3TO9A

Crystal structure of yeast esa1 e338q hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase ESA1
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 83
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to9A02
1GXPA 5JR3A 3C18A 3RPUA 2VE9A 2VBZA 2UWMA 3F8CA 3BJ6A 4YIIA 4JQFA 5HDGA 3ISPA 1YVKA 5DUIA 2O0YA 5D5XB 2RV8A 1Z05A 4CHUA 1MDMB 1XGMA 1BM9A 1VTNC 3EUHA 1HW1A 4YRHA 1PUAA 1HXDA 3MZHA 1QSOA 5HDKA 2DPUA 4CYDA 4I02A 1YLFA 2BBYA 1WWXA 2A69F 3DV8A 1S7LA 4K30A 5F48A 1RXTA 1R36A 2ZXJA 4G6DA 4KVXA 2LSOA 2VC1A 4ETSA 1U5TC 1HSTA 1PUEE 1ZLKA 3CUOA 4Q5SF 3K9UA 5BS6A 4M74A 5A2QZ 2Y48A 2J8NA 4A0ZA 3RIRA 1FY7A 4AVPA 4GCVA 3TKYA 2G3TA 3U1DA 5CVVA 4B8XA 3GO5A 1Z1DA 1IYKA 2PI0A 2VZZA 4UWIA 2HKXA 5LGUA 3P2FA 2VT2A 3IC7A 3GFLA 5LLQA 1WRJA 2CNMA 3KP3A 2IJLA 1G3WA 1I21A 1BBYA 3BJ8A 2K27A 1EH8A 3TOBA 3DXJF 1KYWA 1YW7A 1U6GA 1YIOA 4FT8A 5HMNA 1TTYA 3VOEA 4LLNA 2EA4A 1J4JA 3MGDA 2OAZA 5EEGA 4AVCA 2VI7A 1YLEA 5E1ZB 5L3GA 2ETHA 3EQLF 2P7VB 4G9YA 4ENNA 3BJ7A 1PP8F 4EVYA 1FC3A 2L02A 3N7ZA 2XASA 3ZP5A 1RIOH 1RZ4A 3CXSA 5IV0A 2GIVA 5E17F 1O7FA 3F22A 5KTCA 2ZO4A 4L18B 3PFIA 1IAWA 3F8BA 1QO0D 4PSWA 2G7HA 5K5OA 2OZUA 1YO5C 2HQYA 3K2ZA 4LLGF 3SXNA 1R1VA 5FB2A 2JTVA 2WV0A 3NQOA 4KOWA 2ZKZA 2REFA 1MKMA 1K4JA 1V4RA 2EB7A 1ULYA 4M72A 3RYRA 2BUEA 4JD6A 3TOAA 3KEQA 5C88A 1YK3A 4IJAA 2D2WA 1J5YA 3M8FA 1F1ZA 1JGSA 2B4DB 2HQNA 1FP2A 3BY6A 3TO9A 3E5UA 3DSBA 1KUYA 1B9NA 3JTGA 4L9JA 3V8JA 2RVCA 2M87A 4A2UA 1SFUA 3ZN1A 1XCVA 2ACJA 3T8TA 1F9NA 3NRVA 3CTAA 4EJWA 4GGGA 4N9IA 5ILSA 1OZPA 3DNSA 1P4WA 1Z91A 3M1EA 3DPTA 4KVME 1OYIA 3CUQB 1Z6TA 5AIQA 1I1SA 2OZHA 4UA3A 2L4AA 5IT3A 2ESHA 3GYAA 5JVTA 2XKPA 4QWQA 1REPC 3ZMVA 1O3TA 3F6VA 2VZYA 1SMTA 1I27A 1XGOA 1RI7A 4IRHA 1I6XA 2F5IA 2OD5A 2X4HA 3EFAA 2VOOA 1ZREA 4HBLA 3WE2A 1N71A 4P96A 5ICGA 2XGXA 4B5PB 1R1TA 4RS2A 2JDDA 2P6SA 1DP7P 4O3MA 3OOPA 5HLGA 2ZFWA 5EEHA 5D6EA 2VXKA 2KRFA 4XLNF 2DO7A 3KE2A 4OINF 2I79A 3Q9VA 4PCQA 1WK4A 1H9TA 4NQWA 4YFJA 1RNLA 1NE9A 4WCGA 2ELHA 4RGUA 1TW3A 2VBYA 2K86A 4EGZA 2Q0OA 4ENJA 1QQIA 4JWPA 2QQBA 4ASNA 3F8FA 4IF4A 1USTA 4HDVA 4P55A 2ATRA 2ZW7A 2XHKA 1S29A 2R7HA 2GXGA 3R95A 2W84A 4RI1A 2FNPA 1KU7A 2VONA 1IB1E 2GZWA 2VBXA 4G94A 3BPVA 2RGVA 4H6UA 3L00A 2EK5A 3CDHA 2MC3A 3NE7A 1O3QA 3QU6A 2GE3A 3TE4A 3FMQA 3VFZA 2K4BA 3W6KB 4ZZDA 4ZYHA 3RI4A 1R5HA 4U88A 4PGHA 3WTTC 3KP2A 3C1DA 4ZYGA 4QLCU 1CF7A 3F8MA 1AWCA 1HQCA 3E5QA 1YG2A 3WGGA 3O6BB 2HUZA 3FNCA 3L09A 3DQVC 1DPUA 2PRBA 2YX7A 2IT0A 1B4AA 3KLOA 2Z33A 2COMA 2OZ6A 5HH1A 1ZAOA 2XKOA 4RB2C 4FX0A 5HS9A 3FM5A 3M7GA 3KZYA 3HHGA 1KYZA 5K1YA 4KVOE 3I58A 1ZGJA 5HLHA 1G3SA 3E3VA 5FD6A 5ISVA 1A04A 4L0YB 2PR8A 2EFPA 3KP4A 3RYOA 4H6ZA 6PAXA 4KT5C 5AONA 2PC1A 1YFHA 4LGWA 2XAJA 4UXNA 3F0AA 2OA4A 1GXQA 1IXCA 4M6XA 3K69A 2CG4A 2Z3YA 3WGHA 1M44A 5HVQC 2E1NA 1X3UA 1YGHA 4YG2F 2FQ3A 2Q04A 4O5VA 1XEBA 4PV6A 5EC4A 2FT0A 4Y49B 2B3VA 2R7DA 3FXTA 4ZBGA 1QSTA 1Z9CA 3J81Z 1JE8A 3GFMA 1Y9KA 2BGCA 3JVNA 2IRFG 4CXFA 4HA8A 1XGSA 1O3SA 2LF7A 3ERED 3WU1B 2WPWA 3ML6A 3KEOA 1KU3A 4CDGA 3OV8A 4L89A 2F5CA 1DDNA 4B5OA 1E2XA 2FMYA 5HS7A 4LG0A 1FOKA 2A68F 4ESFA 2NNYA 3DF8A 2DPDA 1HKTA 5H84A 4L5IA 1HW2A 4U0VA 2RKHA 4A6DA 2TDXA 1S3ZA 3ZPLA 3MWMA 2KIUA 3TTHA 5E20A 5BPDA 1P92A 4CRYB 1F5TA 1T98A 1GVJA 1GHEA 1ZRFA 1YW8A 4UVAA 4ESJA 1LDDA 3FWEA 1KU2A 4UV9A 4KZTA 1IRFA 4RB1A 1QSRA 5E8IA 4LJZF 4WWCA 5H6RA 4N9HA 4Q47A 5LBQA 3E6DA 4I0AA 4KUBA 4KOVA 5LGNA 2WTEA 3KP6A 4EJUA 2XVCA 3D5LA 3E0KA 3DEUA 3HRUA 3R60A 3GFIA 1VHSA 4M3SA 4NB5A 3CXQA 2HYFA 4OLLA 4P5OA 4PSXA 4A0XA 1FSHA 2A3SA 1C0WA 4KIGA 4ZYDA 3K0LA 5D8LB 4OIPF 4R87A 3GFJA 4IXAA 3CO7C 2AJ6A 2JT1A 4AWXB 2Q2EA 1TQMA 4MY0A 4R8HA 4EM2A 3P7NA 5IX3A 3I53A 2CNSA 1USSA 4IHSA 3IRQA 1U6MA 5F1RA 3T5XA 3I5UA 5H6QA 2QQAA 2V1UA 1KU9A 4G8XA 2Z9OA 4JXRA 3HRMA 2P5LC 2QBYB 5CVJA 1ON1A 2CSOA 5ICFA 4F6AA 4UUVA 2YU3A 4LLLA 4CAVA 2J8MA 4LB6B 4OMYA 3CLOA 3WTSC 3O2PE 1KZFA 1I1GA 3GYHX 4PGGA 2HTSA 5GCNA 1S7OA 3ZMZA 2ZW6A 2FU4A 2QBYA 1FSEA 4HDUA 2FMLA 2PMHA 2L3DA 1S5KA 2M45A 2Q44A 3LQRA 3R1KA 4HYEA 1SD6A 5TRDA 4E70A 5KTDA 2C6YA 4FD5A 5ED4A 2FNAA 2PQ8A 1WSUA 2O3FA 1MK4A 1KUXA 3BOQA 2PG4A 3R61A 3PZJA 4B09A 2HKOA 3RKXA 2CO5A 2RDPA 2B58A 4BNCA 3LAJA 2LKPA 5CVIA 1O7LA 4TV7A 4RGXA 4L8AA 4ZZLA 2FBHA 1B6BA 3S6KA 2E7XA 3D0SA 5DDGA 1H9GA 5ICEA 1RO5A 3SZPA 2QM3A 4NXYA 5F47A 5L3DA 2DU9A 1FLIA 3ZMUA 1ZRCA 2FSRA 5JFRA 4HF2A 4FX4A 2QQ9A 4HV5A 5DV5A 1EH6A 3LA7A 4KOUA 3FIXA 1XIXA 1XMAA 3ZN0A 3RPQA 4I0BA 3KP7A 5CVRA 1QPMA 4ESBA 4I49A 4U9ZA 1WQ2A 1YS7A 3SQNA 4KMFA 1R1UA 5FFZA 1ZYRF 2EV5A 3I71A 1R57A 2JZYA 