3TO4A

Structure of mouse valpha14vbeta2-mousecd1d-alpha-galactosylceramide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
292
structure length
289
Chain Sequence
b'YTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Vbeta2 natural killer T cell antigen receptor-mediated recognition of CD1d-glycolipid antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 77
structure length 289
sequence length 292
ec nomenclature
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3to4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3to4A01
1IQDB 1I7ZB 3WS6A 5HYJB 1S7SA 2HT4D 3LSOA 4FHBD 4NHUB 1BIHA 1BLNA 1J0ZA 2NNAB 4FQ2H 4KKCC 5HVHB 1IGFH 1W8NA 1PG7X 5I19H 2Y72A 1UB6B 3B6SA 4NZTL 3ZDYE 4CW1A 1BVLA 4GLRI 1BQHB 3V5KA 4JFYA 5CJXA 4CAGA 3MLSH 3P9MA 1EGJA 1HK6A 2APBA 4JRXB 1ZS8B 3RIFF 5JQHC 1U8QA 3VH8G 1YYLL 4YDKH 1FAKT 4P3CH 3T0DA 3C5SA 5E94A 5FHAL 3NZHL 3BDYH 4ELMF 3P77A 3FAWA 2WBWB 1A47A 4WFED 4HG4K 1NCBL 2VLRB 1FH5H 3U6RB 2ATKB 4J8RB 2N7AA 1QACA 4QXGL 1A7QL 4RWYH 2BNUB 2CR6A 3ET9F 3F7PC 3RNQA 1CXLA 4CL7A 1HSBA 2YPKA 4TNWF 3T0VA 1A5FH 3LN4B 1EFXA 4WTZG 5DJCA 4PLNC 3W11C 4L4TD 3EDDA 1GHFH 4YO0A 5MEPA 1DQDL 2MKWA 1F6AB 4AL8L 1B2WH 1Z6JT 3BZ4B 2B5IC 1DBAL 1R3LB 5D7JC 1U58B 3FB6A 2N7BA 2BDNL 5E8NB 3GSUA 4OUUB 3HG1D 2HT4C 1KNOA 2GSGB 4G9DA 1EHXA 4LSUL 1UYWH 4YBQD 4WW1B 1R5VB 3ZKSD 3AROA 2GFBB 2JB6B 1QEWA 4FXGA 4XP1H 1A0QL 5DJZB 2Y4SA 3EIFA 3ZKXC 1ACZA 3T0EC 2V2WA 2FATH 4PS4L 1F3DJ 1BJ1J 2OLDA 2YD9A 4OCXH 3BP5A 4RGOH 4AIOA 3WHXA 4KKBD 3HLAB 8CGTA 4D0BB 1JNNL 1VSCA 4ZPVB 3JXAA 2OR7A 4ZS7L 2X1XR 4Q2ZB 4YPGB 3ILPB 1DVFD 3HZYB 3VWJB 4MA8L 4ZTPH 5AG9A 1TZIA 5HJ3B 1H15A 4ISVA 5LJYH 4CVXB 4HS8L 5DJ0A 3VFPA 1P4LB 2Y6SD 5IVXE 3HAEB 4LASL 3E6FB 3HRZA 2APTA 4G9FA 3RIFK 5T1MA 2XQBL 3IVKB 1RIVL 5B3JF 3L7EA 3GMRB 2D0GA 4GRLD 4F37F 4Y1AA 5ID0A 5JR1L 4ZOCA 2A2QT 4OLXH 2FHFA 5D7JB 2AEQL 5CGYD 2GJJA 2CGRH 3VD5A 2VO5A 4TNWK 4MVBA 1A6UL 4WU7B 3N1PC 5JO5A 1A2YA 1KB9J 3HCVB 2C7UB 4OZIF 3ZKXB 2H2PD 4F57L 3ULVF 1KFAL 1ONQA 3BIKA 5KVDL 4NRYA 5H35A 3HNSH 5JDSA 3ESUF 4W68A 4G8GA 4PRBA 4IRZH 2R56H 3I6LE 1FVEB 1FL6B 1NJ9B 4HXBL 1CU4H 5A40E 1DQJB 3T08A 1RZJL 4UBDD 1A3QA 2YRLA 5C2BH 3QDGE 2VL5A 3GMMB 1OF2B 1AGEB 3ARRA 2JJTA 3GBLA 3OSKA 4XH2B 1N6UA 2GW5A 5T3ZH 3KWWA 3ULVD 2IPKA 1DVFC 2Z31C 1WWBX 3IFPB 5IFAH 3PGCA 3MRBA 1G7HA 1JGDA 5IB2A 3V0WL 4PP1D 5FDYA 2UY7A 2NY4D 3D25A 4X5WB 1Q9WA 4EVNB 5HDQH 3S88H 1IZKA 1JK8A 2Y6SC 1VESA 5BJTB 1U3HD 1QA9A 2BVYA 1MIML 4NOFA 3CDFA 3WUWG 3DRQA 3TV3L 1MY5A 4Q58C 1SJHB 4ODTH 4GRLC 4HLZH 1INDH 5F93C 5IMKB 4L4VE 2BOBB 2NR6D 4JG0H 1GIGH 1FV1A 5GQBA 3QQ9C 4X9BA 2VXVL 1OQXA 5CGYC 3E6HB 4XPBH 2GK0A 3ARWA 4U3CA 1BZ7B 4BSJA 2EIDA 3HG1B 2GTZA 5DLMH 1JUFA 2LVEA 4WNQA 2EE6A 3MFFA 4P4KA 1S7UB 4JFHD 3HZKB 4KHTL 3NGBC 4HWUA 4LSQH 2HJFA 4OD2B 3AXLB 4LRIC 5D8JH 5E8OB 5B22A 4F37K 1HNFA 1ZAGA 1W0YT 3DUUB 2E7LC 3AREA 4QY8A 1TZHA 4A6YA 4YBLC 2FX7H 4XT1C 5BXFA 1A4KB 3IJYA 1WFUA 2A0LD 3HS0A 3LEYL 3ARSA 1G0YR 1C1EH 1G6RB 3D2UA 2C1OA 4FP8L 1Q1JH 5EB9A 4PY8I 1EGJH 1YEGH 3T0XA 1DVFB 2Z31B 4QOKE 1UEYA 1YY9D 5C0ND 1FYTE 5CSZB 4FQPA 4I13B 3ULVC 2AK1H 1OCWH 1JYVA 5DD0L 4OLYL 3KPNB 3ARUA 4XNQA 1GZQA 1M4KA 3Q48A 2WUBH 1I1AA 4PP1C 1KEMH 3SKUD 2N4IA 2NY5L 2NY4C 5GXBB 4LLYB 5INCB 4ZPTB 5E95B 3G04B 2OP4H 1Q9KB 1AGBB 2CLVA 5E2WL 2VRAA 1U3HC 2PYFB 4GRLB 5KSAA 2XZQH 5ERWB 1D9KA 4WGVB 1EO5A 2DMBA 4Y7MA 3VFUB 3U0PB 1PEZA 2VLMD 2ADIA 4PJDF 4EDWH 2NR6C 2H3NA 3EJYD 3F8UB 4R4ND 4L8CB 4HJ0C 2O61B 3UYOD 2DL2A 1AGDA 2WIIB 3NGBB 1HNGA 3QFJA 4YHZL 4R8WL 43CAB 1MH5B 2BHZA 4X9GA 3UO1L 3QB7C 2FHBA 3QZWA 5E8EB 3V7AE 1TJIH 3FJTA 3BPLC 3CC5B 2J5LC 2AK4B 1QRNA 3O6ML 4X83A 4YBLB 2CLZA 4F9LA 2ZNXA 3FN3A 1F8TH 4I3SH 5CSBA 1C7SA 1S5IH 4ODWA 1LNUA 1IEHA 1GGIL 4PD4K 4MX7B 3RPIB 1MHPL 2EYSA 2F53A 1BECA 4LEXH 5BMFH 2VLJD 1D5IL 4PTTA 2X41A 3OX8B 2F58H 4LEOB 1CVSC 4OZIB 4C54A 2FEEL 2XA8L 3TYFA 4RGMC 4XAWL 3QJFB 5C0NC 3FHAA 3NA4A 2GUOB 4NIKB 3R0MA 2PXYD 4UIMB 4L8DB 2NY4B 1A7QH 4QXGH 1URLA 3BP7A 4HJGB 5C9KA 1NH6A 1U3HB 1T1WA 4NJ9H 5KANI 1NGWA 5TPWH 1F2XK 3H6JA 2R2HB 5HI4C 3CVIL 2CRZA 1OW0C 5CP7B 1AHWC 3OXRB 3C08L 5MEOB 4L29B 1KT2A 2HFFA 4AL8H 1YPZF 1QBMH 2VH5L 4DZ8A 1HQRA 4R4NC 3A6OA 4YC2C 1EX0A 1KJ2B 3BKML 3MPCA 2MPAL 3UP1A 3C2AL 3EYFA 1UXSA 3BPLB 2WSKA 3OB0H 2J5LB 5BVJA 1A0QH 3MV11 2B1HL 1XF5A 3FCTB 4X7TA 3D6GA 1XF1A 4GBXD 4ETQB 5F1IB 5EC2B 1UJTA 3S96A 3H3PH 1JNNH 3RWHA 1G7MB 1GGBL 3L5WB 5HI5D 4YHNB 1SYSB 3D39E 4LAJH 1F3JB 4RGMB 3L3DB 1NDMA 5GSVA 1WZKA 3SGJC 2EDOA 3GSVB 3BAEH 4JM4L 4OGYL 2ED9A 2FSEA 4QHMB 1MJ8H 3KLHC 4JRWA 5C08D 3ESVF 1FFOA 2PXYC 4D9LH 5JQ6H 1MF2H 3DSFL 3Q6GL 1ZA3A 3MBXL 4POZC 4ZFFB 1I9RL 4PRIE 4F9PA 3R8QA 3CFDB 1QUNA 1HHJA 3UBXB 3SOBL 4UDUA 3V6BR 4OLZH 4XCFH 5L2KA 3FB7B 3E8UL 5CEZD 5ICZB 4H88L 4OJFL 3SDXE 1S7XB 4WIQA 1NFDA 2MNUA 1U8MB 5DRNB 3VWKA 2UWEF 4YC2B 1MCWM 4MD0A 3UTSD 1A6UH 4FZ8H 4XPGL 4GFTB 4ONHB 5CWSA 3WHE0 3O3BB 5DURD 1KFAH 4LPCA 3MLUL 4YGAB 1EAJA 4GW1B 4IRSA 1NBZA 5C0BE 5C0RH 1L8JA 1KB5L 3QG6A 4MQSB 4PJDB 4LSSL 4QT5A 1LO4L 4GBXC 3PV7A 4V3EB 1RZJH 4A6YH 2VLJB 5FM5M 