3TO4A

Structure of mouse valpha14vbeta2-mousecd1d-alpha-galactosylceramide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
292
structure length
289
Chain Sequence
YTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vbeta2 natural killer T cell antigen receptor-mediated recognition of CD1d-glycolipid antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 77
structure length 289
sequence length 292
ec nomenclature
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3to4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3to4A01
4JR9L 4RMQA 5HI3C 4GXUM 1ZXQA 2Y6SC 3ARZA 1Q9OB 3HZKA 3VXUE 3VXRD 4PRNB 2Q87A 1FL3A 2YPLD 4OZFG 1T04B 5D2LB 4H88H 1FLTX 4JGUA 2VDLH 4K8RC 4PJGA 4H8WL 3EO9H 4F9LA 1I9JH 5KVDL 3L9RA 4XHQA 5D7LB 5E8NA 1X5IA 3CLFL 1KIPA 1XZ0A 5IK3A 2EE6A 3LEXB 4HIEB 1KYOK 3ARUA 1AIFA 4P57A 5DMKA 5SX4H 1T3FB 3STBA 1KJ3H 1S9WA 3VXOA 3IXTB 5ESAA 5EN2A 1Z5LA 1XR9A 3SJVA 3VWJC 3WFHB 2CXKA 4XNMA 3S98A 3GRWA 4EN3A 2G5BA 3FRUB 4NQXA 3UYRH 2UYLA 3ME0A 4FFYH 4PJ7E 3WKMH 2JTDA 2WM0A 1MFBH 5FHAL 2BSSB 1GGIL 2XN9B 2BSRB 1DVFA 4QCIB 1KEGL 5JMRA 3VFOB 4CN1A 5IBLD 1L0QA 4KY1H 3VFMB 2O61A 1H3UA 1DBMH 4LSTL 2PXYD 3WFDL 5ABDE 4R4FH 2A38A 1X5AA 4LSSL 1WSST 1MLCA 4KC3B 3PIQA 1DL7L 1IFHL 5B22A 5EU7C 3MNVB 4LSPL 1T3FA 5I66A 4P46D 2IG2L 1ZSDA 3P4MA 2EYRB 5KVFH 3TCLB 1XR9B 1HK6A 3MV8D 1B90A 3RIFK 1A3RL 4KK9C 1I8IA 3IDGA 1XGTA 1PQZA 4K9EL 3B9AA 5IJKC 3LN4B 1CGSH 1VERA 4KKAD 4A6YB 5CEZE 4UOW1 1IKFL 2P44B 4NWUL 5BZWA 2IMMA 1AGFA 5K33A 1ZMYA 3B9KC 4Z0XB 5LGJB 1H3PL 2EDXA 4N1HB 3QH3A 4ODUB 5IMOB 1CL7H 5JHLH 4U1SA 5IVXA 4UUJB 3AS1A 1P7QD 5D2NC 4WFGE 3AU1A 4JFEE 3MLYL 5GQBA 2C3WA 3NCJH 4WO4A 3F8UB 2F58L 3VDAA 4LHQB 3HG1E 4WFEE 4E42A 1T21A 3CFIC 2Q76B 3KG5A 5J9PA 4BQ8A 2DJ4A 32C2A 3KPQA 1U8IB 5B8CA 1FZJB 1YUHB 5IHLB 4J4PA 4BKLB 2VLJD 4KI1A 1FNGA 1G7QA 4OCRH 3SDXB 5D2LE 1QHOA 1BVLA 2DL2A 2JB6A 5DMGD 1IAKB 3ZSTA 2IQAA 4U1IA 1CFSB 4PP8C 3ULSB 4JM2D 3ABZA 3DPBA 3MV8E 2VE6A 1YMMB 1MFAL 2BVOB 4JFHE 2WBJD 3FB6A 4FZEH 2IPTL 1WISA 3SCMC 1SBBA 1T5XA 5JIHA 3HB3C 1RU9H 1PG7L 2JKXA 1T21B 2W0FA 2W0KA 4U6XB 2IH3B 4LIQH 1HYSD 4XVJL 3CVHA 5JOEA 3VRLE 4W6XB 4PBXA 2E9WA 4DKEH 1DLHB 3WHE1 5DK0B 4R4BA 2G5RA 2BY0A 4WFED 2R2CA 4K8RL 5A2JH 4GBXB 1BMGA 3QQ9D 3GNML 4K3DL 4LSRH 4KKLC 4QTIH 4N5UA 1DQQB 5SWZB 2ORBL 1IL1B 1QFWI 1XF4A 1TQBB 2HKHH 2QQLH 4C55A 1F8TL 1FDLL 4PG2C 1D5ZB 3S36L 5ALCL 4S1RH 3GI8H 5DD6A 1D6EA 4UDTA 1KLUB 5KS9F 2EDTA 5F70A 2N1KA 1Q1JH 3KJ6L 3MBXL 3IAPA 3C5ZC 5IMKA 2YZ8A 4MDJA 5DRNA 1CK0H 3QO1A 2VDOL 4NCC2 5ANMA 4JJHA 4F9LC 3NZ8B 3UX9B 1JPSL 2QKIA 2YUXA 3MLRH 5KSBA 3IVKA 3GJEB 2WV3A 1MY5A 1EO8H 3VFSA 1QBML 2E27H 3INUH 4QRRE 3WLBA 4NJAL 5HJ3B 3O81A 5KVMC 3SQOH 1N0LA 2XI9A 1TCMA 1J5OH 1Y6NR 2ZZUT 1YEHL 4Q2ZB 5DHYB 3RWFB 4RGOL 4ELME 5EOTA 4AM0B 1FYHB 2IMNA 2QHRH 4EN3C 1DUYB 4OZHB 3MREA 1IZKA 5SWSE 4G5ZL 2WAHA 3EDKA 3S5LG 4RA3A 1G1YA 1CT8A 2AK4A 1L7TH 1G9NH 1NCTA 4Z0BL 3IS0X 2RGSA 4U6VH 1MCQA 2D4FA 2ADFH 4PJ8D 2CLVA 1F02I 1X5YA 3VW3L 5J13B 4FFVD 1NBZB 3PHQA 2OSLB 1HI6B 3ALWA 1YMHB 5ITFB 3T08A 3Q3GA 5DZLA 1Y6MR 5HVFB 1WFUA 1GIGH 3QEQA 3GKWH 1G1CA 4ODVL 5D93C 4XPTH 1NMCC 1Q0XL 2AK1H 1V8HA 4TOYL 3KXFD 1BQHB 1MPAH 2R15A 2OBGA 2AW2A 3MV7E 1JK8A 4P4RA 5E7BA 5E6YA 1WZKA 4PJ9C 3S34H 3RWJA 3QDGE 2Z8WC 3V6FA 4HK0B 5GGVL 2NY3C 1I9RL 1UACL 1BZ9B 2DTML 1T20A 1JUFA 3UJJL 3SE9H 2DTSA 5EPMB 1ZA3A 3R8QA 2FCBA 3QISA 3RZCB 2VZTA 4P49A 1KTDB 5CIPA 5IB4B 1IC1A 1PY9A 2A6DA 3QNZB 4MSWB 3CFEB 3STZB 3KLDA 3G6AB 4YH6A 5DT1L 1DQMH 1YQVH 4L8BA 1VGKA 2R23B 5FUOL 4Q6IC 3RL2B 4XXCA 4M43L 4J4PC 3ZHKA 4HKZB 4P2RE 1I7UA 3TYFB 4KJPC 1GOHA 2W1NA 3LSOB 5EULV 4JM2B 3MLVL 5C0NC 4O58L 4HX1A 4IRJA 3EZ8A 3PWVA 4UIKH 1VEPA 1VFAA 2D4DA 1AHWC 4NNPL 4UTAH 1I7TB 1OHQA 3G5ZA 2XKSA 3NIGE 2H3NA 1OCWL 2QADC 1H5BC 1KGCD 1YNTA 5GS0D 1AQDB 2E3VA 5DMJB 4F58L 3T3MF 4GRWB 1FG2A 3PP3H 5GRJL 4IRSC 2Y07L 3WEXA 1MFEH 3KPTA 3VXTA 3QEGL 2XFXB 3UXFA 5GSRA 2XZAL 2FGWH 3IDNA 1UB5B 4S1DD 1QKZH 5SWSA 3H9YA 3GMNB 5T33L 3QCUL 4B7LA 4NN6C 3LN5B 3UPAA 3DRTB 1AKJD 4L29B 3CDYA 1A3LH 1WAAA 1OGAB 5I8KL 3V52L 1RZ7H 1QFOA 3OB0H 4I4WB 3BN3B 3TO4B 5K9QI 1I3VA 1I3RB 5MI0B 4PG2A 3KPOA 1RHHA 3HE7D 3FFCE 4I3RL 4Q58C 2X4UA 4XAKD 2IAMC 3C8HA 3WNNA 3IFNL 3RAJH 2EDHA 1J8HE 3QFDA 4NO3A 4BSVA 1RIVL 2R39A 1J18A 3ZKMC 2NY6C 4JG0H 4XCCL 3V5KA 3GBML 5DSCA 2ADIB 2HFGL 4QXGH 2YK1H 1QD0A 3LAFA 5GRWA 1U6AL 3P0VL 4PGCA 5DD0L 3NACL 4YHYB 5I15H 2XWBB 3WFCH 5C0JA 4HS8L 4PJEA 4YIQA 1QSZA 2C9AA 1I8KB 4MXVF 4L8DB 1EGJH 4G9FE 3MRBA 3K1KC 1CE6B 3ZE0E 3GSNA 2EYRA 5T5NG 5EC2B 4HH9A 4JAMA 2FRGP 3ZTNL 3IETB 3V79C 4IM8A 3L3GA 5KW9H 4UB0H 4K3GA 5MHSE 3PWVB 3GMOB 1EEYB 2AV1B 1KACB 5ICXB 3BP4B 2PXYB 5JORB 2DYPB 4KKCC 3FB7A 4QRTA 4NO3B 5E8DL 4YBLC 3MNWB 4GLRH 2R0LH 5GJSL 2DWDB 3K2MC 4NPYB 5HYFA 1WVZA 1S7TA 5J57B 4Z7UB 4OLVL 2J3SA 2FLRT 3KVQA 2J2ZA 1MHCB 4JDTH 2D31B 3LRSA 3U9PL 2WK2A 1KB9K 3N1MC 1U8OB 3BDYH 5KSAC 4NZRL 3MCKA 3QUXD 4L8DA 5ADOH 3KPRB 3MJGX 3WUZA 4LP5A 1A6WH 3FO1B 3QEQE 1D5MA 3NFNB 4PJXE 1TZGL 4BKLA 4WW1A 1A9EB 4YXKH 3QHFL 3EGSB 5IFAH 4KRMB 2X4QA 2DF3A 