2DTRA 2JEVA 4GO1A 3KCCA 2WC2A 5D5WB 4CO8A 1S7KA 3DKWA 4R1HA 2H94A 1M1DA 3IWZA 4F0YA 1R22A 5K5QA 2ZXVA 4MI4A 1CM0A 1ONVA 2Q0YA 2PN6A 3J80K 1YS6A 1KUVA 3HIFA 1J7KA 1STZA 3RJPA 2CNTA 2EFNA 2VOPA 1E17A 4AG7A 4D0PA 3FX3A 2B5GA 3ECOA 1SD5A 2MH2A 4Q48A 5F46A 4JK1X 2IPQX 3Q9SA 2GXBA 5TJJA 4PK3A 4E2AA 4JJXA 1XF8A 5FLXK 3FMSA 2DK8A 2IA0A 2HFHA 2NNNA 3FRMA 1YTYA 1UFMA 2BEOA 3FBUA 4HQMA 3EC4A 3I59B 5D8KB 1QGPA 2RNJA 5FGMA 4AVAA 3LWFA 4XPLA 1P2FA 1OKRA 1OMIA 3WU0A 5BOXA 4AIKA 3LAPA 2J8RA 2V9VA 4DQ2A 3W6JB 1W7PD 2F5EA 5LEKA 1IN4A 1IW7F 1QZZA 3I59A 2XRNA 1P4NA 4R3LA 3ZMDA 4HLXA 5KK1A 4EVIA 4YFNF 2DFIA 4XPKA 2ZCWA 1OR7A 5FVJA 3U2RA 1XDUA 5I0CA 1DPRA 1MZBA 2FBIA 3W6SA 1EH7A 3E97A 1MJBA 4CICA 2KCWA 3HYIA 4BXUA 1GHCA 2X7BA 4HX4A 4AIJA 3PQJA 1XSDA 1OPCA 4S04A 4UBRA 2E1CA 4XNHB 2DK5A 2D45A 4FD6A 3VWEA 4AD9A 1QNTA 1XCBA 4HX8A 2A61A 1BOAA 3BROA 3CUQC 4OADA 2FSWA 2VEZA 1FZPB 4P9FA 1FX7A 1XDSA 3I64A 2HOEA 1T2KA 2IVMA 3GUDA 4PZJA 2P7CB 3TDUC 2IA1A 2DQLA 3F8NA 3LA3A 2QMLA 2Z0ZA 1NMTA 4KLWA 2IW5A 2V79A 5FFXA 4XRFA 2LDUA 3GEZA 3MFKA 2VBWA 3TFYA 1G3YA 4CZZA 3R96A 2OU2A 1U2WA 4IHTA 1W7PB 3SHFA 2LNBA 2QZ8A 3TDZC 3WTWC 1XE4A 3FYNA 3FXRA 2BSWA 1B6AA 4KOYA 3HSEA 1SAXA 2A5YB 3E6CC 2MLGA 2P5KA 1T6SA 4MEXF 4EM1A 4KIFA 3RKWA 1W7PA 5LHHA 2FIWA 2AE6A 1QSMA 1W5TA 4G7ZF 1Y7RA 3FM3A 4I7HA 5DEQA 1CF7B 3FMRA 2W57A 4QVTA 3ELKA 1RUOA 4IRIA 2ZNYA 4JBAA 5JQ4A 2GQQA 1HKSA 2UXNA 1LQ1A 2P5VA 4BHCA 1XGNA 4MQVA 2KIMA 2I00A 3V7SA 3GVAA 2B3UA 2HYGD 1B59A 3MQ0A 1ZN2A 4NHJA 1P4XA 4EJVA 1S7AA 4KNYA 3FXUA 2FRHA 1D8JA 2Z11A 4GYIA 2VBQA 3G3SA 4ENMA 2Q8KA 2G0BA 4U5YA 3B8GA 5JHUA 3ZZIA 1D3YA 3F6OA 1W5SA 3T9YA 4EQQA 4RGRA 1MD0A 5CNPA 2QYOA 3ABUA 4OMZA 4IF5A 2REEA 2NAZA 4M71A 4RS8A 1K78A 4KOSA 5A2QK 3CJNA 1U3EM 2D4OA 1LVAA 5JPHA 2GAUA 4KDPA 1JHFA 1SD4A 5BPIA 1NSLA 2YSRA 2OZGA 1KGSA 2V1XA 4KORA 5KVRA 1G6NA 4I09A 2PBIA 1YX0A 4M85A 4DNCA 3LD2A 2XROA 2YPRA 2R98A 1FWZA 3QU3A 1S8NA 4NCZA 2HV2A 2XIGA 1EV7A 3I9SA 5LGTA 3HTSB 2ZMEB 3IL2A 3LFKA 4CGZA 1FPQA 4M9XA 2E7WA 3WR7A 2KJCA 4LG0B 5LRRA 2KIFA 5F49A 4CAXA 3R6SA 1YREA 4M9SA 3MZYA 2BL1A 4EJOA 2ZMEA 1Z9UA 4AB7A 2MLKA 1TW2A 1J9IA 4Y13A 4U7BA 2OB0A 3R9GA 2FCKA 3B73A 2VT3A 2NYXA 4MGRA 4Y49C 1SQHA 3WODF 1L0OC 2Y0MA 1XMKA 2AXLA 2NMTA 2HEOA 4LUAA 1R23A 3K1NA 3GY9A 5DD8A 4OU0A 2BYVE 4Y15A 3L2CA 3GXOA 2JSCA 1MJ9A 3TO7A 2Z99A 4NSQA 4OAEA 2HZTA 3T90A 2QWWA 3TCVA 2EJRA 3HOTA 5D4SA 4AG9A 1IN7A 2X0LA 4EMSA 1FBUA 3IKTA 5L3FA 2IA2A 3M8EA 3HUGA 1YW9A 5D4RA 1HSJA 3L9FA 5ERIA 5C82A 2NRAC 3SXOA 3QRFF 1BIBA 2EFOA 2P4WA 4A5MA 1SFXA 3KZZA 1JXSA 2XAHA 3RDIA 3H3ZA 4CAWA 4KUMA 1FBSA 2ZW4A 3P9IA 2AS5F 1D8KA 2ISZA 1TIQA 1FYLA 4U0YA 4M73A 4MBUA 2QVOA 1BI2A 4I98B 2Q7BA 3T1BA 2G9WA 2P6GA 3K9TA 2DAOA 2A07F 4MHGA 3CO6C 2ZJ2A 3IRRA 1U78A 4S05A 1TNSA 5BQTA 3R9EA 2ESNA 3AAFA 2PLYA 1W4MA 3QAHA 3WGIA 4PK2A 4JLYA 3T0YA 1ZH5A 3WTZA 4ONUA 4BHPA 3P2HA 1V0CA 4JXQA 1YVOA 3Q5FA 1UB9A 1XD7A 3N97A 4XPDB 3J7AO 3WE3A 4L9NA 1IIDA 3WTUC 1FYKA 1H0MA 2VODA 2P6FA 3EYIA 4A6EA 1P0HA 2FE7A 1Q2CA 3UY5A 4R3KA 4KA4A 2JLMA 1Z4EA 2W24A 1B1BA 3RTRA 1L3LA 1L0CA 3I54A 3VB2A 1IRGA 3GZ6A 2HS5A 4OOIA 3REOA 3S6FA 5FD5A 3SHPA 3QPHA 1KQ0A 2ZW5A 1XSXA 2LF8A 3FF5A 4UV8A 5IT9Z 4HNXB 2FBKA 1O57A 4Z2YA 1KQ9A 1QZYA 3ECHA 3CXPA 3ZMSA 3KLNA 1P6RA 1J2XA 1J59A 4HZFA 2JPBA 2D1VA 4YGOA 3ABTA 1I12A 3TT2A 3G73A 1ZARA 4HOBA 2F2EA 4BH9A 3V4GA 2DI3A 1U5TB 3RYPA 1B87A 4WK8F 3VWDA 4LMYA 4U0WA 2JRTA 4L9TA 2Q4VA 4KOXA 5CJ9A 2Y75A 4BMHA 1IN8A 1S7FA 2WPXA 3LSTA 2EWNA 3F72A 1TNTA 2CY2A 4AVBA 1YQAA 3S6GA 5L3CA 3HHHA 5E1XA 4WX9A 1U5TA 1MDMA 2A6HF 3JTHA 4MQ9F 3V8LA 2ADUA 1WI9A 4KFCA 4U7DA 1FNNA 1QSNA 2B4BA 4UVBA 4QUSA 1T38A 2DW4A 3U9GA 3KETA 2R1IA 3IHUA 3KP5A 3L7WA 3WTYC 2PJPA 3SFZA 2VN2A 2ZPAA 2O61A 4R57A 1G3TA 2QUFA 4KOTA 1SFEA 1LRZA 4MTDA 1SMYF 3ZMTA 3IKVA 2FL4A 4HQEA 3W91A 3O3KA 2M30A 1WWZA 4UWJA 1LDJA 3HSRA 4KLVA 4MHDA 1ZRDA 4CS0B 3PQKA 3SXYA 1FYMA 1LB2A 4ORFA 1LJ9A 1OYYA 2P8TA 1K6OA 2B5GB 2O28A 2HGCA 4BHBA 2F5FA 3I4PA 1XSVA 3K1PA 1T39A 5L3EA 1IF1A 2ARHA 2EV6A 4P9UA 1FBQA 3JAMZ 5E18F 4RB3C 4X5KA 4HNYB 1AOYA 3J81K 3K1MA 1BOBA 4IRGA 1ZG5A 3LQQA 3FXQA 1MJAA 2PEXA 5D5UB 5J6XA 1MGTA 1M4GA 3D2PA 2VC0A 2VXZA 1Q2YA 4MTEA 2M8EA 2Z5UA 2G7UA 2JPCA 1ZGAA 2PSWA 1KA8A 4GXOA 4ZYEA 1IYLA 1NHAA 1S7NA 4R9MA 2HQRA 2ZNZA 3H3UA 1Q1HA 4BAYA 4RB0A 2STWA 1PU9A 3DR8A 2DLLA 3ZQ7A 3BWGA 3TQNA 2HR3A 2UZKA 4KN7X 4Y17A 2KJBA 3QB8A 1SD7A 2H6CA 1TBXA 1ON0A 2CWEA 2FXAA 2H6BA 5ILVA 4AIHA 5LRSA 3EETA 2CYYA 1ON2A 2XUBA 1LNWA 3SZTA 1IZ1A 1PDNC 4GS4A 4CRZB 2NS0A 2STTA 3M9AA 1Z7UA 3QP6A 3EY5A 5HOOA 