4NJAL 5I30L 1BOGA 4GRWH 2HRPH 1VHPA 3DUHA 1F45A 5ILTL 4M3JA 5IBUB 1N2RA 3PE9A 1AD0A 4O4YH 4MD4A 3FQUA 1P7KB 4JFZL 2EZ0D 1QHPA 2PXYB 3QIUD 2EDHA 3I50H 4P5TC 2ZPKL 3C9NB 4QGYA 2IAND 4HFWA 3QEQE 2WAHA 4PG2C 1OAXL 4XWGH 4QHNA 2NY0D 2Q76A 2NXZD 1NMAL 1V05A 5EBMA 2QSVA 5C8JA 4P48A 2VUYA 2G75B 3MYJA 5SX4H 1P4BL 4GG6F 4WFGE 3PQYA 1NBVL 4G6JL 4U1IA 2HJLA 5DVOA 5LCVH 5IOPA 2OJEB 3RX8A 1CDJA 1BBJA 4M62H 1HHKA 1MJJB 4DK3A 4PRPA 4LIQL 1KYOK 3QNYA 5JW3H 4P2OD 4M7JH 1KB5A 5LKNA 1LEGA 1NMCC 1IQWH 4PB0L 2P5ED 4JVPA 1R5IA 4GBXB 3MBEC 1IFHL 3O45A 4ORZC 5EU6D 5EWIH 1WC7B 2QLVB 3LEYH 2JJVA 3QUZA 4K23L 5EO1B 2YR3A 2XZAH 3CUPB 5DHVA 1E6OL 5L7XH 2EO1A 3TYGH 3RZWA 3PWLB 5C08B 3FN0L 5FYKH 3QIUC 3S36X 2RBLA 5C0CA 1KIQA 2VR5A 1R24A 1UWEL 2VLKB 4YWGL 5GGRB 2V17L 1JGVL 4MXQA 2NY0C 4QO1A 2A9MH 2NXZC 5HI3D 3GSRA 3C5JB 3U0TB 2GTWB 1J0YA 4KJPC 2LTQC 1VGKA 5F7NC 1HHHA 1VFAB 1CFBA 2CMRL 4HIIB 3S5LG 5MENA 2EH7L 2YPLE 3O3DA 1CXHA 2D7OA 1F42A 1SJXA 1F58H 2X6MA 1REIA 4ZFOB 2Q8AL 4CVZB 4BFIA 4O2EA 5ACMA 5FA3A 4R8WH 4WENB 5T1LA 2BXZA 3UO1H 4KKNA 5DURB 4UV4H 1HHIB 4M61A 1NMCB 3WJJA 3LDBC 2DLFL 3OHXB 4HHAA 4P4RA 3MOQA 3N85L 5IF0B 3NAAH 1FG9C 1WZMA 4O51B 2I07B 3IDIB 1N6QH 4PV8B 3DECA 2AGJH 2EKSA 4Y19D 5CHNB 4MD5A 1D5IH 1Q0XH 3H9SA 5TE7L 2V5TA 1FFRA 4LKXA 4J3XA 5DDHB 4N0CD 1GRWA 3A6BL 2XTJE 1YJDH 2XA8H 4R7DA 2BSSB 5AUMA 5GS0H 3PWVA 5FKPA 1MFCH 4PJFF 2YSSB 3QIUB 4TUJA 3OV6A 1MAMH 4F7TB 1RZ7L 4F3FB 2IANB 3E3QC 4N9OB 3I2CH 4XXCA 3T3PE 4MNGB 1MEXH 2NY0B 2WBJD 2NXZB 3OJ2C 1QPPA 1CDIA 3RWDA 3VXTA 2LTQB 4U3XA 5HI3C 4C58B 1BD2D 1WBZB 3OKKA 4IDLA 5ANMB 5BV7C 3DX8B 2UYLB 4HD9A 5D1XC 2CQVA 3D1MC 3JV4B 3BW9A 3DWTA 2I9TB 1RZKC 2XZCL 3WS3B 3GUTB 1P9MA 5C0EB 4EBQL 4G6AD 3NPSC 3OB8A 3UTTE 1PG7H 1DBML 3LEVL 5FA4B 3CJJA 1TIUA 2MPAH 5F7EL 2B2XL 3ZKND 3LDBB 3D0LB 3NIFE 4MAUH 4P2OB 3C5ZA 3D18B 4JY4A 4GG6B 2B1HH 4NDMA 1Y6NR 4MMXC 1OP3H 5BOZG 2P5EB 3KR3H 2VJXA 4MZ3A 5EU6B 5DRZA 2F74B 1JZ8A 4CU8A 1YN7A 1U93A 4ODSH 4X4XA 2ARJQ 1MFDH 4NO0D 1S7RA 3RA7L 3H7LA 2HFGL 4N0CC 5IV2A 5FDWB 4BZYA 2UVFA 5BQ7A 2NLJB 5ID1A 1KULA 2EDDA 2Y25A 2H6PA 4D8PB 1JWSA 2C3VB 5IUSA 3S7GA 4V1DE 3AY4C 3L5XH 6CGTA 1Y0LA 1RFDH 1YEDB 1X5HA 2E7BA 1F5WA 1CK0H 3MNWB 3NIDF 3RVTD 4C55A 2BX5A 3HB3D 2BC4A 5FM8A 5C0JA 4S0UC 2Y5TA 1NC2D 3C60A 2Q7YA 4EN3D 2QADC 3E8UH 2Y9RT 5DK3A 1DANT 4OJFH 2FCBA 3INUL 4HUVB 4GQPH 5CP3A 1WWCA 1XT5A 3QDHA 1RUKH 3MA9L 4G6AC 1WEJH 2E6PA 1EERB 1Z2KA 2YRZA 4P23D 1FLTX 4Z0XA 5KSBE 5M7QA 1KPUB 1UH3A 4OLVH 2ATPB 2YEZA 5GZND 1UT9A 4I3RL 2CD0A 4JRYE 3MRIB 4W4OA 3ORJA 4PRNA 2BVQA 1KB5H 5BZDA 4LSSH 3ZTJG 4ORGB 4GMTH 4FQQA 5CSGA 5E7BA 1SEQH 3DGCR 4RFEA 5EO0A 4Y19B 5HDBF 4DCQA 4HIXH 2LV4A 2E5EA 4Q6YA 4F58L 2ZUSA 3RPKA 5JA9A 2P8LB 1L6XA 3MCG1 4MSWA 1H3PL 4FXKB 4OZHA 4JFZH 5DHVH 4FQ1H 1FNSL 1EO7A 3T0AA 5B39B 1BHGA 4PJXE 3OF6D 3LKSB 2Z91B 4PDCE 2P24B 3KPSE 5D1QA 2P1YA 1HINH 3N9GH 2DWEB 2WBJB 3SE4C 1ZT1B 1OAXH 3L6FB 1FNGB 1NMAH 4DGYL 2WIMA 5ADPL 3GJEA 2IG2L 4EI5C 2WMPA 3HB3C 1DEEB 1U8LB 4MA1C 2CLRB 1BD2B 3WNOA 1VFBB 3VXMD 4EN3C 1BFSA 4W4NA 3GGWA 5F71A 4G6JH 3EZ8A 4WO4A 4XMPL 4YHOL 4PJFB 3GMNB 1Z0MA 3RX5A 4Z76A 2JK5B 3BP4B 1JFQH 1GOGA 4HEPG 5CZXD 1KIRB 3LZFL 5JHLH 1NBYA 2XICA 3WFHA 3G6JA 3ETBF 3U79A 4X5XB 1C5BH 4R3SA 5GS2H 1PQZA 1UQSA 5C09D 1INQB 2JB5H 5GZNC 4Z8FL 1IFHH 4U2ZA 5KSUA 4TTDC 4XNMA 4PR5B 3Q6FB 4Y8DC 4LCWD 1MCFA 5EA0H 1ZLSL 4NO0B 1LDPH 1LK3H 5D2NC 1K4DB 1NL0H 3ARDD 4FOMA 1E6OH 4QRPA 5HPOA 1OLZA 2ED8A 1OARL 3MLVH 2AI0L 5A16A 3JV6B 4WHYH 4XPHH 5D2LF 2FX9H 1OAQL 1MHCA 4HV8A 5D9SB 5DJDA 3FN0H 2E7MA 3W0WE 4NKMB 1E6JH 3MJ6A 5EUOE 1IGCL 3DMMA 4EDXA 3D3VA 4NSKB 4Z77B 1FYHB 2V17H 4EI5B 5IFJB 3T1WA 4LVEA 4NZDA 5C0FB 3U2SB 1A1MA 5EU7C 1NC2B 3WJLA 4EN3B 5FHBL 3ROLB 3S8WA 2DQUL 4HKJB 5IEHB 2VITA 1TQBB 3CSYA 4JVWA 1K2DB 2CMRH 5E9DB 3BJ91 4HC1A 5JHDE 1JYNA 3DX9B 2GEEA 4Z7VA 4AQ1B 1A7OL 1BAFL 5ESQB 4HPYL 5CZXC 5INDB 1ITBB 2KDGA 2HJKA 4PJBA 2EC8A 4KJYB 3EAKA 5I2IB 4R4FH 2ZP0T 5H2BB 1ZHLA 3W2DL 1AQDA 2DLFH 3WUZA 3H42H 2PTVA 5HPMA 1VGEH 1T6VN 1ORSA 4NQCD 2OZ4L 2Y06L 3VFTA 4DOHB 5ICYB 4BH7A 2EYRA 1FGVL 5CBAA 1K9TA 3DOSA 3TGXA 3B9AA 1P7QA 5D2NB 3RGVD 4O58L 3RX7A 4OUOA 3A6BH 3DV4B 1FVCB 3GSNB 3ARDC 3PWPD 2W38A 4HKZA 3M1BB 2ZOKB 3SKNB 2WUCL 4JQIH 3ZE2E 5JPNB 5KVGH 1RZ7H 3TF7A 4DKFL 4RFNC 4GW4B 4YXKL 1XF2B 2WQRA 1TITA 3OKLA 3GNMH 5I8CA 4DGIL 4AIZB 1JWUB 3VFWB 4EXKA 4QRSA 3IJHB 5IFHH 4NCDA 5BRZE 3VXMB 3IXAA 4PJAF 5FIEA 4PJ8D 1J1PH 3P4MA 5CINH 4JO1L 2EDBA 1YEIH 2R1WB 3N50A 5SX5H 1U36A 4RZCA 1KB9K 5FYLD 1JZ6A 5TFSH 2X70A 5C0AA 4EBQH 1RIHH 5CP3H 3RZCC 3G6DH 3LEVH 1DBMH 1E4KA 1Q9OA 4HPOH 4ODUB 1CS6A 4ZG1A 3H9YA 3S37X 2D9CA 5JIIA 3UTPD 4MXWH 3N1GC 1CG9B 4JREC 5C9JA 2OZ4A 5C09B 1G9MC 1R3KB 1TZGH 4AM0B 4S1SL 5ESVA 4W6XB 4NHCH 3BPNC 4XCNB 4JZJA 2P8MA 3QBTB 1B4JL 1F4WL 2D9QB 1I7UA 3QDJD 4OI8A 5DS8A 4NZUL 2FWOB 4JFQA 3RGVC 2YD4A 3ARDB 4GG8A 3LKPB 1I3RA 4G6ML 4YR6A 3BUTA 5GS3A 1IGTB 1P84K 3VRJA 4PJEA 1WZLA 32C2A 3OAUL 2JLLA 4Y2DA 4W6YB 5L2JB 1LVEA 1BQUA 1ZHBA 2YOCA 1I8LA 4RFNB 2OR8A 4FZEH 4M5YL 1JRHH 4UTAL 1N59B 2FX8H 4XRCA 4F8QA 1P6FA 2Z0BA 