4PJ5B 5IEKB 3HR5B 4P23D 2VLJA 4TTDC 3O6FA 4APQB 5B39B 1JJUA 2WBWB 2VXTL 2QSVA 2DWEA 4P9HL 5B3JE 1FRGL 1I1RA 4K8RD 2FBJH 2BERA 4KRLB 2G75A 1ACYH 2Q3AA 5EU5A 1S9WB 5TQ0H 5I1CH 2P5WD 2DQIH 3LRSB 4JO4H 3D25A 3RVTD 3X11A 3S9DB 1T04A 2WBJB 2K1MA 4C83A 5KVEH 3H6JA 2X70A 4LL9A 3V5KB 2RQ8A 2I07B 3OG6B 4F2MA 4YAQA 5HHOB 4U1SB 2CLZA 5IVXB 5F89B 2N7BA 3ARFB 4AIZA 3GHBH 5EFIA 2GUOA 4KI5C 2A0LD 1OM3L 3VFGL 1NFIA 2Q76A 3IDIB 3GMMB 4U31A 3FMGH 4IRJC 2WMPA 4MCYA 5D7IE 2FR4B 5HHMA 5FDYA 2C26A 4UMGA 2WSKA 3H3KA 4PJFF 4YDJB 4YNYA 4Q7DA 3FAXA 5AD0A 5IB3A 3C6LD 4L5FH 4XXDA 5JOPE 1U0QA 3I02B 4IS6B 4P3CH 3CPLA 3QQ3A 3THML 5J7CC 1GVIA 2UZIL 5FCUH 4J8RA 2HT3C 3FQRB 4FA8A 4K94H 2PO6B 1CLOH 2QADB 1KTLB 1JFMA 2MNUA 4V1DE 2YUVA 3ES6B 4HQQL 2HP4A 1E4JA 5TDPB 4OM0H 1F42A 5BJTA 1QP1A 3ZYJA 3E6HB 2IWGA 4HIHA 4ELKA 1QFPA 1AO7A 2FR4A 1YEFH 4JRYD 1K3IA 3EGSA 1HINH 5IF0B 2LQRA 3R0MA 4KMTH 4PJ7B 2MJWA 2BHYA 3I6GA 1NDGA 5TDNB 1I1AD 1NBYA 3CC5B 4Q9BA 4FQXB 2IAMA 3TIEB 2DQFA 5IVOA 5IB2B 5GS1C 2X9WA 2G75B 5KAQG 5IMOA 2EDJA 1G84A 5IROC 3SPVA 5GIRA 5D1QD 1QVOA 4KJWC 4M6NL 5HGAA 5I9QB 2MCG1 1WBXB 2CLRA 4Y5VA 2AK4D 4EUPA 2CLVB 4ACPA 4P4KD 1A7NL 2EDEA 2FB4H 1F4XH 2EYSA 4RDQG 1FJ1B 2B7DT 1R6VA 3T0WA 3HE6C 3WN5A 2J1KA 3EYQC 5HGGS 5I18L 2E6JA 1EIBA 4PB0L 1CF8L 1IBGH 1GJIA 3MROA 4H0GA 3QDJD 4WGVB 1YY8A 3Q1SH 3QUXC 4ZAKD 4OUUA 4WDIA 3BW9A 3KWWA 2ARJA 4G42A 4CJ0A 4DW2H 4AEIH 3UDWC 3MJ9L 4G6AC 3DYOA 4D0BA 4X9FA 1DBKL 3IAQA 3FT2A 3DVNA 3T4YB 2NLJB 2R0KL 1MQ8A 3BEWB 4N68A 1YNKL 4X98B 3VGAB 4HK3N 3ERYA 1BAFH 1S9KC 1J8HB 1J10A 2MCPL 3JSSA 5I1IH 4WIQA 2YSSB 3UTTD 5ILTL 2FX8H 3JV0A 4WW2A 3HTLX 4YWGH 4P0DA 3CLEH 2HMIC 3DXAB 4LMQI 3BUYA 4CU7A 35C8L 3L3JB 2QBWA 4NGHL 2WWMC 3H42H 3GMPA 1MY7A 2CJUH 4X6CB 4P2RB 1JWSB 2R1WA 5BOZG 1SVCP 1GC1H 2C4FU 3QQ4B 4IIQA 5C86A 1NCUA 3B5TA 4BQCA 3KWWB 1VDGA 4K3JH 4TUKH 5SX4I 4I13B 1XF5A 2WQRA 2GSIA 2VOTA 5EZJB 3Q3GB 1XCQB 2X9XA 1QYGL 4HG4J 4R97C 3BT2H 3IAGC 1GZPB 3G6JB 4LHUD 3TJEH 1UEYA 1RUQH 2A0LC 2DMKA 2IC2A 3IDJB 4P5TB 5IQ7L 1F90H 3MMEB 4RWYL 1PGRB 5E2UH 4MNGE 4Q2ZA 3HG1B 1QZ1A 2W65A 1JF6A 4JFFE 4NKIH 1VFMA 3TWCL 3QHZL 1NCDL 3G6JF 1F3JA 1NL0H 5L2JB 2EXWC 3BUYB 1JGDA 4XCFH 4YHNB 2ZCLH 4WTXA 3VG0H 4M6OH 4O2FA 1B4JH 2DQTL 4LSDA 5FYJL 5C0CB 1AGDB 1WAAF 2B1AL 4JE4B 1XGRB 3DHMA 1JWUA 4RRPA 4WEBH 3DX6A 2Q86A 3VXSD 3BXNB 1H5BB 4KTDH 5JTWA 1QR1B 1QRNE 3QI9B 3FFDB 3LY6A 4UILH 2P48B 5IHBA 4G42B 3ECBA 4H20L 4XPHH 4OF0A 1KJMA 3SE4C 4GUPB 1RZKL 3GUTA 1BOGA 4M48H 4YE4L 2V7NB 4HUMB 5TH2B 1TZHA 5F1KC 4Z7VA 1CL7I 2AJVL 1D6EB 2VLLA 5F6IB 3NCYP 5D71H 3QDAA 5JQ6L 5E6IA 4W6YB 1BBDL 2QADD 1G9NC 2VLRB 4PJBA 5IW1B 3FT4B 1HI6A 5I1EH 2Q86B 2VR5A 1LK2A 1JN6A 1QSEB 3MLTA 4XRCB 4HBQA 4LOUC 3VFTA 2MPAH 3CMOL 2QSCL 4D9RE 3EAKA 4S2SA 1FO0A 1E28A 3W82A 1FV1B 4QF1A 4WI4A 3CH8A 3WLWC 4NRYA 1U8KA 4Z78A 1B88A 5IKCA 5EBWB 4C54A 1PKQE 2NYYC 1CXLA 4U3CA 1N59B 4Y7MA 3JTTA 3MRHA 1WWCA 4LRIA 2V9TA 3MRMA 1V7MH 3TN0C 1QRND 3BGFC 4QTHB 3P9LB 1UQSB 2DQEH 5E08L 4JLRA 2X89A 2BOBB 1D5XA 3FONA 2OJZL 3BGMB 4LCUB 1ED3B 5IROA 4IRZL 4WWKA 4Z76A 1EEZB 2B1HL 2AEQL 5L2KB 4Y5VC 2Y36H 5SV4A 1I4FA 5EWIH 4ODXB 4KK6D 3DUSB 4AK1A 3H8NA 3SGEH 2DM2A 4XCYA 2IQ9H 3MV9D 5TDOA 3UBXG 5BQ7A 3HE6A 5GRUH 4ZFOB 3MLSL 1QEWB 1WIUA 2OR9L 1M6OA 2BP3A 1AXSB 4JPIB 5DHVB 4O2CA 5A16A 1KJVB 3SN6N 3QUXA 1DLFH 3QUYD 4PJIF 3QWOB 4NT6B 4OF7A 1YQ2A 1FGVH 3OAZK 4ZOBA 3KPMB 3RU8L 2NY1D 4YO0B 1I7RB 4Y2DA 3T0EC 5IEHB 4P57B 3U36B 1UB5A 3GSNB 2RCSH 1UZ6F 4AEEA 3DYMA 4IOIB 1AXIB 2G5BB 4DGIL 4NUGL 4Y8AA 4YEFA 2YD3A 4XP1H 1IJ9A 4LBEB 1TJGH 3PWPA 5CP3H 5JHDB 3T1FA 3LEVL 1YYLL 5KSVB 2C1PB 4JFEA 4LLWB 1QSEA 1N64H 1FC2D 3LMJL 3W81A 1XCTB 3EOTH 3MOAH 4YDLC 2ICEA 3UTZA 4D9QD 4KMLB 5DUPL 1INDL 3ZKXB 2CDFA 1A4KA 3QWOA 4NT6A 1BD2B 4Y19E 4G59A 3B2UD 2E6QA 5E8OA 1B2WH 3BWAB 4Z9KB 4ZO8A 5D2LA 4J12A 2GT9B 1KB5A 3Q6GL 1ZOXA 2ADIA 4UU9A 2MOVA 1CGYA 3ALXA 1JTOA 5HPMA 2YRLA 4XNXH 2XTJE 2WP3O 1OB1A 1U8MA 2R2BB 4WFHE 3QG6A 4APQD 5ESVA 4WU5A 2X40A 3FONB 1IQWL 4RX4D 3V4PL 3HR5A 2DI9A 3QWRA 1KBGH 1P4IL 4X8XA 5DURB 5F3HA 3UYOD 2DN7A 2NY5L 4UINL 5EO0B 2WLYA 3BH8A 3HC4L 5JMOC 1JRHH 4JFDB 4UT9L 5BCAA 1YDPA 4U1HB 5DVKA 1NC4B 1IGTB 4G8GB 4XHJD 3VXUD 3OBAA 1UWXH 1U36A 4AMKH 4R9HA 4PRAA 5GSVB 2GK2A 1RI8A 2FIRT 3HRPA 1RULL 1AR1D 5EO9B 1FFOB 5HHOA 4QY8A 3N1GC 5E2JA 4LQFL 1U8QB 2WWKT 3O3DB 4GSDH 2EXYD 4P2OB 5H37G 1EO7A 4F7CA 2I26N 5HYEA 3QPXH 3V0WL 4FXKB 2DL9A 3PWNA 3T04D 3WS3B 2R2HA 4PRHD 5ICXA 2GTWA 2AGJL 2X1XR 3N1FC 4XNZC 3OAYH 4HV8B 5H94B 2H26A 2WUBL 4Z7QE 3PUCA 5CILH 3CK0L 3SPVB 2WBKA 4NZUH 5F9DC 1EAJA 3V6ZB 4PY8I 5I8OH 4FQ2L 2A9NL 3UEZA 5IMLA 5MHSD 3B5HA 3GSQB 3GB7B 4PRAB 2JIXA 3LZFH 5GS1B 1ZHBB 4JRWA 3V7AG 2I5YL 2ZUQB 4P99A 1BJ1H 3N0PB 4QHUB 3RA7H 3QNXB 3W9DB 1P53A 4P4KA 3X3FL 3LV3A 4JHWH 2VXQL 2EDDA 1MCSA 3DTXA 3C87A 2NNAB 1DP0A 5DVLA 4PRBA 4JQVA 3ESUF 4QRUA 5CD5C 4RQQB 12E8L 2OCFD 1EXUA 1LO2H 4WHTA 1H9VA 4J3UA 4PR5A 5A2IH 2JLLA 1WAAE 3O2VL 3GSNH 4DKDC 1X5FA 5JPMB 2DI8A 3LD8C 2MFNA 25C8H 5JXAL 3KR3H 4G6JL 4U3HA 3WKML 1MFBL 4RMRA 1ES0A 1OWWA 4U1IB 4APQC 2Q6WB 3I9GL 4PGBB 