The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
83
|
sequence length |
276
|
structure length |
275
|
Chain Sequence |
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb |
molecule keywords |
Histone acetyltransferase ESA1
|
source organism |
Saccharomyces cerevisiae
|
molecule tags |
Transferase
|
total genus |
83
|
structure length |
275
|
sequence length |
276
|
ec nomenclature |
ec
2.3.1.48: Histone acetyltransferase. |
pdb deposition date | 2011-09-04 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01853 | MOZ_SAS | MOZ/SAS family |
A | PF17772 | zf-MYST | MYST family zinc finger domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant, subunit A | Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | ||
Alpha Beta | 2-Layer Sandwich | Wheat Germ Agglutinin (Isolectin 2); domain 1 | N-acetyl transferase-like | ||
Alpha Beta | 3-Layer(aba) Sandwich | Aminopeptidase | Aminopeptidase |