4M1CD 1UWGH 5HHOA 3EGSB 1ZHKA 4K2UH 5IJKA 3H7BB 2A83A 3KDMB 4X5LA 3TBTB 3QDME 3UTQA 2Y36H 1RUPH 2HYMA 4PJ8C 4NBYB 2AJXL 3QWOA 2B7DT 5EZJB 5F89B 4O02H 4S1QH 1IVLA 2Y7QB 3MRJA 3MA9H 3QIWD 4FG6D 2IALB 2PW2B 4JREB 1VPOH 5DEFB 3DXAD 4XBEH 3VFVB 1OSZB 2DTSA 3RHWF 4G3YH 3ARBC 5DUPL 5E99H 4G80A 4MNQA 4I3RH 3BKYH 4BJLA 3CPLA 3HI5L 5C0GA 4NQCB 1OOAA 1OTTD 2A6KB 1HXYA 2R0ZL 5CILL 1Z3GL 1IC1A 3RGVB 1J1OH 1CF8H 1MFEH 2QHLA 3QUMA 4ONGL 2Y07L 4G5ZL 5JXED 3OKEA 4L3EE 3PWPB 1ZLVH 3O11A 2A6DB 1H3PH 5HHMA 1CFSB 3EKCA 4U1NB 2OX5A 5LGJB 3IU4H 1MRFL 2IQ9H 3GO1H 3QDAA 1QG3A 4HKXB 3G5XA 1I8KB 4UINH 4HQQL 1LO2H 4DGYH 1IL1A 3Q1SH 1XGUB 4M1CC 1OD7A 4JFDB 2MOVA 3VGEA 4DEPB 1L0XA 3EOAB 4PJ8B 3LIZL 4QF1A 5E4EC 3DX6B 3RWEB 4Z7QE 1TVHA 4P2QE 5D6DA 1ES0A 2OJZL 3OR6A 4HC1H 4Y16C 2BJML 3IJSA 4XXDA 3S35L 3QIWC 2AXFA 4MZ2A 1FHGA 3DSNA 4PLKD 5C6PB 1KCRH 1SQ2N 3CFEA 5SWQA 5TDOB 1P1ZB 4PJAB 4U6VH 4NNPL 2A6IB 2I5YH 4X8JA 3FQWB 3T0BA 1FDLH 3KYMB 5FGBA 2C1PA 5F97E 4NZJA 4ZUSB 4QXTB 1MVUB 3QDJB 4LCCC 1ZLSH 1D5ZA 43C9B 2PTTA 4Z0BH 2VXTL 3QPXH 2AVGA 3GMPB 3AAZA 3UJIL 3RHWK 3PWUA 1Q72L 3OXSB 1KPVB 4NQEA 1OAQH 4IOIB 4YNYB 2YZ8A 4OZFA 4XNXL 5MEQA 1C16B 1J5OL 2BVPA 5I16B 5F7WC 1I9IH 4S1RH 4KDTA 1FL3A 4ERSH 2LAAA 4RBPH 1YA5A 2IPTH 2W91A 5IK3B 4N9GA 5FHBH 3RVUC 3T4YA 2IF7A 1J05B 4M00A 4MJ6A 3T2NH 5E4EB 2DYPD 5KVFL 1G6VK 2A73B 1ZVSB 2JJSA 4JN2A 3B43A 4AMKL 1A7OH 1BAFH 1F4XH 3QCVL 3QIWB 4HPYH 2VDMH 1KEGL 1A6AB 1AD9B 1GYAA 1MCNA 4YHLH 3FQRA 4PLKC 3BP6A 2X4UA 1XR8B 4WWKA 4U1JB 3VFSA 5KANG 2KZ1B 3BGMB 4LCYA 3QCUH 2OZ4H 2Y06H 4HGWA 5KVMC 1N5YH 3MA7B 3RNKA 1T66D 4H25B 5F44A 1CWVA 4LCCB 1XGYL 1LDSA 2X4TA 1A7RH 3SO5A 4XGZA 2ZWLT 5I76A 1EEUA 1PAMA 5I1HH 1UXWB 5HYEA 1V7NL 2CRMA 2AV1B 1MCKA 1T1ZA 1QLEL 4G7VH 3S36H 3PABB 1A1OA 2GSIB 5DEZA 5J6HB 4K55A 2B4CH 1ZGLA 4X9FA 5EO9A 2V5YA 4YXKH 1ED3A 4FQXA 2OL3L 4RX4D 3LKOB 3PHOA 2JKXA 4P2RE 1JYXA 1WAAA 3FTGB 3DBXB 3V6FA 4AEFA 12E8H 1U8HA 4JHZA 1DCLA 1A64A 3MV7D 5D7LD 4F15C 4ZD3H 1OB1A 1VADB 1X5AA 3JWOH 2XY2A 3RBSA 2DJUA 3B3IA 2NY1D 5T3ZD 2AABH 3RU8H 3UAJD 3RRQA 4P9HH 3VGAC 2J8OA 3LS4H 1BVKA 1OTUC 1I7TA 3WL9B 1RK1A 5DFTA 4LKCA 2YUXA 3PGFH 4NQDD 3EFFB 4S1SH 1CXFA 4CBPA 2P8PA 1X4YA 1IGML 15C8L 3LD8C 2V7NB 1T22B 4C56E 1A3LL 3TO2A 1T66C 2R2BA 3EO9L 5HD8D 1B0RB 1LEIB 1SY6L 1A6ZA 5KS9E 3Q3GA 5FV2A 1KTDB 3QUMH 3W9EB 2BRRL 3RL1A 2CDFB 4NM4H 4JPVH 1ZLWK 1HXMB 4JZOA 4TVSa 1L7IH 4HK0A 2I27N 5FYJE 5DMGD 2OL3A 4UTAH 4KU1A 1T04B 4FMKA 4G8IA 5AD0A 1II4E 2IH1B 3FO9A 1MCCA 2BRQA 3GI9L 3E1F1 5D96C 4KJWD 5HGHA 3X13A 1UM5L 1AE6H 2DYPB 4E41D 4YHKL 4F15B 5J13C 1T21B 3F65A 2Z93A 4MQTB 5DJ8B 5FM5O 2OK0H 3QEHB 1O0VA 5C07B 3KJ6L 3JTTA 1I3GL 4JJHA 3VGAB 3HC4L 1JHLL 4E5XA 2E9BA 4U1MA 5FF6A 3UAJC 5EZOL 1DE4B 4HUXB 3O41B 1ULVA 5DUPH 5FUOH 3LD8B 2BSTB 3IKCB 3FQNB 1PKQE 3TPUE 2X4PA 1Q38A 4KWUA 5CAYB 1SY6A 5FK9B 2AV7B 4RGNE 4QHUB 1R3JA 2D0HA 4WFEE 3SE8L 3EDEA 4ONGH 5HD8C 2Y07H 2XNAB 4G5ZH 3FFDA 1A1NA 1FO0L 2MTPA 2VDKL 3L95B 4L8BB 1UJ3B 1LO5B 4L4JA 4I2XB 1NPUA 1NEZG 1PDKA 3OL2A 1CD0A 1H0DB 3CDGB 2NY6C 1NGZB 4HXAL 5BS0D 1MRFH 4WJ5A 1JZ2A 4ZUTB 3NIGF 3RDTD 3ULUH 4L4TE 1G84A 3IETA 2CXKA 3CGTA 2P46B 25C8L 4OZFH 1YC8A 5DMGC 3WS6C 4ELME 4WFHD 3VDAA 3OKNA 1MI5D 1KN2H 3EYVB 2J8UF 3SE3A 2EDWA 5J13B 2VDNH 4ZDHB 3ZYJA 5IHZB 3LIZH 4X7DC 3MV7B 4Y4FA 1ZSDB 2YD8A 3HG1E 5D7LB 1UB5A 1SYVA 4RAUA 5CJXC 1FCCA 1X5LA 5I8EB 3NFPB 3LRGA 4P99A 4MQ7B 2YPVH 3BEWB 1M71A 2J6EA 1IT9L 2BJMH 4UUJB 5IVXA 5EIIA 2HN7B 3UPAA 5F3HA 1MCOL 3S3SA 2BNQE 3GSQB 2BSRB 3KYOA 4I4WA 3SDAA 4U1HA 4X6EB 1U91B 4NNPH 4NUGL 1NAKL 2ARWA 2BSED 4OCSL 2AJVL 3EYUH 5JUEL 4HUWB 1S9VB 2BK8A 1G7IB 2FBJH 2EXWD 2VAAB 4G9FD 3I6GA 3AMKA 5HGBB 3SJVD 1FO0A 1MCBA 5EOCH 3B2VL 2XRAH 3T1FA 5FB8B 3RWCB 4M5ZH 3UJIH 2JCCE 5DJ6B 1UZ6F 1DQTA 4LPUA 4Y1AD 4M6OL 3WIFA 5FO7B 1MCRA 5IR1B 2E9IA 4LSDA 2VZTA 2OBGA 3BVNA 5JLZB 3K46A 3PIQA 1S7SB 5F7LB 3V9FA 1RSFA 3LSOB 1BLNB 4JFED 2EEAA 4LHUA 2CR3A 1Z9LA 2OTWA 4NPYA 1YN6A 3QDGA 3V52H 1RUAH 4CW1B 1BVLB 3P4NA 1YYMH 3MRPB 3KLAA 1MRDL 4E41B 5IEKA 4JFYB 4OSUL 4UV7L 1PW3A 3U4EA 4LAQL 2HFEA 4TPRL 3P9MB 1HILA 5GJSH 3FL7A 1KJVA 1UA6H 5JNYA 4D0DA 5B3JE 1O7VA 2DQGH 2WV3A 2E7LE 3JVGC 1IM3B 1J18A 1JNHB 1RZIA 2XXCB 3FT4A 4XHJD 3WKNA 3WFEH 5K59F 2AP2A 3C5SB 5E94B 1NKRA 4N8VA 3P77B 3VFRB 2XFXA 1HZHH 5ITBH 1X5XA 5CJOL 3GSWA 4DKEL 1AH1A 3IAPA 3QEGL 1D3CA 3RNQB 4L4VA 1HSBB 2ITDA 2YPKB 5JOPD 3TT1L 1I1RA 4B50A 1XGYH 1OSPL 5DJCB 1ZT4B 2EXWC 2KQMA 5T3XL 3TIDB 2Q3ZA 1YEFL 5I1AA 5F9OL 4KMTL 1LHZA 3BHBB 4QRUA 5DMKA 4YO0B 4WEUD 4N0YH 5HYSA 2CKBA 2VQTA 5MEPB 1EHLH 5BS0B 3F58H 3MLWL 4GRWF 3RDTB 5HHXH 3GSUB 4ZUUA 4KK6D 3OB0K 1HYSD 1KNOB 1VFOA 3LQZA 4G9DB 4MVBC 4OB5L 4XP5L 3BYTA 1MI5B 4P4KD 3ARGD 2GCYB 3ZHKA 4Y5YA 4QXUL 1B0GA 3BKJL 1MOEA 3BJLA 3G9VA 2V2WB 4PIRF 4QOKA 3H3BC 1FYTA 2HKFL 3TZVA 5I6XC 4OCRL 4ONOA 1OAUH 3BP5B 2FLBT 2VZSA 3WHXB 3FB5A 2UVEA 1C8PA 5I1DA 3OGOE 4LDEB 4AEIL 4Z7WF 3TH4T 3WYRA 3ZO0A 4WUKH 4XTRD 3CIQA 2DKUA 4XHJC 3NN8A 1KLUA 2JJTC 5B3NA 2J8UB 2X4RA 1GAFL 1ACYH 2V9RA 1CICA 1H15B 4ISVB 3LMJH 1JHTB 1EK3A 1IGMH 5B21A 1I1AD 