1DTUA 3HC0A 4JPKL 2HRLA 4J3XA 2V7HA 4NOBA 2F19H 3HLAB 1T2QH 3EFFA 2KBGA 5I8CA 1DE4B 3KYNA 1OAXH 1HXMB 3LDBB 5K9KA 5EZIH 2XTJC 3DRQB 4HIJA 4HC1L 2W0LA 4NSKB 3TBVB 2HN7B 5LGJA 3LKQA 1R5WB 1U93B 3QI9C 1MJJB 5HYQB 1HHHA 4G8FA 3V4UL 4XMPH 2XACC 4PTTB 4EBQL 2D7OA 2GSIB 1BZQK 4HCRH 2RAMA 1A9EA 3DGGA 1MRDH 3BZFA 4JKWA 1MCPL 3QZWG 3B83A 4KAQL 1TZIA 5EU6D 2XA8L 3D9AL 3HMWH 5F9AC 1DUYA 3C2AH 2X1OA 2DLFL 2BNRB 1LQVA 3MLUL 4X6CE 4JFHD 5CHNB 1F3RB 5C6PB 4LVHB 4JVWA 5DZOA 3BEWA 1CGTA 4WCYL 1F6LL 4OJFH 3MLYH 5DMIH 2D0FA 1S5HA 4KZDL 4MWFB 3EJYD 4N0FA 5J1SC 1OT1A 1BJ1J 1D5IH 4LF3B 4G8IA 5E4EB 4R96B 4MGXA 3X3GH 4G43A 2IFFH 4RBPK 1T89A 5HVHB 4E41B 2DLIA 5GRXG 3VXSA 1RFDH 4DQOL 4ZNEA 3IDIA 4DUWA 2E7LE 5D5MF 5DJCA 4Y4HB 1MEXL 2M26A 5F7EL 3STLB 4JZJB 1MFAH 3CFJB 3ROLB 1M7XA 4BSWB 4JREB 5FYLH 4DN4L 1ZHNB 1NAML 1QA9B 4XC1H 5GIRB 3D0LB 5TFSL 3UYPA 3I02A 1BVKB 4IS6A 3WD5H 1R0AH 1SY6H 2PTTB 5D5MB 3A6OA 4HJJH 1N0XH 4FQIH 5TE4H 3D3VD 1MOEA 4MD5B 4I5BA 2HVKA 1UYWL 1KLGB 2ZSWB 5DGRA 4ZFGH 5E8PA 3DXAE 2W59A 1A1NA 3MXWL 3SEPA 4FQQB 5DVOA 4OZFA 3VXSB 4ODTL 3DX8A 5DRXA 1JV5B 2Y5EA 4OGXH 2BNRE 5DXWA 2CUHA 3BW9B 3O6KL 5LXGH 5CWSA 2R56H 1G7LB 1ZVSB 5IFJB 3BKMH 4QOKD 2OTPA 1KG0A 1A6VL 1QR1A 2HA1A 5I19H 3BQUB 5LQBL 1QLFB 1LK3L 3U4BH 2VLRD 2A6IA 4C56D 1O0VA 2GTZA 1C08A 2BX5A 3AM8A 5C0EA 5F7YC 2QHLA 3MUY1 1Z9SA 4LEXH 3FCTA 3GMQB 1CZ8H 3RNKB 1G9MC 1NCAH 5AEAA 2YBRB 4JM2C 5E6ZA 1P1ZB 3PGFH 1S9VA 2Q8BL 3WKNA 1Z3GH 5LAXA 4D0CB 1DDHA 1EO8L 2BMKB 1QSED 4P4KC 5D1ZB 3RVVD 1CGVA 3P11L 4MVBC 3TFKA 1YEEH 5C3LD 5L2JA 3CVIH 3HC3L 1I8LA 3IB4A 3GM8A 3MV9B 3M07A 4JQVC 4YHNA 3CZJA 2AXJA 1T5WB 2B20A 2WINB 2VISA 4N8VB 2QEJA 3DXAD 4XVTL 4IOFC 1NBZA 3K4DA 3JXAA 1ZLSL 5FOJA 3CVHL 5HYSG 5KTEL 1I9EA 1CN4A 3DHJA 4R90L 4HKZA 4JQXA 5T3XE 1SMOA 2VABB 3B2VH 1TETH 1C12A 1N2RB 4YC2B 1QOKA 4TSBH 1JHKH 2NY3B 4OCSH 2FIKB 3QWRD 4PYGA 1KCUH 4XNUL 1SEBB 3VW3H 4Z7NF 1K3ZA 3ZKXC 4CMHB 2A6JA 1C5CH 3GIVB 5D2LF 2F9BT 1CD1A 1Z0MA 1OGAD 2X4TA 3VXUA 4CU6A 3ZT7A 3IRZA 2ZUUA 2O5ZH 3OKDB 3QI9A 1ZAGA 5J12C 1JV5A 2A6DB 3FZUD 3QNZA 1AC6A 3C8KB 4JCLA 3GK8L 3HE6B 5HYJB 1I8KA 4PJXA 4LVOC 3HRZB 3S34L 2D7QA 3IJHB 4XPAL 5CKAA 4YDVB 5GGVH 3DROA 3TNNB 5I1JL 4YUEL 5GGRA 4X83A 1G6RL 4FQHB 4RCAA 1XIWD 4XPGH 4KKCD 1ULVA 5JIIA 1N59A 1GGUA 1IEHA 3HG1A 4M1DH 2JIXD 5T1KB 1WFTA 1LO0H 2A6JB 2DMBA 1J05A 4KJYA 2RR3A 5FXCH 1HKFA 3TGXA 1HKLH 4PLOB 1AD9B 1IC7L 5JHDD 3PABA 3EYOA 2A6KA 3JBG7 4HIXL 1RZJH 5LCVH 1XGUA 2D31A 4PGDB 3HNVH 3P30H 3KLAB 3PHQB 3FO0L 3RZCD 4I0CC 2B4CH 1FL3B 1T89C 3G6DH 1P7QA 2XN9E 3UC0H 4G6KL 3LKRA 1XCTA 1FFOA 4KPHH 3C5ZD 3RY4A 3ETBF 4MLIA 1DEEA 1VENA 4I2XE 2G9HA 4Z95L 4D9RD 2X1PA 4ZODA 1KIPB 2VWEC 4ZTPH 2P5ED 4R26L 1NEZB 3QEHB 2YEZB 4F7EA 4Z7WB 4GRLD 1BVZA 5BW7C 3TN0B 5FECB 4HH9B 3W2DL 2W07A 5J6HA 2DDQL 4DGVL 5BS0E 2J6EL 4PJCB 4JFOA 3SDCD 5D6CB 1FL5A 3CFBB 4XTRD 2YKLL 4X80L 4MQSB 3CSYB 1A5FL 3QHTC 2ZCKL 1QPPA 4ZAKA 2LTQC 1KPRA 2R4RH 4YHKH 5ACMA 4JQIL 3RPKA 2BZDA 4M62H 1NCWH 1TMCA 4M1CD 3WUWA 3NTCL 1LD9B 4PJCF 5M95B 3IDMB 1FCGA 3VRLF 1MIMH 4M61A 4QHUA 3W9DA 5JXED 3G5VA 1KULA 1BWMA 4JFZL 1BGXH 2BNQB 1FZKB 1KLFA 3CDFA 1RZ7L 3BESR 4NO5B 3QIWB 3SDXF 3T3PF 3U9UA 1A7QH 3CCHB 2CRMA 4P2QA 4KJQC 3UBXA 3VD5A 1JPFA 1AI1L 3MRHB 3ET9F 2P24A 5ID0B 1NKRA 4M93C 3U7AA 1PLGH 3AM8C 3X14B 4F15C 4O2EB 1NCBH 3SDAA 3RAJL 2DLTA 5I1DA 2I9TB 5HD8C 1A1MA 1G7JB 5C6TH 3EYSL 3ULVH 1UADC 4Z0XA 1CFNA 3BZDA 4WUUB 3H2WA 3GMOA 5ADPL 4X7TB 4EKXA 4PLNC 4U6HA 2VLKB 2XZQH 1JZ6A 3WFCL 1FG2B 5A2LH 1G0YR 5C0BE 2XRAH 1EJOH 5EO0A 1IQDB 2XZCH 1MF2L 2DQUH 3EYVA 4PJ9D 3EYUL 3JUYA 4O2CB 1NSNL 5A2KH 3LS4H 1IGTA 3QNXA 3K81A 2VLMD 1A6UH 4HGKC 4PJDB 3LN5A 4X7SL 1ADQA 1HEZA 1W0VA 1O7VA 5E99H 3FRPG 4PJCE 1FZOA 5IF0A 5EH1A 4XC3H 1YJDC 2P45B 1A22B 5L9DH 3WO4C 2VDML 1JGUL 2GJJA 2LAAA 4MCYB 4RSVA 1NLDL 1F3DH 1NKOA 1XT5A 1KPUB 3BN9C 3WJLA 3VRJA 4LSUH 3QYCA 5C2BL 3OR6B 3VXOB 1KPRB 3O6FB 3VWJA 5D9SB 1HNGA 4XNMB 4H8WH 2VITA 2ZJSL 4NN7B 1Y18B 4HUUB 4I18B 1MFCH 4UDUB 1R3IL 4N0UA 3QQNA 1MVUA 2ICEB 4QY8B 5F93C 1HWHB 1FIGL 4O9HL 3UTZB 1FVEA 2V5MA 4X9IA 3S37H 1RZIB 4EXKA 1FPTL 2HJFA 1KJ2A 4I77L 4PJBE 1KJ3L 2VB5A 4LNVA 4GW4B 5C08A 3AREB 4C58B 4R6UA 3SE8H 2CGRL 5DK0A 1WF5A 5KBNC 2I24N 4LCWE 3GHEH 3PGCA 2PN5A 3HB3D 5DEGA 1CFVH 3OG4B 4PRNA 5IW6B 1UT9A 4JKLA 1GGTA 2AERT 4ENEC 1HH6B 3NPSB 3PV6A 4L3EE 4LLUB 1KIRB 4P59L 1X9QA 3PE9A 2LABA 5E7FA 1MHEB 3FN9A 1RMFH 2NW3B 3OR7A 2JB5L 2A77H 4LIQE 5IJKA 1G0DA 1MRFL 1X5LA 4Y4HD 5I73C 3CXHK 1JWSA 2XWJA 5FF6B 3RI5F 2IG2H 5IVXE 4WWKD 4KJWD 3HLAA 3N9GL 1MREH 1EXUB 3HG1D 1Z9OA 2LVEA 2PW2B 3ZKMD 5D2NA 3N06B 4OV6F 3HMXH 3QDJB 3SKNA 3A6BH 5IK3B 1IILE 4KK8C 3G04A 4WO4C 3VWKD 5BW7A 2ATKA 2D3VA 1DQLL 2YD9A 3ZMRA 5ICZA 2X10A 1Z5LB 4YDIH 1EO5A 3ARSA 4JY6A 4M1CC 3A67H 3M1BB 3WFHA 4HV8A 3RHWK 1DQQA 2IH1A 4R2GD 3QUYA 1KPVA 3LD8B 2NY2C 1ZK9A 4M5ZL 3QI9D 1UM5L 1W8OA 5E0QA 1SJXA 4W4NA 1GPOL 1XGYH 4JFXA 3B8YA 2B2XH 4PJDE 3R1GL 1INQA 1LMKA 4RGMB 4XVSH 4PJAF 1FCCA 4I1NB 5EIIA 4OLXH 3OPZH 4JCMA 1WICA 2FHBA 3KPNB 5D72H 4JM2F 4ETQB 5E1HB 5SWZE 2DLGA 1NC2B 2DQHL 3PWPD 4JJ5A 