1ZHFA 4HKFA 5E96A 4QBJA 3ROUA 4E8OA 5IB0A 3EXNA 3ULQB 2OBPA 4BYYA 1BN5A 3OWCA 2EUIA 5KTAA 5J8CA 2IP2A 2B4DA 1LDKB 4OIQF 3JSOA 3ZJ0A 2PFBA 1Z4RA 2GA1A 4WXCA 4HLYA 2V1DA 1RUNA 4WF2A 1YR0A 1XN7A 2R3SA 4A0YA 4L0ZB 2QLZA 3I3GA 1BO4A 1Y9WA 4HNWB 4UNOA 2FOKA 4O6JA 1OYWA 2PMUA 2XAGA 1M4IA 4MEYF 3COAC 4J3GA 2EFWA 1TQIA 2F5DA 4BQAA 4I2OA 2GWRA 4KYWA 2OQRA 1UHWA 2W25A 4RAYA 3JUWA 3CUQA 3V7CA 3R0AA 4XSXF 3HTUA 4XNHC 3EO4A 1BI3A 2EA2A 5FO5A 4YFKF 3KKWA 4EV0A 1V3FA 5DWNA 1QBJA 3S2WA 3F8KA 3GWZA 1BI0A 2FS5A 4IPAA 1FP1D 3F21A 2O8XA 1ZLJA 3HRTA 4U9YA 4B5PA 2CQKA 2QENA 3GZ5A 3QPTA 3T8RA 1ZG1A 2Q4YA 3BP8A 1Q2DA 4H0EA 3F5BA 2MA3A 3B02A 4OIOF 4KIBA 4K2EA 3D2MA 4M6YA 3E5XA 1BJAA 1S60A 4LK1F 2K4JA 2GA2A 3GF2A 3BZ6A 4FHTA 4EM0B 3FHZA 1IN5A 3EDPA 2PR1A 3P9KA 1XMTA 3F3XA 2GANA 4ON0A 4FD7A 4HX7A 2B0LA 2XAQA 4MNUA 3C26A 2P0WA 3HRSA 5LEJA 5DYMA 1DUXC 5IT9K 5H20A 1TQPA 3DP7A 5CYVA 1UFHA 5F64A 5ILUA 4LD5A 2RQPA 5CLSA 5DD4A 4LX9A 3R0JA 3GX4X 3WG9A 4UHTA 2H5MA 3H92A 2K5TA 2A4NA 1K78B 2L54A 5JI6A 2O03A 3HOSA 1HBXG 2FIAA 2DT5A 2YX4A 1K7AA 2D1HA 5D6FA 4L9VA 1JHHA 4QB9A 3D3SA 1P4AA 3QP5A 2WWYA 4YFXF 4YIFA 2V6CA 2IL4A 4RGSA 5E8GA 2XAFA 3FB3A 2YR2A 4LB5A 5F6FA 2BV6A 1LEAA 1IICA 1VKCA 2L01A 2FE3A 3VODA 2Z10A 1IN6A 1B9MA 2CW0F 3BPXA 2D4PA 5HS8A 2XV4S 3IWGA 2K02A 3MEXA 5DCMB 4HF1A 1TLHB 4MY3A 4G7OF 2MH9A 4WXHA 5ICCA 1ODDA 2EV0A 2RN7A 2W85A 1J0RA 1T0FA 3RKYA 2EFQA 4F7ZA 2ZBKA 1IUYA 5DCMA 4GYGA 3VEPA 2HDCA 1PP7U 1I1DA 3PP9A 2BEIA 3MAJA 2FF4A 5AIPA 3J80Z 1S6LA 2HWVA 3NEUA 4XLPF 1U8RA 5D5VB 2VQYA 3JAMK 4L5JA 4NEXA 3BJAA 1HKQA 3P9CA 3DPLC 3PGPA 2MD5A 4XSZF 4G6QA 2P6TA 1F4KA 3TGNA 5FLXZ 4UVCA 5H86A 2H09A 1D5VA 3C7JA 3WTVC 1FT9A 1BC8C 2MBFA 1UCRA 4ENKA 4KICA 2CGPA 4EGYA 1S3JA 4KUAA 5K5RA 3BLNA 5DWMA 3V8IA 4H89A 4R79A 1HW5A 2L4MA 1M4DA 1J75A 1R00A 5LHGA 3H4QA 2A6EF 3IWFA 2R7FA 4IVNA 2JDCA 3JSPA 3HSFA 5HLIA 4XBFA 1KQ8A 2DXQA 5L3BA 4IUSA 1K79A 4EJTA 4KN4X 4Q4ZF 2M5WA 1BC7C 5E1WA 3C3WA 3W6XA 1IXRC 3IGRA 5J8FA 1ZG3A 2PDOA 1XB4A 2BE5F 2R8VA 5DUKA 2HTJA 4I01A 3D8PA 4E0AA 3GLXA 4WXDA 1Y0UA 1I5ZA 5BMZA 2VE8A 3TO6A 2RC4A 2OH1A 2QIRA 2J5OA 1R7JA 3V7RA 4HAMA 2FEZA 2G3AA 5HDNA 2FXFA 2EVNA 1IXSB 2CFXA 1WKMA 3BDDA 3S6HA 3JW4A 4LK0F 3GW2A 3DR6A 1CJWA 2K7LA 4MJ8A 2OQGA 1Z6RA 3LODA 5EBVA 3MCZA 3E6BA 2ISYA 3KFWX 3EYYA 4QC6A 4RAZA 5DCFA 3E6MA 4G7HF 1LEBA 2C27A 4OIRF 3G8WA 1R58A 5CVUA 2H27A 3BJOA 1R5GA 3GKRA 1UHMA 3WTXC 3DFGA 3DDDA 2J5PA 4M9ZA 1CGPA 1G4DA 1YYVA 2M1BA 3I0TA 4HF0A 2UXXA 4N0BA 3F23A 2DBBA 1BIAA 3G3ZA 4A5NA 4HW0A 2KKOA 3R9FA 4XPDC 2FA5A 4LFUA 4FD4A 3V8KA 4NF1A 4HV6A 2O6GE 3N4MA 4ZH4F 1BI1A 4A12A 1O3RA 3QOPA 4KMUX 2QECA 3LA2A 3R4KA 2P6EA 4II9A 5LHIA 3FZVA 2DQRA 4PDKA
chains in the Genus database with same CATH superfamily
1GXPA 2QGUA 5JR3A 3C18A 3BG9A 3RPUA 4UEFA 2R0QC 3OYJA 2VE9A 1GYTA 2VBZA 2UWMA 3AG2H 3F8CA 4XQFA 1YIJI 2KRHA 2XF7A 3BJ6A 4YIIA 4JQFA 5HDGA 3ISPA 3SZGA 3BR5A 3ZOBA 5DUIA 1S5LC 1ULNA 1YVKA 2O0YA 4PJNA 5D5XB 2WZNA 4CGPA 2RAEA 1BR1A 2RV8A 4XKCA 1Z05A 4CHUA 1MDMB 1MBHA 2PIYA 4FASD 1XGMA 1BM9A 3F0CA 3GLLA 3EUHA 1HW1A 1VTNC 5EX0A 1IC8A 2FD5A 4ZY1A 4FISA 1HCRA 2Y0SA 4HPSA 4YRHA 3MKZA 1PUAA 2E5ZA 1HXDA 3MZHA 4MFZA 1QSOA 3AG4H 5HDKA 3KYLA 2RQQA 2DPUA 4CYDA 4I02A 4HG2A 1YLFA 2BBYA 4NFRA 1RR7A 4BDZA 1WWXA 2A69F 3DV8A 1S7LA 3PBBA 4K30A 5F48A 3CDIA 1Z8WA 1RXTA 4UIAA 3JRUA 4FAIA 1R36A 2ZXJA 4G6DA 4KVXA 1YITI 3IAM2 3KHXA 2KHMA 2LSOA 4CA0A 2VC1A 4ETSA 4IQ4A 1U5TC 1HSTA 2FVGA 3CESA 1GT0C 3ZQIA 1PUEE 1WCMJ 1ZLKA 3CUOA 3G4SI 3I4MJ 4Q5SF 2R7ZJ 3K9UA 4Z65A 5BS6A 2W4SA 3IH4A 4M74A 5A2QZ 1SGQI 2Y48A 4TWEA 2J8NA 4A0ZA 1FOWA 3RIRA 2R7XA 1JKPC 1FY7A 4AVPA 2EIMH 3ZCOA 2BOLA 4GCVA 3TKYA 2G3TA 3QODA 3U1DA 5CVVA 3BTIA 3BR6A 4B8XA 3GO5A 3CF5F 1Z1DA 3DLLF 5CPRB 1IYKA 4NBQA 2PI0A 3JRGA 4ZX8A 2O9LA 2VZZA 4NDLA 2ORVA 4UWIA 4R7MA 2HKXA 1UG2A 5KCMA 5LGUA 3P2FA 2VT2A 1AHDP 3IC7A 3GFLA 5LLQA 4A3GJ 3OS2A 1HEVA 4OIWA 4CYOA 4A95A 4BXXJ 1WRJA 2CNMA 3KP3A 1PCEA 4XONA 5EF6A 2IJLA 2GM4A 1G59A 1G3WA 1X4SA 1I21A 3K4LA 1SGRI 1BBYA 3BJ8A 1FTZA 1JJ6C 2LY2A 3J7AY 2K27A 1EH8A 3TOBA 3DXJF 4XLAA 1KYWA 1YW7A 1U6GA 3A4CA 4B10A 1YIOA 3H5NA 4FT8A 1JUMA 4MFDA 5HMNA 1TTYA 1QVUA 3VOEA 4C3HJ 4LLNA 4HGUA 2GLJA 2EA4A 1P9GA 1J4JA 3MGDA 2OAZA 1JKQC 5EEGA 4AVCA 3BCBA 2VI7A 1WI3A 5G1ZA 1UHAA 2L2OA 3HOXJ 3ZQCA 3BQYA 1SVLA 1YLEA 2BO9A 1X4PA 4DYRA 5E1ZB 5L3GA 2JA1A 2ID6A 4KSFA 2GKVA 1N78A 2ETHA 1DQUA 3EQLF 4C2MJ 2J87A 3R5BA 1TWHJ 2P7VB 4AC0A 4G9YA 4ENNA 7WGAA 3BJ7A 5LYFA 1PP8F 4EVYA 1OISA 4XMYA 3H5ZA 2JMWA 1FC3A 2L02A 5IYDJ 3N7ZA 2XASA 3ZP5A 3K10A 1RIOH 