3TO4C

Structure of mouse valpha14vbeta2-mousecd1d-alpha-galactosylceramide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
204
structure length
190
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTVYITDKTVLDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Vbeta2 natural killer T cell antigen receptor-mediated recognition of CD1d-glycolipid antigen.
pubmed doi rcsb
molecule keywords Antigen-presenting glycoprotein CD1d1
source organism Mus musculus
molecule tags Immune system
total genus 32
structure length 190
sequence length 204
ec nomenclature
pdb deposition date 2011-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3to4C01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3to4C02
3ZO0A 5MEOA 2VXQH 4H20H 3T2QA 5JMRA 5DHXB 1M7DB 3QXAA 2ZG2A 1QLRA 4L4VD 4YDLC 5F3HB 3BVNB 2DIBA 3U4BL 3GDBA 3ZDZE 3KPQB 1NEZB 3EYOA 4XTRC 5B3NA 3DX7A 5FGCB 1IKFL 2D7NA 2PXYB 3KPPA 1EVUA 5IB3B 5DVNA 3G6AB 1FH5H 1VHPA 4TTDD 4YGAB 5JUEH 2A73B 2LU7A 2ATPA 3ULVD 4N0UA 5HXMA 4H1LA 3OAYK 4R2GD 4XHQA 1NMAH 1RIVH 4MDIB 5B4MD 1A6ZB 1HXYA 3QWRD 1NGPL 4WFED 2R1YA 5CUSH 4TULH 3RVXD 4NKIH 3DIFA 3DXAD 1L6XA 4GH7B 3TFKD 4I2XA 1CQYA 4L3EB 2AJ3B 2OSLB 3DVNA 4FQCH 4P3WA 1YN7A 5D2LA 5JORB 3QYCA 4PJHE 1RUAL 3B3IB 4R0LC 1YMHA 4MNGA 3VFGH 3QUZA 4LLYB 2H32A 2IAMB 4ZFZA 3RWIA 5T3ZL 2AQ2A 1BLNB 1CGSH 3CMGA 3GSNA 1FNGB 4R26H 2AABL 2EC9U 3WLWC 1S9WB 4ZG1A 4JEGB 4R4NC 5JHLH 4YDIH 3HCVA 3WFBH 4JQIH 1RHHA 1T83C 3T2OA 3OL2A 2NY6B 2P8PA 4AL8H 4NIKB 4F7CB 2H2SC 3S37H 1X5AA 1FE8H 5CCKH 4Q58C 2ADFH 4MXQC 3GIZH 3SKJH 2VWEC 32C2A 3UXFA 1RUQL 1Q9LA 1N0XL 4JRXA 4HGMA 1YY8A 2YUVA 4HXBH 5HY9A 5IVXA 2Y06L 2ERJC 1V7MH 5HJ3B 5ILTH 3IDYB 1NGYA 3V2AR 2YZ8A 2ZJSH 2MFNA 1OGAB 3RPIA 3NABH 2QR0A 1B6UA 3I84A 4PJHB 3OKMA 3VCLB 5J13B 1MCRA 5DR5L 4WV1C 2BJMH 1T0MA 2NY6D 3HUJA 3OJVC 4LPCA 1XMWA 1KGCE 4P4RA 1FO0H 1PD6A 1UACL 2OP4H 1F13A 2OI9B 2ZSVA 1DL7H 1GHFH 3BAEH 4AIZA 1C5BL 3P30H 4EXPX 3K1DA 3U1SH 5EOTB 4PJDE 3WEXA 1R3IH 5E9DA 4DZBB 2V9RA 1V7NL 2L4OA 3SCMC 3ARQA 3PDGA 5C0JB 4UTAH 3DO7B 3HG1B 1IGJA 4L8SB 4I18C 4QT5B 3FQUB 4FMKA 1T20B 4JFZH 5KVDH 4MA7L 5I1DA 4J3VA 5BJTB 4PJ9B 1JZ7A 3M17A 3D48R 5E94A 4LGPB 4YO0A 1JNLL 2CMRL 4WO4C 1HH9A 5FHBH 3NBNA 3TO4A 3ZE0F 3VH8G 3VXTA 1G7PA 4HBCH 4HF5H 3FQRA 4QOKE 5DHYA 4GW5B 2X9XA 5F8QC 4NZRH 4F15C 4TNWK 3SQOL 3HG1D 4U1HA 3NCJL 9CGTA 1OTUD 4Z9KB 1MY7A 3GB7B 1YPZE 4HCRL 5DJDA 4K07A 5IROA 4WDIB 3O6LL 4YHIB 2X1PA 3HFMH 4H0IA 4U2ZA 4G8IB 3FB5B 5C7XL 3VG0H 4PJ9D 5KSAC 1C12A 2XG5A 4UIMB 3X3FL 1LO3H 5D7JC 3PWNB 3PXHA 2Z91B 5JNYB 4OQTA 5CJXA 3P4LA 1KGCD 5JW4M 3NMEA 3P3YA 3MNWA 4LSSL 1TNMA 1UJ3B 5F7MC 1L7TL 4XP1L 1TJGH 3VD3A 4EUPB 2IADB 3UBXB 3H6JA 2XG4A 3RY4A 1CE6B 3GI9H 3MRCB 4FQXB 4QOKB 1EEYA 3VRLE 1G9NC 2WV3A 5DD3H 1RJZA 5C0RL 5J6HA 1F4YL 3VFMB 4L8CA 1E6JH 3B8SA 2NY0B 1JPFB 5C08E 1OB1B 1YEHH 4M6OL 3JTTB 4JPKH 2QQLH 3LEXA 3O6FB 4QXGL 4GG6E 3REVA 2QHLA 1IAKB 2FDBP 1YPZB 2VXVL 1RFDL 4IDJL 3AXLA 1XFPA 3H7BA 2NY5L 2WUCH 3BW9A 4WEBL 2PO6B 3ARDB 5CILH 3SDCA 1WWCA 1CDYA 5GGUB 2FX7L 4CADB 3T0WA 2HFGL 4XCNB 1F6AA 1MFBH 3S36H 1YEIH 3WIHA 1WVZA 2KPNA 1U8PA 2KUTA 4X9HA 3T0VA 3TZVA 1BBDL 4FQXD 3OX8A 4QOKD 5EO1A 3WSQH 4U33A 2QQQA 4HK0A 3JXAA 3GJFH 1Z9MA 1CFTA 1ZEAH 3SN6N 2OK0H 2VH5H 4ZS6C 1KJMB 2F74B 3AMKA 3D87B 5BVPL 2B39A 5ITFA 4HG4J 4ONHA 2BNQA 3C9NA 3QG7H 1UXWA 4X80H 3MCG1 4XWOC 3ARDD 3B9DA 3UTTA 2PKDA 1A5FH 1L0YA 4WW2C 35C8L 3OF6D 5JW4R 3U30B 4UB0H 2H6PB 1XIWC 5IMOB 1U58B 3FMGL 4GG6B 4XX1G 4U4BA 3BIKB 4UBDD 1MWAA 5T5FL 3B9AA 5HHNB 2VDRH 3Q6GH 3EFFB 2MCG1 4XCFH 1M6OB 4HUNB 1LO4H 1EEUA 3IKKA 3MNVA 1TZHA 5E2UH 3KDMB 4HH8A 1T0PB 5E5UB 3TLRA 3RZWA 4X4ZA 1TTGA 2VZUA 1YEEL 4EI5B 5CEXB 1XCTB 5GISL 4AT6A 3P77A 3HMXL 3LKRB 5C08D 1HKFA 3AREC 4J4PD 5DQ9A 4NQSB 1FL5B 2LAGB 3A0OA 2IBZX 3IDGA 1PX4A 1UM6L 3LVEA 2YEZA 2X05A 2CDFB 3SY0A 3FRPA 1YEDB 1OP9A 3KYAA 1QFWL 3U7WL 1A4JA 1Z5LB 3OKKB 3I85A 2FWOB 5CIPH 1WWBX 5F9OL 4PJCA 1J0HA 2ZCKH 5D7LA 1QLEL 3L3OA 4OZ4B 1YY9C 3QI9C 2YD6A 5L0QC 5DRNA 3V7MA 4PJIF 3WD5L 3ULUC 1ZHBB 2JJSA 1J05A 2BSRA 2VDKH 1T1ZB 1J0IA 4L9DA 1SHMA 1NCBL 4X6BB 4XCEA 3D39E 4U31A 5J4MA 4YX2H 4YHKH 1HSAA 2P48B 3T77B 4GKSA 1TZGH 4YEFA 4OJFH 4GAYA 2Y72A 1QBBA 1FNSL 4JO1H 1LDPL 4TNVK 1ZGLM 3BKMH 4XBEL 1U36A 1I1YB 1G1CA 1CXKA 1NANH 3HI1B 4X6EB 1DBAH 5EZJB 2OTPA 1U8HB 4QXWA 4E0RB 2DI9A 4M5ZH 3GMRB 2FBJL 4PP2A 3OJDA 2BSSA 2R0KH 3IRPX 1IKNA 1X6NA 4X9IA 4OGYH 4GUPB 1F02I 4RA0C 5HVFB 4M7ZB 3TVMA 3D85D 2N4IA 4EBQL 4LKXB 1HI6B 3GMQA 4KROB 4LCWE 1H8SA 4LEOA 4YPGA 5FYLE 4ZYKB 4S11A 3RTQA 1KJ3L 3E3QC 5ID0A 1D5XB 3VXNB 2VSDA 4F9LA 1A6VH 3MLZL 1OSPL 3WO4C 2G9HB 4YZFF 4JFEB 3QEUB 3N1GC 4JN2A 5ERWB 4ONOA 2BC4B 4P2QA 5DEZA 5DEGB 5FA3B 4PIRF 4NQEB 3ULUF 2EXWD 2GYSA 3KG5A 5CD5D 3RUGB 5EWIL 4HHAB 3W2DH 3QEHA 5DRWB 2WIIA 4KROD 3ELAT 4DFIA 1H15B 3MYZA 4XXCC 4Y2DB 2E7HA 1NAML 1ORQA 2R0LH 4CMHB 1UQSA 2UWEA 2UYLA 3QA3A 5HGHB 4JFED 4Z18A 4I48A 4NQVA 1C16B 1RZ7L 5ADPL 4OD3H 5J7CC 4W70A 5D71L 5DFTA 3RY6C 3D39D 2E9WA 1BZ7A 3GK8H 1KN4L 3CDCA 4LLWB 1TDQA 2UUDK 4NQED 1T03H 5HPMB 1GZPB 2HLFD 1NFIA 5C0NC 5HGAA 4DVRL 