1HQRB 3BIBX 4S1QL 4JR9H 1MJUH 1H3VA 2FECI 5EOQH 3AU1B 3WJJA 1I8IB 5IG7A 3F12B 3VXNA 3DMMC 4MX7B 2KQMA 2YD1A 1LO5B 5DQDL 4B41A 4M6NH 5EOTB 4AM0A 4NQDE 4QYOB 3ARBD 3MLZH 3WIFA 5CBEA 1MI5D 4RFOH 3VXRB 3MSPA 4RWHA 5CIPB 1V3JA 4HKJB 5GHWL 3LKSA 3L3OB 3MFFB 5KOMC 2YBRA 1KELL 4G9FB 5A3ID 3GM0A 1JYWA 1IAKA 3IDYC 4TYUA 3QRGL 1H3WM 5DEFB 4NO2A 2EH8H 1YEDB 3I85A 3D2UD 4OZIE 1C7SA 2W60A 4PS4H 3QJHB 4AH2B 1QTYT 4JM4H 3C5ZA 1U8IA 1G6RA 1GZQB 4NHUB 1E4XI 5IQ9A 2FX7L 4LFHD 2R8SH 1RUPH 5JO5A 3T0DA 3QCTL 3RVUC 3BP5B 1U58B 4CJ1A 2OXHA 2E9BA 3FQUA 4G3YL 4WFGD 2ZUSA 4LSTH 2WWKO 4PRID 3BZ4A 3WJLC 1M4KA 5T5NF 2BRRH 5EUKB 4ODSH 5ILTH 5J56B 1ZT7B 3MBXH 1IKNC 5K9OA 3BSZL 3CLEL 5FYKL 2A73A 4NRZA 1BFOA 2R29L 3K4AA 3KYOA 4LSPH 3U6RB 5I8EA 3L6FA 5TPWH 5MEOA 2VLJE 3K8MA 2DQDH 3RVXC 5E8PB 4PFEA 3MREB 5ALBL 4F57H 4OQTH 5E9DA 5IB1B 3MV7B 3RNQA 1J0ZA 2EEDA 2H6PA 5DQJB 5EIIB 3GSXB 1YEHH 2GAZB 4PJ5D 3KS0H 4MNHA 1RUQL 3SDAD 1N4XH 1ONQA 5ACLA 3QXTA 5DUBB 2QHRL 3O4OB 3FQTA 5F9JA 3TC9A 1KN2L 2VXSH 4D2NA 3GIZL 3UO1L 3JTSB 5GGQL 1CLYH 3U0PB 3TO4A 5I6XB 4MCZB 3E8UH 1Q38A 1NCDH 4PGEA 5CMAA 3FT2B 5C09E 3TZVB 4OCLC 4X9GA 4Y4KC 1WWBX 2ZG1A 2BOBA 3DMMD 5KJRH 4C56E 4FFZL 3PDOB 4LU5H 1KLUA 1P2CA 3BP6A 2PTTA 5D5MA 5HTSA 3SBWA 4I3SL 4PP2B 5E00B 4PJ9A 3I3EA 2ZG3A 1U3ZA 5JDSA 3NABL 4JHZA 2P5EB 2SEBB 4ZYKB 4NWTL 5EO1B 5CD3B 1IM3A 4JFFD 3QIBB 4P48A 5GJTL 4BM7A 4WFFD 1LE9A 3DUHA 1HILB 1AE6L 2DBLH 4DTGL 3RHWF 1FVDA 3HI6L 3BGAA 2WWMD 1W8NA 2BVUA 4KQ3H 1QSEE 4ZUWA 3HKFA 3H3BC 5DR5L 3VA2C 3UJIH 4GXVL 2Y6SD 4QLRA 1KNOA 1BF8A 2C5DC 1VPOH 1L7IH 3QIWD 1GZPA 1CR9L 4HAFA 4EVNA 4ODWA 5ENWB 4XXCC 1XF1A 1ORSA 3I3BA 5D7LE 3T4AA 2HFEA 3IKCA 3HZMA 1H15B 1B3JA 4U6YB 2I9TA 4OZIA 4OLZH 2MQCA 1MCWW 4NQVB 3L95A 5I1EL 1WLHA 3TT1H 1T03L 1Q9WB 3H3PH 1DQML 3MODL 4MA7L 2QSCH 3WXVL 3LH2H 1A6PA 4U1GB 1AHWA 4FXGB 2AJXL 4K3DH 5LAXB 3IRPX 1SYSA 2FJHB 2B8OT 4IRSB 4NP4L 5IBLC 1K6QL 1HILA 3U30B 1VKXB 4KVCH 3EDJA 3ZKQD 4YHPB 5EIQA 2QQLL 4F7MB 1H5BA 3BISA 2P1YA 5CFHA 1KTDA 4AENB 1OVZA 3PHOA 3L1OH 3C6LA 2ERJB 2XFXA 3WJJC 3NZHL 3OGCB 1ZANL 4P2QB 4P4RB 3IF1B 4TVPH 5SWSB 5CAYB 2GIYA 3O2DH 2GJ6D 4HGWB 3DRTA 1T20B 1G7MA 2IAND 2FIKA 2LE9A 4I18C 4OZGB 4NJAH 3TNMA 4ZS7H 1SEBA 5GRJH 3CFKB 4JHAH 4YXHL 5HDLA 8CGTA 2DLEA 5DJ0B 1JE6A 2XV6B 4QXTA 4X4XA 5F1IA 3LQAH 2FNBA 2VITB 3DURA 4LPUA 3RVUD 1MH5A 2H9GA 5DO2D 5T33H 4QKXB 3F58L 4BH8B 4P23B 4AY0A 5BVPL 3KYAA 4OLYL 5BZWB 5FGRA 4OF3A 2UUDK 2WP3T 5DJ6B 1JTPA 2EDFA 3MZGB 4D0DA 2ED7A 1RK1B 4Z0BH 3U7YL 3SGJC 2DJUA 1YPZF 1Y6KR 4NCDA 2ZUQC 3TYFA 4ZD3L 3SJVD 1BQSA 4HPOH 3GO1H 1Q0YH 3EOAB 3HZVB 4WW1B 4GAYA 4H25B 3S3JA 4HK3J 1R24B 1XGPA 3JWDC 4H1LG 1ND0A 2DKMA 2OI9B 4ORGB 1IGJB 1N8ZB 3IXAB 5C7XH 2ZCHL 2DICA 1LO4L 2EEAA 2AVGA 1B0RA 2JJVA 2P4AB 1A4JB 1N64L 1E6JL 3VH8B 3CU1A 1QSFD 1YEIH 5CS7A 5F6HI 1N5YL 4EOWL 4KV5F 5HDOA 4W6WB 3OR6A 2ZUVA 2DM4A 4XPFH 4LAQH 1PX3A 5B3NA 3ARXA 1T4KA 3EHBC 3IDXH 4NPYA 4R7DA 4DOHE 5FYJD 1CFNB 3QIBC 1OTSC 4WNQB 1L4IA 5F7DA 1R5VA 2G60H 3TJHA 3WUWG 5AG8A 3VU2A 1U8OA 4LKXB 1ZHLB 4U4BA 1EHAA 2YN3A 4NHCL 5I1LB 5KSAA 4NM8H 4OGYL 1X5KA 1L0XA 2NW2B 4FQ1L 3V4PH 3ZDXF 1ND0B 1MI5A 2AAVA 4RDQF 3DO3A 5D7JC 2ITDB 4JRYA 1YQVL 1S3KL 4JPVL 5D7LA 5E8NB 2BHUA 2Y23A 2J8HA 5IW6A 1JRHL 1WBZA 1KJ2L 5TJWK 2Z93A 4LCIH 4ZUUA 5I6XC 1OSPL 4AL8H 3U9PH 2VLJB 3WDHA 3QXVA 1JBJA 4UV4L 1OP3K 3O6FC 4YXLH 1YEKH 3K3QA 4ZTOL 1IM9A 5HY9A 1TMCB 2C1PA 4RMVA 2FEEL 2IADB 2EYSB 2AV1A 5H35B 3B9EA 1F3DJ 3ULVD 3MGTA 5HHXL 2R4SH 3E6FB 3KHOA 4YXKL 4PJEB 1MCHA 4PRIA 4ZFFA 3VFMA 3TT3H 2O61B 1OF2A 3EO0B 3CXHJ 4WDIB 4KJQD 1IGCL 4DCQA 1E4WL 4N8PA 5J1AB 3KYKH 3ZT5A 4NN5B 1KB5L 3QDJA 2HJLB 4M8QB 4RAVB 4HWBA 3CJJA 1ACYL 2J4WL 4PJEF 3CK0H 4LVNB 1BJ8A 3JWNC 3PP3K 4ORGA 5T1DH 5KSBB 2YA1A 2NLJA 1KIUA 2KDGA 3BE1H 3MFGB 3O4LD 4WI2A 4U0QB 5T1LA 4JFQB 1B0RB 4NKQB 5ERWB 3VD7A 1UXSB 2C1OA 4GKNB 4PJAA 5LVEA 4I0KA 3DECA 3PL6B 3QPQC 3HI1B 3QCVL 2GK0B 4LHUG 1YZZA 3QFJB 5INCB 3VFGH 4X6EA 5C8JB 1NCCH 2FJGA 4LARH 1CQKA 3AS2A 1CT8B 4Q9QH 4ENED 3BIKB 4LVHC 5LWYH 4MQXC 4JKPH 1C5BH 5CP7A 3O0RH 1MCOL 2C3XA 2LV4A 3HN3A 1X5XA 2D03H 3S4SA 4HWBH 1MHPL 4XGZB 4F3FA 5J11C 1RJLA 3CDGA 5KOVC 2IBZY 4YHMH 4F7PA 4ZPTB 1FGNL 4BFGA 2CLZB 1UCBH 1RUAH 3OJDA 5DWUH 1WCQA 5KS9A 1NFKA 4U7KA 5DD0H 2DWEB 5IV2B 1DBBH 4WW2F 4A2LA 3DETD 4P9ML 1CICD 4NDMB 2OZ4A 1DQJB 1BFOB 4K94L 5ICZB 1T1XB 1KCRH 1S9XA 5TF0A 4OF6A 3UZQA 3VCLA 1VSCA 3O4LE 3HE7B 1VEOA 5I0ZA 2WIMA 3CSPA 1T6VN 2H32B 3MA9L 5J6GB 2UWEE 3BPNB 5GS1A 5C2UB 5DGQA 1NFDE 4UB0L 4PDCE 5CGMA 5IOPB 4DZBB 3VFUA 5I1HH 5CCKL 1I8MA 1U3HC 1HINL 4O51A 1JVKA 3RTQD 4KDTA 5CGYC 5EBMA 3I2CL 4MA8L 4N0FB 2YA0A 3DX8B 4NN7C 4KK8D 5HHQB 2P8PA 2AJUH 2D9CA 5FA3A 1T22A 3T2QA 3HMWL 2AXFA 2PYED 1X6LA 2GFBA 3UTSD 5J1AA 1ZVSA 2O5XH 1KJMB 4I48B 1KTLA 4IDJH 4BK4A 3DV6A 3KPNA 4OT1H 1Q72H 5F9WB 1QLFA 4Q97A 2IPKB 1FO0L 2UY7A 5L88L 4JJ5B 1FZJA 4MD0A 3K2UL 5IESH 1OWRM 3IFPA 4M3KB 1S7SA 3QQ3B 1RQ5A 3CZFB 2NY6D 1A2YB 4CNIB 3ROLA 4BSWA 3QHFH 4N8CL 4OLUL 4IDLA 3UZVB 1CFQA 4L1HA 3I75B 4DKAA 5CEZL 1ZVYA 1OAZL 2DQFB 1J0IA 3QIBA 3G5ZB 2BNRD 4I3GA 