4UFWA 1KZHA 1RZ4A 4M3EA 1B8IB 3CXSA 5IV0A 3OR1C 2ELKA 4ZDLA 5HVFA 3DU5A 2GIVA 4MCPA 1BLLE 4Q36A 2O8KA 1SAUA 2DDAA 5E17F 3L1PA 5FKMA 3CCRI 1O7FA 3F22A 1UVGA 2ZO4A 3D66A 1TWGJ 5KTCA 1MNDA 3CCSI 2PJ9A 1RKWA 3OYEA 2HPIA 4L18B 4II9A 3CMEI 1CPSA 3PFIA 1OCOH 1TP4A 2WY7Q 2QSFX 3F8BA 1LUJB 1IAWA 5J4VA 1QO0D 2F8HA 4PSWA 2G7HA 3LSKA 5K5OA 2QQ8A 2OZUA 4AYBN 1B8IA 3S14J 1YO5C 5HNHA 3K2ZA 4LLGF 2HQYA 3SXNA 3QWPA 1ETXA 3VYUB 3FXJA 5CQGA 1R1VA 5FB2A 2CV1A 1ZG9A 2JTVA 2CUJA 2WV0A 4KT6A 3NQOA 3QPSA 3VDXA 4KOWA 2ZKZA 2M7BA 2LBFB 3TX8A 2REFA 2DCEA 1MKMA 5IYCJ 3UNGC 1K4JA 1V4RA 2CU7A 4BS9A 2EB7A 3DTKA 3OYDA 1AN1I 1ULYA 1MIJA 1SEUA 4M72A 3RYRA 2BUEA 4IHXA 4JD6A 3TOAA 3KEQA 5C88A 1YK3A 3B7IA 4IJAA 2D2WA 1J5YA 4BEHA 3M8FA 1F1ZA 1JGSA 2P81A 2B4DB 4D7NA 2HQNA 2SGDI 1H8LA 1FP2A 2DA3A 2K3FA 2LBFA 3BY6A 3JR9A 3G6EI 3K70C 1HPTA 3TO9A 1QZEA 3E5UA 3DSBA 1KUYA 2EZKA 3HLPA 2VQLA 4UXIA 5M3MJ 1B9NA 4DGWB 1OR7C 4F9UA 3JTGA 3B6CA 5EZHA 2I8DA 4BQNA 4L9JA 3V8JA 1E3OC 1FJLA 2TCTA 2RVCA 2M87A 4A2UA 2K9QA 3AKZA 1SFUA 3ZN1A 4CCJA 1W4RA 1XCVA 2ACJA 1MNMC 3T8TA 4IEJA 1F9NA 3NRVA 3CTAA 4EJWA 1Z2LA 1M1EB 2KLOA 4GGGA 4N9IA 5F0FA 5ILSA 1OZPA 3E2IA 3DNSA 2CQQA 2PJ4A 3NH5A 1P4WA 1Z91A 1JGGA 3M1EA 3DPTA 5FKNA 4KVME 1OYIA 3CUQB 1Z6TA 3IIBA 5AIQA 1I1SA 2OZHA 4UA3A 4G6TB 2IS6A 5LD2C 5HI7A 2FX0A 2L4AA 4SGBI 3PUBA 2ESHA 3HGYA 5IT3A 5JVTA 3GYAA 4PQAA 4BQQA 1FTTA 2B8TA 2XKPA 4QWQA 3RSNA 3WHBA 4A3IJ 1REPC 4B6DA 2NXNB 3ZMVA 1Z5RA 5HVGA 1O3TA 3F6VA 2LR8A 2VZYA 1SMTA 1I27A 1XGOA 2SGEI 2PJ3A 1RI7A 4IRHA 4C2YA 1I6XA 1DGWY 2HVRA 2F5IA 2OD5A 2X4HA 3EFAA 2VOOA 1ZREA 4HBLA 2DA7A 3WE2A 4P96A 1N71A 4OIDA 1MMAA 3VARA 5ICGA 2MFZA 3DBRB 2XGXA 4B5PB 1E3HA 1R1TA 1R6RA 4RS2A 2JDDA 3JTKA 2P6SA 1DP7P 4O3MA 3OOPA 5HLGA 2WY8Q 3WC6A 3I1UA 2ZFWA 1D1AA 2K9HA 5ELYA 4AM3A 2XGCA 5EEHA 5D6EA 5F0CA 2VXKA 3HH2C 2BY0A 2KRFA 4XLNF 2HC9A 1YE9A 4DJAA 2DO7A 3KE2A 2CH0A 4OINF 5IP6A 4LQ6A 2I79A 2F3CI 3Q9VA 2M34A 3PM1A 4Y7NJ 2GKTI 1JT6A 4PCQA 1WK4A 1H9TA 1OCZH 4NQWA 1CX8A 4OC2A 4E7SA 1RNLA 2HXOA 1S20A 1NE9A 2ZEMA 4YFJA 4WCGA 1YX3A 2ELHA 3DPUA 1ZG7A 4RGUA 3M4OJ 2AFZA 1TW3A 2VBYA 2K86A 2W82A 2DMNA 2Q0OA 4EGZA 4ENJA 1QQIA 4JWPA 2CUFA 2QQBA 1Y0RA 4ASNA 3F8FA 4RM3A 4IF4A 3SEZA 1MBEA 1USTA 4P55A 4HDVA 1ULMA 1YQEA 2ATRA 2ZW7A 3I56I 3CMMA 2XHKA 1S29A 5G20A 3FK6A 3KX2A 1LAMA 2DXIA 2R7HA 4B43A 2GXGA 4J19A 2L9VA 4BBHA 3R95A 4DBQA 3G71I 1A2ZA 4CZCA 2W84A 3PO2J 4RI1A 2FNPA 4A24A 1KU7A 2NU3I 3L2VA 3BR1A 2VONA 4HNVA 4C3IJ 2B7EA 2IGMA 1IB1E 2GZWA 1SANA 2ODDA 1ELMP 2VBXA 4G94A 3PB7X 4OP4A 3MZ8A 1IDZA 2I3CA 3BPVA 2LMDA 3HM5A 2WB1N 4MIMA 3LL7A 1DE4C 2RGVA 3ZR8X 1IOFA 2ABZA 4H6UA 5THWA 3L00A 2EK5A 1V54H 2MC3A 3CDHA 3NE7A 2DT7B 3H8EA 3RO0A 1O3QA 2JA7J 3SJFA 3QU6A 3HC7A 2GE3A 3TE4A 1UVFA 1XTAA 2BVMA 3ISXA 3GB0A 5J47A 3FMQA 3VFZA 2K4BA 3W6KB 4ZZDA 3HKZN 4ZYHA 1Y8FA 4MHZA 2AFWA 3RI4A 4DOZA 3DWLE 1TURA 1R5HA 2M2EA 3VDPA 1T95A 2BXYA 2E34A 2EO8A 4U88A 2JEWA 4PGHA 3WTTC 4RMNA 4A3JJ 3KP2A 3C1DA 4ZYGA 1YJWI 4NGTA 4QLCU 1CF7A 1EE3P 1Z8XA 2Z3KA 5E3LA 3K6GA 3F8MA 1AWCA 2K3PA 1HQCA 2R7OA 3E5QA 4AU7A 2KIQA 2W00A 1WFXA 1YG2A 2KT0A 3WGGA 1JKOC 4ITVA 3SEKC 1BAVA 3S9MA 3GZNB 2PJ8A 1EF4A 1HDLA 1XMXA 3O6BB 3CCVI 3GTJJ 2R5ZB 2HUZA 3FNCA 1JQGA 3L09A 3DQVC 3T8WA 1DPUA 4F55A 2X48A 2AQFA 3PL8A 1TT0A 5CKTA 5C4JJ 2PRBA 2YX7A 2IT0A 1B4AA 3KLOA 2Z33A 2COMA 3IV5A 4IAVA 4DYOA 2OZ6A 5HH1A 4FCYA 1U9NA 4DJLA 3OYCA 1ZAOA 2XKOA 1S7EA 2XDVA 4RB2C 3A1YA 4FX0A 3OYLA 5HS9A 4XOPA 1OCCH 2Y0SN 5FLVA 3FM5A 3M7GA 3KZYA 3HHGA 1KYZA 5K1YA 1R0RI 2CQNA 4KVOE 3I58A 5EJCA 2QQCA 1ZGJA 3M3YJ 2Z3MA 5HLHA 5JHFA 1G3SA 3E3VA 5FD6A 3JRIA 3EUAA 2YUSA 1A04A 3HPGA 5FKLA 2ZC2A 4L0YB 5ISVA 2PR8A 2EFPA 3KP4A 3RYOA 4H6ZA 6PAXA 4KT5C 3GOXA 5AONA 5TGTA 1LE8A 2PC1A 3TJQA 3BTCA 5IP7J 3UEYA 1YFHA 1PUFA 2PIZA 4LGWA 4EATA 3BZCA 2XAJA 3MVPA 4UXNA 1FAQA 4B1RA 9WGAA 2CQXA 1OLTA 3F0AA 4UUSA 2ECBA 2OJED 2OA4A 1GXQA 1IXCA 4M6XA 3DBLB 3K69A 1HC8A 2DIPA 1YW4A 2PVVA 3VWBA 1AA7A 2CG4A 2Z3YA 3H8GA 3WGHA 3JCUC 1M44A 5HVQC 3O8HA 1N13A 2E1NA 1MMNA 1X3UA 1CBXA 1YGHA 2OV7A 4BQOA 2G9DA 1Z21A 1X4OA 4YG2F 2FQ3A 2J9RA 2JK3A 1Z3YA 1WJAA 2DA6A 4HEA2 1YRNA 2DMQA 2Q04A 4O5VA 2X9DA 1YJ9I 3PNVA 3CQZJ 2XPUA 1IY7A 1XEBA 2CS3A 4PV6A 2MYSA 1VDDA 5EC4A 5J1RA 2FT0A 1TWCJ 2E5NA 1RESA 1VQ4I 2B3VA 4Y49B 2NVXJ 4C2ZA 2R7DA 2R5YB 2QECA 3FXTA 3OSGA 3K4NA 1YSJA 1LFBA 2GOMA 1Z9CA 1QSTA 4ZBGA 4BD9A 3J81Z 2ZEEA 1T56A 1JE8A 3IC1A 3GFMA 4NJQA 1Y9KA 2BGCA 1X1CA 2QEXI 3A02A 1QU3A 3JVNA 5FKOA 4P44A 2IRFG 3PUFA 4NGQA 1XG1A 4CXFA 4HA8A 1XGSA 1IV8A 1O3SA 3V7ZA 2B63J 2LF7A 3A0BC 3ERED 