2JIXD 3BP6B 5INDB 1FNEA 5JDSB 2GITA 3QDMA 3L6FB 3MLUH 5D1QC 4Z78B 4MAYA 1MHCB 1UWEL 3IXTA 4K8RC 1MCEA 4PLJD 1TLKA 4LVNB 5I1LB 3LKQB 1CE1L 5LJYH 2XRAH 3SO3B 1LEKB 3MJ9L 4ZFFB 1QACA 3STZA 1NFDA 2OJEB 3LKSA 3LN4B 1RURH 3NCYP 4JDVB 1FIGH 4GXUM 3WHXB 4HWZA 3T1WA 3BGMB 3OKDB 2EDLA 4LCWD 4YUEL 4HX1A 3NAAL 3LIZH 5I15L 2W0KA 3VXRB 1AGEA 3IDNA 4AJ0A 3VRIB 1MI5E 4JM2B 2NZ9D 1F4XH 5D6CB 3WS3B 3GBNH 5SWZE 3SDDA 4LRIC 4NHUA 1EA9C 1NPUA 1FGVH 3ZKXB 3KPRB 1JL8A 1ZLSL 1YA5A 1OGTA 1PVHA 2XICA 5CKAA 5F6IC 1E27A 2BXYA 2CDEA 5IP4A 3RQ3A 3RVVC 5DDHA 4MA1B 3Q5OA 1AGDB 5JA8B 3EDEA 4ZUUB 3KJ6H 4HUWB 2H3NA 2RHEA 3TT3H 2H26A 1J1XL 5D7SH 4UQ2A 3UEZA 4OCSL 2D9QB 4NN7B 2P1YA 1A7QH 1N3NB 5HHQA 5HGDB 2A1WL 4PJEE 4EOWL 4JM2D 2AXGA 4ZD3L 3VJ6A 5I1HL 3QNZA 4M3JA 1WZMA 5CSGA 3W0WA 4JB9H 3AC0A 1TCRA 4P9MH 3DTXB 4AEEA 4E41A 1LQSR 2JELL 3DHMA 4FQ1H 5H35A 5FV2A 4MVBC 3HE7A 5DD5L 5KVGH 1BOYA 4ODVL 3QUMH 3SDAD 1C7TA 2X4PB 1UEMA 3MJ8A 1S78D 2PW2B 1FL3B 2EEAA 2Q7NA 2E9BA 4LBEA 5JZ7C 4OI9A 5EU3A 3QZWB 1AD0B 2V7HA 2X6MA 3RNKB 4LASH 2L7UA 1JZ4A 2ATKA 4RBPK 3QFJB 3PP3K 3ARPA 1FVEB 3GBLA 3OG6B 4YDVA 4M7LH 4N0YL 4KV5F 1T3FA 2F53A 1U3HA 2EYTB 4PJEB 4U6HA 4OZFA 1DQMH 1NGQL 4QCIB 4OZIE 1S7VA 4H88H 3E8UH 3R8QA 1DLFL 4DN3H 2VERN 2B2XL 1JK8A 2VXUH 4JR9L 4OBRA 1FYHB 3MRPA 1HZHL 4OFVA 3V0VA 1QLFB 3QFJD 2HFEA 1NUFA 4UNTA 1MLCB 1G9NL 3MFGB 1FYTE 5F96L 1WWWX 4PR5B 3VMNA 1X5ZA 2FD6L 5J6GB 2EDFA 1JGUH 3QHFH 2KZWA 3CU1A 2P5WA 3GKWL 4NHCH 3P4MB 3ZKND 4U1LA 3HC3H 1NUGA 2MQ3A 1B6DA 1CICA 2GKIA 5CBAA 4YLQT 5DT1H 4IOIA 2CRZA 4I5BA 3ES6B 4NKOB 1AO7E 4QTHA 5DSCB 3P73A 4JZOA 3ILQC 1J8HA 1H3VA 4FZEL 3WN5C 4OZIB 1JHKL 4HFWB 5E8PB 2DICA 1A64A 2YA2A 5FYKU 2HFTA 1W72L 4QRSA 4ZNEA 2QSVA 1H5BA 2QJDA 4OKVB 4HJJL 3W81A 4NQCE 2DD8H 2IJ0C 2R4RH 1I8IB 43CAB 5EIIA 1K4CB 4MAUH 4ENEC 1CR9H 1S9VA 1UA6H 1G7QB 1YEFL 3RPKA 4URTB 1CG9A 1OARL 3QIBC 3KPSA 2HKHL 4Z95H 5DUBA 3DETC 1IGIH 5GS1B 1A9BA 4FFWD 5ICYA 2P5EE 5HHOA 1EIBA 4X99A 5DUMH 3PGCA 4J12A 1FZOA 1U95A 3HZYB 5CSZB 5L2KE 2NW3A 2I9LB 4YNYA 4JHZA 3TYGH 1QFWM 4Q9RL 2KBGA 4LMQE 5GPRA 3NPSB 4KXZH 4RDQG 4U3XA 5DURB 1AO7B 3RDTC 3L7EA 5J3HC 4UV7L 3LN9A 3DV6B 1P7QB 2RFXA 4M9PA 1DBBL 1I9RL 1NC4B 4G9FE 3IDMB 4Q6IB 3RWEB 1FYTD 5GHWH 1HINH 1RZGA 4ZAKA 3FKUS 2E6PA 2DTSA 4Y1AB 3CH1A 4DVBA 3L3HA 2MPAH 2GUOA 3TNMA 3UJTL 4IRSB 1FGNH 4KHTL 1VB9A 3MRMB 5C07A 5LGJA 2XPGA 1CLOL 3FHAA 2O5ZL 4O5LL 3BMWA 3F7VB 5F93C 5HYSB 1LEGA 5DURD 1AO7D 2AV1A 4XC1L 4OCNC 2R29L 5D1ZA 4EUPG 3UBXG 2XY2A 4JM4H 3WYRA 1T1YA 3CVHB 1Y0LB 5EOQL 5L2KB 5MEQA 5ESAA 3ULUL 5JW5A 4Y1AD 4ZXBC 3JTSA 2NX5E 4S1SL 5F9JB 2ARJA 1C7SA 3GHEL 4IRSD 1NGXA 3WJJC 1FORH 4NQCD 5DD0L 1YYLH 4XHJD 3MLSH 2WBKA 5B8CB 4FQJL 5ALBH 2G75A 2FX9H 3VGDA 4G9FB 4N8VA 1MHHB 3BISA 3FONB 2CRMA 5I8OH 4J6RH 3J7HA 4MJ6B 5BXFB 5C6TH 4U0QB 5D72H 2VR4A 5EU6B 1IC4H 3ROLB 1J0YA 3UYRL 1QYGH 1H3WM 3ARTA 3TNNB 2P5ED 1TJIH 3TT1H 1JF6A 5ENWB 3T1FB 5IEHB 2EIZB 4HWEH 2E6QA 1IJ9A 3CSGA 1K8DB 5L9DL 5L2KD 3F7QA 4E5XA 1P9MC 1A4KA 4HLZG 2X09A 4L4VA 4N68A 3RWFB 2A9ML 5J11B 1K8IA 3V5KA 2OQJB 5KAQF 3MQIA 3LQAC 3BKCL 2VIRA 3EKCA 3GSVB 4GSDH 1LO2L 4KJWC 1HOCB 3NN8B 4HS6B 4XBGA 4G9FD 3EJJX 4QNPE 1ES0B 3DX8A 3PP4H 4L3CB 4Y4HB 1EMTH 5E8DH 5CJOL 1JF1B 5GS0D 4XPTL 4MNQE 4DZ8A 2NX5B 1TTUA 1RU9L 1V3KA 4NT6B 1BEYH 2MOVA 5HDBF 5JR1H 2D31B 4K7FB 3QG6B 4AIXA 1M7DA 1EAJA 5CAYB 2B5IB 4HIJA 2KQMA 1JP5A 3BVNA 2V7NB 4I3RL 3KPQA 1NEZA 3H9SB 4Y5YC 1PLGL 3OPZH 2MCPH 3BQUB 2PXYA 5IB3A 4RMWA 7FABL 3S37X 3P11L 3BFOA 4Z7WB 4QTIH 3G6AA 2R1XA 2AAVA 3BN9D 4OFIA 4Z7VE 2A73A 1CZ8H 3WV0A 5IGXH 1ZAGA 4JANB 4IM8A 3STBA 2NX5D 3QCUH 5HGBB 5TDNA 2HT4D 1BP3B 5D6DA 1Q0XH 1DR9A 4MDIA 4PJIB 1Q0YL 1A6ZA 4F9PC 1H8NA 1AQDB 2SEBB 4QO1A 3QXVA 4RGNE 3NFSL 5CP3H 4GFTB 4DK3A 3EJZC 4PRIE 4XCCL 1HILB 3LDBB 5L6YL 2AQ1A 2AJ3A 4L3EA 2OSLA 1NAKL 5JORA 2ZCHH 3KWWB 3AROA 3BQUD 3NIDE 4U1GC 4PJFF 4K8RL 3U2SB 2IAMA 2E27L 1FC1A 3BDYL 3MOBH 3RX7A 1BF8A 3MGOB 1BLNA 1XGQB 2RIKA 5D7KE 3BIBX 1FNGA 5E00B 5ITBH 4KJPC 2FNBA 3LMJL 4ZSOE 2D7TL 1S9WA 5EG6C 1AE6H 5I1KH 3MPCA 3PHQB 1MUJB 2K3TA 5IVNA 1ZKAA 5HHVL 4F7CA 1A7OH 4RMQA 3TBWB 1KENL 2NYYD 4MNQD 4KVNH 4L1DA 1CDJA 3VI4F 2EXYC 4GAGL 3OGOE 4IBLT 3U36B 5A2IH 3CUPB 4RGNB 4XNXL 2Y4SA 1BPVA 4PRIB 3C2AL 2HH0H 4OLYH 4BELD 5BZWB 5HJ3A 3VFSB 1ZT7A 1AQKH 1QO3B 2XI9A 2XIDA 1OGAA 4OTXH 3DGGB 3GGWB 2HMIC 4PJHA 6CGTA 5F7YC 1JNHA 2DWDB 2QQKH 3MV7E 3VCLA 1MJ7H 1OAYH 5ADOH 2YXFA 1CGUA 3NTCH 4KJQC 5C9KA 4NNPL 4CDHA 2EDDA 2CR3A 4YDKL 3X13B 5DFVD 2NW2B 5LAXA 2VZ3A 4LSVH 3TO2A 3BGFB 4IJ3B 1F90L 2YHGA 4OD1H 4ZSOB 5DJZB 3HE6C 4RGND 5CEZE 3K8LA 1CDIA 4PRID 5AYUL 4HWBL 5CBEB 5EOTA 3I3BA 3BPNC 1KN2L 4DZBA 4LSRH 3VGBA 3H3KA 4Q74A 2FATH 5C0JA 3DO7A 3HG1A 2YR3A 4X9BA 5EORL 4L8SA 4QT5A 4TPRL 3FQUA 3CJJA 1T2JA 4YIQB 3QNYB 2VQ1B 1LILA 5BJTA 4D9LH 4PRDB 2LE9A 4PJ9A 5FKPB 3T0DA 1KCLA 4OQ1A 2EH8H 1A7NL 3L3JB 2ITDB 1R3KB 4LK4A 3HNVH 5DZLA 4Q0XL 5GJTL 1KB5L 4GKNB 1TQCC 2DQGL 3PQYE 3BEVA 5GGQH 1NCCL 3S8WA 2F15A 2MMXA 1CLCA 1R0AH 5J1SC 3GB7A 1TCMA 4G8GB 1NBVL 1MPAH 4WDIA 4YHIA 5IK3B 4OCWL 4G8IA 2V2XB 3FB5A 4OD2B 3SE4C 3VXUE 4UIMA 4O9HL 2C5DC 