1YMMA 5IW3A 1HHGA 5FO9A 4WW2C 1ETZB 1YMHA 1W72B 4GAJL 4PJFE 3LPWA 3NH7L 1B0GB 4MXWL 3BQUC 4MD4B 4WI8A 3MCLL 1SJEA 4Z7OE 5D7JA 2BFVH 4EJ1C 2W9EL 5FA4A 2OTWA 4YDLB 2ZUWA 4Y1AE 1CFBA 2ZPKL 4X7DC 4Z7VE 4IIQC 4PJGE 4HG4K 4OCWL 4MJIB 2VLRE 1EHLH 1NPUA 5IFJA 1T1ZA 1ZS8A 3JV4B 1J0JA 4TSCL 5BOPA 1UJTA 5JO5B 3RX5A 3D85A 3FL7A 4ESKA 3V6FB 1HXYB 4WUKH 1CGWA 3WIHA 2VDPH 5L2KA 4OUUB 1NMCB 4D9LH 1Q9WA 3HAEH 4RGNB 5TQ2H 1CGXA 2HH0L 5C0EB 5C9JA 1R3KA 4KZEH 2H32A 5J6GA 4M7LL 3G5YB 4ZSOE 1LVEA 1ERNA 1YNLL 1XIWB 4HWUA 4R96A 2DIAA 3AFLA 3BT2L 3BYTA 3ARQA 2YPLA 4MA3B 3U7WL 4L8CA 1MCRA 5TF1H 2NXYC 1BBJA 1A21A 4EEEA 1XGRA 4NRYB 1FYTD 3FO9A 3P9MB 3U2SA 3OZ9L 1IM9D 3HZYA 5CJXA 3RUGE 4J3WA 4EDWH 3JTTB 2X4NA 5I1AB 5GGTA 5HHNA 5J6HB 1OTUC 5C0JB 3DUUB 3NCJL 5BZDB 4XAWH 4IOIA 4CVZB 2R0ZH 1UA6L 4GAGL 2D7TH 4GFTB 4M6OL 3MRBB 3ILPA 1IAMA 1W72L 1C12B 1N2RA 5LBSL 3FN0H 4JRXA 5ID1A 3SE4A 1J05B 1J7VR 3IDJA 1TIUA 1WQVT 3LHPL 5F7NC 5JW4N 1ZHKA 1T0NA 3JVGC 2EDQA 3U79A 5E6IC 1JF1A 2PO6D 2Z31D 3LQMA 4OFKA 1AXTH 4JG1H 3C5ZB 5KSUB 4ZFOA 1TFHA 3P9MA 2CMRL 1AFVL 5KVGL 2VZ1A 5DHVA 5C9KA 4R4NC 2BVTA 5GZOD 5JOFA 4HUWB 1H8NA 4BSJA 1AD0A 2MKWA 4DAGH 3HAEB 1A7NH 2KZWA 2R1XB 1MCLA 1PG7H 5CZVH 1JWUB 5AWNL 4E41D 3RIFF 3WBDA 1MRCH 4PJXB 4NBYB 4BQBA 1A6AB 2R1YA 3BDBA 3GMQA 1I3RA 1I1AB 3D85B 1BFSA 4LRIC 4X4YB 4TULH 1JTTA 1U3HD 1I3GL 2ED8A 4GKOA 3DO7A 1WBYA 1P1ZA 5DFWH 4HW6A 2MPAL 1S7TB 3RJDA 3QA3A 4L3CB 5BVJA 3GJFH 1T6WA 4LCUA 5FCSH 4AEIL 1WZLA 3QXAB 4OZGE 2H1PH 5B39G 5EZLA 5FDWA 1KCSH 1JF1B 3D2UA 5DZNA 1QBLH 4OF5A 4GS7B 4JO3H 1PY4A 5FO7B 2V5YA 2JK5B 3CU7A 5ALCH 4YHOL 5HYJD 2KZ1B 3ULUE 2W9DH 4I9WD 5ISZD 4NQUA 3D25B 2XXCB 4WFFE 3O6MH 4N9GB 3SKJL 2AJYH 1ORSB 4F7CB 4UBDC 2YWYA 3U2SB 3LKRB 4ERSH 1FAIL 3VFTB 4BH7B 1N6QH 2ITDA 2JCCF 1ORQB 4JFFB 4ZDHB 2XZZA 2AEQH 4JAMB 4YHZL 2XA3A 4NQCB 4OI7A 2GSGB 2AEIT 5T3ZH 2M8XA 2F5AL 5ELIA 3MUGA 4Y2DC 5D7LD 5BVJB 2NZ9D 2WIIA 4J23A 3RTQA 4X7FC 3BEVB 1LE5A 3OAZH 2F54E 4NBZB 4U1LA 2ILLA 5IW1A 2MQ3A 1IGMH 1QNZH 2WBJA 4C83B 4QGYA 3WDIA 1Y18A 4HUUA 4KPHL 4YX2H 1DANU 2QQKL 4YDJA 5E2WH 2O26U 1DLFL 1YN6A 1SJHB 1U3YA 2BNUB 4QO1A 1BIIB 4MHHG 1B6UA 1GXEA 3WUWB 5ICYA 2NY0D 1KENL 2NXZD 5LJYH 5HGDB 5J11B 3ARYA 1GAFL 2NYYD 2WANA 3O2WH 4MNGA 1AD0B 4RGMC 3H7BB 1LDPL 3OKNA 2W92A 3MZTA 3MC0A 4K7FA 4NUGH 3QXUA 3CUPB 4B7IA 2V17H 4KROD 1AXSA 3FTGA 3A6CL 1ZLWK 5JPNB 4D94A 1ED3A 1B9ZA 3MBEB 4WVRA 4ZQKB 5ISZB 2R4RL 4YHKL 3NIGF 2P5EE 1R3JA 4LLUA 4M62L 4U1LB 3WIIH 1J1PH 3LMJH 1YN7A 3O3BB 5DC4B 4P46C 1BGXL 3EFDH 3DX9A 4XNQA 2VDRH 3BH8B 4UQ3B 4DZ8B 4HXBH 4M48L 1A02N 2AS5M 7FABL 3ULVC 3BWUC 3EYQD 4HPYL 4M00A 2J7LA 2BDNL 3O6LL 4G7YL 3HUJF 4ELKB 3OKNB 5K9JL 2ZUTA 5CJXC 4R7DB 2BY1A 4X8JA 3FQXA 1OAKH 3S35H 5DD5L 2F8XC 5I66B 1KBGL 3MV9E 4LDOB 3U82B 1YPZA 4OD3L 3IGAB 1PVHA 4LKXA 2IALA 1BREA 3VH8A 5JPMA 3C6SB 2OI9C 1EX0A 3QUYB 4JREC 1QLEL 4YC2C 4JFPB 4FOMA 1BFVH 2PXYC 3RWHA 2ZP0T 1FNHA 3HUJE 2O93L 1MFDL 4PP1C 1JGEB 3C9NA 3UTSB 1G7HB 3EYUH 2DQEL 1EEYA 5GGTH 4CMMB 1DSFH 1IARB 4OCXL 2R9HD 4PRPE 3S6CA 5IOPA 1OTSD 4V3EB 1U91A 4V1DB 2L0DA 4DGYH 1I8MB 4XAKE 1XH3B 4TUJA 1IVLA 1RIUH 5CJOH 1GYAA 3ARGD 5TE7H 3GSQA 4EIGB 4NSKA 3TBVA 4P5KB 1NAMB 3BPLC 4X8JB 2J5LC 4N0UE 5CD5D 1C1EL 2XOTA 4LCWD 4IJ3C 32C2B 3KPQB 3D85D 1NLDH 4KROC 2HKFL 4P3DA 5CSZA 2DM3A 3SDDB 2WUBH 2HJKB 2Y07H 4FQJL 1KF9B 1Q9LA 4AYFA 3PGDB 4MAYA 4I0PD 4EQ3A 1QRNB 3QR2A 2W91A 4FQ2H 3NFPA 1G7JA 2IAMB 3ARPA 1S8DA 4MJ6B 4FABH 5IHUL 1G7IB 1U8JB 4KK6C 5IB2A 5D5ME 1A6ZA 3S3PA 3JV5A 3BN9D 3WS3A 2XNAB 5DYOA 4U1HA 2CK0H 1QBAA 1ES0B 5HGAB 4XTRC 1N26A 3LQZB 4LLDB 2RCSL 5E5MB 4ONHA 3SE8L 5HHPB 5F97E 5C0RL 1FL6A 4DGIH 1PEWA 3HI1A 4DZBA 2YPVH 5BMFL 1MCKA 1NGXA 2G2RA 4IEFB 4O5LH 4TVPD 3SOBL 25C8L 1EA9C 3GB7A 3CLFH 1RZGB 2FZ3B 1AGDA 3PJSB 5FHBL 4HZLB 1C5DA 4FTVE 5DUPH 5T3ZE 1FNGB 2F19L 3X12B 2V2TB 1WZ1L 1ZGLM 3UTTA 3ARTA 4JFPA 1LO5A 3ZKNC 4P5TC 5FKPB 2XY1A 2VZOA 3V6ZA 15C8L 3GSRB 1JPGA 5HHMB 4XPBH 4NQEB 2Y06H 2BNQE 5T3XL 3LPFA 4XNXL 4NZTL 5L2KD 4HT1L 2NXYB 4HKJA 3MV7A 4PRHE 3PHSA 1S9YB 4F8QA 5F7FA 1DQJA 3SGDH 3HMXL 4KV5E 1RUML 3GSXA 4Z5RB 3BPLB 5MENA 1MRDL 3RZCA 1OARL 5E8DH 3MRKA 4M7KH 3SKOB 4ELMA 3UROR 1NEUA 3W0WB 2QR0A 2XA8H 5I8CB 2GW5A 3OJVC 1VCAA 5L7XL 3MLWH 2F53E 4HS3A 4GRWE 4XP5H 4E41A 3BDYL 1JNLL 1UM5H 3O3EA 1P6AB 4TPRL 2OTWB 1U8LB 5LGHH 3HR6A 5C0CD 2DAVA 4R4BB 4WHDA 1XGYL 4HIHB 1NLBL 5DC0A 3LQAC 1JMZA 3L5JA 5JNYB 2HFFB 2OZ4H 4PG9A 3KXFB 1CU4H 5C6WH 5JDSB 2VXUH 1EH9A 4XHJC 5B21A 1H8SA 3QPXL 1HHJB 4LEOA 5EA0H 1FYTB 1CL7L 1MQKH 4QGTA 3TIDB 2RIKA 2D7NA 3DRQA 1CFTA 4X6EB 5C8JA 4BFBD 3LKSB 4W68A 4CMHC 3Q6FA 3Q5TA 3ZE1F 1UEMA 4M1GH 2BVOA 4L8SB 4Z7WF 4POZC 4TNVK 5I17A 3T0XA 4M7JH 2BY2A 5F7EH 1M05B 2ENYA 5JOFB 4U2ZA 3G04B 4Y1AD 1CDHA 2FZ3A 5DUBA 1T1YB 4N1EA 3GJEA 5KVEL 3VXTB 1PKQA 3U48A 3WD5L 1QEWA 4IHOB 3MYJA 4R8WH 3OKKA 3O9WC 5GHWH 1QR4A 1SJEB 1P69B 3X12A 2JF1A 4PG9B 1MAMH 2PYEB 5FKAA 1OM3H 3RBSA 4IMLA 2VJXA 1BZ9A 1IC4L 12E8H 3MQIA 2ARJB 4WI3A 3BZ4B 5MEPA 1ADQL 2OLDA 3NBNA 1KTRL 4S10A 3B3IA 2R56L 5JXAH 2JELH 2FX7H 4G8IB 1FNFA 4H5SA 5I8EB 3IU4H 4LVOB 