5GRVL 3VGBA 4NWTH 4MWFA 5DJ0B 3VFPB 2DQEL 5K9OA 5JDJA 3HRZB 1XGPB 1NUNB 4G9FB 5T1MB 3SJVB 2ADJA 3EO9H 4F7CB 5J3HD 3D48R 3A6CL 1KCUH 1SY6H 3L7EB 1QSVA 1CDHA 1OGAD 1CLOL 4OFIA 4Y1AB 5KSAD 3RAJL 2QHRH 3HZVB 3UX9B 1D9KD 3SCMD 3U7WL 2OQJA 4J23A 4CN6A 4IHOA 4WCYL 1D5MA 4KROC 1ZEAH 5F9JA 4JFEB 2EC9T 5JO5B 3UBXI 3BMWA 2GJZB 3BD3A 4L9LB 4BQ6A 3GI9H 4P4KC 2CPCA 3VGDA 3BIKB 4MXVF 4NRYB 5MI0C 5H35B 4GW5A 2EIZA 3CMOL 5I6XB 2G2RB 3P2TA 4LFHG 4PRBB 1FNEA 3B9KA 2GITA 2NW2A 3AREC 1RZJC 4WUUE 1MHHA 4UNVA 3S37H 2BNRE 2VL5B 3KJ6H 5F1SA 4ZFGH 1I3GH 2EH8H 3HC4H 4QCIB 2AJSL 3VGHA 3BZFA 3KWWB 4QHKJ 4WDIA 3GMLA 2IPKB 4XTRC 2J6EH 4PJDE 3GKWH 3PGCB 1G7HB 1JGDB 2PO6A 4APQA 3BYYA 5IB2B 5FYKD 1AFVL 2AJYH 2VLJE 4K3EH 3TNMA 3D25B 1F3RB 2PR4L 1Q9WB 5DK0A 1I1AC 1CD9B 1RZGA 1FG2A 4AENA 1JK8B 5D70L 3FFCD 1D5XA 2RFXA 1JTOA 2OMBA 1QA9B 3DIFB 3CFCL 5J3HC 4X4YB 2PETA 2F8XC 1FO0H 3DRQB 3ZSTA 3TBYB 4KZDH 5KSAC 1FV1B 1D9KC 8FABA 4TULL 1IE5A 3VXQB 3GEWB 2GTZB 3EHBC 1TDQA 1JUFB 5AZEH 3CXHJ 4P4KB 4JO2H 4KK9C 3ARGB 1MWAL 3FT3A 4XCEB 3FOMA 2HJFB 4HWBA 1RULH 3AS0A 4JZNA 2QR0A 4U0QB 5GRJH 5JXAL 1CZ8L 3D39A 2C5DC 3WDHA 5FGCE 1B90A 3F5WA 1DR9A 3CZFA 4QY8B 1IAKB 4A6YB 4OCYL 5BXFB 3IJYB 4GRWB 3GI8H 3HS0B 1DUYA 4LL9A 1OTSD 2ZUWA 2C1OB 3NCBB 3IFNH 1OP9A 4DFIA 3KYNA 3QEUA 5GS0D 4PRIA 2BFVL 2FO4B 4WEMB 3IAGC 2HH0L 1YPZE 4Q6IB 3RUGF 2FLRT 2IFFH 4YIQA 4XNQB 2B0SL 5ETUA 1GZQB 4I48B 1I1AB 4DTGH 3VXUD 4NRXB 2NTFB 5D6CA 3SDXA 4U1LA 1ZA6B 4TOYL 1WLHA 3SQOL 1QHOA 4OZ4A 4YDVB 2CLVB 3T3ME 3JTCA 2F5AH 5C08E 5KSAB 4R26H 4LNRB 1D9KB 3SCMB 2CH8A 2JIXA 2VDRL 2ADIB 2H3NB 2CKBH 4IRJD 3VWKD 5C0BA 3OMZA 4MB5A 1DSFH 3PNWA 4NQUA 3FMGH 3EW3B 2W9LA 2Q87A 3U48A 5LGKA 4GXVL 3QZWB 4FXLA 4EQ2A 3QUYA 3TN0A 1U8OB 1MRDH 2E8YA 4OSUH 3UTSE 2MHAA 4IRSD 2CLZB 5ECJE 1AXIB 1DQLL 1XF3A 1IKFH 1FGNL 1I8MB 1LNUB 2QSCH 4KRNA 4NO3A 2EYSB 1MREH 4IMLA 2E8ZA 5HHNA 3WFDH 3SKMA 4PTTB 5EOCJ 1YJDC 4HBCL 5CGMA 3QEQA 3DROA 5J89A 3TYFB 3UYRH 5GS0C 2ZCHH 2UWEE 4PGJA 1QR1A 1QFUH 2FD6H 2O26U 3QR2A 4AT6A 4FQHA 4I1NB 4WHDA 4LLQA 1IEAA 1HQ4A 5IQ9A 4N0FB 4LVHC 3FFCB 3UROR 5LGHL 3VD7A 4Z7OF 5GZOD 1T1WB 4F9PC 5E08L 3MOBH 2ZOLA 4WEBL 1JTTA 3C6SA 1QFHA 2Z92A 5T1DH 3PQYD 2M26A 2VXSL 3MLWH 2HFFB 5FXCH 1HSAB 4DZ8B 2O5ZL 1RJLB 1CGSL 3VWKC 5J12B 3QYCA 4IJ3C 2NX5D 1FPTH 1WVZA 4JPKH 4LF3B 4E42A 1KJ3L 1OP3K 4PRPD 3N1FC 5DJXA 5BVJB 4IIQA 4M8QA 3T04D 3MO1A 1XF5B 4OFDA 3O9WA 3X14B 1KELL 2HKFH 3GSXB 4OCRH 3ARFD 1KTLA 4IRSC 2OTPA 4BFGA 3WSQH 1KTRL 5DI8A 1B9ZA 3GMOB 3QUZD 5C6TL 2X4SA 3EOTL 4DQOL 2P5EE 3VXOA 1IGYA 3SY0A 1L7TL 4NCC2 5GSVB 2VSDA 5JOFA 4HT1H 1QSEE 5EU6E 2OSLA 2HKHL 3HI6L 4G6KL 2FSEB 3GRWA 4RAVB 1LO0L 1BJMA 1MY7A 3IYLW 3JWDH 5SWZD 1MIEL 1A6WL 1L4IA 2YK1L 4KY1H 4OCMC 4OD3L 2YPLA 2ZUQC 2EDXA 2V7HA 3LH2L 3T2OA 1HHJB 4MXQD 3A6CH 3MR9A 4UDUB 5GZOC 2VZ3A 3B4NA 2ZSWA 3HC0A 3RUGB 2PYEE 3SE9L 2FJGA 1XCTA 3SDYL 5I1CL 4P2YA 2VZVA 1NFDB 2RHEA 4BQBA 3ZKMD 4IRJB 5FCUL 3VWKB 4MD0B 2XOTA 2VDLL 5D1ZA 1J12A 1WCQA 5I1JH 5CWSB 3W5NA 3C09C 5HYQA 4LARH 5EC1A 3CMOH 4HWBH 3QCTL 4IRSB 4EEEA 3QG6B 4UT6L 4QT5B 2QL1A 4YX2H 2O5XH 1A6VH 2AEPL 2DAVA 1BOGB 2HG5A 3H9SD 3L3KB 4QRQA 3QUZC 1Q0YL 3E0GA 2E7HA 1N2RB 4GO6B 4H1LG 1AD0B 4YDIL 1RAMA 4MD4B 3FQUB 4UQ2A 5DWUH 4M9OA 4LQFL 1I4FA 2ENYA 4Y19E 4LGSB 1RUQH 4HFWB 2W0KA 5ITFB 2DQHL 4QHNB 4PG9A 3V6ZA 1FZOA 2Q76B 3FONA 4B53A 4YGVB 5EBMB 3CFCH 4G8FA 3UTTA 4MXQC 4GQ9L 3MYJB 4GUPA 3RWGA 1W0WA 3PQYB 4MCYA 4U1IB 4JAMB 5FOBB 2HJLB 5FUZL 4M48L 1ETZB 3DV6B 4MJ4A 2Q8BL 3L7FA 1HHGA 4RRPA 2NX5B 1HHKB 5DUML 2AEIT 3IFLH 2IBBA 3C09B 4PRPB 1NLBH 5JXAH 1L9MA 3QNYB 1CZ8H 3C5ZD 2Q86B 5H37H 4KAQL 1LEGB 2HTKC 4OLWH 1R5IB 3WJJC 3X12A 3U9PL 3ARFB 3ISWA 5KG9B 1CR9H 5J8OA 3QHFL 4HIJB 2NXYC 3QUZB 3CVHA 4V1DA 4NRZA 2J4WH 4PGBA 1T0NA 5F72S 5I17A 2BFVH 3VW3L 2FZ3A 1EHAA 2HH0H 4C59B 4KV5F 4JG1L 4XPFH 5D7IF 3DVFA 1DQQA 1TCRA 1WFTA 3PWNA 1CT8A 1QO3B 3TA3A 5TQ0H 3TO4D 4FFYL 4X99A 5SWZB 2COQA 2D7TL 1KIQB 1YNLH 3NACH 1R24B 4XXCC 1WTLA 4KI1A 3EYSL 1F4AA 4K8RD 4S1DD 4TOYH 2FYYB 1HDMA 5JZ7D 3CX5J 2YUVA 3D87B 4ZO6A 7FABH 5I1KL 4UILH 3W82A 3BH9B 3IF1A 4XMLH 4HMDA 2AQ3A 1EV2E 4JLRA 5KSBA 2VDRH 3VFMB 4G6FD 3OKOA 4JRYA 2VWEE 4TQEH 4M6ML 4U0RC 1MJUH 1P9MC 2K3TA 4O2EB 3TBWA 4BSVA 2A9NL 5FA3B 3TWCL 2X4QA 4GXVH 4M61B 2GQHA 3VRLF 3K74B 1CTOA 3C5ZC 1SM3H 4HHAB 2X4OA 3MYZA 4P4RB 1YMME 3IGAA 1WIOA 3RIAK 2J7LA 3MLRH 5DJYA 1DQLH 2HWZL 3NIDE 4XNYH 1A7PL 1MCEA 4PJXA 3BD4A 2BMKB 5AYQA 2EKSB 2OR9H 3KPSA 1N0XH 3H9SB 5D7KE 4LKXB 4HBCH 5EG6C 4R7DB 3B2UD 5AUMB 3QT2A 2GT9A 3PWVB 5FKPB 2Q3AA 3BSZL 4F80A 4U49A 3KNBA 4TUJB 2XY1A 4K7PX 2DLGA 2W59A 2GAZA 3H9ZA 4K94L 1G0XA 5D1QD 2E9JA 3GRWH 1T03L 1NFKA 3RWDB 3G6JF 1I9EA 2GY7B 4S1DC 4NCC1 3O2VH 5E08H 3VXTB 1ZT7A 2ZZUT 3OKKB 5DA4A 4PJIE 4CKVX 3AM8A 4N0UE 1KIUA 4XVTH 1OP5K 5HDBE 4LIQE 3TVMD 2W9DL 3BW9B 3QQ3B 4U0RB 4JO4L 4PP2A 3VRIA 2G60H 2YS4A 2XWJA 3LQMA 3P30L 1IC4L 4XPAH 3C5ZB 4JY4B 4KTDL 4HBQA 4NDMB 3KPPA 5TQ2L 4W4OC 1L9NA 2ZUUA 4OQ1A 3DETD 5DRZB 1IAOA 4HS6A 4KVCL 1YN7B 3HUJF 4LLAA 2B1AH 4X4XB 5C6TH 3W0WA 2DQIL 5EUOA 2OMNA 1S7RB 3HAEG 4BM7A 1IARB 