3WU1B 1MBJA 1NG7A 1N25A 2WPWA 3FEEA 1LANA 2A05A 3ML6A 4DYCA 3KEOA 1OCPA 2R5YA 1KU3A 4CDGA 4PJLA 2LK2A 3OV8A 4L89A 2F5CA 1DDNA 4B5OA 1E2XA 1UG0A 4I6ZA 5C3EJ 1IGBA 2FMYA 5HS7A 4LG0A 5KAIC 1FOKA 2A68F 1WGTA 3H9QA 4ESFA 2Q43A 2NS7A 3HOZJ 5IPAA 2NNYA 3DF8A 2DPDA 1NK2P 1HKTA 1NXUA 2XEFA 1VQNI 2K9NA 5H84A 3RZDJ 2VJ4A 4AXVA 4L5IA 3FXKA 1HW2A 4C7IA 4F3QA 5B5EC 4U0VA 2Z1DA 2RKHA 2E1MB 3BJIA 4A6DA 1UZCA 1ZR4A 4NC7A 4GI3C 2R4GA 2TDXA 2JQ7A 4ZYAA 1S3ZA 1RRJA 3CZ6A 3ZPLA 2XEJA 5GAGJ 1Y8RB 3Q0VA 1JKRC 3MWMA 4G1PA 2NOGA 3DTIA 2AFSA 1Y8QB 5M5XJ 2KIUA 3TTHA 5E20A 4E7KA 5BPDA 3OIOA 2IGKA 1LFWA 1P92A 4CRYB 4RAGA 2OUMA 5M5YJ 2FUG2 2NU2I 5HLTA 5KNLA 3HOYJ 1F5TA 1T98A 1GVJA 1GHEA 1OFCX 4P10A 1ZRFA 4MFLA 1YW8A 2KMUA 4UVAA 4ESJA 3D4UA 1LDDA 3FWEA 3GUXA 2DOEA 1KU2A 4UV9A 2L7MP 2YNDA 1V5EA 3B4VC 1GDTA 1IRFA 4RB1A 3H0DA 1QSRA 4GFBA 5E8IA 4KZTA 4LJZF 4WWCA 5H6RA 4N9HA 4Q47A 5LBQA 5J1UA 3E6DA 5EMIA 4ZY2A 3K4JA 4I0AA 4KUBA 1K7TA 5LGNA 4PFPA 4KOVA 2WTEA 3ZRGA 3OYHA 3KP6A 5DM7F 1K6YA 4EJUA 5AGEA 3Q0WA 2XVCA 3D5LA 2JBKA 1BA5A 3E0KA 3DEUA 4RBOA 5E3RA 3TW7A 4UF4A 2ANPA 3HRUA 2CUEA 3FXLA 4E1RA 5F27A 5IB9A 3R60A 3GFIA 1VHSA 3PNYA 3FKJA 3JRFA 4M3SA 2VJJA 2WBMA 4NB5A 3CXQA 2WGCA 1R43A 2HYFA 4OLLA 2QF7A 3KHZA 4P5OA 4PSXA 1IG7A 4XRMA 4A0XA 2PJ0A 1FSHA 2A3SA 4CYCB 3GBGA 4JP0A 1C0WA 4KIGA 4ZYDA 4RLFA 3D68A 3K0LA 5D8LB 1UMQA 2ZEOA 1R4MB 4OIPF 3BI1A 4R87A 3GFJA 4IXAA 3CO7C 2AJ6A 2JT1A 4AWXB 1K7UA 2M7AA 2Q2EA 3HPHA 1Z7KB 1TQMA 4E4HA 4MY0A 4R8HA 2VJ5A 4EM2A 3ABMH 3P7NA 5IX3A 3I53A 2CNSA 1XPXA 1USSA 4IHSA 1HDPA 3N05A 1I39A 3IRQA 2ORWA 1PCAA 1U6MA 1POGA 4CYCA 3K4BA 5F1RA 3WU2C 3T5XA 3I5UA 2AQEA 5H6QA 2QQAA 2V1UA 1KU9A 4G8XA 3TP0A 2O5RA 4BE1A 2Z9OA 1FYBA 4JXRA 3HRMA 2P5LC 4N4NB 1K61A 3IJ3A 2QBYB 2QKLB 3QPLA 2YS9A 5CVJA 1KWMA 4MMOA 1ON1A 2CSOA 2NOJB 2L9NA 5ICFA 3KYDB 4F6AA 2OF7A 3MN2A 4UUVA 2YU3A 1DS2I 4LLLA 4CAVA 2J8MA 4LB6B 4QTRA 4OMYA 3CLOA 3WTSC 3O2PE 1KZFA 1I1GA 3GYHX 4PGGA 2HTSA 5GCNA 1WPKA 1S7OA 2VPRA 2KMQA 3CC7I 3ZMZA 2ZW6A 2FU4A 3HKZA 2LREA 1BPMA 3H0GJ 1P9ZA 4EEFG 2EH3A 2QBYA 5J1QA 1VQLI 1FSEA 3B3TA 3W3CA 4HDUA 2QKMB 1QPIA 2NU1I 2FMLA 2PMHA 3LMMA 1PYTB 4NGMA 2L3DA 3RKQA 1BW6A 2BW3A 2M45A 1IUFA 3LQRA 1S5KA 2Q44A 2VB6A 4HYEA 1SD6A 3R1KA 5TRDA 4E70A 1VQ9I 5KTDA 2C6YA 4FD5A 2NVYJ 5DTDA 3S32A 2DB6A 4PXCA 2M0CA 4J00A 4NGSA 3S9LA 5ED4A 2FNAA 2PQ8A 5CCLA 2CUZA 4HSTA 1LAPA 1WSUA 4I76A 2L8EA 4W97A 2O3FA 1MK4A 1KUXA 3ASNH 1PVEA 3CC4I 4EWTA 3BOQA 3FXOA 1W0UA 2PG4A 3R61A 2EZHA 3HOVJ 2WAEA 5EZGA 3ZQHA 3PZJA 2IJZA 4B09A 1B72B 2HKOA 3RKXA 2CO5A 2RDPA 1N77A 2E60A 2Y9ZA 1APLC 2B58A 3B3VA 2LRDA 3I55I 2XB0X 5FUXA 3GCMA 4BNCA 3LAJA 4X2TA 2ZEHA 2LKPA 5CVIA 1O7LA 4P4EA 3MEKA 4TV7A 4RM2A 3ZXSA 2XPVA 4MHNA 1BL0A 4MFPA 1OYVI 4RGXA 4L8AA 5JGFA 1A35A 4ZZLA 3FDYA 2FBHA 1B6BA 1BR4A 3S6KA 2E7XA 3D0SA 3EUHC 4MFEA 1MH3A 1B72A 2YU9J 3OL0A 5DDGA 1H9GA 1VQ7I 5ICEA 5IYBJ 3NA6A 4KSAA 4WJBA 1RO5A 2KISA 3SZPA 1YLOA 1XX5A 2QM3A 3BT9A 3HEFA 4D7MA 4NXYA 4M6GA 5GTHC 4A3BJ 1DU6A 3BG3A 5F47A 5L3DA 2DU9A 3KEYA 1FLIA 1BMOA 1LR9A 3ZMUA 2L5QA 2ERWA 3VATA 1ZRCA 2FSRA 3LACA 5JFRA 2LOOA 4HF2A 4FX4A 2QQ9A 4B3XA 4HV5A 5DV5A 5EX3A 1EH6A 2KFDA 1Z77A 3LA7A 2QQEA 4KOUA 3IWWA 3FIXA 1XIXA 3IU2A 3H1CA 4AMLA 3M07A 3RCOA 2O4HA 2V9KA 1VIXA 4BKXA 2W1OA 1ORKA 1XMAA 3ZN0A 3FECA 3RPQA 4I0BA 2XB5A 3KP7A 1QPMA 5CVRA 3U21A 4ESBA 4XOTA 3BQZA 2RFHA 4YIRX 1SFOJ 4I49A 2KMPA 1MH4A 3CCLI 3S3NA 2HI3A 2WUUA 4U9ZA 4I2OA 2OTJI 1WQ2A 3FXMA 1R71A 1KBEA 1YS7A 3K70D 1VQMI 3B35A 5FRMA 3SQNA 2BCOA 1HDUA 4KMFA 4PJ0C 1R1UA 4C3JJ 5FFZA 3OYAA 3W2WA 1ZYRF 4YEJA 1F2OA 3HOWJ 1ERDA 2EV5A 3VYTB 3I71A 1R57A 3WABA 2JZYA 4C68A 4PPZA 2F48A 1YHQI 2DTRA 2JEVA 2R7VA 5DS0A 4BE2A 3SI2A 4A33A 4CCKA 1W5CC 4GO1A 2X6WA 1P9QC 3KCCA 1TT5B 2WC2A 5D5WB 4MHPA 4CO8A 3DCFA 1S7KA 3DKWA 4XKVA 4R1HA 2H94A 5GAEJ 4B4CA 1M1DA 3IWZA 4HRIA 4F0YA 1R22A 2OTLI 2L7XA 4DZJA 4KJZA 2DFHA 2LP0A 5K5QA 1OVOA 2ZXVA 4MI4A 2CW8A 1CM0A 2BZTA 1ONVA 2JXDA 2EIKH 2Q0YA 1ETKA 5K7FA 3PRTA 2PN6A 2N17A 2YGWA 4E6KG 3OMYA 2BVLA 3FEDA 2Z3NA 3D7FA 3J80K 1YS6A 1OJLA 1KUVA 3HIFA 2AFMA 1WJ5A 1J7KA 4E7HA 1STZA 1JUSA 3RJPA 2CNTA 2EFNA 1WGCA 1Q1VA 2HOSA 2VOPA 1E17A 4AG7A 2LFBA 5JLXA 2AFUA 4D0PA 1OCRH 3FX3A 2HU9A 2PJ2A 3FF3A 3KQZA 2B5GA 2WAQN 3ECOA 3NFZA 5K8PA 1SD5A 2CTBA 2MH2A 4Q48A 3FH4A 2VI6A 4JK1X 4DW6A 4PUSA 2IPQX 5F46A 1JWQA 3Q9SA 3KGQA 2GXBA 2A5WA 1S9HA 5TJJA 3CXLA 4PK3A 2VL1A 4E2AA 3A2KA 3D1NI 4JJXA 3ZQFA 3CCEI 1XF8A 5FLXK 4ABZA 3FMSA 3OYNA 2B9SA 4BEHB 2DK8A 2HVQA 2IA0A 2HFHA 2NNNA 3C2GA 3UEJA 3FRMA 1YTYA 3OYMA 4RA2A 3LSJA 3SI1A 4V2GA 3R5CA 