2HTKC 1A7PL 4L5FL 3TYGL 4XRCA 3WCYA 5I19L 5LQBH 5MENB 4LIQL 5DD6B 5B3JF 1KFAH 3MACL 4OKDA 4LHUB 4C56B 5FCUL 4MVBA 5HYJA 2NY4D 4FFWC 2DD8L 5J3HC 3OGCA 4YHLL 1I8LC 2NPLX 5C70A 4BH7A 4GG6E 2BC4A 1C7TA 3GNMH 1CLOL 1IGYA 1B4RA 3NZ8A 2EYTB 4HGWA 3QBTB 2OL3A 4YIQB 2Z92B 4PV9B 2XXMB 4NKDA 3WNMA 5M94B 1FLRL 1T1WB 2FH8A 3BRFA 3V4UH 1FDLH 1J0KA 1X5ZA 2IANB 4FZ8L 5GGSA 4HWZB 3KLSA 4U1MA 2AJSH 5AZ2H 3D69A 5I9QC 3W9EA 4NFDA 4ZO6A 2A6IB 1VFUA 2VZVA 2D9QB 4U1NB 3S5LA 1F4WL 1HCVA 4F15B 4QHLB 1YN6B 4N0YL 1OAYH 4FQQA 5IB4A 4KROB 4UTBH 1FZKA 2FATL 3T2OA 1FNEA 4DK3A 2JCCA 4OJFL 4AQ1B 3VXSE 4AIXA 4OKVA 1MHCA 1VFBB 3V5DA 1JHKL 4KZDH 2NXZB 4PGJA 4CVXB 1NBVH 4X6DE 2HRPL 2EDRA 1GGCL 3WS6A 5CP3A 3FO1A 5H8DA 1EJ6A 3LIZH 1T0MA 4X99A 4EXPX 4YQXL 3MRMB 4NIKB 3ARDC 4NQCA 3SDDD 2ITCB 5EU6B 2AV7B 4HX1B 3NCCB 3B8SA 4LDLB 7CGTA 1U8NB 4TRPH 5GJTH 3G9AB 3W11C 3ZKND 3KDMB 3SDYH 2C4FT 4DTGH 3RGHA 3MJ6A 4GBXD 3QUKB 4HSQA 2ADFL 2P8MA 2WY3A 5ITBH 4G8EA 1EZVY 4QT5A 1NAMH 1KN4H 3O3UN 1JGLH 3KPSA 3R06A 4HUWA 3MBED 5I1JH 4ZOCA 1EAPB 5C92A 3OB8A 1MCBA 4F37K 1DN0A 1XR8B 4WHCA 1Q0XH 5DFVD 4YWGL 2GT9A 1NMBH 2H41A 3AY4A 4M1DL 1YECH 1UYWH 2Z0BA 3MA7A 2XKUA 1V05A 3MXWH 4JANB 4G9DB 2CJUL 2E6PA 1HKLL 3TV3H 3QXWA 4YO0A 1T1WA 3V4VH 4OD1H 3UJJH 1HDMB 3WSQL 4KVCL 5E4IA 4U1MB 5D4QA 2B4CL 2X41A 2BCKA 4RA0C 2F53A 4FNLH 4KHXL 1INEL 5T3XD 1TJIH 1D5XB 3O2DA 4XMKL 3VGBA 5DMKB 2CO7B 1RZ8B 2MHAB 2A9ML 2DRUA 2ICWA 3PWJB 5E2UL 1HCFX 3V9FA 2HLFC 1UZ8B 5HVGB 1FBIH 3WIHL 3MOBH 3T1FB 3OHXB 1P4BH 1FH5L 4GXUN 5IBUG 4LSVL 5IBTL 2HJFB 1SHMA 1I4FB 2XG4A 3FRUA 4NQXB 2D2OA 3RP1A 2IBBA 5CJBA 2R0WH 1JZ8A 1KNOB 4GRLB 3W2DH 4LQ1A 1XGUB 2RJMA 1FSKB 1KCVH 4JDVA 4FQCL 5HYJE 4LGPB 4WENB 2AP2A 3MYZA 4XVUC 2HJKA 4I9WE 2FSEB 2YKLH 3O9WA 1DQTA 5GGRB 3QIBD 4K94C 2HN7A 4ZS7L 1I1YA 3IKCB 3QIUD 3HC3H 2WIIB 1CE6A 4Z8FL 3QJFB 2NZ9C 3SO5A 2AI0H 1A1OB 1MJ7H 4MAYD 2WLZA 3SO3B 2IGFH 3HHRB 5GISL 3LB6D 4F7TA 1KPUA 3DJ9A 4L9LC 4JN2A 3SDAC 3FFCD 3HAEG 4UILL 2A74A 5I1GL 3WV0A 4HJGB 1ZLUK 5EUOE 3MRDB 1OAUL 4J6RL 5IR1B 3TIEA 5IGXL 3I84A 2KH2B 1SY6A 3L3DB 1HN1A 3QEGH 4KKAC 4XMLL 2YD5A 2IADA 4P23C 4TTDD 1D3CA 4XNUH 2XZAH 3FQNB 4YJZL 5HGBB 1UVQB 1BQLH 2W9LA 5DVNA 4M4PA 3SKNB 4MDIA 1IQDA 4MZ2A 2OL3H 4QRUB 3HI5H 3TA3B 3GMLB 3IFOA 4OCNC 5E9DE 1OPGH 1LP9B 1PBYA 1ORQA 4KHTL 3O8XD 3J7HA 5C6TL 1MCWM 4UNTA 2Y1VA 3K8KA 1L8JA 5MP6L 1KXTB 3F7RA 1JI1A 4E42B 4NDMA 1FORH 3RTQB 3M8OL 3WL9A 3SJVB 4D3CH 3R0NA 3IDYB 2V6HA 1MHHB 3GBLA 2A1WL 1EBPA 2EIDA 2VYRE 2YA2A 3D39B 4X4ME 1IL1A 1CXEA 3BAEH 3UPRB 5DJ2B 3TBTB 4KRPC 4BQ9A 4ODBD 1RAMA 3KYNB 2YK1L 2IPUK 4NHCH 4M6ML 4J4PD 1I85C 1UH4A 2UWEA 3SKMA 1OW0A 5FYJU 5HHQA 4JB9L 4U6HB 1YYML 2GKIA 4JO2H 3MV8A 4WV1A 6FABL 1RZJL 3WS6C 4HWEL 5C0FB 3HNVL 5LKNA 4PB9L 4GJTB 3FO0H 3C2SA 1OSPH 3ARFD 4OQTA 4KFZC 1IGJA 4G6KH 4E5XB 1YEKL 3MCG1 2DJSA 4OIIL 3ARDA 5E9DD 3ULVF 3VFRA 1UB6A 3QAZB 5JW5B 1CG9B 1CXHA 3TBWB 5GS0C 1AJ7H 2COQA 4ZS6D 4FQLH 2ZKHL 2VC2L 3MGAA 4PJ5A 4CMMA 5IEKA 4LGSB 5I1KH 3EYFB 4L3EA 3GBNH 4CW1B 3CPLB 5CUSH 4H8WC 1FVCA 1UXSA 1E0OB 2R2EA 1IAII 2FWOA 2R69H 3QH3B 1IGCH 1YJDH 1BJMA 1IGIH 2IBGA 4LPTA 3NVQA 5DJYB 4U0RB 4PRPD 4JKKA 1RURH 5KVDH 4JGJA 4OLEA 2FD6L 1M05A 2BSED 3AY4C 3GRWL 4G7VH 4UT6L 2JIXB 1O5DT 4WHYG 2OTUB 3H9SB 1FL6B 1RK0A 4JGMA 5D6DA 4X6DA 4PTTA 5ITFA 4QRRB 1I1CA 2VXVH 4POYA 1NFDB 1HZHL 4GH7B 3ULUH 4OZ4B 4XX1G 1IT9H 4TNWF 2FBJL 3IJYA 3PXJA 4KXZI 3D0LA 3WL9B 1NANI 2VTFA 1RJCA 4MD0B 5D1XC 1AI1H 4QXUH 2VKXA 1LEGB 1WT5C 1E6OL 1A6TA 1E27B 1JGVL 1TJHL 1PLGL 3C9NB 1JYNA 4TUOA 5GS0H 4Z7WE 2R2EB 4FQXD 1K85A 3QUYC 4JN1H 1MVUB 2BJML 4OTXH 1NUFA 3FB6B 3WFDH 2Q6WA 4OZHA 4N0CD 2CLRB 1K2DB 4Y5VB 1F4HA 1DQLH 2XQYK 3EYSH 2NY5H 1AQKL 2CKBL 2IBZX 1JNJA 2FLBT 3FQRA 5DS8B 2MWCA 1HH9B 1DE4A 4CVWA 1PFCA 5DEZA 4DVBB 4MQXD 4L4VB 2OX5A 3RWFA 1S7XA 4H1LA 1EJOL 5FA4B 2Z92A 4PV9A 5H2BA 5AYUL 1GGYA 5T1LB 2FJFA 3LS4L 4NC0B 4OD2B 5FK9A 2ENSA 2IANA 1AGBA 4NWUH 5DO2C 3TBWA 5M7QA 3DROB 3TNNA 3DMMA 5TE6L 2KPNA 5I1HL 3OQ3B 5DYOB 3KYOB 5CCKH 3B2UC 3VFVB 3RGVD 5EG6C 5D72L 3G9VA 2Z91A 5T5FH 3VGEA 2NY3D 4Q74A 4C4KT 1JL8A 3VD9A 5D7KE 4KJYB 2EE3A 1EEZA 3B3IB 3V0VB 4KK9D 2O5XL 2FGZA 2GQHA 2AK4E 3MV9A 1YNTB 5E03A 5FB8B 4JFXB 1U3HB 4MXQD 4PGDA 1BX2B 1SMAA 4HF5H 5KVFL 2EXWD 1F00I 1DBJH 3RKPA 1Z2KA 4NKMA 1U42A 3QDJE 1UKQA 4RFOL 3NIDF 4WUUD 3FO9B 5CINL 4PY7B 2F53D 5CEXA 3X3FH 4NNYA 3DBXA 4JHWL 4N8CH 1JMXA 1KELH 2EZ0D 4F80A 3RL2A 1CGSL 2GCYA 1QUNA 2N56A 4CKVX 4XCNA 1X6NA 4QHKI 3W39A 1WITA 3MRFA 3P73B 4FFWD 3ZDZF 1CXIA 5GS2D 4H88L 1K4DB 5F71A 4N0CC 3WNPA 4JM4L 1IKNA 5ECJE 4QRSA 4QYOA 1F4XL 1I85A 2D0HA 2UV3A 3D2UB 1K8DA 4FQXC 4MXWH 4H1LH 3G6AA 1OW0C 4QHLA 1CTOA 5DLML 2BFVL 1DDHB 3EDEA 1J88A 4GW1A 4U0RC 1CF8H 1IBGL 3DX6B 5IKCB 4MB4A 4YR6B 2GFBB 1KC5H 3QEHA 5F1NB 3UYRL 5EZIL 3FQWB 3F12A 3FB5A 2J5LB 1ZLVK 3S36X 4JVPA 5DRXB 1OAQL 1JFQL 1UQSA 4ELMF 4OCYH 3WFBH 2Q8AH 3W39B 2R0KH 1OGTB 3LOWA 3DVIA 1MVFA 2DQGL 5D7SH 3TO4C 1BAFL 4HCRL 3QQ9C 1YNLH 5DRZB 2CRYA 1F58H 1H3XA 1LO3L 4RMTA 4MAUL 3MRLA 4Y4KA 1XMWA 3MRIB 4YDKH 3C09B 3T0ED 1F97A 1UKTA 3QZWB 1IGFL 2I60L 