFKA 3HG1B 2OZ4H 2YD3A 4UIMA 4DAGL 1H9VA 2JJTA 4KXZI 1E28A 2Z8WC 3CVHB 5HJ3A 3V7MA 1JHTB 3CVIL 4KKBD 1CDGA 3LN9A 2IAMC 1DL7L 1IGFL 1U2HA 4OD3L 4PGJA 4G7VL 4WI7A 4G9DA 3DETD 5I1IH 3SDXB 4L1DA 1FNAA 4LLQB 4P3CL 1FSKC 1ZS8B 5EZIH 2J6EA 5INDB 5TDPA 3HE6D 1SJXA 1QG3A 3GI8L 3SDCD 3MLTA 1JYWA 5LBSH 4KI5C 1HQ4B 1N6UA 3ROOA 4KJYA 1IAIH 4YO0B 1LNUA 2VXTL 2R0ZL 2JCCA 5TDOB 1KBGH 3DO3A 3D1MC 3MLZH 4XWOC 3K1DA 3QDJE 5FDWA 3NIDF 4OTXH 4XCYA 2UZIL 3R1GL 2NW3A 1QRND 1JPST 5L2KE 3HPJB 1YNTA 3SBWC 3MRRA 4HPYL 4Q6YA 3PWPE 3BUYB 3SE4C 2APWA 4DCQA 3UJTH 1HCFX 4MX7A 4P46D 1DQQB 1TZHB 3VXUD 1OT1A 3ARYA 1JPGA 2EH8L 2IG2H 3MUZ1 2AKRA 4UV7L 3TT3H 3M1BA 4XAWH 2QSQA 4PD4K 1V3MA 4PJXE 3HS0A 4ERSH 4PJFA 4K3DH 4P23D 1DN0A 3V5KB 3IFPB 4U05A 4G8GD 1ZT4A 4I18B 4XPAL 1C5BL 3O3AB 5ECJE 5EO0A 5AWNL 4YX2L 5C6WH 3LMJL 4P5MB 1RD6A 3RA7H 3VFNB 2HFFA 5KAQF 3K2UH 1KJ2L 3H9ZA 2EC9T 3EOAA 1K8DA 1E4XL 1UQSA 1U8KA 1A6UH 2W0KA 1OAKL 5IB4A 3BXNB 3GMPA 3A6BH 5ESAB 5JOFA 4Y5XC 1BIIB 4FP8H 5KVGH 5CZVH 2DDQH 4PJCA 1AQKH 1YEIL 5FKAB 1MWAA 3ARGA 4HUVB 5GGRB 2E6PA 3CFJB 2P24A 3O2DL 4LCWB 4PRPD 4FTVB 5IR1B 4IIQC 4HS3B 5E5RB 1MHEB 4LSRH 2OSLB 4D9LH 3UTTA 4NQED 1J0HA 3H42L 2P5EA 5AZEL 1CFVL 1YMME 2XOTA 1OGAD 2JK5B 2R2HB 3CC5A 5GS2D 3SGJA 3O6FA 4I77L 4WTWA 1MQKL 4X7TA 5GZNC 5F7KC 4Y19A 2XFXA 3EW3B 3PDDA 2VDQH 3QIBC 5C08B 3OR6A 4QRTB 1QNZH 1UXWB 4X6DA 4UILL 4UOW0 5T3XL 1K2DB 3GHBL 4K7PL 3O2WL 2ZUTA 4XCFH 3U7YL 3I75B 1RZIB 4S1DC 5DLML 3KNBA 3MLXH 2WK2A 4NNPL 1NUDA 1U0QA 4JFFE 3RL2B 1EJ6A 3M45A 1IM3A 4PJIA 1Q9OB 5CSBA 4UT7H 1A3RH 2K7PA 4NKDA 4PYGA 5CUSL 3D25A 5CZXD 3OJ2C 3BN3B 3BP5B 4HBCH 4UDUA 3V52L 5KVFH 1NAMB 5DJ8A 5IVOA 1GZPA 4FQIH 1ACYH 3HE6B 2JJTC 2VL5B 5MEPA 2YPKA 4OI8A 2CIIA 4OUUA 5LWYH 3SDCB 2FH8A 4PJHB 3HMXL 4PJGA 2DQDL 4H5SA 5CKAA 4BA8A 4RFEA 5KTEH 3LEYL 4O9HH 4ZPTA 3E8UH 4PGCB 2N7BA 1WWCA 4PBWD 2PR4L 3RVTD 4N1EA 3MUHL 3KLAA 4G5ZL 2NY5C 5SWZE 1LHZA 1EO8L 43C9B 4JM2F 5M94B 3REWB 3LKNA 1BZ9A 1I9RL 4AT6B 4RMTA 1JZ4A 1QRNB 1O5DT 3MFFB 1U91A 4GW4A 4YUEH 1D9KA 4MB5A 4QCIA 5I71B 2Y36H 1S9YB 3WFEL 4P46B 3P2TA 2PUQT 2WW8A 3VXUB 5TQ2H 