1AJ7H 1DVFC 1NKOA 3ZT6A 3G5ZB 4OLZL 3PWNA 4M1GL 1HHIB 3EOTH 1DUZA 1ITCA 1IM3B 2Z91A 4FRWA 5JNYA 4XP6L 3TM6A 4JHAL 4XNZC 4S10A 5C0BE 3ZL4L 4PJXF 1UJ3A 1OL0A 4K94C 4EUPA 2IADA 4JKWA 4LCIL 2NR6D 5CEZD 2KL6A 1CE6A 3MRCA 2Y25A 4F8TA 4I0PD 4IDLA 3O9WB 3TESA 3B4NA 3CFIC 3EZ8A 4RWYH 3VFMA 1ZGLP 4DW2H 1JPFA 1OB1A 4MGXA 4HKXB 3JTTA 1XGRB 1JHLH 3O6FA 4XNUH 4Q97A 1IAKA 1L9NA 2LAAA 1YPZA 5KN5B 1BVKB 1HWGB 2AJSH 2PO6A 3ARBA 3ARDA 3RJQB 2YPVH 5FCSH 3G5VB 3AFLA 3GBMH 3OF6A 5GGUA 4ELMF 5LKNA 4CADA 2AV7A 5E2WL 1BF2A 4FFZL 2O26U 2E7MA 1KJ2L 2NY7L 5DFWH 5CKGA 5F7HA 3MLVL 2EO1A 2VLJE 1BFTA 4DTGH 1FRGH 3O9WD 5CZVL 4R7NB 4I77L 1PG7W 4LSPL 3OXRB 3RGHA 2W9DH 3VWKB 2F74A 1MCOL 3U79A 1NLDH 3BP5B 1I8MB 1A6TB 2EICA 5DJ6B 2DL2A 3VXUD 4R4BB 1QOKA 2H6PA 4FMFA 1U58A 1XR9B 4PGEB 1PJ9A 3U7AA 3BIKA 2H2PC 4AEHL 5HHNA 3DJ9A 4NJ9H 1A3QA 3EFFA 1XZ0B 5C0BD 3OGCB 1M6OA 4JFDE 4JGMA 4LVOC 3TP4A 5F1OB 2CKBB 2DI7A 1MCPL 5E1HB 5GGTH 3P9MB 3E6FA 3KDMA 1F00I 3VXQB 4C54A 1OCWL 5K33A 5GRUH 4EI5A 3MLRH 5CEXA 1XCTA 4XPHL 4K7PL 4TRPL 4JKPH 1U2HA 2DI8A 4MXWH 2VLJB 3RVUC 5BOZG 5F7DB 2OS7A 3FHQA 3VG9B 4P9HC 2IQ9L 4XNYL 2CK0L 5GXBB 2QEJA 4JY5H 2AJYL 4PV8B 1NFKA 1MQKH 4NQSA 1FL5A 2ZCLH 4QXUL 1MY5A 4NUJB 2YPLB 2CDFA 2WWMC 3HZKA 4WUUB 3UAJC 1YEDA 4Z7OF 1D5IH 4YHYB 2CGRH 3OKKA 2QTEA 2FWOA 1F6FB 3L7FB 4P5MB 1CTOA 1W0WB 4DEPC 1P1ZB 4GW1B 1QKZH 1ACYH 4WEUD 4OZ4A 3I6LE 5HDQH 3S3JA 2VLJD 3U4AA 1A3LL 1KSRA 5C0DB 3MMEB 5HHPB 1N64L 1OAXH 4PG9B 1UKQA 1T1ZA 4GW4B 5FUZL 1JRHH 2XA3A 3GSUB 1DQJB 1I3RB 4X6BA 3EFDL 3EJYD 4PV9A 4WGWB 3T77A 4UV4H 5D1XC 2YPLD 3GMLB 1NC2D 3B2UC 4X4ME 1MCWW 3MRJB 4IOSD 1SQ2N 4M7LT 4LP4A 1SJXA 2GY7B 1T6VN 4BZ1L 4RIRB 1I1YA 1UXSB 3DSNA 4XRCB 1A1NB 4GBXB 1AGBB 3TV3L 3HI1A 4X6EA 4X8JB 1MJJB 5EZJA 4ZTOH 5DLML 1U8HA 4JFDD 5FYJU 2OJZL 3DUUB 2ADGA 4GUPA 1H3UA 4OT1H 4LKXA 1HI6A 2NXYD 5KVEL 1HH6B 3OKEB 3BH9B 4ZYKA 1S9XB 2IH3B 2ITCB 1D5XA 4NNYB 1KPRA 4KXZI 1RY7B 3VXNA 3VD4A 1QRKA 3UAJD 4PBWD 5AZEH 2G9HA 4JFEA 1P4BH 2FECI 3HAEG 3QEUA 4PJAF 2YWZA 3KJ4C 5ERWA 4GBXD 3VA6A 2BC4A 2DQUL 3PHOB 2NXZB 5JUEL 4WU7B 1JYXA 1EGJL 5DEGA 5FA3A 4D0BB 3QISA 2M26A 4NQEA 1DQLL 5T33H 3NACH 3SOBL 4X4XB 5ICXB 5I1EL 1AGFB 1KJ2B 3D0LB 4LPXA 4HD9A 1RIVL 3RUGA 1K6QL 4HHAA 5HYSG 2HJFB 5TQ0H 5CUSL 5DRWA 4RWHA 2X41A 2I60H 4MMZC 2D7OA 3I6LD 4Y2DA 5F8RC 4P5TD 5LGHL 5T3ZE 3C6LC 2IBZY 2XQBH 4FQCL 5EU4A 5HGHA 5FOBB 2GSGB 6FABL 4KQ3H 1GGTA 1C16A 3IJYB 5EUKB 3LB6C 4APQB 5C2UB 5GRXG 4LLWA 5IESH 5F7NC 1I1AC 3WNKA 5HPMA 1GZPA 4R90H 3AVEA 3DOSA 3H7LA 2CSPA 1ZGLB 4N9OB 3BP6A 5INDA 4HIIB 5JDSA 4W4OC 3Q3GA 3HI5H 3L6FA 4F3FB 4Z78A 2OL3B 2WW8A 3OJMB 4KPHH 1X4YA 4ZTPL 4O51B 2VXSH 4JQIL 1Q94B 4NC1C 4Y5XC 4NDMB 5I1LA 3OMZA 4U2YA 4ZO7A 3LKQA 3AM8C 4TVSa 4XMKL 4U1IB 4FHBD 5CCKL 2YWYA 4ZFFA 2NY4C 1KELH 5E99H 1QG3A 4KKLC 2OJEA 3SE8H 1EH9A 2DQEL 3HMXA 3SKJL 3VD7A 1N5YH 2XWJB 4X6CE 1CXHA 4APQD 3KPTA 1MHPL 4JFFE 1YEJH 4MNHB 1OAUL 3O2DA 1CXIA 1CBVH 3VXRA 1CXFA 1YQ2A 3VRIA 4JM2A 5T1MB 5IV2B 5D6CA 3WS3A 4LDOB 1JYNA 4PUBH 4MZ2A 1SBSL 3VXME 3VFNB 3KPRA 1IGMH 1QSFE 4PBXA 5D7IF 4HJ0D 3IXAA 3LRSB 3X11B 1H3GA 3H9YA 2HG5B 1X6LA 2OP4L 1KC5L 1S7UB 4KAQH 4ZUUA 4HC1L 3RA7H 4HUWA 1WV7T 2B0SH 1J9CT 1V8HA 4DK6A 4TUKH 3BT2H 1JPTH 1KUMA 4WFGD 1SBBA 3GSRB 4HXAH 5T3ZD 1N3NA 4AEIH 1SEBB 5HGDA 1R3IL 1OM3H 5I1AB 3O4OC 4L5FL 4KKAD 1CN4A 2HKFH 3U0WH 4PJFB 1SM3H 1Y6NR 1TZIB 4X6CB 2CD0A 4FQ2H 4JFZL 4OCYH 5KVDL 4JFFB 1MLBA 2V9QA 1MAML 2DIAA 3DTXA 3BRDA 2BVOB 1ADQA 1CLYH 4MQXC 1CU4L 4QHUB 2FCBA 1Q9KB 3ARFB 4KMTH 4OGAD 3VXMB 2YUXA 2FIRT 2X4PA 3B9KB 2VZVA 2PW2A 4HBCL 4KHXH 1FL3A 2A83B 3SHSA 3QZWA 1AD0A 4KKCD 3RNKA 4X4YB 3KLDA 2Q8BH 1X9QA 3QFJA 2JJUA 3OTTA 1FVEA 3H2WA 2ZUSA 1YUHB 3O3DB 4K3GA 4Y5VB 1Q9OB 4JFFD 4XI5C 3TBYB 4G42A 4KI5E 2IG2L 3BZDA 2EYTA 4PY8I 1RMFL 4H5SB 4QCIA 4RFEB 1I85A 2I07B 5KZCB 3VXMD 3BSZL 4OM0H 5I30H 1PG7L 1QSFD 5IMKB 3QUZC 2XTJE 1U8LB 5HVGB 7CGTA 4K94L 4B5EA 2DOCA 1MEXH 4MJ2A 3WE6B 2NPLX 4YHNB 1GPOL 1FZMB 1YEKH 1MLCA 2APFA 3ZLQC 5L88L 1R3HA 4PR5A 5AZ2L 5J6GA 5T1KB 2VLRB 4L8BB 4TVPL 3P9LB 2BFVL 2XWTB 4M8QB 4OLEA 1N6QH 4GJTB 1OQOA 4PJBE 2N7AA 2Q1EA 5CLWA 4JPKL 4W6YB 3EAKA 5SWSB 3RGVB 3PIQB 4JPWL 3D3VE 1AH1A 1MCNA 3KPMA 2NNAB 1T83A 4NKOA 1FSKC 1EJ6A 3ES6A 3MLYL 2WUCL 4X5WA 3LD8B 1IM9D 3QEGL 5CILL 1W2KT 2X4SB 2V5RA 5JLZB 1EUTA 4U05A 2DJ4A 2NQCA 1L4IA 3AB0C 1DQTA 4OZIA 4HFWA 3S36L 1RZKC 4PY7B 2J88L 3V4VH 5JQ6L 1OAZH 3WSQL 2XTJB 4M9OA 2X70B 4OKVA 3BXNB 3OJ2C 1AC0A 1ZEAL 43CAA 1I8IA 3MRQB 1K4CA 3GJEB 1AP2B 1G7QA 1X5HA 3JSSA 1HHGB 3LS5H 3QG7L 5IBTH 3LEYL 4P2CG 4RFNB 4P59H 4X80L 5DUPH 5GS1A 1GRWA 1I8LA 4KI5D 4JFYB 3DX9B 1JZ8A 1WQVT 3SE3C 3T4AB 5IHBA 5CSZA 1MCSA 2I9LA 4BUGA 1A6PA 1KBGH 4P2OB 3HHRB 5JPMB 1FO0B 2EIDA 2XTJD 4FXGB 1AO7A 5I1GH 1LK2B 2VDRL 1LWRA 3VFVB 1FG2B 3DV6A 4PJXB 5GGVY 1P7QA 5IFAL 3SCMA 4UNUA 1NC4A 4B41A 4XP5H 3IDMA 1IC5H 4Q6IA 3RWEA 4MQSB 4QRPE 2IMMA 2NCMA 2I5YL 4P9HL 4Y1AA 1RZFH 2MHAB 3TO4C 3ZHKA 3GHBH 4IRSA 3LKNB 2FIKB 2FSEB 1DBKH 3GSWB 5E1AB 5F97E 4X8XA 1SVZA 3F7VA 1EBPA 4P2OD 3D3VD 4GAJH 4DAGL 2QHRH 1NDMB 1W0VA 4PRBB 4HT1H 4NC0B 5IROC 4XH2B 1U3JA 4KUZL 3QO0B 