5SWSD 3MTRA 4PBVC 4KK5C 3H42L 3C2AL 3SBWC 5CLWA 2BNQA 2FO1A 1CLYL 2MQ0A 5FM5O 3OX8B 3P0GB 4EDWL 4GRLA 1QQDB 2X4OB 4NCC1 2G9HB 5DMIL 2P24B 5ID0A 2B2XL 4G6MH 1FG9C 1FVDB 5D6DC 2F5BL 4GAGH 1RVFH 1IKFH 1WCBA 3NMEA 4NKDB 5F88B 4BZ2H 3CUPA 3TZVD 4M4RA 5EO9A 4OKVB 3MA7B 3I3DA 3O9WD 3NABH 3RX7A 5CJ8A 4LLQA 5DA4A 3VD3A 2WUCH 3LHPH 1WT5A 3M45A 5C9JB 3VMPA 4BUHA 4GW5A 3TCXA 3IXTA 3K0WA 3AXLB 2EIBA 5ESAB 3RVXD 4OZIB 3KJ6H 2VL4A 3CX5K 3FFCB 3DV4B 3ARRA 1V3MA 1OL0A 5EPMA 1LD9A 2BY3A 3ULUD 5ISZE 4QXWA 4MNHB 1J1OL 3P77A 1K9TA 4CVUA 4XCEB 5CZVL 3KLAA 3MNWA 3SQOL 2XN9A 2DB8A 4YHPA 2HT3D 4G8EB 1H3GA 4LVNC 4FP8H 4HLJA 4PRHB 3JTSA 4RGOH 5EBGA 4UU9B 4ZUVA 4DUXA 3BKJH 4M9PA 1T0MB 4X99B 1MPAL 2VAJA 4XPHL 3MOQA 4POUB 3ARFA 2CRZA 3N1QC 1I3GH 1K4CA 3LPGA 1ZLUH 4K23H 4ONFL 3C6LC 5EU6A 2J8UF 1BECA 3V95A 1UACH 3SDAB 1OGTA 5F9WC 4GRWH 1N8ZA 1RU9L 1ZT4B 3BP6B 1A6VH 5FM8A 3P9LA 2P8MB 4U6VL 1IM9B 5ENWA 5FO8B 3MRIA 4I18A 2J8UB 2W9DL 3LN4A 3ZSSA 1F4AA 3OKEB 4EIZC 5T1KA 5FGCB 4BSVB 1EFXB 4ZO7A 2BCKB 4HUXB 1FAIH 2H9GB 1GIGL 1MH5B 3EFFB 4WNQA 4P46B 5C71A 4PGCB 3O6FD 5GZND 2CUIA 1W0YT 1OGAE 4OLWL 1ZHLA 4M8QA 1MNUH 3S36H 1PKOA 4PJ8B 4PJHF 5ICYB 1Q94A 1YEEL 1JZ7A 4YXHH 4I2XB 1WGOA 3SGJA 1HHHB 4G8FB 1UM4H 3H7BA 3KAAA 1JYXA 3RY5A 3VWJD 1K8IA 1I1FB 4OBRA 4ONGL 3IETA 3SE9L 1N4XL 3MGOA 1ZA6A 1WBYB 3CDCA 2CR6A 4N0CA 3IXAA 5MEQA 3GIZH 4OLYH 1C8PA 4FXGA 1UFUA 1CLZL 4QRTB 4FQXA 5E8EB 5HY9B 3VJ6B 3UTSA 2X4PA 4RAHA 2E8YA 5KJRL 3O3AA 4NNXA 4LFHG 3HPLB 4D9QE 2FSEA 3PP4L 2QL1A 3A6CH 1UC6A 1WZMA 1HNFA 4ODUA 1LO4H 3H9SA 3WIIL 1UKSA 2IH3A 2QQNH 3TJHC 4HZLA 1FZMA 3UP1A 4ODHL 4XNYL 4ZSOB 4U7SA 2A83A 4OB5H 1RIHH 4HUVA 3BJLA 1IMHC 1W2KT 3RZWA 5DR5H 1JWMB 3ARDB 4XWGH 2OQJB 1CI5A 5E95B 4WI7A 5D70H 4Y4HA 4JPWL 2K3TA 1TJGL 4XT1C 1SJVA 1ZWIA 5ETUA 2ZOKB 2N7AA 2CDEA 3GSOA 4U2YA 5D7JD 2OK0L 3GBMH 3EOTL 1AO7D 2AK1L 4TOYH 3LQZA 4NM8L 3QFJA 5INCA 3P4OB 4P2OD 4GRLC 1G9EA 4QCIA 2AXGA 1OAKL 3S97C 1G7HA 1BLNB 2PW1A 3QCUH 5FA3B 5IMKB 2V2XB 5DS8A 4PTUA 3DXAA 4LRNL 2AJXH 2X1WL 5HHMD 1EMTL 2IPUG 3MUHL 5DJ8A 3C5SB 1KJ2H 3HZVA 5I8KH 3QO0A 3O9WB 4Y2OA 4F3FB 4EZMA 5FV2A 1Q94B 4PJHE 1NGYB 1TVBB 1MFDH 1D5BA 1IQWH 2OQJA 3PDGA 1I3UA 2RFXB 3I6LE 1NFDA 4KQ4H 1ITBB 5GJSH 1NGQL 2AKRB 2PKDA 3QG7L 3HCVA 4OFPA 4OSUH 1EVUA 3VFVA 5IMMA 3U1SH 4M43H 4JKMA 1IE5A 4NFCA 1XAUA 1JCKA 4U1GC 5ERWA 3TT3L 1X3DA 2HFGH 4QXGL 2W65B 3CH1A 5DDHA 2P5WE 3C60A 2BVEA 1R5VB 2ARWA 5T1MA 3W0WD 4ONOA 1EGJL 4LLYB 1OY3B 4I0PB 3PQYD 4WY7H 2HAZA 1U58A 1NGYA 5B4MC 1T1YA 4AZ8A 5FUZL 4BJLA 3MRNB 3HS0B 1B0WA 4K3EL 3GI9L 3MYJB 4OGZA 4QHNA 1OCWH 4P9HC 2IAMD 1K5NA 5F8QC 4M6AA 2R1WB 4OFYA 4FS0A 4PYHA 4GRMB 2JB6B 5HJ3A 5DHXB 2V2WA 3BGFB 2BNQD 1T66D 1SBSH 2VDQL 4KVNH 5FM4A 1RUKH 3JWDL 2VE6B 2OYPA 2VQTA 4PJDF 5F1SA 2EDOA 3MXVL 2BVPA 3MFFA 1M7DA 1T1XA 2Y72A 4QRSB 5IT2L 3VXMA 4O5LL 5BS0A 1N6UA 3T2NH 4BK5A 1T2JA 3GFUA 3GHBL 2Q20A 4KKBC 1JP5A 2QQQA 1OOAA 3QUMB 2IF7A 3VWKB 3NA9L 4YHYC 3VI3E 4O02L 1NAKL 1ETZA 3P9WB 4S0SD 4QHNB 3MLTB 3LKPB 4HJ0C 1Q9KB 1G9ML 4I3RH 1S7UB 4X6BA 1AR2A 1U3HA 3W0WE 4KDTC 4C4KO 5I74C 3BKCL 4G6JH 5JLZA 4U7MA 3QP3A 4P9HH 4XGZA 2E7BA 3IJHA 1U92A 5E99L 5I1CL 3VI3F 2DQCH 1PW3A 4L3EB 2LU3A 1AC0A 4OF8A 5KZCD 1S78D 1ZHKB 5HDQH 1BM3L 4PLKC 1Q8MA 2F54A 4Y4KD 4N9OB 2BVQA 2X09A 4YHIB 1LGVA 4HC1H 3GUTB 1J8HD 4NC1C 5C2BH 5L8LB 4IDJL 5BRZE 3PWUB 1HYSC 3C09C 5L2KE 1XFPA 3QXDB 4DJMA 2YPLB 5AZEL 4OZHF 5E6IB 3T3ME 3VFUB 4JZNB 3BD3A 3HZYB 5HHXH 1REIA 1GHFL 3BQUA 5KANI 1NEZG 4QWWD 2AEPL 4PGEB 2C4XA 4OFDA 4CGTA 4Y4HC 5AUMB 4NZRH 3P4NB 2EDNA 3BPOC 3LEYH 2E7HA 1WFOA 5ADOL 3HE7A 3EOBA 1A6TB 1E27A 4DEPC 1Z0NA 3IYLW 3OXSB 3ZE2F 2IFGA 3S96A 4UV7H 3IFLL 2E7MA 4RFEA 1OP9A 3KNBA 4CL7A 5JW3H 5T1KD 1D5IL 5MEPB 3MCLH 2DI7A 5D1QC 1T0NB 3CSYA 1K4DA 3LS5L 4D0CA 4HJ0D 4P59H 4S2SB 3RNQB 2EZ0C 1BZ7A 2X89D 4X7EC 5EDXA 4H5SB 3DURB 3UJTL 1T5WA 3UPCA 1KOAA 43CAA 1BPVA 1OTTC 3F62A 1J1XH 1BFTA 4OCMC 4Z18A 4MMZC 5C0ND 5F8RC 4LARL 4OBSA 3N9GH 4PJEE 3P4NA 4DN4H 43C9B 1R3LA 4N1CA 3E2HB 5CBAB 1MCOH 2LVCA 2X9YA 3BP5A 3OXSA 2JELL 5CMAB 4LSSH 3T0EE 3ZYOA 1I9JL 4GRWF 2A6KB 5TF1L 3HUJB 1SJHA 1EPFA 4MNQE 3AXLA 3MX0A 3C60C 4GKSB 3GMRA 1SYVA 3DV4A 2AK4B 3CFEA 1GSMA 2XTJB 1A3RH 4WEUD 3N50A 3LDBC 1GC1L 1QPXA 2YD7A 5IVZB 4KH2A 3TH4T 4U1NA 4QHMB 2ZUXA 3JVGA 3K1DA 3NFSH 5C08D 3ZE2E 3R1GH 3P4LA 5GRZA 2BVYA 2GYSA 4HDIB 1U2HA 2X05A 3JUZA 4H0HB 5DHVH 4QTIL 5FGCE 3THMH 4PJGB 2ORBH 5GS3A 1NDMA 2UZIH 4NNYB 2AJSL 4OLXL 5HYSA 4RWYH 5SV3A 3RWDB 4KK5D 4UIMA 1KEGH 3DWTA 3C60D 5BXFA 3NCYS 4JFOB 5GS2H 1NCAL 1TVHB 2HFEB 3BD4A 2EIEA 1MJUL 3UTQA 4KUZH 3MR9B 3DX7B 3OSKA 5LGKA 1Z3GL 4UOJA 5FO8A 3X17A 4UT7L 4NGHH 3KLHD 1TZHB 1WC7B 5L88H 2CIIB 1JPSH 3KHQA 3QFJD 3MLPA 4OCRL 3EO1B 1ZV5A 3INUL 5TDOB 2BSSA 3WEXB 3ALPA 3GSUB 4JVUA 3RL1B 4RX4A 4NQDB 5CEZH 4UDUA 4MA1C 1OAZH 3FQWA 4LP4A 1GGBH 1RZIA 4YZFE 4NQED 2IPTH 3VXMD 1I7RA 4Y2DB 5D1XD 5I1DB 4GW5B 1D5MB 3U46B 2ICWJ 1NGZB 1TCRA 4DVRH 3ILQC 3VFNA 1NUDA 5DD3H 2H32H 5D71L 3D69B 2V5RA 4QTHA 5EU6E 1G7PA 2GSGA 5HI4C 3IKKA 4XX1E 4OCWH 2ZOKA 3IU3A 3MRPA 3RTQC 5F6IC 1E4XL 2B1AH 1YEGL 