5ESQB 3TNMB 5CGYD 5LVEA 3VRLF 4M43L 4XPBL 1FGVL 2EZ0C 3LQZB 2EDOA 2KUTA 1V7MH 3V4PH 1BFSA 5EBLB 3OB0H 5I1EH 2EXYC 2X41A 4DKFL 4KVNH 4G8GB 2QSTA 1CE1H 4PJ8A 1S9VB 4L3EE 2PCPA 1ZHKB 2IGFL 4HUXB 4MSWB 4EEEA 4U1GB 4JKMA 3FZUC 4P49A 3GSQB 1AO7A 5DTFA 3GI9L 4OD1L 4GRMB 3DSNA 3VXPB 4JDZB 4R96A 2FB4H 5IEHB 3MRFB 4J3SA 5DJ0A 5L7XH 4QOKE 1ZLSL 5KZCD 4HS6A 3SPVA 2OZ4L 3IDUA 4GH7B 3UPAA 2E27H 2GITA 3RTQD 1PG7X 5J13C 1BWWA 1IMHC 4OLXH 3BWAB 4PRPB 2DOCA 4PRDB 3ALWA 4NQEB 4DGYH 2OTUA 1NMBH 3QEQA 4NZJA 1J9CT 1KENH 1OGAB 5BZWA 4BFBD 5C0AA 3BEWB 3IXAB 3RWJB 5FM4A 3HHRB 3TPKA 4QHNB 4LRNH 3Q6FB 4NO0A 3DUHA 2VR9A 1CFTA 1PBYA 1J18A 8CGTA 4AQ1B 1QYGH 4HWZA 1LWRA 2A6DB 3KPSE 5LBSL 1QFWH 1T22A 4QXTB 1IAIL 4MVBA 2WUBH 5CLTA 1EPFA 2BNRD 3VI4E 5I66B 1KBGL 2UZYB 1I8LC 3MLZL 3ZKND 3SGJC 1HHHB 4OTXL 3S98A 5F3BB 1OTUD 3H8NA 4XC3H 5LGJA 5C0BE 4D0BB 3EO9H 5FM5O 2QQNH 3U9UB 5JMOC 4GG8B 3KPNB 2J3SA 3ESVF 3FMGL 3UJTL 4FZEH 3W81A 3GSWB 3KPRD 3DV4B 3QUXD 4RISH 5I6XC 1U8PA 3C5SB 2MTPA 4G8IB 2IG2L 2V9TA 4LHUD 3TT3L 1R5WA 1K6QH 2HLAB 2NY3D 4XAWL 3W0WD 3VW3H 2VRAA 2FHBA 4ERSL 4K3DL 3MGOB 4P23C 4X4MA 5C0JB 3VFWA 3ULVE 3KPPB 4MWFB 4QRPD 3RA7L 3KJ4C 2WBJD 5EPMA 4ZOAA 3TNNB 3FT3B 3HZKB 4MGXA 2FATH 3OJDA 1OAYL 1A6UL 2VLME 1Q9LB 1XCTA 1MIEH 3O3DA 5E03A 1QBBA 1LO0H 4K55A 5CAYB 1YUHA 4BSWA 1IAMA 3QUYC 3A6BL 1NGZB 2VERN 1WVZA 4M7LT 5E6IA 1KJVA 4K7FB 3MRBA 2OYPA 4WIQA 4FP8L 4YLQT 4NFBA 5KVGL 5CZVL 1MRDH 2J5LB 1AQKL 4CN1A 3SQBA 3IETB 4PGBA 1I1FB 3QI9C 3IVKA 2K1MA 1KJMB 4RA0C 3ROLB 3MRCA 3KPQB 3EOBB 5EIIB 2XY1A 5D2LB 4D9LL 4N0UA 1CFSA 4QHKJ 3JV4B 4WHDA 3ZDXF 5LQBH 3UTSE 4JZOB 4Z7VF 3R06B 1AGBA 1W0WB 3SGDI 2VDQL 1I3GH 1U93B 1JF6A 2Z91A 4F15C 4OD2B 5EO9A 5FIEA 5KZCB 1MH5A 1QNZL 4PJ8C 5D5MB 4XAKD 5IB2A 5I16B 4DVRH 2BVOA 3NFPB 3RTQB 1E4KA 4TYUA 2XWJB 4PRNB 4YHMH 2NZ9D 4M02A 5JO5A 2NLJA 3PHOA 2X9WA 1LO4L 1A3RL 5F7DB 3I3EA 2UWEF 1A7OH 2GSGA 1I85C 4P2RA 5J1TC 1XZ0B 1BZ7A 5CZXC 4HBCL 4UB0H 3HI1A 5F7WC 5KVFL 5HDQH 5IROA 4DZBA 5FYLD 1FZJA 4FQIL 1ACYL 1UADC 1VFAA 3QZWB 2A6JB 2FL5A 2O5ZH 3BIAX 5LWYL 3FB7B 2D0HA 3MA9L 2B4CH 3KWWB 5JW4Q 5HVWA