4B3AA 1UFMA 4BGDA 2GXAA 1WJBA 2BEOA 3FBUA 3TBIA 2X3TA 1TWFJ 4HQMA 2M0MA 3GTLJ 3EC4A 4R8FA 3I59B 5D8KB 2Z2SB 2WVJA 3NH8A 1U9OA 2RNJA 1QGPA 5FGMA 1QVTA 2L0KA 5EG0A 2DJNA 3LWFA 4FTHA 3L2RA 1X74A 1P2FA 1OKRA 1BUSA 1OMIA 4XPLA 3WU0A 2IQ6A 5BOXA 3CJRB 4E7ZA 3LAPA 4AIKA 2SGFI 3TP3A 3FK7A 2J8RA 1VFCA 4X3RA 3DKXA 2V9VA 2M9HA 4DQ2A 3W6JB 5FUVA 1KMAA 3PIOF 1W7PD 2F5EA 5LEKA 2VJIA 3FISA 1G2HA 1ZK8A 4ZTFA 1V1IA 1IN4A 1IW7F 4UXHA 1HOMA 1QZZA 1R9TJ 2AFOA 4UUTA 3I59A 2ME0A 3SDGA 2Q51A 3WT4A 2E5RA 2XRNA 2EZLA 2ZJRF 1P4NA 4JZ0A 2E2JJ 4R3LA 1A5JA 3ZMDA 5H2FC 3FSYA 1YJNI 4HLXA 5KK1A 3MN8A 4EVIA 1QHGA 3G1LA 4YFNF 2JJ7A 2DFIA 1V1HA 2JA5J 2ZCWA 2NU0I 4XPKA 1OR7A 5FVJA 3U2RA 2GOXB 3G1MA 1XDUA 3HJEA 1AU7A 1F36A 1XBUA 5I0CA 1VZ0A 2ROWA 3MMYB 1DPRA 3B3WA 2VKVA 1MZBA 3QYEA 2FBIA 1FT7A 4X0GA 3W6SA 1EH7A 3E97A 1MJBA 2EILH 3Q3SA 1LFUP 1WZ2A 4CICA 2KCWA 4B48A 1X3ZB 5CCMA 2X52A 3HYIA 2GREA 4BXUA 1GHCA 2X7BA 4HX4A 4AIJA 4CCOA 4YWYA 2OC6A 3PQJA 4P4IA 1XSDA 5IOZA 1OPCA 2VLAA 4S04A 2L7ZA 2VUMJ 3BLYA 3VPRA 1Y1CA 4UBRA 2F4MB 2Q1ZB 2VASA 3MKWB 2E1CA 2LUYA 3D00A 4NJRA 1FNOA 4XNHB 3SJXA 3BTJA 4TNUA 3A0HC 2CFOA 1BJZA 2EPFA 5AG7A 2DK5A 2QQ0A 2D45A 4F9VA 4FD6A 3VWEA 4AD9A 4LITA 1QNTA 2XEGA 2DYRH 1XCBA 2DA5A 2A61A 1BOAA 4HX8A 2JRMA 3BROA 3KY9A 3CUQC 4NQWB 3CCMI 2PE3A 4OADA 2H8WA 4B47A 5LRJA 2NVUB 2JVHA 4C2TA 4JCVE 3NWSA 4BE0A 2FSWA 2VEZA 1FZPB 4P9FA 1FX7A 1XDSA 3I64A 1D1BA 1YX5A 2HOEA 3C2HA 2ZSIB 1T2KA 1SGEI 2IVMA 5B3SH 1DS3I 3GUDA 2QQDA 4PZJA 1VQOI 4V2FA 4B44A 2P7CB 3SGQI 2PVWA 3TDUC 2RNGA 2X1EA 4LIVA 2IA1A 2DQLA 3F8NA 3LA3A 2H1KA 2DOAA 1TBOA 3SGBI 2EK8A 2QMLA 3RNZA 2QSHX 3S9NA 2JSPA 4AUXA 2Z0ZA 1W1WE 1NMTA 4KLWA 1OCTC 1MMGA 1RTQA 2C6CA 5CPAA 2IW5A 2L9RA 2V79A 5FFXA 2HDWA 2VL8A 2JYYA 1WJDA 4XRFA 2LDUA 4Y3OA 1OMUA 2LH9A 1PJRA 1Y56A 2IEKA 4DUKA 2VQGA 2V4JC 4BJ5C 3GEZA 3MFKA 2M3AA 3HBLA 2VBWA 2ODFA 5LYLA 3IFEA 3TFYA 1G3YA 4CZZA 2B0UC 3RU0A 3R96A 2R7QA 2E36A 2OU2A 4S0HB 3CD6I 1U2WA 1WHUA 2CTCA 4IHTA 4C9YA 1TWAJ 2R7RA 1W7PB 3SHFA 3TEDA 5C4XJ 3KL9A 2LNBA 4D1QA 2QZ8A 3TDZC 3WTWC 3J7ZI 1XE4A 2PJCA 3OS0A 1W0TA 1H0ZA 4PFOA 3UKGA 1IRZA 4A3EJ 3FXRA 1QA6A 3FYNA 4KS9A 4MFKA 3H9GA 2OR4A 2BSWA 2ID3A 3BR2A 3OY9A 1B6AA 2ZJPF 1Y39A 3M1CA 4KOYA 3HSEA 1SAXA 2LB7A 3DEEA 2DMUA 4D5FA 2A5YB 1VHEA 3E6CC 2MLGA 2P5KA 1T6SA 5HXDA 2CWGA 1HDDC 2BHZA 4EM1A 4MEXF 4KIFA 1I3AA 3IUOA 1W7PA 3DTEA 3RKWA 5LHHA 2FIWA 2AE6A 1QSMA 2VKHA 3D5SC 1W5TA 4G7ZF 2DFFA 1Y7RA 2C6GA 1YOVB 3FM3A 4I7HA 5DEQA 1IOIA 1XRYA 1AKHB 1CF7B 3FMRA 5JLWA 2W57A 4QVTA 3ELKA 1RUOA 1X3WB 4IRIA 1CT4I 2ZNYA 2HZDA 4JBAA 1EKEA 1CGII 5JQ4A 2GQQA 1HKSA 1ZGWA 2UXNA 1HF0A 2EK9A 2V1CC 1LQ1A 1BW5A 2VQCA 2P5VA 3PFYA 1X2MA 4BHCA 1XGNA 4MQVA 2KIMA 2I00A 1XC5A 3V7SA 2CIJA 4P4JA 4UFVA 2Z3PA 3LSMA 3GVAA 1AKHA 2B3UA 2HYGD 4XNFA 3CCJI 1B59A 2ZJQF 1W36C 3KQXA 3MQ0A 3UOEA 4KSIA 5J1YA 2G0EA 4IOAF 3PSIA 1FIPA 2XRCA 1ZN2A 2HOTA 4NHJA 2V26A 1LR8A 1J09A 2VPLA 5J3LA 1P4XA 1Q9BA 4EJVA 3ABLH 4BUPA 1S7AA 2XC7A 4KNYA 1ZO0A 4A39A 3FXUA 2FRHA 4X8IA 3E59A 1D8JA 2CWFA 4UEZA 2Z11A 1XOVA 2E19A 1OQYA 2N8GA 4GYIA 3FKIJ 3GTGJ 2VBQA 3G3SA 1GV5A 2NSMA 3PFOA 2C6PA 4ENMA 2Q8KA 2G0BA 4JYKA 4U5YA 3B8GA 5JHUA 2K9LA 3U1KA 3ZZIA 1MW7A 4II3A 1D3YA 3F6OA 3RQ4A 1W5SA 3T9YA 3S93A 2FOWA 2KMOA 1PYVA 4EQQA 4BDYA 1DP3A 4AVAA 2DYSH 1MD0A 4RGRA 4LQGA 5CNPA 1PUFB 2QYOA 3V38A 1IDYA 3ABUA 3OL4A 5CBMA 4OMZA 4IF5A 4FBEA 2UVOA 4UUSB 2NAZA 2REEA 4M71A 4W9YA 4RS8A 1K78A 4KOSA 1WVRA 5A2QK 3CJNA 1U3EM 2D4OA 3S3MA 1LVAA 5JPHA 2V53A 2GAUA 3HZJA 1D0YA 4KDPA 1XA6A 4FUUA 1JHFA 2F4IA 3CMYA 2BY3A 4UIBA 1TZLA 5GAHJ 3D67A 5EDNA 1YRNB 1SD4A 2OOTA 5BPIA 1NSLA 1G8XA 2YSRA 2BUSA 2CRGA 1KGSA 2V1XA 2OZGA 3S1MJ 2DOFA 1X2NA 4B11A 1OBRA 2YNCC 3DEWA 1X1AA 3L2WA 2EINH 3C2BA 3I4NJ 4KORA 4A69C 5KVRA 1G6NA 4I09A 2PBIA 1YX0A 5M5WJ 3IAS2 4A3CJ 4M85A 1T33A 1DU0A 1T0FC 4DNCA 3LD2A 2O7OA 2XROA 2YPRA 2R98A 1FWZA 3QU3A 1S8NA 1IY6A 2WAQA 4NCZA 2HV2A 2XIGA 2ZOGA 1EV7A 1P7IA 3I9SA 2XPWA 5LGTA 3HTSB 4F8ZA 2EBIA 1TF8A 5I4MA 2ZMEB 2PJ6A 2I5UA 3IL2A 3LFKA 4IO9F 4CGZA 1JTXA 4IX7A 1TKHA 3CZXA 1FPQA 4M9XA 2QA4I 2E7WA 3OSFA 2M8GX 3WR7A 4J01A 4EFDA 5C44J 2R92J 1FIAA 5G21A 3FHNA 1ULKA 2KJCA 5DS9A 3KR5A 4LG0B 2RREA 2KIFA 5LRRA 5E3OA 2LLKA 5F49A 3GTOJ 4CAXA 3R6SA 4HNTA 1YREA 4M9SA 3MZYA 2BL1A 4EJOA 2ZMEA 1O4XA 2KPMA 3KI9A 1Z9UA 4AB7A 2BY1A 2MLKA 4L5EA 2E1OA 1TW2A 3B3SA 2PX9A 2HDDA 3PB6X 1WKXA 1J9IA 3BG6A 4LOCA 4Y13A 4U7BA 2R93J 2OB0A 2FCKA 5D29A 3R9GA 4F0XA 4XLEA 3B73A 2V8HA 2VT3A 4IHVA 3SJGA 2NYXA 4MGRA 4Y49C 1SQHA 3WODF 3FJUA 2WAFA 1L0OC 2Y0MA 1XMKA 2VKEA 2BOAA 2AXLA 