4LGSB 4M43H 1Y0LA 1YNKL 3HN3A 4Y19B 3RKDD 4RMVA 5D2NE 3GJFK 2QSCH 2ZCKL 4HBQA 5F9JA 1SJEB 4Z5RA 2CJUL 1I1FB 1HK6A 5FO7B 3VI3F 5DA0B 5KVFL 1E6OH 4R97B 5B8CA 2VDKL 5CJXC 2H1PL 4G9FA 5DO2C 3WXVL 1MHHA 3NIGF 3FONA 4L1HA 5D70H 5BXFA 3X17A 4RCAA 4YX2L 5EU6A 3ROLA 3UDWA 3DMMB 3VGEA 1ED3B 3HI6H 4WWKB 5K9JH 3TNNA 5GGSB 5ENWA 3EO1B 3T1FA 5IEHA 2EIZA 4JO1L 1F6LL 3BKML 2HRLA 4QHKI 1NL0H 1CT8B 4K71B 4Y19D 5HYEA 3ESUF 1ZANH 4LSQH 5I18H 4YH6A 3LY6A 5IB2B 3JUYA 5DJ2B 3RWFA 4KY1H 3HR5B 2IPTL 4M5ZL 2OQJA 3GSVA 3T65B 2Y5TB 1ZVSB 1HOCA 4GO6B 3NN8A 3Q2CA 4HS6A 1RUKL 3HLAB 4OZHE 4OGYL 3O8XD 1ES0A 3SDCC 4L3CA 4Y4HA 1IAIH 4QRPD 5B39A 1N5AB 3RBGA 3OAUL 1JF1A 5FF6B 3IFOB 4HLZH 2NX5A 4LNVA 4NT6A 4WWKD 1WWAX 1KIQB 1L0XA 1SY6H 5K9QG 4NP4H 4JQVA 3TZVC 2D31A 4K7FA 4P2YA 3QG6A 4UT6H 5HSFA 4NFDA 3SJVB 3ABZA 1AXIB 3QXUA 4QXTB 3BJLA 5EUOE 2V7NA 5ESVB 3H9SA 1TQBC 5IQ9B 1INDL 3BQUA 5F9DC 3T04D 1BWMA 4NN6C 1RZ8B 1AI1L 3BPLB 1QBLH 4FOMA 4Z7WA 1QR4A 1LO0H 4Y0GA 3EYSH 4JANA 3DYPA 5HGBA 4P3DB 4G6ML 4PREB 3IRZA 5F72S 4WFHE 5FECB 4KRPB 2R0LL 4PJIA 3WUWB 2GEEA 1V05A 1AQDA 3MGTB 5F7EL 1JTOA 4HMDA 1XIWA 2OM5A 1G0XA 4PD4J 1EO8H 1RZIB 2YKLH 3QPQC 1HILA 2YUZA 4OF5A 2GI7A 1T03L 3KWWA 2G5RA 1YNLH 3H0TB 3U2SA 4U49A 5H94B 2VWEE 3RU8H 3T2NL 1SVCP 3QCTL 3MXVH 4R4FH 1IGCH 4OZGF 3MGOA 1N4XL 1XGQA 3WXWL 3IGAB 3G5YB 4QRQB 5EUOB 3O4LE 5MI0B 5E00A 3RL2B 1L0QA 5M7QA 4F57H 2XRAL 5CGTA 1H0DB 3S96B 1QFUH 2O5YL 5CEYB 2BNRE 1OP3H 4AG4H 3RZCB 4O2EB 3PHQA 1JRHI 1MUJA 3TBWA 3AS3A 3MFFA 1XCQB 2XT1B 5CJ5A 1YDPB 4UOJA 4DOHE 2QQNH 2YD7A 1D5MB 1TMCB 4XPGH 4WI7A 4W68A 2WBJB 1T1XB 4OSUH 5FM5M 3U36A 3CUPA 1QFPA 4YK4B 1QR1B 3L3GB 4PJAB 2HT2C 4PRIA 5FYKL 1LEIB 2JJSC 1FGVL 1BFVH 5BZWA 3VFSA 3ETBF 5I1CH 5JW4Q 2W0LA 1QO3A 3QRGL 2AK1H 3H3PH 3QB7C 5CIPB 3DGGA 3GGWA 4X9GA 5I75C 2DLFH 3L5XL 4XB7A 2DWDA 1J8KA 4GRLB 3TBTB 1TJHH 4LAQL 1C5CL 4Q9CA 1U2CA 4XPBL 1RJYB 3X13A 1T7XA 2NW2A 2EZ0C 5D7SL 5CJBA 3O4LB 4WFHD 4DJMA 3WDIA 3VMOA 3ORJA 3U0TA 3WLWD 2W65B 5DJZA 4R4ND 2BNRB 4NYLA 2R23B 4NM8L 3RI5F 2H2SD 5FUOH 1IKNC 2VOTA 2CUMA 1RK1B 4NN5C 2MSPA 5JOFA 5IB4B 3TVMC 3BKYL 4P9ML 3DLQR 3FTGB 4FQ1L 1GOGA 3OQ3B 2R8SH 1MJUL 3RTQC 5J1AB 4ONGL 4YHMH 1RIHH 5KVGL 4N8CL 4F9LC 1S5IL 5IQ7L 4OM1L 3QNYA 2H9GB 2VQ1A 4KZEH 2KQNA 3FQWB 3O4LD 2G2RB 2VLKB 5SX4H 2CDGB 1OD9A 2AW2A 3MJGX 4M7KL 2ITDA 2BX5A 3T0EE 2BNRD 1R3KA 4U1SB 3N85L 4LU5H 2IFFL 3NCMA 3QUXB 1IC1A 1OSZB 4GKNA 5EIVA 4Y2OA 3MROB 4MYWB 4KWUA 1NKRA 4XMLL 1QRNE 1IGFH 2NMSA 4PB9L 3NVQA 4NQXB 3DSFH 4JFOB 4OUOA 1TVHB 1JPSH 3HC0B 3QIWB 3TIEB 1GOHA 3W11C 1K5NB 5BV7B 4H88L 4G8GA 4ZS7H 4QWWD 3CSYA 2VUOA 5IK3A 2VXUL 2V2XA 4OD2A 5FYLH 1YJDC 1T21B 1G6VK 1A2YB 4A6YH 3EOBB 4FQLL 1AY1H 2Z93B 3UPAA 3G5ZA 3O6KH 5CGYD 5DHVH 3V4UH 1IM3A 4F2MB 1DDHB 3IS1X 4V1DB 1HXMA 2RJMA 1TITA 4MAYC 3LKPB 4GMSH 3QIWD 4WO4D 2XXMB 1P4IH 1Q38A 4NC2B 3T0EB 5D5ME 1MCIA 4NGHH 4BK4A 1REIA 3C2SA 4ZFOB 3FB8B 3O9WA 1QRNB 4U3CA 4J1UB 3O2DH 1JV5B 1ZVHA 1RZKL 4HKXA 1XGRA 3EW3B 2X4TB 3WDJA 3NCYS 1A14H 3FAXA 5KN5A 1U6AL 1BVKA 2EDHA 1DSFH 1BFSA 4XP9L 5KANI 3CVIL 4V1DD 3G5VA 2VKWA 1J0JA 3T4YA 1G9MC 3SDDC 4JO3H 5KSAD 1JZ2A 3DWTA 1MCWM 3X3GH 4HFUL 3P0YH 5D7JD 5DJCB 3T0ED 1BGXL 2DD8L 4S1RL 4ODWB 3ECBB 3IYLW 2NY2C 3VGAC 3N1QC 1MFEH 3ZT7A 1N7MH 4K3DH 3IAQA 2X1QA 4R7NA 1QRND 5A2KH 3OXRA 3VWKA 5GRJH 3C8KB 4Y4KB 5D5MB 5EOCH 4HUUA 3AAZB 4WTZA 2BHYA 3WLBB 3S4SG 1I8MA 1IEAA 2GT9A 4JO4H 1A6TA 4X98B 1L9MA 4MS8D 4Z7UF 5I9QC 3FQNB 1PYWB 3T3MF 4NKQB 5E2VL 2X40A 5I8CB 3B5GA 4PJGE 2R9HC 3ZDXE 1XR9A 2XKSA 1CWVA 3TH3T 1W8NA 4PGEA 5ACZA 5KSVB 1A0QH 4LLAA 1Z3GL 2CKNA 5GHWL 1HINL 3HE7C 1HQRB 4LPYA 4CUCA 1XZ0A 3K0WA 3OGCA 2R56L 2EIBA 3DPBA 2FGWH 4HWBA 3P9MA 1B3JA 4KMQA 1S3KH 3VXQA 2WLZA 1MRCH 5DMYA 2X2YA 4NM4L 2BVYA 2VE6B 5FM8A 5CMAB 2Q76B 5TE4H 5F7DA 4AEFA 3QUMB 3IETB 1OP5H 4KK9D 2O61A 5IKCB 5EZOL 4LKCB 2Y6SD 1JPGB 1U3HC 4NCC2 4NUJA 3ZDYF 2YPLA 4YHOH 1FP5A 5MHSE 4OGZA 1NCWH 2NY3C 2DKSA 4WUUA 4OQTL 4YC2C 4KDWA 3V52L 3M07A 2IEPA 3L7FA 3I02B 1FORL 3QDGB 4P5MA 5DGRA 5ALBL 2WNGA 1P1ZA 4GW1A 4X6DF 2J8HA 2WZPD 5I8OL 2W07A 3WHE1 5C0DA 3BHBB 4GQ9H 3MMEA 1C8PA 1T66C 5LGKA 5HHPA 1B0RB 4PG9A 5IHLB 2GAZB 4GW4A 5DS8B 1FZKB 5TFSL 3WFEH 4EVNA 2VYRE 3GSUA 1DQJA 2X7LA 4C56A 3VFPB 3WIFB 3B2VL 1RVFL 3GMLA 1MCLA 2HTKC 4JREB 4K3JL 4RGMC 3MRJA 3FCTB 4F7MB 5D93B 1CICC 4CAGA 2FL5B 3KXFE 2UY7A 3B43A 4B7LA 2P24B 4RIRA 5C8JB 1UXSA 1Q1JH 4XRCA 5DA4A 1A1NA 4GBXA 4OKDA 1AGBA 2FO1A 2VDOH 4X8JA 1MJJA 5L7XH 4LEXL 1VCAA 4XVSH 5EBLB 3K7UA 4PJ5A 1VA9A 4LHJB 1BEYL 4J3UA 2OTWB 3CH8A 3MODH 4UDUB 2EE3A 1IBGH 4CVXB 3FO9B 4KK8C 5SWQB 1T1WB 1H5BC 1DBJL 4YHZH 5DI8B 1HH6A 3BH9A 4MXVE 5DYOB 1S9XA 2ITCA 4YXHH 4NNYA 3WKNA 1HWHB 2D03H 4NO3B 2XN9E 5I71C 3I2CH 2MCPL 1A6WL 3BEWB 4WTWA 4U7KA 3L3IB 3PHOA 4YHLH 1FNLA 3GFUA 4U0RC 1JVKA 4WU7A 1PSKL 3G08B 4D0BA 5IGXL 1G7IB 3BYYA 3U0PB 3G6JF 3V6FB 1MWAL 5ICXA 1AGFA 1Q0XL 1KJ2A 1JYVA 3KXFB 2HJFA 3HAEH 1XAUA 4B50A 4PLKC 1MSPA 2CR6A 5SV3A 3KYMB 5K59E 4XPAL 4MSWB 5FOBA 1Y6KR 2GSGA 2ZCHL 4ZAKC 4EIZC 4MA8H 1P6AB 3OR6B 5EUKA 5A16B 4X5XB 4E42A 3IFLH 8CGTA 1DZBA 2ICES 4WI8A 3LRHA 3C09C 4HGKC 