1I75A 1SYVB 4ODSL 1HHIA 5EZOL 3P4OA 1GOGA 5KSUA 5ACZA 2YD4A 1UWEH 4Y4FB 1QFWH 4ODXA 2WBJC 1BOYA 1DBKH 4J8RB 5DJAA 3AS0A 3A0OA 2DQJL 4ODVH 4WV1B 2CDFB 2GJ6B 1FNLA 1W0VB 2H2PD 5EUOA 3X11B 4F7MA 5AAWA 2YRPA 5HDBE 1ZT1B 1TDQA 5HGHB 3O11A 3IDNB 3HNSH 1WIOA 3T0VA 1TTFA 4YK4C 4NZDA 1I9RH 2DTMH 4XH2A 5J3HD 5CGTA 3QNYB 4MJ6A 1KEML 4E0RB 5IB5A 1CK0L 3ARGC 5F9OL 1TQCC 4O2EA 1JPTH 2VQUA 3NCMA 5BS0D 4MXQA 2Z93B 3U30C 3TVMD 3WHE0 5JPNA 4G80B 2EIZA 4HIXH 5IBTH 3ZKSD 3ULSA 5D1QA 2IH1B 4HBCL 2X5PA 5E70A 4CDGC 1CE1H 1F45A 4K8RH 4B0MM 5MEQB 2JJSA 4LK4A 4P46A 3D3VE 3DI2B 3MRDA 4LHJB 4XNQB 2OS7A 3FN0L 3SKUD 3F5WA 1AGEB 4HFUL 1CDBA 2V17L 4HCRA 4Z7QF 5JR1H 4NQDA 4PRHA 1PSKL 3MRNA 3QHZH 4Y19D 1L7TL 4CN6A 1BQUA 4BZYA 5JW4R 3WN5B 1Q1JL 4RFNC 5J4MA 3NIFF 4NNPH 4AJ0A 3TA3A 1VESA 2B5IC 3S35X 3B6SA 4GRMA 4NOFA 1FFPB 1OLZA 3BEVA 3VGGA 2CXGA 1ZKAA 1YUHA 1CIDA 1RZFL 1S7WA 1MHEA 2YPKA 4EN3B 3AC0A 1TENA 3QSKB 4WO4D 3VWKC 2OI9A 3WXWH 4ZUUB 4MNQA 5IHZB 2J8UA 3O6LH 2PXYA 2RBLA 2YMXL 3FN3A 4L4JA 4CADB 4DN3H 3AUVA 5K9KB 4X5LA 3MOAL 2ADGB 3MLSH 5IFHL 1UH2A 1INDH 3MRKB 4EI5C 1A2YA 4KHTH 3Q0HA 4FFEX 1EUUA 5L0QC 4A6YA 4I5BB 1Q9OA 3C08H 3PG2A 5T1MB 5EFIB 5D7IA 2OMBA 5EU3A 4X6CA 5GSVA 2UZYB 3H7LA 4IIQB 3UTOA 4M8VA 3BKYL 2V2XA 1W72A 3QUZB 4ZXBB 3PXHA 1DSFL 3O6ML 3IFNH 4HC1A 4MAYC 4ALAH 4XP1L 4NZJA 3KPRE 2NY1B 3I6KA 4MB3A 4NN6B 3T2PA 5LG1A 5IP4A 3BRDA 4TVPL 4RGNE 4LCCB 5KS9E 1MUJA 1HXYA 1BLNA 4OUOA 1IEBB 3O8XC 3WNKA 5D9SA 3C5SA 1J8HA 1JGEA 5E5MA 3Q6GH 1LILA 3BFOA 2H2SC 4W4OA 3AREC 5BJTB 4R7NA 5DQJA 1ACZA 3F58H 2HVKB 5BVPH 1MWAH 2GUOB 1NGWB 4ZNEE 1MJ8L 4FTVD 5AAMA 2CDGB 4LSUL 2Y9RT 2YC1A 3D3VA 5DT1H 5CILL 1T7XA 2VN4A 1ZEAH 3CVHB 3IFPB 5FUOH 4NQCD 1BP3B 1XCQA 5E2TH 1YJDL 5C0RH 4GG6A 4YNYB 3HNTL 1FIEA 4P5TA 2V7NA 2EXYC 4GBXA 1W0WB 4V3DB 1L6XA 3RU8H 4S1SL 4EUPB 2P7TA 2EE9A 4G8GD 4NO2B 3NGBB 1KCGC 4NYLA 1J8KA 4GW1B 3L5WA 2VLRA 2XNAA 4LQFH 3BH9B 3S7GA 3FOLB 1CD8A 4Z7UE 3F7YB 1AGCA 4TSAH 4KKNA 3KGRA 1P84K 3RWIA 3SDDA 3RZCC 3ES6A 2FJGB 4B50A 3O2VH 2APFA 3GSWB 3DIFB 4CVZA 4Q9RH 1JHTB 1PG7X 3JV6B 5T3XH 5J89A 5KN5A 2G60L 2Z4QB 4M5YL 3GJFK 4XCCH 5IG7B 3I9GH 4LLAA 5GGSB 4CDHA 1MFEL 5F96L 4NZUL 3VGHA 1VEMA 5D7IF 3HAEA 1U6AH 2BJMH 3P0VH 3S37X 2AJ3A 1D9KD 4J1UA 2YUWA 2FGWL 2JB5H 1QKZL 3BHBA 3M1BA 2WW8A 4K07A 1CDIA 3DSFL 1YEJL 2CIKB 1I1AA 4HGMA 2Y5TA 3IT8D 3AAZA 2RHEA 4DFHA 4FHBD 5CEZD 1HHJA 4LEOB 1MWAB 5KSBF 1K8DB 3QO1B 4RAUA 4JHBA 1J0HA 4F8TA 3TESA 5EC1B 3QULB 3T0EB 2KKQA 2CO6B 3OMZA 4X6DB 3TA3C 1QFWM 4TNVF 1OP5H 2MKLC 1BEYL 3PWPE 4OLVH 2VDNH 4JDTL 3D39E 4OZ4A 2DLFH 3FQUB 2ITCA 1PKQB 1TVHA 2XTJD 4JRYE 4QRPB 1R3LB 4MJ2A 2M1KA 4RFNB 2DKSA 4X6DF 4HS8H 1MI5E 4K71B 2FBOJ 2EDYA 4JRXB 4GG6B 4XI5C 2Y5TB 4NQDD 3FFCA 1QBBA 1U8LA 1PZ5A 2Z31A 4P2YA 2NY1C 2FEEI 1Y0LA 2EC8A 4ZMAT 5CD3A 5IFAL 3CFKA 2IFFL 3F6LA 1X7QB 4ZNCD 3W0WA 4WW2B 3TPUE 5IIEA 3I75A 4G6FB 1XIWA 2VXTH 4IRJD 3DETC 1WV7T 2J6EA 3L3KB 3F6IA 8FABB 4HH8A 5D7KD 4HAGA 4DOHB 2BK8A 5F1OB 2YXFA 1U8HB 4Q9QL 2A9NH 3EJYC 1L9MA 1OT2A 1JZ2A 4JPIA 4JO1L 2BC4B 3U46A 1N3NA 1UXWA 2C3HA 2ICCA 4WI5A 4MNGB 3WDJA 1OB1B 4MJIE 4GAYB 4H25A 4XB8A 3T0AA 1NEZA 1ZA3B 5CJ5A 1SM3L 3MLXH 1RUAL 1DUZA 5CBAA 3E2HA 1D9KC 1CFTB 4PD4J 5DJZA 3KDMA 4TNWK 2DYPA 2GY7B 4GLRI 5DRZA 4ZFZA 4D8PB 1IAIH 2CD0A 5I2IB 1F3JB 4L3AA 3O8XA 3U6RA 2P5EA 4TVSa 3MRQB 5I18H 4POZD 4W4OC 2OJEB 3QDGA 1JFQH 2YUZA 3R8BB 3Q1SL 4PJ5E 2YOCA 2E9IA 3QCTH 3BYYA 3G5YA 4LLVA 1FP5A 1UENA 3MA9H 5KSVA 3NN8A 4BZ1H 3E3QE 2DQGH 3VG9C 5DSCB 2F15A 1U95B 3SY0B 4N5EC 2YS4A 5FHAH 3O4OC 5HPOA 4LEXL 1MIEH 4KMQA 4E0RA 4MA8H 4AT6B 4HDIA 2VDKH 1G7MB 5BRZB 4IRJB 1J86A 3CCHA 4P3WA 1OP3H 5HHVL 1P5UA 1PD6A 5AYQA 1FFRA 1N0XL 2L4OA 3L3HA 4OM0L 1NGZA 1TCRB 4RBPH 2YN5A 5DC9B 1QSFB 3RUGA 4L4VE 4XMPL 1ZTXH 2F53B 3RDTC 4TPRH 5LGHL 1FNAA 3DO7B 3TF7A 2X4PB 3VRJB 3LKNA 2NMSA 2GI7A 1JNHA 3PDOA 2HT2D 1P5VA 4M03A 4PJHA 3REVB 5C0IB 5BQ7B 3UAJC 2BSRA 1CU4L 2CKNA 3ARDD 3SDDC 2HYMA 4K9EH 4PRPA 2JE8A 4KUCF 3FQXB 3E0GA 4X7TA 2NY4C 1E4KA 2WNGA 5H35A 4L4TB 3TJEL 3MRRA 1EZVX 1IGYB 4R90H 3R4DA 1FC1A 3VI4E 3GDBA 1WEJH 4KTEH 3WFEL 1FZMB 2OL3B 3C6LB 4J3TA 3BI9X 4OZHE 2EC9T 3NCFB 1JPST 5JHLL 2DLHA 2HWZL 2UUDH 4M7JL 3MR9A 5FEBA 3RVVC 1UH3A 4CU8A 1CS6A 2BSTB 5CSZB 1N7MH 1GOFA 1A9BB 5IB5B 1XZ0B 5DUML 3D39A 3P0YL 3SDXE 3T3PE 4YLQT 1M71B 5CGYD 1I1AC 1QRNA 1EEQA 1B4JL 2B39A 2R2HB 4PB0H 3UPRA 1DFBL 1EHLL 3D48R 3WFZA 5DTFA 1RV6X 1S5IH 3DX9B 3ZHDA 5E8EA 1VACB 4OM1H 4L4VD 4J2XA 2BHZA 3RDTB 4HS6A 3TPKA 4BH8A 3PWJA 4A6YL 1NMAH 4KGJA 5JORA 3ULUF 3O3AB 3QFJE 1NFDF 3LKOB 2EDKA 3CFCL 2EEBA 5I1LA 1DVFB 4OD1L 1P7QB 3FZUC 4URTB 1SY6L 5JW4M 4KXZH 5I1IL 4PLJC 4KRPD 4FQIL 1KJVA 1A0QL 2VZUA 2FX8L 5I76A 4PY8J 5L0QB 3IGAA 3U7WH 1INEH 1MLCB 4CBPA 5BXFB 3DTXB 5DFTA 3I50H 4HWNA 1U8MB 1UWGH 2R2BA 4IRSD 4P2RD 3ZDZE 2OR8A 2DD8H 3U0TA 3WHXB 3MRPB 4G6AD 3M17B 1C5CL 3OZ9H 3I6KB 5L6YH 1FH5H 4XP4H 2UWEF 4LKCA 3O6KH 5LXGL 3NCEB 1IZJA 4NP4H 4KRNA 1CDJA 1A4JA 4P5TD 3V6OC 5JA8B 1FL5B 5HHPA 3CH1B 2YXMA 4L9LA 3ZDYF 3G6DL 1HDMA 1T7ZA 2XIDA 4HJGA 5CHNA 5MERB 4IOSD 4AQOA 5EN2B 5GGVY 3K46A 3L7EA