5C71A 1L7TH 5IV2B 1T2XA 3DRTB 2X7LB 1G7PB 5IMLA 4XZUA 3I3EA 2LU4A 5BQ7B 4HCRL 4PJ9D 5ID1B 5LAXA 1EXUB 4LCWE 3NCJH 1NGXA 3DHJA 3TO4B 1CI5A 5EZLB 3T65A 2AS5M 1Y0LB 3WFBH 2YK1H 1CLYH 3D3VD 5D1QC 5JHDA 4FABL 1RIUL 3T77B 2BC4B 3UJJH 5I8KH 5J11C 2Y5TB 3MXVH 2VXQL 5E5RB 2EO9A 5D7IB 3O2DA 1G9NH 2LABA 4G6FB 4P3DB 4WO4C 4NGHL 3Q5TA 1FC2D 1BFVL 3MRKA 2VDLH 4FS0A 4HK3J 1W72H 5D2LE 5KN5B 1BM3H 4P5MA 4Z0XB 2YEZB 1D5BA 3VFNA 1U8PA 3QCTH 4PRNB 4PTUB 4C83A 1KCGC 3WDJA 4CMHC 3UTZA 2Q6WB 1KCSH 3DETC 5GGUB 4P9ML 5DK2A 4K71C 2AEPH 3WE6A 2VXUH 4OI7A 4DCQB 4XC3L 4XPTL 5ICXA 4HCRA 1IAIL 1OPGL 1PD6A 2QQKH 4NQCE 3CVHH 3OKMA 4MSWB 5D4QA 2MQ0A 2AJUH 2CUMA 3LKRA 1J88A 2BOCA 4CU6A 2YWZA 5BRZA 4RFOL 3KPMA 3BPCA 4WY7L 4P57B 3TCXA 1OAZL 1JNLH 1MCWW 1MQKL 3MRLA 4OTXL 5D1QB 5EPMA 2ORBL 2R9HC 4JJ5A 4TRPL 1KXTB 5C7XH 3DMMC 4K3JL 5GGSA 5J11B 2OM5A 1IKNA 3GJEB 1JTPA 2FL5B 1KCLA 3BDBA 1T4KB 4UOW1 3WJLC 2VERN 3GGWB 1A6PA 4P5KA 1AI1H 3TVMB 4DVBA 4Z76B 4YQXL 4U1KA 3G6AA 1QSFD 5C0AD 4NO5A 3G6JB 4Z7UF 5CJ5A 3D9AL 1PQZB 4NQVB 3SHSA 3GBNL 4YPJA 4KAQH 4PJEF 1I9JL 3MRQA 4DW2L 5ABDE 4TTGA 1CQKA 4CMHB 1HCVA 3QG7H 4POYA 3EFDL 5GS1A 5J56B 3DO7A 1A9BB 3CXDL 3EOYG 4FTVE 4GSDH 1WBXB 5E00A 3NH7L 3T4AA 4K71B 2DJ4A 3ZTNL 4GKOA 3UTPE 2ADGA 1S7TA 2WY3A 1JYWA 5GRYA 4M1DH 1BQLL 3WLBB 3CH1A 3PL6A 4CNIA 2X9YA 5FUCE 3O8XD 1KJMA 4M3KB 4PJ9B 4XP6L 1QYGL 3G08A 2VABB 3FRPG 4Y2DD 4NKOA 1RPQA 5D7SL 5ALCL 3BESR 3QDJE 2J1KA 2ADFL 2CIIA 3K4AA 1ORQA 4G7YH 4OAWA 2C3GA 3QDMA 3DMMB 3EO0A 2V2XA 4J3SA 3TF7C 3HUJB 3D3VB 5D71L 4M43L 1TNNA 2A38A 3EYSH 1JHKL 4TSCL 3V8OA 4U7SA 1T0MA 5HHOD 2Y5EA 5I1KH 3GHEH 1DBKL 1IGJA 1PYWB 1OWRM 1ADQL 2ZJSL 2VITB 2V9QA 4Y4KA 3W9DA 2VC2L 3HN3A 2V2TA 4Z7VB 5D72L 3U4AA 4M93C 1RZFL 4P59L 4ZOBA 1IM9D 5IP4A 2FR4A 3UEZA 2A9NH 1E4KC 4RIRA 4XC1L 2WM0A 4H26A 5T33H 1LP9E 2NYYD 3H8NA 35C8L 3V95A 1RMFH 5IIEA 5HPMB 4MNQD 4YBHA 1CFVH 5DD3H 4L3EA 4BQ8A 2HWZH 4G8EA 1Q9LA 2J2ZA 4BH7B 2EYRB 3DXAE 5CBAB 5HHQA 4JZJC 1XGTA 5J0BA 1NSNL 1RU9H 4MLSA 4MNHB 2HMID 4X7SL 1X5ZA 4G59A 3VG0L 1EJOL 3GJFK 1BIIB 2DI8A 4M7LL 4R0LB 1D7FA 2EKJA 2HTLC 4HKZB 5HHMD 2DMKA 3PXJA 1K6QL 2YD2A 3I9GL 3QJHA 4KHXL 2B4CC 4Y2DC 1YQVH 3D85D 1I8LC 1C12A 3LAFA 3STBA 4P2QA 1NAML 3IS0X 3RQ3A 5IG7A 1WIUA 5I8CB 2VLLA 3LKNB 4QRSB 3EYQD 3BXNB 3THMH 5IJKC 1YY8A 2BVOB 3IXAB 2EDYA 1IRAY 3N1MC 3P4MB 5HGAA 4NT6A 2D03L 2CIKA 3JWOC 4HWZA 1SHMA 5AYUH 3FOLA 3A67H 4M93B 2YA1A 5K9QI 3PDGA 5C0AB 3O2DH 1JPST 3QNXB 4P9HC 4QTHB 1NANH 5C9JB 1U3YA 2NYYC 3ULUF 5ESVB 5F8QC 4JZJB 1CDUA 1NGQH 2XWBA 3SKJL 5IW3A 5C0IA 3BISA 3LOWA 5DS8B 2GK2A 4JFQB 1D6EA 3LQAH 1U8NA 3GIZL 4Z7UB 5IW6B 5KBNC 3GJFB 1HKFA 1I3RB 4YR6B 2HMIC 4K7FA 4EXPX 1KPRA 4WHTA 3O8XB 3UBXG 4PJEB 4HCRH 32C2B 1CLCA 3CSPA 4ODHH 4Y2DB 5GISL 4NQED 1QFWH 3ULUD 4K7PL 4W81A 1J1XH 2CK0H 1ZHBB 3L3JB 4LSTL 1VB9A 2NNAA 1R5WA 4EIGB 3HKFA 3VXSE 2R8SH 1HH6A 3O6FA 4OD1H 4FABH 5HHOB 1VEPA 3LB6D 4ENED 2FIKB 3NTCL 5DYOA 3FO1B 1BQHA 4YZFF 3EJJX 2DKSA 3EYQC 1AJ7L 3UTQB 3FB8A 5FYKU 3MV01 1OGTA 3QWOB 5J6GB 3T09A 4ZAKA 1S78D 1QKZH 3MRJB 1XAUA 1J0HA 5D6DC 1IM9B 2UUDH 1V3MA 1K3ZA 5E8PA 1F90L 4G80B 4MNQB 1A8JH 1UWXH 4NNXB 3CLFH 5IBUG 5B38A 2J12B 3ZHDA 2BNUA 1HXYB 1XFPA 3ULSA 5FGBC 1T5WA 3PDOA 1JF6A 4XPTH 5DQDH 4KPHH 3QUMB 4AY0A 1MFAL 1IAIH 4PRAA 3P0GB 3OKEB 1XCQB 4OV5A 4FNLL 5FYJL 1MPAL 3BZDA 2XN9E 5HHMB 1LQVA 3HNVH 4XMKL 4P2RA 1F6AA 1OWWA 2P5WD 4LLWA 1R3LA 3ULUC 5GGVL 3TT3H 5LG1A 3D85B 1TJGL 4PJGF 1T2QL 2RIKA 1VERA 4KDTC 1BGXL 1IL1B 2DN7A 2YXMA 4FQXD 2GFBA 2WQ8A 2EDLA 5DJZA 5I74C 4D3CL 1A7NH 2YD7A 2ICWA 1ERNA 3S4SG 1AIFA 4YE4L 4QF1B 1MFBL 5LXGL 1TVHB 2DLTA 3ALWA 3ZDZF 3HLAA 5ISZE 3GK8H 5A3ID 4L1DA 3OZ9L 4YQXH 1S3KH 1ES0B 3OR6B 2GHWB 1S78C 2EDRA 2JJSC 3BD5A 5IHUL 1T3FB 1AGCA 4C56A 4YPGA 1G9EA 2ZSVA 3VWJA 3RWFA 2R4SL 5H94A 1J87A 4MA3A 1OVZA 3D9AH 2VE6B 1L0QA 2ARJB 4GAFB 4WTWA 5SWQB 1TETL 2VDQH 4PJ7F 4RNRA 4RSVA 3ZDYF 5KS9A 3JUYA 5T3ZE 4WWKC 3C8HA 3EFDH 1KV3A 3C87A 4KUZL 1P4LA 1NCDL 2C1PB 4GAGH 1OM3L 1LK2A 4R9HA 4AYFA 1IC5H 2YA2A 1FZKA 1CN4A 1D5ZB 3IVKA 1TTUA 4NQDE 1XIWD 4NQXB 3GMRA 3BRDA 4L8SA 2MFNA 5F8RC 3PWUB 4U1GC 5EZIL 2APWA 4XP6H 1QYGH 1XZ0B 3U46B 4NQEB 1AY1L 5DVNA 3LPFA 4UU9A 4UTBH 3SQBA 3O0RL 4JPIB 5KAQG 4O5LL 1T20B 2YUWA 4YAQA 5EOTA 5D71H 5KJRL 1FL3B 1JHKH 2BP3A 2DOCA 2C3HA 4OF7A 5EUKB 1N4XL 4FQXC 5EBGA 4JM2F 4N9GB 1UEMA 3ROOB 4MJ6B 4U7KA 1UACL 3O6LL 5BO1L 4R6UA 1KBGL 4WU5A 4XVSL 3S3JA 3KPTA 4D2NA 2WWKO 2GI7A 2VOTA 4HULB 4LSVH 5D72H 5TF1L 1PKQA 4I77H 3TPUA 3GMMA 4HSQA 4U33A 3SKOB 4DAGH 1F4YL 4GKZA 1G6RL 4E41E 1Y6KR 4N68A 5ADOL 4XC1H 4DUXA 3KVQA 3BP6B 1F13A 3VXRE 4JM2D 2X4UB 4OFKA 3QRFM 3VFSB 4LNVA 4LCYB 4X0KB 3MZGB 1YUHB 5F88A 5BW7A 4HGWB 3TJEL 5DMYA 3RNKB 4LSRL 5GGQH 3HI1B 4EVNA 1Z9SA 1Z9MA 4R7NA 4KK5D 3MXWL 2XYCA 2X4TB 5BJTA 2ICEB 5IVNA 4XGZB 4L4TA 4M6NL 4U1GB 3BGFC 4X7SH 4ELMA 5CMAA 1B4RA 4LRNH 5I76B 2OI9A 2XZZA 2X05A 2WK2A 2DM4A 2BOBA 4X7CC 3VDBA 1X5FA 1T1ZB 5DVLA 2P5WB 2B39A 4EI6A 4P3WA 1A1OB 4YXLH 5IB3A 1MNUH 2XXMB 3MOAL 3HG1A 1DLHA 1HKLL 4JN1H 4Z18A 1S7UA 3HZKA 4FQXB 5IVXF 5E8OA 5ESAA 3AXLA 3PHOB 1B6UA 