5B38A 2JB6A 2XN9B 1ZGLA 4IOFC 4DFHA 2F5BH 3KXFD 4HIIA 2AP2A 5CJQH 4F3FA 2WWKO 3BH8B 2VDPL 2OL3A 1BD2B 1WAAE 1GOFA 4M6MH 4J3XA 3TN0B 3V5HB 3CVHH 4O51A 2XXCB 5GSVB 1Q94A 5H8DA 4NDMA 1A9EB 3SBWA 1A7OL 2YD2A 4KK6D 4U1IA 2PETA 2XZQH 2E8ZA 5IHZA 1NMCB 5FIEA 4FQPA 4YAQB 3CIQA 5HYJE 3FJTA 5KS9E 2WAHA 3GRWA 1RUPH 3STLB 2WM0A 2XWJA 2BDNH 2EDRA 2HH0L 4KZDL 1I3GL 5E8OB 3OR7B 1LE5B 4MNHA 2XN9D 5M95B 5FUCE 4LVHC 4GRMB 4XNMA 4FXKB 5T1MA 5IV2A 2R0WH 3EOYG 3VW3H 1U8OB 3TN0D 5BS0E 1MJ7L 3VFNA 1GGBL 3V0WL 4KQ4L 5ADOL 1ZLUH 1MNUL 3B5TA 4AQ1B 1HIML 1IAII 2FLRT 3LRSA 3X11A 4LSVL 2HG5A 5C0ND 1U8MB 1S7UA 4OD1L 3PWJA 3R1GH 4JVPA 3BO8B 5KSUB 5DTFB 2OR7A 3UPRA 3FO0H 3RWJB 3GKZA 3GSRA 5SX5K 4DGIH 2YD9A 3RI5K 1GGIH 1KPUB 5L2JB 1SEBA 5I1AA 1I9JH 4LSRL 4HZLA 3NCCB 2FATL 4HIHA 2QL1A 5HYJB 3ULVC 5KS9B 5MENB 2DWEB 4PJFA 4F80A 2D4DA 4RMSA 1RIUH 1TZIA 4R2GC 4X6CA 3FQXB 3MRIB 2R0ZH 5B4MC 5BW7A 4JFFA 4XMPH 2FB4H 3PWUA 1UZ6E 3WUWG 4Z0BL 2BVOA 4D9LL 1ROWA 5DVMA 3RVXC 3RVTD 3DVGB 2GY5A 1EJOH 5F70A 1UB5B 4QHUA 2R1WB 5E5MA 2QV2A 5BS0B 1Q9KA 1M71A 1ZHNB 3ARFA 1KG0B 1ZS8B 2C3XA 5FCUL 1GZQB 3PGDB 5F3BB 3B9KA 1KCUL 1INEH 2PXYC 1BMGA 1CGYA 2LU4A 2A83A 5GRVL 1BIHA 3RVVD 4OBSA 5GGQL 4X4YA 5HYJD 4OLWH 2QLVB 5MEND 2J5LB 2YUWA 1R0AL 5D6DC 1YJDL 3O3DA 4Y5VA 4JZJB 4ELKB 1Q9OA 3BP4B 2R69H 3HPLB 5MP6H 3TBYA 4JDZB 2CQVA 3QHZH 2OR9H 5E4IA 2X9WA 3OAZH 4Z7NE 3MACL 4RFEA 1R5VB 5BS0D 1AJ7L 2G60H 2I07A 2Z31B 3GMPB 3EOTL 3WL9B 5IMKA 3ZKSD 1U8LA 2BVEA 1UC6A 3I75B 2IAMC 5DQJB 4XVTH 3MLXH 3EDJA 3KVQA 1IGTA 3WE6A 4IRZH 5HVHB 4YHNA 3MUGB 1AGCB 1AHWB 1FZMA 3H3BC 3DARA 1M4KA 3F12B 4NZUH 4UT9H 1D6VH 1F97A 2ZUWA 5T1KA 2VLRA 4M6NH 2L7JA 4NO0B 1CVRA 2COQA 4L8BA 4PS4H 3FT4B 3S7GA 4M8QA 2XWTA 4MCZB 3RL1B 2NY6C 4TUOB 1IC7H 3LPGA 3QPXH 2HRPL 3CXHJ 5SWSA 4P48A 2OZ4H 3C08L 4TSCL 3RGVA 2Z31D 2Q8AH 3PIQA 2VDQH 1G9ML 2NNAA 3HNTH 3ZT5A 2D7PA 5DK0B 2YPVL 5FYJL 1T4KB 2X4SA 5JLZA 3HTLX 3VGGA 3IDYC 5GRVK 4PY7A 1UEYA 4H26B 4OCXH 4NO0D 5CINL 3G04A 4DTGL 5J13C 1FRGL 3VFWB 4A2LA 3BXNA 5EO0B 3MJ7B 4NZJA 3MRQA 4CU7A 4LVEA 5I8KH 3GJEA 5AAWA 5C71A 1UWGH 3B8YA 3P4NB 1AP2A 4ZPTB 2DM7A 1NLDL 1HHGA 1OF2B 3DYOA 1Z9OA 2OI9C 1MFDL 4I8DA 5TF1L 4D0CB 5C6WH 1I9EA 2OXGA 1VFAB 1LHZA 2E8YA 4JFYA 3DX9A 4PJ8B 4ZDHB 4W6WB 4D0DB 1JJUA 3T4AA 3ZDZF 4P2OA 5TDOB 5JPMA 1FO0A 4ZOBA 4QKXB 4FXGA 4TTGA 3IU4H 1LK2A 4L8SC 3MV9E 4NNXB 4AMKL 3LH2H 3ILQD 2IALB 3AY4A 3VFVA 4PJXA 3MRHA 3KPNB 1BQUA 2VDLH 4PJ9C 3UJIH 4DUWA 1E4WH 1WEJH 2MHAA 4MXWL 3VGFA 4PJ8D 5C6PB 1D5BA 5F89B 5IIEB 3K2UL 2FIKA 3LKNA 2FSEA 3N50A 3GSWA 3MCLL 4X5LA 5CFHA 5E1AA 4ENED 3EDDA 2EYRB 5IOPB 4HEME 1DEDA 4LSTH 4PJHF 4DKEH 3CX5K 4O58H 3GSQB 4KMLB 1NDMA 4PRBA 1KB9J 4Q9QH 4XH2A 1WFOA 3HB3C 4ELMA 4ODHL 2IQAB 4HLJA 3QO0A 3MX0A 4RAVB 2VKXA 4N1CA 4PRHA 4Y19A 4M7JL 1MCBA 3KS0J 1QKZL 1SJEA 5HDQL 3RDTD 5FO7A 4BKLB 1OAXL 1WICA 1JGLH 1KYOK 3QBTB 2N1KA 4POZD 1CD8A 1A7RH 1UJ3C 5FEBA 4V2CB 2M1KA 4UV4L 1AFVH 3DMMA 4OLXL 1ED3A 4WWKA 1H3TA 5GGSA 4HS3B 3EO1A 5MERB 4Z7UB 4FQXC 4LL9A 5D96B 3MBXH 3QDJE 4D2NA 3TWCL 5L8JB 1CT8A 5C0FB 3DGCR 4N5ED 3KNBB 2NY0C 5GGRB 3DBXB 1JPST 5IB2A 1R24B 3HR5A 1ZE3C 1F8TL 3MV9D 3O6FC 4TSAH 3S35L 2OMNA 4M02A 3SPVB 3T65A 4WY7H 4XPFH 2Y5TA 1ZVSA 2DYPB 3A67H 2PO6C 2MNUA 5AUMB 3ARDC 3HLAA 1C08B 5C09E 4JG1H 4RDQF 4GQPH 1N5AA 1JGEB 5FF6A 3HNSH 3IFOA 3TH4T 1LGVA 1F3DJ 3FB7B 1R5IB 2PR4H 2J8UE 4P4KB 1KIQA 3MCKB 3GMNB 4OGXH 4UBDC 2DJUA 1BJ1H 5GIRB 2JCCE 1P4BL 1LVEA 5J0BA 3SJVA 1DEEB 2DQCH 4NO2B 3FN0H 4FNLH 1FPTH 4OCMC 4QXTA 5ESVA 1A3RH 1KTLB 5JPNB 3MRRB 3F7YB 5T33L 1T7YA 1JF5A 5IM7A 1RZ8A 2DYPD 1IL1A 3HA0A 5ACLA 5IFHL 4PG2A 1TETH 1MRDH 4DQOH 5LCVH 3GJFA 1BQHG 3U30C 1F3JB 2XNAB 2PN5A 4P3DA 4PREA 4Z7QF 1L7IH 4IRJB 4KTDL 3WUWA 2ZUXA 2CKBH 1T5XB 4L8DB 4M8VA 3V6BR 4TOYL 1RZIA 2AGJL 4OIBA 4XAWL 4RFOH 1X5LA 4JVUA 1YPZF 3H0TA 2F8VA 3IFPB 4EI5C 2JCCB 3QDJD 4LHUD 4CVWA 4EDWH 5HHMB 4KPHL 4U3HA 3IGAA 3G5YA 1CLZH 2VXSL 4QRQA 4AH2B 4MQ7B 4LPVA 4P23B 5EUOA 1U3ZA 4K55A 3RL2A 4IRJD 4OLVL 2GK0B 1H0DA 3S96A 4G7YL 4RISL 5CEYA 1ETZB 2DDQL 3RZCA 4O2EA 5LWYL 5F7WC 5C09D 1N5YL 4P57B 1ZLVH 4M5YL 1QPPA 4DKFH 1XCQA 4XWGH 3TF7C 3ESVF 4PRNB 1YDPA 4D9RE 4Y16B 3NGBB 3I50L 1D5MA 1K9TA 3QWOA 5ALCH 4EI6A 5EBMB 4EN3B 2WBJA 3VRLF 2DQTH 1I1CA 3EJZD 1XF4B 1QR1A 1OAQH 4PJAA 1LEIA 4X7DC 4PUBL 2VAAB 2XZAL 1IGML 1JWSB 1WJ3A 3N0PB 5CIPA 4MMXC 4GG6F 1MOEA 4XBPA 5L8LB 5T5NG 1FG9C 5E6IB 4ZUSA 4GRLA 3TBTA 4I3SL 1DQQA 4FN0A 3GUTB 1WCBB 1XGTB 4JJ5A 3BT2L 1ZLWH 1MCKA 4LCYA 3ULVL 4Y16D 1DQDH 4KJPD 4AEIL 1D5ZB 1AR2A 2VITB 2W65A 4EN3D 2BNRA 2HKFL 4KTEL 1G7LB 4X7SH 5C0AE 2R23A 2EXWC 4ODBD 5EBWB 2YN5A 1SM3L 3MV01 3UYOD 1GXEA 4ALAL 3UMTA 5CD5C 1BZ9B 2BZDA 4RMTA 1RK1A 2QADB 5IB4A 4M7ZC 3QJHA 3F58L 5C2BL 1GGCL 1QSEE 3FTGA 4KROC 5E6ID 2DQIL 4PRAB 5J1AA 5DJAB 3O3EB 2EDKA 3P0GB 5K9KB 3VXSA 1MREH 2P8MB 5H37G 3G9VA 2H9GA 2R15A 3MZGB 3WFCH 3FQWA 1MAKA 2G2RA 2VLKA 3O6MH 2Z8RA 2CDGA 2HMID 1VPOH 1WGOA 4U1SA 1B2WH 3QUXA 2RB8A 3QUKB 1R3LB 2X89A 1CK0L 1OSZA 4KJQD 2HLFC 4MD0B 2X42A 3MROA 5D9SB 1OT1A 2QADD 4NWTH 5KSBE 4D9RD 4N9GB 4NQXA 3D2UD 4JFOA 1LP9E 1TVHA 3HC0A 3EZJB 3QIWA 3KPLB 