2R7TA 2NMTA 2JA8J 2HEOA 4LUAA 1R23A 4XK4A 4BACA 3K1NA 4CGMA 1WJFA 3BCAA 3OYGA 2IS2A 1WTJA 5AG6A 1VQ5I 3GY9A 5DD8A 8CPAA 4OU0A 2DPTA 3ZGKA 2BYVE 4Y15A 4XM3A 3L2CA 2KDOA 4K3NA 1A6IA 2F6CA 4W1UA 3GXOA 3HG9A 3CJQB 3K4MA 2JSCA 1MJ9A 3TO7A 4FKDA 2JVGA 2Z99A 3SEQA 3SJMA 1S72I 3OOUA 1EJ9A 4NSQA 2NYQA 4OAEA 2HZTA 1PTQA 3VSLA 3T90A 3TCVA 1CT0I 4XLFA 1LCPA 5FLMJ 3PIPF 1QQ9A 1LPQA 2EJRA 4A3KJ 1HA8A 3HOTA 3OXGA 5EYRA 5D4SA 4AG9A 1IN7A 1R3NA 3K7AJ 2X0LA 4EMSA 1FBUA 5HODA 3IKTA 2E1MC 3K4CA 2IA2A 3WHCA 5L3FA 3M8EA 3HUGA 2EIJH 4A37A 1SC7A 1YW9A 3O8GA 4WWVA 5D4RA 4GRIA 5G22A 1HSJA 3SFIA 4XICA 3L9FA 3OYFA 1XJOA 1P7JA 5ERIA 5FRNA 3FSXA 1D1CA 5C82A 2NRAC 3SXOA 3QRFF 2FQ4A 3AFHA 1BIBA 2EFOA 1VQPI 4XORA 2P4WA 4A5MA 1SFXA 1X58A 3L2NA 1X1DA 4V19K 3AL0B 3KZZA 1JXSA 4E1PA 2XAHA 3RDIA 4P1WA 3DGVA 2LY9A 3H3ZA 5E79C 3HUVA 5GADJ 3G1OA 1ELLP 4CAWA 2MSYA 4KUMA 1FBSA 2CJSC 2ZW4A 3P9IA 2DTZA 2Q2EB 2AS5F 1D8KA 2ISZA 1MNEA 1TIQA 3IU1A 3VDUA 2CMPA 1FYLA 1XX6A 4U0YA 4ANJA 4M73A 4MBUA 2QVOA 1BI2A 4PXBA 4B14A 2K40A 4I98B 4OC1A 2Q7BA 3T1BA 3HB9A 4A3DJ 2G9WA 5EGOB 2KMRA 1M4LA 2P6GA 3RQIA 3A03A 4LG3A 2L9SA 3K9TA 2DAOA 4RUHA 4C7HA 2A07F 2V8GA 5TISC 4MHGA 2C1CA 3CO6C 2ZJ2A 4BU2A 2N71A 3IRRA 1U78A 4UCPA 4S05A 5LRGA 1TNSA 4RAFA 5BQTA 2WSAA 2ESNA 3AAFA 3R9EA 2PLYA 1M8CA 1W4MA 5HNFA 3QAHA 3WGIA 2Q7SA 3LSIA 4PK2A 4JLYA 2YNEA 2ME6A 2AFXA 5EGOA 2OD1A 3UR3C 3BHXA 2I10A 1XS9A 3T0YA 1IRXA 1ZH5A 4UFXA 1IO2A 3WTZA 4ONUA 5E3QA 2KZGA 4PJMA 3CCQI 3SYTA 4BHPA 3JRBA 3H5RA 1V0CA 3IEHA 3P2HA 4JXQA 1YVOA 3PNTA 3VYSB 3GTPJ 3Q5FA 1ZQ3P 1UB9A 1XD7A 1E3PA 3N97A 1YTPA 4XPDB 1SVMA 1OMTA 2BW3B 4CH7A 1JT0A 2DA4A 2JUCA 5JHWC 1NH3A 3J7AO 3WE3A 4L9NA 1IW4A 1IIDA 3WTUC 1FYKA 1H0MA 2VODA 4A3MJ 2P6FA 3EYIA 4A6EA 1A36A 1P0HA 2FE7A 4Y33A 4FE4A 1Q2CA 3UY5A 4OMEA 1R5ID 1RETA 1UHSA 4UCMA 1RPWA 4R3KA 1UAAA 3H35A 4KA4A 2JLMA 2CV0A 1Z4EA 4I99C 3GTKJ 2W24A 4ZC3A 1B1BA 2XRLA 3RTRA 1L3LA 4UY8I 3D7DA 1L0CA 3CMAI 1JI8A 2XEIA 5K8OA 3I54A 3VB2A 4XN0A 5FUWA 4FE7A 1K4SA 3S2HJ 1IRGA 3GZ6A 4M6VA 3BR0A 2M4KA 2HS5A 2J9AA 4OOIA 3REOA 2COBA 4QPQA 3S6FA 5FD5A 1IGNA 3SHPA 5EEAA 1V5GA 2IBDA 3QPHA 1KQ0A 1YU6C 2ZW5A 3PB9X 1XSXA 3DLJA 1NUBA 2LF8A 3FF5A 4UV8A 5IT9Z 4HNXB 2FBKA 1O57A 4Z2YA 5E3NA 2DKVA 2KZVA 4ZTJA 1KQ9A 1QZYA 3ECHA 3CXPA 3PFEA 2LG4A 1IV6A 2PRQA 3ZMSA 3KLNA 2SGPI 4E7JA 1M8BA 3B2YA 1P6RA 1MT1A 1J2XA 1J59A 2MD0A 1ZLHA 4HZFA 2JPBA 2D1VA 4YGOA 4H2KA 4BJTA 3ABTA 1SGYI 1CP6A 2YUUA 2VRWB 1ITYA 3CP8A 1I12A 1K4TA 3TT2A 3G73A 1U5KA 1ZARA 4HOBA 4P6YA 2F2EA 4PXEA 3JRCA 2CWHA 4IHWA 1Z7LA 1TUSA 4BH9A 2HXIA 3V4GA 2DI3A 2TRTA 1U5TB 3RYPA 1B87A 4WK8F 2ZELA 4LMYA 4U0WA 1SGNI 3VWDA 2JRTA 3A01A 4A31A 5K8MA 4A93J 2Y2ZA 3RZAA 2UUZA 5IOYA 1RC9A 2PJRB 4L9TA 2Q4VA 4KOXA 2L7FP 3EPZA 2LTPA 5CJ9A 1JJ8C 2Y75A 4BMHA 1IN8A 3CPXA 1S7FA 2WPXA 1A6QA 3LSTA 2EWNA 3F72A 1TNTA 1UWYA 2CY2A 2PCUA 4FWUA 2Y69H 4AVBA 4DYQA 1YMEA 1YQAA 3S6GA 1XBTA 5L3CA 2FJ1A 5LFAA 1PTRA 4XR6A 4RDUA 5DAEA 3HHHA 4OAZA 2GKRI 3DLAA 3FBNB 5E1XA 2O53A 1JTYA 4U87A 1U5TA 4WX9A 2V77A 1MDMA 4BXFA 1KBFA 1X12A 2A6HF 3JTHA 4MQ9F 2XGDA 3V8LA 3LSRA 2PJRA 4ZI6A 1QRYA 2ADUA 1Y0NA 5B1AH 1WI9A 4XRSG 5E3MA 5BNGA 1FNNA 4M3BA 4U7DA 4KFCA 5FROA 1QSNA 2B4BA 4CGNA 4UVBA 5FKKA 2W0TA 1X1PA 4QUSA 1T38A 2DW4A 4IOCF 3U9GA 3X2QH 3KETA 1MSEC 2R1IA 3IHUA 3KP5A 3OWTA 3L7WA 3WTYC 2PJPA 1ETOA 3SFZA 3D5RC 2W7NA 2VN2A 2ZPAA 2O61A 4R57A 1G3TA 2QUFA 3K4KA 3CC2I 1QMUA 4KOTA 3S3OA 3MKYB 3I9V2 1SFEA 1LRZA 4MTDA 4CAFA 2V1NA 1W3SA 1SMYF 3ZMTA 3IKVA 2FL4A 4HQEA 2DA2A 3P5JA 2ZEPA 3W91A 4E7IA 3O3KA 3L2QA 3LMSA 2DFEA 3IH2A 2M30A 4BINA 4FQGA 1WWZA 3GIUA 1NK3P 4UWJA 1LDJA 2X6YA 3HSRA 4KLVA 4MHDA 2ENZA 4C30A 1ZRDA 5A28A 3Q0UA 2E71A 2DMTA 2DEAA 1ZTRA 3PQKA 3SXYA 1FYMA 4CS0B 3CPAA 1LB2A 3LSGA 1UELB 4Q38A 4ORFA 1LJ9A 1OYYA 2P8TA 1K6OA 2B5GB 4H4KC 2O28A 2NU4I 2HGCA 4BHBA 2F5FA 5KHDA 3S16J 3I4PA 1XSVA 2K85A 3CCYA 3K1PA 4P4BA 3E0JB 5L3EA 1T39A 1IF1A 2ARHA 2EV6A 4P9UA 2LEOA 1FBQA 3JAMZ 5E18F 4RB3C 3OXFA 4ZJZA 4X5KA 2E2IJ 4OC3A 4HNYB 1TKFA 4JX4A 1AOYA 2KL4A 2F5VA 3J81K 3TMOA 3K1MA 1BOBA 4IRGA 3RBUA 3R5DA 1MBFA 3GMEA 1ZG5A 3KR4A 3LQQA 3FXQA 3IO1A 1MJAA 2PEXA 2HQ5A 2PMZN 5D5UB 5JVGF 5K8NA 5J6XA 4NGPA 1MGTA 3FC3A 3B6AA 2GLOA 1ZKGA 1M4GA 3D2PA 1WJCA 4MXUA 2VC0A 2VXZA 2X1DA 1Q2YA 3IH3A 4FETA 3BTLA 5EG0B 1ETYA 1MBKA 2M8EA 2Z5UA 4MTEA 3UGIA 4DBRA 3OVOA 2JW6A 4M6IA 4OC5A 4BBSJ 1ACIA 2V8DA 2G7UA 1H89C 3QYBA 1IU8A 2PJ5A 1LOKA 2JPCA 1ZGAA 1HJAI 2PSWA 3D7GA 3ABKH 1KA8A 4GXOA 4ZYEA 1IYLA 1NHAA 1CPXA 1S7NA 1BPNA 4R9MA 2LVSA 2HQRA 2ZNZA 1PJUA 1SGPI 3H3UA 4Y4RA 1Q1HA 2DDBA 