1GC1H 5BS0E 5KVEL 4NBZB 3VJ6B 2ESVD 5I0DA 4TVPH 4KUCD 5E2UH 1SVCP 3N06B 1JMXA 4M03A 1U8HB 2BNQA 3CK0L 4Y4FD 3SDCA 1DUZA 4Z95L 1A4KA 1OB1B 1MI5E 3ZE1E 1G6RA 4PJGB 4RMUA 1QLRA 4ZO8A 1QP1A 1CYGA 3ZT5A 5DR5L 5CSZA 1I7TB 2ZKHL 1RK1B 2MMXA 3NZ8B 3ULVL 3HNTH 3TNNB 5EN2A 3EYOB 2JCCA 4D0CA 3D5OF 5DD5H 1IC7H 1NGYA 2W1NA 1X6NA 5E6ZA 5ALBL 2I26N 4HF5L 3TO2B 3BKCL 2J8UE 2R2BB 2XIDA 2O5YH 4ZPTA 3BGFB 1NEUA 4BZ2L 1AGBA 4FQCL 1UC6A 2R29L 3GIZH 2W92A 1A6ZB 4YHPA 3Q3GB 4NBXB 5ERWA 1RUML 1YEKL 3RL1B 3U0PA 4HDIA 3PP4L 2FHCA 4K7PH 3SJVE 4GAJL 4L8CA 2O61A 4JZOB 5F7DA 1I3VA 4HJJH 3MLYL 4HK0B 1TVDA 2WIIA 1AR1C 2WW8A 3I6LD 3MGOB 4G8IB 3FO9B 3QXDB 4GRMB 4CADB 1KJ2L 3QDGD 3CC5A 2E7LA 5DD1H 3X13B 3L5HA 2YC1B 3SE3C 4JFEE 2CKNA 5GGTL 2Z93B 3JZ7A 4NKIL 4Y4FC 3ALPA 3RPIA 2BHYA 3MROB 3M17A 4L3CB 2X4NA 4MDIA 3JTTB 5EIVA 1UZ6E 1PJ9A 3OX8A 5C1MB 3W11D 4LVOC 5JIKA 4E5XB 3O4OC 4U1MB 4ZSOB 1JI1A 1WT5A 2XI9A 4JM2B 2RCSL 2ZUVA 3BMVA 2GUOA 2RB8A 4O2FA 4F7MA 4YXHH 4BSWA 3SDAC 4UIMA 4XVJL 4L8DA 4MDJA 5B4MD 3ZE0F 5LBSH 2X4PB 4JHAL 4NP4H 3NFNA 5B39G 4FQIH 3R06A 2R2HA 3VCLA 5I18L 3FFDB 1A1NB 4N1CA 3T0ED 1FLRL 4FNLH 5CJ8A 5FYJH 3HZMA 1IEBA 5GIRB 1DEDA 4L29A 5HY9B 5MEOA 4XMKH 3ES6A 1WUNT 1YECH 4NQTA 4WJ5B 4YFEA 1T1YA 3TBVA 1S5HB 4MMZC 5K59E 3VXPB 4W70A 1TXKA 3IETB 2WP3O 5I66A 3BWUC 5H8DA 2CO7B 3L3OB 1CE1H 3OKNB 4LLDA 2W0PA 2ESVB 3FCTA 5GGTA 1B6DA 1IILE 1F11B 4QOKD 5DQJA 6FABH 1FYTD 5LXGH 4Y4FB 3TZVD 1KC5H 1SYVB 4UZGA 1GL4B 5F1IA 4ETQA 4RAUB 3WLWC 4OFYA 4O9HH 4EUPA 1K5NB 1QBLL 4ZOEA 4OCWL 1SYSA 2WWMC 1FE8H 3O4OB 3WIIL 3KPRD 3NMEA 4EJ1C 3L3DA 5IVXB 4LLMA 1AXTL 1XH3B 5ACZA 5EIIB 4JR9L 2PTUA 5F3HB 2H1PH 5E5MA 5T5NG 4NUJA 3DGGA 3KHOA 4I4WB 3SDAB 5I1IH 4U1HB 4N5EA 1CICD 4NOBA 4DKDC 3SPVB 3V5HB 4O2CA 5KW9H 1H3WM 5B4MC 3RWJB 3WFCL 3OR7B 3UDWA 4TUKH 1QNZL 5C70A 1U95A 1RZ8B 3S6CA 2QQLH 3DYPA 5T5FH 3L1OL 3T1FB 1GPOL 1JF1A 4C57C 5TF0A 2DDQH 4XP4L 3UMTA 4ZFZA 3MRGA 4ALAH 1GZPA 3WIFB 4KGLA 2DL9A 2A74A 3X3FL 1AY1H 4Z7WE 2IGFH 3HMXL 3FO0L 3GBML 1DL7L 5F1NB 3F12B 4AJ0A 3PIQB 1OGAE 5MHSD 5SX4I 5K9JH 4ONHA 4S2SB 2OTWB 2AW2A 4WUUA 1YN6B 2Z31D 3QDGB 2BNRA 1DBJH 2JJWA 4Y5YC 3KLAB 2EYTA 4QHLB 3X3GL 3ZYOA 5AAWA 4PJDA 1T2JA 3U4EB 3B9KD 3TZVC 4CMMA 4KZEL 1BWMA 1HILB 5JNYB 1KJVB 3P73B 3BZEB 4D0DB 3QUXA 2VLJA 1LEKA 4HUKB 1RZIB 4R97C 3FT4B 1F4YH 3M8OH 5IW1B 4F8TA 1G6RH 2BY1A 3WKMH 2JTDA 1NAMB 1BZQK 2GJ6D 2YN3A 1TPXC 3V5DB 1WIPA 1P7KA 2XFXB 5CZVL 4WI2A 4APQD 1TFHA 3QQ9D 5D5ME 4ETYA 1CICC 2B5IB 3SBWA 5EORL 4LSRH 2ITDB 2APXA 5L9DH 4MXVE 4HUUA 2R4RH 2R0LL 5I1AB 4HKBB 3HPLA 2DLEA 3OPZL 5B8CA 3T0EB 4QRUB 5DT1L 1J8HE 3HMXA 5HYSB 2Z4QB 2CKBB 2AK4D 1Z0NA 3O2WL 1BZ9A 3FFCE 5CEZL 5I15L 1QBBA 4MYWB 4JDZB 3CFBB 4ZUUB 5GGSY 5GRUH 3GM0A 4AZ8A 1MJJA 4ZTOL 4M7KL 4ZFOL 1T5XB 4YUEH 4Y5YB 1C5DA 4OM1H 1WTGT 4QOKB 3MLPA 3S97C 1FYTB 1EEYA 4HFUL 3TZVB 3CK0H 1YPZA 1INEH 1WC7A 3PHQA 3P11L 3PV6A 3B9KC 3FB5B 3GHBH 5GSRA 3SDXF 1I8IA 5I1DB 4XBGA 3CNKA 4R97B 5EO1A 3KPRB 4HAGA 1TPXB 4R96B 3RKPA 5FOJA 1ROWA 1KLUB 4PJ5E 4PRID 4QTIH 3OAZK 4JANB 2X4RB 1JBJA 1R3HA 1CICB 1K8IB 2JE8A 1YNKL 2QQNL 3PWLA 3MNZA 4N8CL 4D9RE 2PO6C 4APQC 3JWDC 5C08A 1E4WH 4HJ0D 4JFPA 1NGPL 5K9OB 4OKVA 1ZK9A 5ALBH 1JPSH 4JFOA 1X5KA 3BKCH 2ADJB 5GGRA 1E4XH 2CK2A 1DLFL 3TFKA 3VFOA 2YA0A 5F96L 3V4UH 4IS6A 1C08B 2ICCA 3C5JA 1WQVT 2FB4H 5L6YL 2LU7A 3VXUE 1Q94A 5EU4B 1RUMH 2OQJB 1P4IH 2CXGA 5DJAB 2JIXD 4UB0H 4IHOB 3F6IA 4KTEH 3UTSA 3SGKA 5F9JB 4CVZA 4OM0L 2PN5A 3RUGE 1PLGL 1SEBB 1T1XA 1HHIA 4A2LA 4WTXA 4GW5B 4MS8A 3BUYA 5I1GL 3BEVA 1N3NB 1FNEB 3B9KB 2GITB 2NW2B 4Q9CA 2CSPA 4O51A 2UWEA 2I07A 1JGLL 4P49A 4PV8A 2A77L 4PREB 1MHHB 3WXVL 4HZAA 5DDHA 4EUPH 2GJ6B 4K3GA 3BZFB 3QEQD 3RP1A 1BWWA 5HI4D 4WDIB 1IGIH 3GMLB 4JHWL 5HHVH 1ZTXL 3AS2A 2MCPH 4APQB 1Z5LA 5T3XE 4XVJH 4F33B 3QISA 3TNMB 4F3FA 4WFGD 4ONFH 1MIMH 1RZGB 1FG2B 1Y18B 1D6VL 3RTQA 4NC0B 2H41A 4PGCB 1N6VA 1D5XB 3HMWL 3JV5A 4NZTH 5F9WC 3OKYA 5ELIA 4TNVF 1QFOA 3ECBA 8FABB 2UY6A 5DSCB 2W0LA 2ICWJ 3WS3A 4X80L 5DMJB 4R4BA 4OLEA 1RZKL 2PCPB 2EECA 1QQDA 2CO6B 4KK8D 1WITA 4NZRL 3FT3B 1YYLH 1KGCE 2VQ1A 3D0LA 4P2OA 5FHAH 3D18A 2QR0B 3NZHH 4JZNB 4OGXL 1IBGL 2P5EA 3MLXL 1SVZA 3O9WD 3F5WB 1NCBH 3QUYC 3KLHD 1WSST 3CZFB 3TN0C 4HG4J 2I60L 1QSEA 2NX5E 5EU6A 2F74A 5EOQL 4Z7OE 4POZD 2KUTA 3CFKA 1EO8L 1DUYB 4ZQKB 4U6HA 3IAQA 2DQJL 1ZXQA 3WIIH 3GIVB 3QO0B 1R0AL 2V5SA 4PRIB 1OAYL 1CDBA 1A7BA 2XACC 2ZCKL 4X6CF 1K4CA 4YIQB 1J0KA 1ZMYA 2EICA 2C3VA 1DQDH 4AEHL 2PYEA 2H32B 3I3BA 4NKDB 2APVA 1DBAH 3WFCH 3SDXB 4U1LB 2BDNH 3IFOA 2AXGB 5K9KA 2L7UA 4N90D 4LSUH 5F9WB 4BELD 1T7YA 3VE0B 2VR4A 3QXVA 2H9GB 2M2DA 3QXTA 5SWZE 2XWTA 4XB8A 4UT9L 4PS4H 2JIXB 2D31B 3HMXH 3GBMH 3SDDA 1A14L 4H8WL 1NC4D 3L3HB 5TE4L 5DF0A 3PNWB 5D1ZD 4ZS7H 4NC1C 4H20L 3T3PF 4KK8C 1B0WA 4XVUD 4MA8H 1KPUA 3KPLA 4XNZC 5EBLA 1R3IL 4IIQC 4TNVK 2XTJD 3X3GH 4OLUL 2MHAB 3VI4F 5KAQF 3O9WC 4P5TD 1XF3B 4BKLA 2DQTL 5LWYL 4HS8H 2P44B 4NO3B 1KOAA 4B7LA 4Y19A 4IMLB 5HHNB 4LASH 1AQKL 1FIGL 3SKMB 2VLKD 5IKCA 1HWHB 2XQBH 4EIZC 3QEQB 1NCUA 1RIVH 3DROB 4L5FL 1AHWB 4FXKA 4DJMA 3AUVA 1A22B 2G5BB 5E03A 