3TIEA 3HE6D 5K93A 4Y2DC 3OXSB 5ANME 3JWOC 1K5NA 5J12B 4CMHC 1X7QB 1IKFH 5C0AB 2C3HA 2DRUA 1AR1D 2E6JA 2Z35A 1A47A 1A2YA 5E4EB 1KCVL 5DZNA 1XF2B 4ZPVB 1ZT4B 3GMOB 3C6LA 3EOBA 3DRQB 1QSEB 2Z93A 1MEXL 3LSOB 4TVPE 5I1JL 5ISZE 1O7VA 1YEKL 4F2MA 1DDHA 1NGPH 4N90D 4UIKH 2PYEE 2NZ9C 4V1DA 5I19H 4M48L 3LKPA 1JNNH 1UCBL 2A77H 5B22A 4BH8B 3Q6FB 4LVNC 5I0DA 1K4DB 1WZ1H 2ID5A 4PJ7E 5C0AD 3SO3C 1RUAH 4UQ3A 3FB8A 4MJIB 1JZ3A 2WQ8A 1FCCA 1VADB 2I25N 5T3ZH 1FAIH 3AM8A 4J1UA 1JV5A 1QSED 3NH7L 2EH7H 2X4TA 4LCCB 4EZMA 4QY8B 4N1EA 5FKAB 3V4VL 3OSKA 4JM2C 3MUJA 4HPOH 3QXWA 3RVWD 4JRYB 3J8F7 3ZKXC 4Z0XB 5DJCA 5JOPE 1DVFD 2G5BB 1MIMH 1VDGA 2W91A 5F1KC 3GNML 2B20A 3MR9B 4MA1C 3LS5L 5GGRY 2EKSB 2VZTA 2P47B 1N0XH 4P59L 1KV3A 1CI5A 4Z8FH 4PRPE 2OLDA 2Y06H 4QGTA 5EC2B 3DYMA 3C8KA 1S78C 4Y4KA 1J87A 5D5MA 3AAZA 4BA8A 3WLBA 3PWPB 1RPQA 5F7KC 3LKOB 1JZ5A 4X98A 5DR5H 1RK0B 4FQIH 5I1GL 3FQNA 1UT9A 5I8CA 1T6WA 4B7IA 1HNGA 2APWA 3UO1H 3RWCB 5KSVA 2I27N 1IC5L 3GSXB 2DL9A 3ARGB 1DJSA 2C9AA 1U91B 2X4RB 1HQRA 2PYED 1C5BH 1TENA 1SMOA 4O2FB 5JA9A 2XV6B 2YD4A 1DBKL 1F11B 1V7NH 3DXAB 5JXAL 5JDJA 3PWPD 4Y4FB 1SYSB 1W0YT 2VE6A 4G80B 3QQ9C 4OFKA 1HYSC 4EDXB 4JM2F 5CMAA 1N59B 2Q76A 4WUKH 4K9EH 3CLEH 2QHRL 3OKOB 4MA7H 4PRPB 3QUMA 3IETA 3ILPB 3GMMB 4HT1L 4WI2A 5IKCA 2VLLB 4LKCA 1FL6B 2IBBA 2V6HA 2BOCB 1JPGA 4M43L 2ESVE 3ARGD 2CMRH 1YZZA 3QQNA 2QSCL 3OB8A 2Q7YB 3ZYIA 5FA4A 3ZKNC 3MA9L 3RWGB 1I85C 3Q1SL 4YHPA 5JOPD 3D5OF 2AJXH 2GFBB 3I02A 4KDVA 3QDGA 3TJEL 4Y4FD 3VU2A 2V2WB 3BUTA 2LTQB 4CRPA 5D70L 1DN0B 5A2FA 3IJHA 2D0HA 4HCRH 5J06A 2ED9A 4PRPD 2RQ8A 2XACC 5K9JL 1B0RA 1FC2D 3SE9L 5F21B 5DS8A 5C7XH 1FZKA 1FHGA 4XP4L 3X3FH 3VFPA 3QH3A 3WIFA 2X1OA 3I3DA 1B0WA 4J2XA 1EXUB 3MRKB 4MJ4A 3ZE2E 3RVUD 3FCTA 5DC0A 2FL5A 1M05B 1VFMA 2P24A 3MV8A 3AUVA 5C8JA 3EIFA 4LSSH 5IJKA 5BO1H 3N1PC 1H3PH 1L7TH 4XP1H 4FFWC 3S88H 4RA3A 4H8WH 2BY2A 3SDYL 3SKOB 3C5SB 3W39B 1C1EL 5F1SA 5EBLA 2WWMD 2AKRB 2EDOA 4WWID 2OTWA 4UDUA 4CVXA 4KKBD 3FO9A 5SWQA 1F4YH 1T1WA 1EO5A 4UT6L 1AXSB 5DI8A 2ZUQB 4M6OH 1EVTC 4GG8B 5DYOA 5D7IE 4PJEF 1A1OB 4NO3A 4IDJH 2B4CC 2NY5H 4OV6F 1CFQB 1ZHLB 3BEWA 4WRLA 5FHAH 3L3IA 5GS1C 1I8LC 2P7TB 4JCLA 2FX7H 1KCSL 2ESVD 5D1XD 4K2UL 1LO0L 3G08A 1G7IA 3B2UD 4KI1A 3U0PA 3V6FA 4G3YL 1JFQL 3DVFA 5HI4C 1F3RB 1MFCH 3NPSC 3QULB 5FB8B 3SE3A 3SDXE 1ORSB 1JGVL 3D6GA 3EYUL 1BVLB 1ONQA 3EHBD 1BJMA 4FQHB 4NC1E 5BVPH 5IT2L 3V6OE 3QRFM 1JE6A 2P8LB 2YKLL 3KYMA 1XT5A 3IDJB 3MREB 4MSWA 4Q6IC 1IMHC 4DGYL 4G9DB 3OR6A 35C8H 1XF3A 5A16A 4EKXA 3MXVL 2Q20A 2ICWI 3D1MC 4IRSC 4X5XA 4WI5A 3FMGH 4XHJC 4J8RA 3DROB 4OZIF 3PDOB 5T5FH 4F57L 4NSKB 1QFUL 3BH8A 1BOGB 1BD2A 3TN0A 4HIXH 1TIUA 5GRZA 2OXHA 2GJJA 3HZVB 3MBEB 3V5HA 4AG4L 5GSVA 2Y7QB 1A9EA 2BK8A 1UYWL 3CK0H 5DJXB 5FYKE 3TPUB 3CNKA 3RAJL 15C8H 4XZUB 5GISH 4YAQA 4LIQE 4ZQKB 3MRDA 2DTML 3C60B 4P2RE 3STLA 4TSBL 1ERNA 4PJDB 5AD0B 4PP1D 5E8OA 1BFVL 3OR7A 1LE5A 5B8CC 2AK1L 3H3PL 1DBML 1UM6H 3ALWA 4X7EC 2IFGA 4GRMA 4FXKA 3UDWC 2W92A 5GS0C 1U8OA 5E08H 3MBED 1M7IB 1QFWH 2J4WH 3U7WH 1TJHL 4KDTA 4S1QL 2AXJA 1X5FA 1G6RH 3ZYOA 1I1AD 5DXWA 5F9OH 1YEGH 4IMKA 3BN3B 1EZVY 4LAJH 1U8MA 1IILE 2AS5M 1ZTXH 3C60D 4LSUH 2LVCA 3BO8A 5J11C 1I7RB 1RZJH 2ED8A 5KSUA 3RWJA 1NCUA 5GZOD 2XZCL 3PJSB 1KPUA 4QRTB 1NCBH 1HEZA 3BN9C 2NY4D 4Y4HC 4N0UE 5HYJA 1BWWA 4LHUG 5KS9A 5MENA 2DWEA 2C4XA 4MX7B 2HT4C 2R39A 4P2RB 5K9QI 3FQXA 1RIHL 2CK2A 4WJ5A 4F37F 1Q72H 4OZGA 4JQVC 4ESKA 1WIUA 1MIEL 4GOSA 1UVQA 3KAAA 2H45A 4RGOH 1KOAA 3DVGA 1OP3K 2B5IC 3O3BB 4I2XE 5HDOA 2FBJH 1C5DB 1UB5A 2R1WA 5D2LE 5BS0A 1ZHNA 5F3BA 1KG0A 3QR2A 1GZQA 3PGDA 1UM4L 2DLHA 3REWB 3BQUC 4MNGE 3VXPB 5MEOB 3BD4A 4EBQH 3JWOL 1QLRB 1IGFL 2MQ0A 3DSFL 5B21A 1JPSL 4NUGL 4P2RD 2FEDC 5J1TC 4JZJA 1WTGT 3BP4A 3HPLA 1NQBA 4G43B 4JDZA 2ZPKL 5C08B 3PWVA 2ILLA 1EHLL 4A6YL 3LDBC 1R5VA 4MD4B 2B1HH 2NYYC 5JO5B 2Z31A 5DMGC 3WL9A 5EWIH 2KZ1B 3I75A 2YD8A 5DQJA 5FO9B 4JRXE 3C5ZB 5CP3A 4PD4K 1JMXA 4MQXD 5IVXE 4GMSL 5FAAA 1NAMH 4HWNA 3IFNL 3W9EB 1AGCA 3MUGA 1AHWA 4I2XB 3OHXB 1MCFA 3F12A 2A9NH 1UKTA 3HS0B 5DJ8B 1WIPA 3DUHA 2M8XA 4OF0A 3F6IA 3IB4A 4NO0A 3QFDB 3FT4A 2HN7B 4J23A 1M1SA 5HGGS 3RL1A 4R96B 1KN4H 3HUJE 4UINL 3O2DL 4TUOA 5LQBL 3T0BA 2F54E 4GAFB 1CXLA 3GSNB 3WS6A 4WW1B 1MF2H 2VDML 4LGRB 4DVRH 5FDWB 1E4XI 1FNAA 3W5NA 4XI5D 3FN9A 5DK0A 5IFJB 4U6XB 4RGNC 2VLME 1G7MB 3C5ZD 1R3JB 3HCVB 1T4KA 4Z7WF 2B1AL 2R2CA 3X3GL 5E9DE 3MJ9H 3BPOB 4H26A 2Z8WC 4M1DH 5I73B 5LBSL 2VO5A 5TE7H 1MFEL 2IANA 3O0RH 2CRIA 4BSVA 3VFWA 4YWGH 4JRXB 5EO0A 3MJ7A 4H0GA 4QNPF 4U1NB 3PP3H 3D85B 1DLHA 3GZKA 4HQQH 2IPKB 5I15H 3P4NA 1NGYB 4ZPTA 1FVDB 5EOCL 2QKIA 3BGFC 1OF2A 3RPIB 4D0CA 4IJ3C 2QR0B 3PHSA 2WINB 1VFAA 5INCB 3ARYA 1F2QA 4PJ8A 4ZDHA 1ZLSH 4D0DA 1T0MB 1FBIL 3LN5B 1ADQL 4L9LB 5ETUB 2F54B 1AXTL 3UZQA 1UM5L 2OMBA 3AGVA 1VGKB 4CGTA 3QT2A 1J86A 1I3UA 4NNXA 4AIZB 4JRXD 4HS8L 1KNOB 2IALA 1J1XH 5I74B 4Z7VF 4OCSH 3L3DB 1L6ZA 3KPNA 4DUXA 4ONFH 4BZ2L 5TH2B 2R4SH 2NZIA 2A1WH 5E9DB 3RIAF 3KR3L 4CVZB 4EOWH 4UNVA 1J1PL 1ZT1B 4JPIA 1MCDA 4ODTH 2YXMA 5I1HH 5F89A 5TE4L 1IT9L 5IIEA 1MCJA 1ZHKB 2F54D 2EYRA 3D39B 1VKXB 2JELH 