2NY7L 1QR1B 3CFJB 5JR1H 1S7QA 3K8MA 2Z91A 4AT6B 4FQHB 1SBSL 2P24A 2ZUTA 4V2CB 2AEQH 1IEAB 2JELL 3WCYA 1HQ4B 3H0TA 5IQ9B 2WBJA 1F4HA 2DI7A 3HPJA 2YD6A 2WBKA 5K9QG 4K7PY 3OPZH 3ZDXE 4F57H 2ZOLB 5CFHA 4QLRA 1FBIL 1DANU 5KVDH 2CDGB 3GMNA 3MBED 1LWRA 3CFIC 3MNVA 2GKIA 2DBLL 2JK5A 3VH8A 2ZUYA 4HXBH 5IM7A 2QKIB 4OGZA 1GSMA 4E42B 1DQML 1S8DA 5D1ZC 5J9PA 4XNZB 1SMAA 4AIXA 5DJXB 4M8QB 3ZYZA 4XVUC 3O9WB 2DWDA 3RL2A 3OQ3B 3V0WH 2XTJC 1ZWIA 1KTLB 3J7HA 4QNPE 4WTZA 4E0RB 1AO7E 4PR5A 3Q6FA 4ZS6C 3LKQA 5DI8B 1AKJD 4V1DD 2X4SB 1OAKL 3VXOB 1IGYB 3GSOB 1V7ML 3NPZB 4KJPD 3JV6A 3ZT7A 3TV3H 3QA3A 2QQNH 3GSNL 4FQJL 5JIPA 4TUOA 1UM6L 3EO1A 3VXNA 1KUMA 4X6DF 3S34L 3TA3D 2VXVH 3LHPL 1YNTA 3UZVB 3VGGA 5AWNL 4NSKA 5IFJA 4XAKE 5DUBA 5C0FA 3MR9B 3V6OE 4OF0A 4KHTH 3S4SB 5GGVY 5IEHA 3HC0B 3K8LA 5DZNA 4JDVA 3AU1B 4X6CB 1G9NC 2FJGB 3MRDA 5SV4A 1ZVYA 2HP4A 4FFEX 4M02A 2VR9A 5TDPB 5D93C 4ESKA 2VSCA 3BX7C 4JRYD 1DDHA 1YMMA 4PJXF 1NC4B 1CD1A 1YEEL 3NFSL 5D1ZB 4FP8H 1F6FB 1PLGH 4KV5E 2BXYA 5DZOA 5D7IE 4BH8B 3W5MA 4P23A 5I2IA 3PF2A 5HYQB 1RI8A 2R0WL 2XTJB 4ZXBA 3MUZ1 5DD0H 4OLYH 4P5TB 3I6KA 5SWSE 3KAAA 1PZ5B 5ICYA 4KMQA 4GH7B 5DC4B 2NY5H 3ELAT 5D2NA 3TEUA 3KPSD 2HG5B 5EFIA 3GSNA 5E2WH 4LPXA 5KSVA 5C3TA 4POUB 3SKNA 2X10A 5JPNA 1I4FB 4MJ5A 5D1XD 4AQOA 2X2YA 3KYAA 4PJIA 4FFZL 1X4XA 4N0UA 2PW1B 3TA3C 2FH8A 1D6VH 1JV5A 4PG9B 3V6ZB 1FZOB 3VRLE 1XF2A 1FQ9C 1X7QA 4RA0C 3MRNA 4YHZH 4AIZA 2IQAA 1CLZL 4GUPB 2CJUL 3RWGB 1JRHI 4PYGA 4MCYB 4U2YA 5D93B 3MBEB 3O6MH 5KOMC 2R1WA 3RWIA 2R1YB 1A4JA 1CL7L 3IXTA 1GGIH 1W72B 1MHPH 1GOHA 1HHGB 4ODUA 4PD4J 5EUOF 1F02I 2A1WL 3MTRA 4X98B 2W9EL 5ENWA 1I85A 4DWHA 4XAWH 1R3KA 1IBGH 5IBTL 3SO3C 2HAZA 1G9ML 3GMQA 3QHZL 3X12B 4XCNA 3MLZL 3HC3L 1YC7A 4D9QD 2VKWA 3MCLL 4LCWA 1EO8H 1AKJB 4F2MA 4UQ3A 3CVHB 4V1DB 3WUWA 2FWOA 5L88L 1T0NB 2PKDA 3LKPA 4XHQA 1R0AH 3T8XA 5I17B 2G5RA 3C2SA 2FZ3B 2QADD 3CVIH 4HLZG 3QPQC 3C08H 1TCRB 5L2JA 3HR6A 4YHML 5HTSA 3TA3B 4ODXA 1T89A 4X99B 2VH5H 2D7PA 1N59A 5F3BA 2VIRA 4N0RA 3Q5YA 5IMMB 5JHDD 3CDCA 5T5NF 3EGSA 3BKMH 3C2AH 4CVWA 4WVRA 4FFWD 3IF1B 5D2LA 3KDMA 5E5UB 1MLCA 3TBTA 4LPVA 2F5BL 5IBLD 4OF5A 4JLRB 3UXFA 3HUJE 1I75A 1FVDA 1YEJL 5EZJA 3AM8C 4JRYB 4X6DB 2DQDL 3ZE2F 1ITCA 4H8WH 2FEDD 5FYLL 5TE4H 3TBWB 1GGBH 2PW2A 4BSVB 3L3IB 3VFVA 2DIBA 2X4QB 2D7QA 3SO3B 4JM4H 4OGYH 2I9LA 2X4OB 4NQCA 4OFVA 3ZZ1A 4NQSB 4KQ3L 4JB9L 5LWYH 4M7ZC 3RVWC 4PJXB 3DSFH 3LN9A 3U4BL 3Q6GH 3MBXH 1P69B 1I9RH 3KPSB 3BE1L 4KJQD 2XTLA 3OWEA 3UPCA 3X11B 1AXSB 1JGUL 1HOCA 4EI5D 3SOBH 1CFQB 5CKGA 4YEFA 1CFSA 5BV7B 2DM3A 3O4LE 5CBEB 2NY7H 4H88H 3MMEB 3IRPX 1FAIL 5D1XB 3KNBB 3AB0C 4WW2A 2EDQA 5E9DD 5BRZD 2DBJA 2BZDA 1ZGLP 3BO8B 3NPSB 4HKXA 3EDFA 4GAYA 3SGEH 4XCCL 1C5CL 1TMCB 2E3VA 4XPGH 1WZ1L 1XGUA 3LY6A 4ZYKA 3WXWL 3WIHL 1BEYL 1ZT7B 3S35X 1JJUA 3MLUH 3EOAA 5T1KA 5DVKA 1S9WB 4FFWC 1F6LL 3RWEA 1X44A 4H0IA 3TH2T 5IBLC 3RY5A 2R69L 4TTDD 1LO4H 3QP3A 4FTVA 4ODBD 4PP2B 3VRIB 2FEDC 4NJAH 5I30H 2XWJB 2ID5A 3G9AB 3FZUD 2FDBP 1NCWL 1KENL 4HMCA 3HE7A 5ILTH 3LS5L 5TDOA 1A9EB 3KYKL 4MAYD 3BOVA 3NCFB 1KG0A 1G7LA 4IDJL 2A6IA 1QSFE 1PKOA 3OGCB 4M7ZB 3FQWA 3DHMA 4GS7C 1IAOB 1HE7A 2ZPKH 5C2UB 4QXTA 5DC0A 3QWRD 3QDJA 5C3LD 1NLDL 1T83A 3LQAC 5EUOB 2EDFA 1H3XA 2KQNA 1G0DA 4KJQC 4NM8L 3PL6D 4WI5A 2QADB 3OXSA 5IMLB 4XZUB 5EIQA 1P4BH 1LE5A 4QRTB 4FQJH 3PP3H 4IOIA 1NBVH 5DEGA 1KLFA 3HE6A 1C16A 2IADA 3I85A 5I16A 2OCFD 1OY3B 4Z7UE 3T65B 4FQ2L 3H9HA 2A6JB 3WIHA 2UV3A 5JHDB 4QRRE 1RJZA 1CIUA 3NVQA 2P43B 5IK3A 2H8PA 3EZJB 4LIQH 3OKDB 5K93A 3O3AA 1IKNC 4H0GA 1KYOJ 4PB0H 1LP9A 1RK0B 3MLSL 3IS1X 1H3TA 2RR3A 4Y4KD 1FZMA 3MRKB 1J7VR 3NFSH 4YDKL 4P3CL 4DKAA 4K23H 3DXAA 5F6HJ 2DQFA 3BDYL 3DURA 3FZUC 4P5MB 2NW3A 3KPQB 1U8PB 2QSQA 4MAYC 4RDQF 4C83B 4GS7B 4L3ED 4PY7A 3MA7A 4H25A 1QPXA 4PPTA 5GS1C 1R6VA 1UZ8A 1A5FL 3V7MA 4F7EA 1UADC 3DVNB 2YKLL 1UWEH 4YWGH 4GKSA 4PJCE 5ICXB 4JFFE 1A02N 1JGVH 5JXEA 1GHFL 3TIEA 4MA1B 5F7UA 4WHCA 3OKMB 3ZYIA 3PL6C 2VQUA 2LAGB 4J4PA 3LKRB 2FECL 1B2WL 5BRZB 1BFOA 3BPCB 5J6HA 2EH7H 4I5BB 4NNYB 3MRLB 3RZCD 1I3UA 4IOFD 5I1LA 5I8OL 2WWKT 2Q8AH 1MCDA 4P2QD 1UYWL 5GGSB 2DM7A 4MJ2A 3LKOA 3MV9D 4XP1L 2OTUA 4ZMAT 5J1TC 3FTGA 2FATL 1A21A 2X42A 1BF2A 4I18A 4Y4HA 4BFBD 4UNUA 4P5KB 4LDOB 2FBOJ 3N85H 2XKNA 1VADA 4DVBB 4U1SA 1CL7H 5JOEA 4U1KB 5FO9A 3G6AB 3GDBA 3L3GB 4Y4KC 5IB1B 2F54E 4NO5B 3MLTB 5TE7H 3U36B 2A1WH 3CZJA 4OZGE 4ZTPL 3WL9A 3IDJA 4MAYB 3MRQB 4HMEA 5IBTH 3EFFA 2R2EB 1HEZA 3EUUA 3C8DA 5GS1B 1T22A 1T7XA 3I02A 2ADGB 2V5RA 3FO2A 1LEIA 1FJ1A 2R0KL 3CH1B 3PL6B 4CNIB 3VXSA 4JFDD 3OJMB 5IB5B 1KTDA 1KJMB 4OLXL 3B5HA 4LLVB 1JPTL 5F21B 1HXMA 2CIIB 1ORQB 2CGRL 4OAWB 3QDMB 3EO0B 2XZCH 1PX4A 5GGRY 4LBEB 4AG4L 1H8NA 4IOFC 3O6FD 4NYLB 5F7HA 4TVPD 4OCNC 5F7EH 2B2XH 5FECB 3ARBD 3MUGA 3HNSL 1IGJB 2DYPA 3DVGB 2D3VA 5EBWA 3K80A 2K7QA 3ARVA 3QZWG 1T21A 4IRZL 2R56L 4MGXA 4WFFD 3QEHA 1CU4L 4Y4KB 3W9DB 4ZAKD 4LPWA 5C2BL 1CGWA 3QFDB 5TGBA 2FR4B 5T3ZL 1N8ZA 3ME0A 3P9WB 5KOVC 3KPOA 4H26B 1JMZA 3RA7H 3O41A 2HFGH 3OAYK 4B0MM 5IIEB 3V0VA 4LHQB 1EEZA 1DTUA 4L3EB 4UNTA 4G8EB 2XN9A 1Q9LB 3C8KA 5HDQL 1X5YA 3S88L 2DRUA 3MRFA 2IMMA 1NCTA 4QHUA 5E6YA 4HS3A 1GJIA 4YZFE 3BE1H 2XNAA 2SEBB 3TPKA 1U92B 3B5GA 3DX7A 3L95A 1UJ3A 4MJIE 1LO5A 4ODTL 3S5LA 1MAKA 4JG0L 1H0DA 1GIGL 3RBGA 2XA3A 1NGZA 4P2RD 3LN5A 2VL4A 1QFWM 3INUH 4ZUTA 4RMQA 1O7SA 4XPBL 3RZCB 3EDKA 1C12B 2XPGB 4Y16D 4P2QB 5ISZA 4PGZA 3U7AA 5IG7B 2RJMA 1WZ1H 4RX4A 1GC1C 4LSQL 5D8JL 3MV9B 3EYVA 3O6FC 1PGRB 2VLLB 3WIHH 2P5WE 4ZDHA 1YY8B 4I9WD 3BPNB 5HGAB 4KKLC 1MUJB 4HWZB 4ZODA 5CIPA 3FOLB 3MREA 3N0PB 1KCVL 3NFPA 4MQ7A 4ZAKC 1EGJL 1YEGL 4C56D 4UUJA 3MRMA 4F58H 3GSQA 4U6XA 2BSRA 3KYKH 1OCWL 4NQDA 5JTWA 1U91A 4IDJH 1FNSH 3BFOA 4PJGE 1KEML 3B8SA 1S9VA 2XWBB 2ZG2A 4JQXA 1G7IA 2LE9A 5C0IB 5M95B 1NLDH 2LU3A 2OP4L 1U8NB 5ADPH 3RWCA 4P46A 3F7RA 5DJ6A 3RVUD 2IG2H 2XZQL 1KPRB 1LILA 3ZDZE 2BVUA 5IR1A 3FQTA 3MV8D 4EKXA 4XMPH 4YHOH 5JLZA 4LVNC 5JORB 2X1OA 1EIBA 1R5WB 3LZFH 2DD8L 4KTYA 1HH6B 3O6FB 5EDXA 4J3WA 2W0FA 4PJ7E 5DQ9A 4Z7NF 3ABZA 1TJIL 3ARBB 2LQRA 4OGAD 5DYOB 3MJ8A 3NCYS 4PJHE 3MRPA 4E41A 1F8TL 4B41A 4I3SL 1WFOA 2BVEA 3FB8B 3IDGA 1P2CA 4YEEA 2HVKB 3VXRA 1OGTB 1RD6A 1S5IL 5A2KH 4Z8FH 4ZAKB 2AQ1A 4LEXL 5BMFL 1IM3A 1JNHA 2F58L 4KDVA 2BCKA 3MRRA 3TJHA 4RGND 5DRWB 3VWJC 5E8PB 3VFRA 1OARH 3K3QA 4ELKB 2AI0H 4YDJA 2N1KA 5B38B 3NCMA 1P6AB 4ZSOE 5CD5D 1HYRC 1IGCH 1WCBB 3ULSB 2VISA 1ZT4A 4H5SB 1T5WB 4NJ9L 2YKLH 3TIDA 3PDOB 1DN2A 5TPWL 1A6TB 3BHBA 4PRAB 4OV5B 1LE9B 4L8SC 2DQUH 4P2RB 5BS0A 5HYJE 4LVNB 3QO1A 4NHUE 1QBML 4LLWB 3RDTA 3DUSA 1QOKA 2NY1C 4MLIA 5C07D 4HWNA 5I8OH 4Y16B 1UM4L 1P7HL 3AC0A 1MI5A 3MJ7A 2GCYA 3OJDA 1OTUD 3WEXA 1X5GA 1UCBL 2VB5A 4OGAC 2ICWB 3W2DH 1AIFB 2JCCF 4JRXE 2BNQD 2E27L 2EEBA 3HFML 3SDCD 5HVWA 4NKQB 3H3PL 3JVGA 1FGVH 3V79C 4QYOA 2VDOL 5E7FA 2ESVE 4C56B 1AGCB 3G5YB 2ZSVB 4O58H 3RWFB 5H94B 4MA3B 2J8UA 2VLRE 3BAEL 4JKKA 4Q0XL 4YFLI 3CAFA 5FM4A 1EVTC 4JGUA 3T2QA 4RGNC 2H45A 3C6LA 1ND0A 4JY6A 5EULV 5IJVA 4RNRB 1JHTA 5KS9B 4PRHD 1MJ8L 4RMVA 3PUCA 2WUCH 1TVBA 4HW6A 4D9LL 5JQ6L 2VZUA 1MF2L 5BW7C 2GY5A 1XGPA 1LK2B 4K9EL 1QLFA 3SJVA 4DKFH 5TH2A 4F7CA 5CD5C 1FZKB 2R0KH 1E28A 3QQ4B 4KFZC 5MP6L 2JF1A 2XG4A 4OLZL 4L8SB 4XCFL 4DGIH 2AQ2A 2PF6A 1HIML 3HZVA 1H5BA 1JPGA 2OI9C 3CU7A 4XP9L 3MV8B 1JPTH 4UU9B 4PGEB 4JO1H 2NY1B 4ZNEE 5I71C 4JFEA 4YAQB 1ZLWH 5EOTB 4LPYA 4FZ8L 4AG4H 2GJZA 4L9LA 1WK0A 2MKLC 3QH3A 2MCG1 1N0LA 2DM2A 4JKPL 4YBQC 4G42A 5GRXG 5E0QA 3PGDA 2G2RA 1JFMA 1G7QB 1NCCL 5C0RL 4WU5B 1HH9A 3TCLB 1BVZA 4ZNCD 3SDCC 4KKBC 3BRFA 1B4JH 1F4WH 4A6YL 2C3WA 1PKQB 3TPUB 1TENA 2HRPL 3QUKA 4QCIA 5CIPH 1IMHC 3F6LA 4GKZB 3IU3B 4NZUH 3KXFD 3P9LB 5AG8A 2ENSA 4ZO7A 4G43A 4RGNB 4O4YL 4G6MH 3RFZC 4WHYG 2NY6D 3OAUH 1P84J 4TSAL 1NDGA 5F88B 2H26B 3I50L 4S0TD 3RY6A 5F7FA 4F7PA 4R7NB 5JW5A 4M5YH 4XWGL 5HHPA 3SGDH 3DIFA 1KN4L 4L4TB 4X4YA 4ELMB 5CMAB 5JA8B 3TBYA 2OI9B 3QI9A 3DJ9A 4Z9KB 4ZO9A 5LCVL 4EI6B 5I71B 2EDJA 3NCCB 3VXQA 3DLQR 2AJXH 2EC9U 5FO8B 5IB3B 4RMSA 5AEAA 4PB9L 3OG6B 1DLHB 4M62L 3KJ4C 4KDWA 3T0EE 3ARGA 4XCEA 4U6YA 5ESAB 5JW3L 2H2PC 1U8JA 4M7JL 2NMSA 3ZE0E 1IQWL 4WI3A 1EAPA 3EOBA 4NN7C 2AKRA 2EEDA 2BNQB 4XCYB 3HI5H 1IAKA 3IDMB 1DUZB 3SDCB 3TBSA 1ZKAA 5EWIL 4OT1L 1YDPB 4OFYD 2R0ZH 5CILH 1KCVH 1Z3GH 2EDKA 4UBDC 1MAJA 1QLRB 1VFMA 1EFXD 4Y5VA 1H3UA 2XZAL 3B8YA 5L7XL 2FO4A 2IBZX 4HX1A 1QVOA 2IFGA 4Q6IA 5J1AA 1WT5C 1VKXA 4C4KO 5CD3A 4N5ED 5EN2B 3TYGL 4PRHB 3RI5F 4I48A 2JCCB 2WANA 4D0CB 3FQXA 2NY2D 1EZVX 5FYKL 1NGYB 1U6AL 3KPRE 4NRXA 3U83A 2NTFA 1NUGA 4Z7WA 1ZA6A 3REWA 3P4LA 4HH9A 2YXFA 2A9ML 2BHUA 4HQQH 4YDVA 4GKNA 1ZLUH 1OGAA 5D96B 4YHPB 2OS7A 1EDQA 1CXEA 4LNRA 3SCMA 3STLB 1CFTB 4HDIB 2YHGA 4M9PA 1J8KA 5F7DB 3KJ4B 1F58L 4ZUVB 3PHSA 3D69B 4HUMB 3ZLQC 2OJZH 4RQQB 2DD8H 3RY4A 2UZYB 4J7RA 4UV4L 3S35H 1FL5A 4WUUD 2BNRD 1U8IB 1J10A 4NN7B 5SV3A 1U8OA 4YLQT 2X09A 4XBPA 1M05B 1Z9OA 3PG2A 5MHSE 3NAAL 5IMOA 1I8MA 3G5VA 3ZTJH 2Z8SA 5D5MA 1N6QL 5GRWA 2A0LC 2AGJL 2EE3A 3M17B 3QUXD 2HLAA 2W60B 2X4NB 1Q0XL 1JF5A 4MDIB 4DUVA 3KXFB 1YJDL 1CGXA 5IROA 2VXTH 1GGCL 1YY9C 4N1EA 1MHEA 1Q72H 5FKAB 5BZWA 5GS0L 1MFCL 2NY6B 4O2FB 4F7MB 4BSWB 5TDNB 4KH2A 4N5EC 4MDJB 1MAML 1J8HA 3I2CL 2NY2C 3NFNB 4N0FA 4XNXH 2GJ6E 1J5OH 1MEXL 1N26A 3FFCA 4MVBD 4KXZH 3UDWC 3R06B 3H2WA 2KL6A 5CEXA 3VCLB 2VKXA 3B6SB 1ZVHA 5L8LB 4WI7A 3V5KB 3HZMB 1IEBB 1FSKC 5KVFH 3RI5K 3ES6B 4G8GD 1HSAA 1JZ3A 1T1YB 3TBVB 3EJYC 2WZPD 1UKSA 1RJLA 1PG7L 4LF3A 1UM4H 4AMKH 1U8QB 5I66B 3QCVH 4YHIA 4LLDB 2AK4E 1KEGH 4MAUL 1FFPA 5I1EL 2AXJA 1UCBH 3X14A 3MRHA 3KR3L 3T3MF 3O6KL 5DQJB 4PJ5A 3GSXA 1DBBL 2E27H 4Y5XA 3HFMH 3UZQA 3UPRA 1FN4A 4EUPB 4OZIE 4ODSL 2B8OT 3ULVE 3GMOA 2VDOH 3F7QA 1EFXB 1MFDL 3QUXC 1M7DA 1EVUA 2Z8WC 4LLMB 5ACZB 4BUHA 1UGNA 3G5ZA 4Q0XH 2YBRA 5E5MB 4NUJB 3DGGB 4Q97A 2HRLA 2J3SA 1V7NH 3P4OA 4JVUA 5IT2L 4BUGA 4RAVA 2NY2B 4O2CB 3VXUA 1QLEH 4GLRH 2D2OA 4KROD 3L5XL 3AS1A 3BRGC 1RFDL 3SBWC 3FB6B 4K9EH 2RAMA 4MHHI 1CK0L 1U95B 3TFKD 4I0PA 1AGFA 1JF1B 2OL3H 5MP6H 1M1SA 1QEWB 4FXGB 1HIMH 2NZ9D 4ZFZB 3RUGA 1FSKB 3MRGB 5B8CC 1GZPB 2A74B 4XP9H 3ARED 4IRJA 3K4DA 1WBYA 4JFHE 1RUKL 2AJZA 1I7RA 1WEJL 1E4JA 3D2UD 4PP8C 3VD9A 1J9CT 1T7ZA 4WUUB 4JKPH 4U05A 2BNRB 4OLVL