5IOPA 5E2JA 1PZ5B 5BV7H 3M17B 3FFDB 5E94B 3NIDF 5DD5H 5BOPA 3GSQA 1A7PH 2JIXB 1NCWL 2VLMD 2NR6C 4S1DD 3VDBA 1G7PB 4BYHA 3U9PL 2IQAA 1GSMA 5E9DD 4RAVA 3WKML 1KIPB 1PBYA 1U0QA 4U1HB 5KJRL 3MTRA 1S8DB 1UADC 3LCYA 3ZE1E 4TUJB 2JTDA 4RMRA 1FLRL 4BKLA 1T89A 3LQZB 5T3XL 3VH8A 1CIDA 5E5RB 1QUNA 1N26A 4LCWB 1WIOA 1D6EB 5A1AA 5EH1A 2O5XL 2UZIH 4AYFA 4OCRH 4A6YB 4YXLL 2B2XH 4ODUB 2ORBH 1EHXA 1JNJA 3WFHB 1UCTA 4JR9H 4HS3A 5MERA 4Z7UA 5DHVB 3K8MA 2HYMA 3L5IA 3O9WC 2VZ1A 2BY0A 5C0FA 3MNWB 1HZHH 3KNBA 4XC3L 5GGRA 3DBXA 1UFUA 2VDOL 1R24A 1DFBH 5DWUL 4XVSL 1G9NH 5F96H 2BNQE 1U8JB 4HGWB 2FD6H 3SPVA 1D9KB 5AUMA 3MOAH 1EEYB 3CFJB 3UTTE 3LRGA 4AM0B 1C08A 1RJZB 2FEEL 5I2IA 5M94B 5FYLD 3GKWH 2YN3A 1JGEA 5I6XB 2B4CL 4QLRA 4UT7H 3FB7A 1R5IA 4P4KA 2KKQA 3MCKA 2EDJA 5CZKA 1VENA 2D03L 3GMNA 4K3HA 5KANG 5GIRA 3H7BB 2DQFB 4F58H 3I2CL 43C9B 3E2HB 2FBOJ 1DEEA 1O0VA 4NO2A 5HPOA 3VWKC 4FZEH 5BMFL 5EZIL 1FFNB 5JPNA 1KTLA 4H25B 1VGEH 3MRRA 3F7YA 1U3YA 1W72H 1D9KD 5JW3H 2F58H 5EU7E 2YD1A 3SDAB 2FHFA 1KEML 3A6OA 4HJJH 4HKZB 2XFXB 1F3JA 2XNAA 4X6DA 5ITFB 1YEFH 4IRJA 4U7SA 2HKHH 1PEZA 3BYTA 3V6ZB 2PF6A 1RQ5A 4U1KB 1T5XA 4L8DA 5FM5O 3S6CA 1CDUA 4JGJA 4PJCE 1MI5B 3IFPA 3GO1L 4CW1B 5SWZB 2JCCA 2XY1A 2VXTH 4NKDA 4M6ML 2YRZA 3VG9C 3CVHL 4AH2A 2BOBB 4MQ7A 1DBBH 2AJZB 4P23A 5GGTA 2D2OA 5C0EB 2BNQD 2VN7A 2GK0A 4ZUTB 2EDEA 3M45A 5C92A 4I0KA 1F58L 1ETZA 3UTTD 4PGZA 1RI8A 4LDLB 4FP8L 1RUPL 4YHYC 4I13B 4P57A 1CLOH 3I6GA 2BDNL 2O5ZH 4PRNA 4Y16A 5DQ9B 5GS0L 1MI5D 3M8OL 2V2TA 3DURB 5SWZD 4K23L 3CFBB 5EBMA 4EN3A 4XC1H 3IU3B 1XF4A 3SY0B 2R0WL 2R29H 2AQ3A 2VN4A 3G9AB 2VAAA 5DRZB 4UZGA 4FXLA 1I7TA 1JWSA 2RCSH 5EOQH 1NDGB 3WHE0 5HI3D 3CFEB 3B5HA 4JAMB 3G6JA 2ZUTA 4WI3A 2BXZA 4GS7B 5TPWL 5DRNB 2FJFB 4BFIB 3GHEH 4XXDA 4JKKA 1I7UB 3R1GL 1WCBA 1XGTA 3JWNC 3BJ91 2V17L 1D3CA 5DD0H 4KFZC 4FQJH 3BDXA 2P4AB 2APBA 4JPVL 4GBXC 4PGBB 1NLBL 1UZ8B 3L5JA 2XZZA 1D5ZA 2VITA 3UYRH 1F5WA 1QBAA 1G7LA 2YC1B 5CGMA 2WWKT 1A7BA 5EBWA 3EO9H 4JN1H 3GIVB 5JOEA 1BZ9A 1ZA3B 4DN4L 3HMWL 4F37K 5FFLA 5L9DH 1QHPA 4XMPL 3O41B 2D9CA 4PTTB 1KLFA 4P0DA 4PRAA 5DJAA 3O3EA 1A21A 4LPUA 5IVZB 5K9KA 1J5OL 2P8MA 2UWEE 3BKCH 3OJDB 4DCQB 1LO2H 5H2BB 2HVJB 3VFRB 4UAOB 2NXZC 3CXDL 4P3CH 4XPTH 4YPGB 4P5KB 1FYTB 3QUKA 1R3LA 1UG9A 4UUJB 2A74B 4MHHI 4MD0A 2LABA 3EYFB 3U7YH 1QTYT 2W9EL 3OKNB 3QDME 2VAJA 5H37H 1QVOB 2FO4A 4N9GA 3OZ9L 1XGYL 3INUH 3QHZL 3KPLA 2I26N 2OR9L 4E9LA 4I3RH 3OXSA 4FTVA 1X7QA 5C0AA 4YE4H 2G60L 2DMCA 4JKMA 3P11H 1G0YR 3WNMA 1NFDE 3TVMD 1ZT4A 3GMOA 4XVTL 3HAEB 1P53A 3DRQA 4NJAH 4APQC 3LSOA 3WUZA 4IRZL 1HKLL 4J7RA 3QUYB 4M62H 4HAFA 4NQVB 4M6NL 4MB4A 4EQ3A 1U42A 4NQCB 4XCCH 4BH8A 3F62A 5L6YH 3Q6FA 1NEUA 3SBWC 1K4DA 5FYJE 3JZ7A 1NAKH 4HJ0C 4R8WL 4WGVB 1JCKA 2JF1A 1U41A 2OZ4L 4LCUB 1CTNA 1QFWI 4K8RH 3CFDB 2NTFB 2JJTA 4MJIA 2E27H 3V0AC 3BDYH 3HNTL 2P5EB 1VADA 3C8DA 4UU9B 4W81A 4WCYH 1SYVB 4U6VH 4LCCA 2AI0L 2R2EB 2WUBH 3QUYD 4QY8A 2X1WL 1E4JA 5T1DL 2EE6A 3LMJH 2D7TH 5FKAA 2X10A 3PG2A 4OV5B 2DS4A 4JRYA 4Z76B 1Y18B 4Z0XA 3W0WE 3VD9A 4CMMA 2G5BA 4E41E 1UWGL 1IZKA 1FFRA 3MR9A 4BM7A 4GAGH 1TFHA 2EKSA 3OAZK 4XNXH 3QDMD 1XEDA 4TQEL 1YECL 4NHUB 2F8XC 5CD3B 5EC2A 3G5XB 3KGRA 3PWPA 5KW9L 1OTSD 1SEQL 3F65A 5IMMB 2DQJL 4ZUVB 1RK0A 3TYFB 4PY8J 4NNPH 2H3NB 3ARZA 2V9TA 3C87A 5FV1L 5BW7C 5HYQB 2F53E 3RWCA 2VDLL 3FO1B 1F90H 1FQ9C 3GSXA 3ARGA 1I9IL 1Z0MA 2X4RA 5EC1B 2AXHA 3KYKL 1KIRB 5AYUH 5C9JB 3ARFC 4I4WB 2PCPB 1U8NB 3QWRA 4O2FA 5EA0L 1VEMA 3B9KC 4BQ8A 1UH4A 1NBQA 2A38A 5ABDE 1KN2H 1F11A 3NPZB 3DXAA 3MRBB 5F3HA 4JVWA 2NY2D 1SYSA 2VNCA 5CEZL 3LHPL 4G80A 5EORH 3A6BL 3UZEA 4EDXA 4TPRH 1N59A 2DQDH 1PY9A 2BVTA 2M2DA 4G5ZL 3OKOA 4PRPA 4Y5VC 3ILPA 1S5HB 3GMMA 1PGRB 4U1JB 4Q9QL 2VLLA 3MXWH 1FL6A 2BOCA 1A7NH 2P5WE 1NGZB 4NPYB 2Q7YA 3K1KC 1T2XA 3RWGA 5E95B 4Q0XH 5GJTH 4OF6A 1KB5H 3F7PC 1BBJB 4MWFB 5C0GB 2DQGH 3W0WD 2R9HD 2GFBA 4TNWF 1F3DH 2YA1A 4E41D 4KVCH 1NCCH 2V2WA 5I66B 4MNQB 5B3JE 1J8HE 5TQ2H 1DN0A 4OZFB 1OW0A 1MRFL 3AU1B 3B3IA 1NCAH 4LLYA 4X6CF 4EEEA 4OCWH 4NWUH 4KGJA 3RX5A 3MBXL 1H8OA 4HJGB 3T0XA 1J18A 4D9QE 5HVWA 3MRPB 1LK3L 1I7ZB 4G6JH 3S3SA 3MRKA 4OLZH 1CFVL 4M1GH 5I16B 2HFEB 3L5HA 1KXTB 3WO3B 3RGVC 1F4WH 4TSAL 5A3ID 4XP6H 4I9WE 1M05A 3KPSE 4JHAH 4NZTL 4Z7VB 3ZL4H 2F53D 1YYMH 3LD8C 1G7JB 3FT3B 4G6KH 5HHOE 3SKOA 4JG1L 3C5SA 3W39A 3ZKMD 2EEDA 4LCIH 2NY3D 3HNSL 3CXHK 4U7MA 4D3CL 2CIIB 4YQXL 5F44A 4CN6A 4H8WC 5HHXL 2ZOKB 4I5BB 1X5KA 1PKQE 2XTJC 3KHQA 1AXSA 3HZMB 4GG8A 2HVKB 5DK2B 2DQCL 4MB3A 1A1OA 5DD6B 1EFXB 2Y36L 5TGBB 1ZWIB 1CFQA 1ZHLA 1GGYA 1GGUA 4RFNC 4QRSB 4QRUB 2P7TA 1FDLH 1TETL 1X3DA 2P5WD 2BVQB 5C07E 4QEGA 1CXEA 4FFZH 1N6VA 3L1OL 2NY7H 1PW3A 3MLVH 4P2OC 5CZVH 5FB8A 2CKBL 4I77H 1OPGH 4LSPH 1BVLA 4FQHA 4HIEB 5GS3A 1MCOH 1NMBH 2ICEB 3AY4C 4MA3B 2P8LA 3ZKQD 1EFXD 3MREA 3IDJA 2OBGA 1HHKB 2E7LA 2AEQL 4HH9B 1JGDB 2YS4A 3RKDC 1KF9B 1T20A 1PKQB 1RJLB 3KLHD 4KI5F 5D7KD 4D9QD 2OTUB 4F7EB 3MRNB 1CLZL 3DROA 3NA9H 2GJZB 1IFHL 1JZ6A 3PDOA 3NCFB 3CX5J 2RBLA 3MV7B 4YBQC 4NSKA 4AEHH 4I9WD 2CXGA 4QHKJ 1BOGA 1LNUB 4GW5A 3MBEA 3HZVA 2GUOB 1MCPH 2Y7QA 4FG6D 3TPUA 1OCWH 4F33B 3QIUB 4N0FB 4XWGL 4DGVL 4XPHH 4K7PH 4XZUA 4C59B 4ZODA 1QBMH 4ZQKA 3C60A 1KB9K 4ODSL 4XNYH 4I0PB 4PJDA 1OAQL 2CK0H 5D1ZB 1KFAL 5AD0A 1KYOJ 5DMKB 4R97C 2AJYH 3V6OA 4PJBF 4GRWE 4QXUH 5MEQB 4HW6A 3MV7D 4ZAKD 2IGFL 2ICWB 3ULVE 3CDFA 2X4OB 1RUML 3DMMC 3DV4B 1M7IA 4WWKC 5KTEH 5C07D 2CIKB 3QIUD 2DBLH 4K71C 3UBXA 4OLUL 1V3JA 5HD8D 1A3LH 1RD6A 4FQXA 2LV4A 4QOKA 2QSTA 1I7RA 4BQCA 3FOMB 4QHNB 2MTPA 1N64H 4X7SL 5D1ZD 3SEPA 4FABH 4ZO6A 4ZUWB 3PQYB 25C8L 5FUZH 4JHWL 2V5TA 3MLWH 3PJSA 4QRTA 3EFDH 1RZJC 1VACB 1AIFB 3LQAH 3UX9B 4JY6B 5GGVL 4KU1A 4MX7A 3S5LB 4P2RA 2CH8A 3MSPA 2Z9TA 1FCGA 4BFEA 3G6DH 3VXUB 4ODXB 2J6EH 3O2WL 4PGDB 3WFCL 3TV3H 3CFCL 1JN6B 4XCNA 5DLMH 3GI8L 3O3BA 1WBZB 2XKUA 4OB5L 2CLVB 4L3EE 1C5DA 1MHEB 1GIGL 2YSSB 1VPOL 1FIEA 2P44B 5IWLA 4LARL 1ZLVK 5BQ7B 2OJZH 1BQLH 3UP1A 2L0DA 2VABB 3REWA 2AEPH 3PQYD 5C0BB 1SY6A 3LZFL 3VXPA 3BPLC 2A6DB 3Q5YA 1KJMA 4PG2C 4OIIH 4NWTL 5KVEH 3ULSB 2EC8A 4RQQB 4HIJB 2R2BB 2KH2B 3V4PL 1B4JL 4KRPC 4CJ1A 2ZG3A 3F7RA 2W38A 4G43A 1P7HL 5C08A 2DQUH 2R1XB 3BKJL 5IMOA 4J4PA 1EGJH 1AKJB 4PYGA 3UJJL 3FRUB 3RNQB 1EV2E 2F19H 4MD4A 4GG6A 2DQHH 1DQLH 3MYJB 3SOBH 5TDNB 4M1CD 3RX8A 3UROR 1KXVC 1WITA 5I1EH 5JO5A 2FHBA 5LXGH 1ZLWK 2OL3L 1K6QH 3QHTC 2VRAA 4UIKL 5FO9A 5I19L 3C5ZA 1JNNL 5LGHH 4FQQB 3W9EA 2A77L 3NIFE 4OFPA 3OHXA 3FRPG 5MI0C 2VL4A 6FABH 5DJ8A 1OGAE 3HS0A 1WZ1L 3GRWL 4B53A 3R0NA 2PXYD 3QFDA 3LKRA 2VTFA 3GSOB 1NSNL 2HN7A 4LRNL 3RZCC 4O02L 4DUVA 2APVA 4R96A 1FAIL 1AKJD 5IBLD 3SO5A 1EAPB 5DVLA 2EH7L 5HDLA 4WW1A 5TE6L 2Q86B 3D69B 5FDWA 3KPOB 3CMOH 1NC2B 1IEBB 3LS4L 2WBJC 3OWEA 5IFJA 2P43B 3K4ZA 1Z5LA 4U6XA 4ZTPH 1G7MA 1R3JA 4HPOL 4YK4C 3TEUA 5JIHA 1KXQE 4XMKH 4L3ED 1K85A 2JLLA 3VE0B 1MIML 3BGAA 1U8KB 4JO2L 1ZHBA 3HG1E 4JFDB 2DQEH 4GRLC 2IAMD 2HFFB 4OZHF 4Z8FL 1MHPH 4U1NA 2JJWA 3D85A 2IPKA 2NXYB 1OAUH 1ZT7B 1XGUB 1FVDA 1OWWA 1KCRH 1AC6A 2WINA 5INCA 1JNHB 1SBSH 2BERA 4FQIL 3LN5A 4PB0H 2X9YA 4L9LA 3SKMB 5ETUA 2F54A 5LAXB 5EUOF 3AS1A 3TO2B 3UO1L 4E0RA 1T7ZA 2ZKHH 3GMRA 4G8EB 4CJ0A 1Q8MA 1KC5H 1IEHA 4HC1H 1VGKA 2HJKB 2NY1B 2HWZL 4YBLB 1KNOA 2Z8SA 2VXQL 4H20L 4QWWC 2APTA 3L3DA 3M1BB 1HHJB 3CLFH 1XF5B 5TH2A 4L5FH 3TPKA 4CVZA 1OGAD 1ZXQA 4WHYG 4P5TB 1FFPB 1ZT1A 1AD9B 3QUXC 5CGYC 4N0RA 4WUKL 4K9EL 3CLEL 4MCYB 1FVCB 5IJVB 1ZHKA 4RZCB 4DWHA 1MAMH 3D39A 1VKXA 1FH5L 4J3SA 5IHUH 5C3TA 1PZ5A 4LOUD 5F9WB 1W8OA 3FFDA 1CU4H 1YMME 3QIWC 2NY1D 4UOW0 2HTLC 4Z7QE 1NMAL 2JIXA 3W5MA 5BV7C 5FO8B 4FFVC 1WTLA 3T09A 5FGRA 3IDIB 1JIBA 5CP7B 4OFDA 4TULL 2PTVA 2AJXL 4XVUC 1HNFA 3EUUA 4NKIL 1H15A 3BEVB 5E8EB 1KIPA 3QDAA 1WBYB 3F5WB 1S8DA 2LU3A 1SJHB 3FO2B 4TUJA 4I0CC 2D7QA 2UV3A 1EO7A 4GLRI 2FRGP 3T3PE 3VFGL 3LQZA 2C1PB 3TBVB 2IG2H 1B4RA 4LCWA 1PZUB 5E70A 1D6EA 1RMFH 2IBGA 3WFZA 1CGSL 5F71A 4A6YA 3T0EC 4R26L 4ODUA 2WLYA 5JIIA 4F7PB 3BSZH 4WHTB 1PG7H 3WFHA 1DUZB 1MHCA 2UVEA 4YDJB 1MH5B 5DHVA 4YDIL 4K94H 5JHLL 4JFHE 3WFBL 4HULB 3PV6B 4AL8L 5BO1L 1H3PL 3S37L 1GPOH 1YMMB 3S88L 1FE8L 4H8WL 4HKBB 1LEKA 2ENYA 4WU5B 1U8JA 1F4HA 2ADFL 5L88H 5IW3A 5AZ2H 4HGWA 3WMSA 3JV5A 2LVEA 3GIZL 1D9KA 3HB3D 3LN4A 1X44A 4KUCD 4JDVA 3CFJA 3WHXA 3NZ8B 4TVPH 4AM0A 3BGMA 3OKDA 4POYA 2BFVH 3SGKA 2ZWLT 4HXBL 4MS8C 1V7ML 1TPXB 2BY3A 5ILTL 4JRWA 2ZJSL 1OTTD 4JE4B 4JPWH 3NABL 2KDGA 3Q5TA 2DQFA 3MLYH 43C9A 3ARBB 1KJVB 4NCDA 3ROOB 2BJML 3QEGH 2XWBB 4KK5D 5FHAL 2PYFB 2OR8A 1YMMD 3SKNB 2AV7B 1FFNA 4Y4KC 1FO0L 4DKAA 1AGDA 4H25A 2J88H 2XYCA 1I3VA 5D8JH 5JQ6H 2Q3ZA 3MO1B 1DL7L 1GHFL 1BECA 1XR8B 3BAEL 1MJ8H 3SDAA 2A6IB 3EYVB 1MFCL 3VWJB 1EK3A 4NKMB 4LSDA 3P30L 1PQZB 2NY0D 4HKZA 2XFXA 1N2RB 3U1SL 2ZSWB 4KK9C 3LOWA 3O6FD 1MFNA 2AEIT 3BPCB 3LEYH 5IR1B 2Y6SC 4UTAL 1YC8A 3V6ZA 2PO6D 1KTRL 3ARBD 3ARSA 2IMNA 4U1KA 1WBXB 2ZUUA 3PUCA 5J89A 1MI5A 2BMKB 2HP4A 5FHBL 1NUNB 4CW1A 5SWZA 2J12B 3VWJD 4JFHD 2BRRH 3S4SB 1QSFB 4HF5L 2PTUA 3MZTA 4M93B 4HIXL 4OZFG 5IFAH 2BOBA 4C57C 2AJZA 4NZRL 2Z8VC 4LQFH 3E6FB 5C0EA 3CK0L 3CFKB 3HRZB 2J3SA 4ZUTA 3QAZB 2I5YH 4P9HH 15C8L 4Y8AA 3S3PA 1U8IB 2QBWA 2DMKA 2W9LA 3HFML 3VG0L 4XNQB 4PJEA 5D5MF 1P84K 3QNXB 3TJHD 1LO3L 1BZQK 3DURA 4DAGH 3WFDH 3CFBA 3HZKB 3IU3A 1CFBA 4MLSA 2A2QT 4LLDB 5E08L 2J4WL 5DRZA 1IM9B 4KUZH 2BVPB 1YNKH 1G6RL 1NDGA 1QLFA 3CFEA 4JAMA 1YEGL 1TJGL 3BWAB 4EI5D 2CJUH 4NBYB 1NBYB 4JREC 4AENB 4MD5B 2FJFA 4BFIA 1ZTXL 3GI9L 5KVFH 4LSUL 4WW2F 1I7UA 2PNDA 1S7QB 5D93C 5GZNC 1RZJL 1S7TB 4JFEE 4WI9A 4CDGC 5DD3L 2H1PH 3WXVH 3QJFB 1E6JL 5F6HI 5IJKC 4PGBA 3P4MA 1YEHL 1ULVA 1UZ8A 1YN6B 4PV9B 1LE9B 3BZEB 1MQ8A 2QQLL 3BE1H 1A22B 2YC1A 4NQEE 2A0LD 3GIVA 4EXKA 5DSCA 4L4JA 1ZA3A 4S0TD 1Q72L 2QSQA 3BOVA 4NRYB 3RUGE 5GSRB 3O41A 3PNWB 5EN2B 4RGOL 4PTTA 1OT2A 5E8PA 1MFBL 1YEIL 5IVZA 2IPTH 2DM4A 4MJ5B 4DCQA 1B88A 2ADGB 1RUKH 5H2BA 4PJGF 3OV6A 3ZDXF 2HVJA 3VFUB 2OK0L 2VH5L 2ZNWA 3VFRA 3OAUH 2DLGA 4P5KA 3EYQC 5DK3A 1FYTA 1U93B 3I9GH 1KPRB 4UUJA 2A74A 1MELA 4Y7MA 1QFOA 4O2CB 3EYFA 3LPWA 3OKNA 1TVDA 1A5FL 5HI5D 4YXKH 1QVOA 4PJBB 3PL6B 4UB0L 3HZYA 3D3VB 2B1HL 1INDH 4KK6C 1BQSA 3LEVH 1AI1H 1UWXH 3Q6GL 5EU5B 3OB0H 4XCFL 1PY4A 1CFNB 1I8KB 1LO4L 3HAEA 3R06B 5E2UL 1IVLA 4G6MH 1CGWA 2DMBA 3QUYA 3V95A