2Y31A 1CSOI 4F93B 4BAYA 1X10A 4RB0A 2STWA 1PU9A 4IHMA 3DR8A 2DLLA 4AIDA 3ZQ7A 3BWGA 5CQEA 3TQNA 5J4YA 2ZXIA 2HR3A 2UZKA 4G12A 4Q7AA 3K2AA 4KN7X 4Y17A 2KJBA 3KZIC 1CHOI 5M3FJ 1SD7A 3QB8A 2MABA 2H6CA 1TBXA 3W2VA 3H8FA 1ON0A 1ARLA 5GTIC 1NG6A 1CP7A 2CWEA 2FXAA 2H6BA 5ILVA 3UFFA 4AIHA 5LRSA 3HDDA 1Y1WJ 1ZLIA 4UCNA 3EETA 1BR2A 2W48A 2CYYA 1ON2A 2XUBA 1LNWA 3SZTA 1FEXA 3H9JA 4D9JA 1IZ1A 1PDNC 3S8PA 1FOXA 4GS4A 2NS0A 4CRZB 2STTA 5JH9A 3M9AA 1MSFC 1Z7UA 3QP6A 2X85A 2GIZA 1D5YA 5HOOA 2AXTC 3EY5A 3HGGA 1UUCA 3PO3J 3NH4A 1JUPA 1ZHFA 3JRHA 4XLHA 2DF5A 4HKFA 5E96A 1TGSI 3ROUA 4QBJA 4OVOA 2BXZA 3PDNA 4ZYQA 4E8OA 5IB0A 2Z3LA 3EXNA 4IKFA 2XGEA 5F08A 3ULQB 2OBPA 4BYYA 4KISA 2WYRA 2CW7A 1BN5A 2WA0A 2F4OB 3OWCA 2EUIA 5KTAA 5J8CA 2SGQI 1TKJA 2IP2A 2B4DA 1LDKB 4PDKA 2ARPF 2MW8A 4OIQF 4R6TA 3JSOA 3ZJ0A 2PFBA 1F43A 1Z4RA 2DA1A 2LY1A 2GA1A 2IXSA 4WXCA 4HLYA 1W36D 2IS4A 5HQ8A 2JBJA 2V1DA 2Y9YA 1RUNA 4XKBA 4C2XA 4HPQA 4OC0A 4WF2A 1YR0A 1Z8LA 1XN7A 2GVIA 2R3SA 4A0YA 4L0ZB 2QLZA 3I3GA 3J7YJ 2WCYA 3GLJA 4MCSA 1TIHA 1BO4A 2OCCH 1Y9WA 1VQ8I 4HNWB 1Y0YA 2CXAA 1ENHA 2JA2A 2CQ7A 4UNOA 2FOKA 4O6JA 1OYWA 2PMUA 2RB7A 1GVDA 1Z2IA 2XAGA 2CF4A 3TC8A 1M4IA 4MEYF 5K7ZA 3COAC 4J3GA 2EFWA 3G2BA 4KITB 4CUGA 1SVOA 1TQIA 2F5DA 5GPAA 2GWRA 1Y6IA 4BQAA 2OQRA 1UHWA 2W25A 4RAYA 4C2UA 4KYWA 3CUQA 2UZ3A 1HDQA 3QTLD 3JUWA 3V7CA 3R0AA 4MO7A 4JX5A 4XSXF 3HTUA 3QOEA 4XNHC 2HYJA 3S1NJ 2IMOA 4CYPA 5A27A 4CSWA 3EO4A 3FMCA 1BI3A 2EA2A 5FO5A 4ZX9A 4XIDA 3SI0A 4YFKF 4BL0B 3OXLA 3S1RJ 3KKWA 2EZIA 3A9LA 4EV0A 2OPTA 3BXMA 1V3FA 1GUUA 2JZMA 5DWNA 1QBJA 5AG4A 3V42A 2QVPA 3S2WA 3F8KA 3GWZA 4UB8C 1BI0A 4D5CA 2FS5A 2R7WA 4GDFA 4IPAA 5K7HA 1FP1D 4OC4A 2MGQA 3F21A 2O8XA 1ZLJA 3WC5A 1I50J 5B66C 3HRTA 4U9YA 4B5PA 2LKXA 2CQKA 2QENA 1VNDA 1TXRA 4CYQA 3GZ5A 4RLQA 2N1AB 1TBRR 3QPTA 3T8RA 3L2UA 1ZG1A 1CT2I 2Q4YA 3BP8A 4MLOA 2MC4A 4QIWN 2E73A 1Q2DA 3NE8A 4H0EA 3F5BA 2MA3A 2OCEA 3B02A 2E2HJ 4OIOF 4KIBA 4K2EA 1E0EA 1TOTA 4M6YA 4IZZA 3D2MA 3K2KA 3KZWA 3E5XA 2ZEGA 1BJAA 3UGLA 1S60A 4LK1F 2K4JA 2QYVA 2GA2A 1VI0A 3GF2A 3BZ6A 1U0JA 2WV1A 5LYDA 1R79A 4FHTA 4EM0B 2ENNA 3QYFA 3QNVA 3FHZA 1Q7LA 5LRKA 1HEEA 3LSHA 1ZR2A 2ZOFA 3H3VK 1CE3A 2VXDA 4ZGYB 1IN5A 2CJJA 2DODA 3EDPA 3ZQQA 2PR1A 3P9KA 5D8NA 1TBQR 1T8IA 1XMTA 3F3XA 1LR7A 2GANA 2V6EA 4ON0A 4FD7A 4HX7A 3ESWB 2B0LA 2XAQA 4MNUA 3C26A 2P0WA 4QSHA 3AG1H 5IP9J 1FOYA 4CCLA 4PJJA 3HRSA 5LEJA 3ZQLA 5DYMA 3PBEA 1R49A 2V8VA 1DUXC 4EMEA 5IT9K 1X1BA 5H20A 1TF9A 1MMDA 1TQPA 3DP7A 3BC8A 3VSKA 4BJ6C 2NVTJ 2V7FA 1Y7EA 2Z3OA 5CYVA 1UFHA 2V1CA 3PB4X 1VQKI 3OR2C 5F64A 2HVSA 4ONWA 2KP6A 2QPOA 1RKTA 5ILUA 4F52A 4LD5A 2RQPA 5CLSA 5DD4A 3H36A 4LX9A 1VQ6I 2R7SA 4P45A 3R0JA 2IGOA 3WG9A 2A6TA 4UHTA 3H92A 3GX4X 2H5MA 2K5TA 2A4NA 2LKSA 4HSRA 5AG5A 3OS1A 1K78B 2L54A 2OVOA 3F9KA 2QJ8A 1I3QJ 3JRDA 4JYWA 1KONA 1VF9A 2M4GA 5F1JA 2O03A 5JI6A 1K7VA 1D0ZA 1Z3XA 3IP4B 1SFKA 3HOSA 2GBYA 2XSJC 4NNJA 1HBXG 2FIAA 2DT5A 2YX4A 3ONQA 3JREA 4NGRA 1K7AA 2IAIA 3BI0A 1XMBA 2D1HA 5D6FA 4L9VA 3OYBA 1JHHA 1UJ8A 2H1LA 3HXLA 4QB9A 3EUKL 3D3SA 3OYIA 2P6AC 1P4AA 3QP5A 1MMSA 3H4QA 5E3PA 4YELA 2R7UA 2WWYA 4YFXF 4YIFA 4BY1J 3I3LA 2ECCA 2V6CA 3M8JA 4L9MA 2IL4A 1H88C 4YU9A 2KQRA 4RGSA 5E8GA 1LVKA 2XAFA 3FB3A 1D0XA 2YR2A 4LB5A 5F6FA 2VIXA 3E1SA 5GP9A 2BV6A 1LEAA 4P4DA 4NC6A 4GM5A 4M3FA 1IICA 1NSAA 1VKCA 2L01A 4RN7A 3QAYA 3W6VA 2R5ZA 5F04A 9ANTA 2FE3A 1XFOA 1X19A 4CCMA 3VODA 5FUYA 2Z10A 1IN6A 1B9MA 2RIJA 1RR8C 2XF6A 2CW0F 3BPXA 2D4PA 5HS8A 2WADA 2HQAA 2XAUA 2XV4S 3IWGA 2K02A 3MEXA 3DKYA 5DCMB 2POKA 4CGOA 3ISZA 4HF1A 1AYEA 1TLHB 6CPAA 4MY3A 4DIQA 2YNCA 1DTDA 4G7OF 1ETWA 2ZSHB 3FBIB 5FJ8J 2IS1A 2MH9A 2LYCA 4WXHA 1DGRM 2PMZA 3LFUA 1VHOA 4CYNA 5ICCA 1ODDA 2EV0A 2RN7A 4ZDPA 1GLNA 2DT6A 2W85A 4A3FJ 4NC8A 1J0RA 2CV2A 1T0FA 1WGXA 3RKYA 2EFQA 2LC2A 2ZBKA 4F7ZA 1IUYA 1CG2A 4NGNA 5GPCA 3VE5A 4M6HA 1AUGA 3OL3A 5DCMA 1QHHD 2GU2A 4GYGA 3VEPA 2HDCA 1PP7U 2QSGX 1I1DA 3RZOJ 1FARA 4IL6C 2BEIA 3PP9A 4XLCA 3ERMA 3MAJA 2FF4A 3ASOH 5AIPA 4HNUA 1S6LA 2HWVA 3J80Z 3KASA 3NEUA 4XLPF 2HB6A 5J40A 1U8RA 1NTCA 4AYBA 2QCOA 1HLVA 4Y52J 2FNFX 3GTQJ 1MBGA 4B13A 5D5VB 2L7KA 1ARMA 2VQYA 2ZEFA 4X6AJ 3DU6A 3N5FA 3JAMK 2ZB9A 4L5JA 3SJEA 2ZMEC 2DMPA 2ZXWH 3PSFA 4DZPA 2EBJA 2JN6A 4NEXA 4IHYA 3BJAA 1HKQA 3RAMA 3OIPA 3P9CA 2PJ1A 3DPLC 3PGPA 2MD5A 3MD2A 3OIQA 4XSZF 4B6ZA 4G6QA 2P6TA 1FMWA 4MCRA 2YQPA 4P4FA 3VH9A 3CP2A 2X6XA 2XF5A 4M3GA 1F4KA 1Z0XA 3TGNA 1F57A 5FLXZ 4UVCA 5H86A 2H09A 1D5VA 4OKOA 1Z8TA 2DPSA 3C7JA 3WTVC 1FT9A 4MFJA 2E35A 2ZXHA 3QQAA 4N4OB 2XSDC 5B1BH 1IY5A 1BC8C 2MBFA 3GTMJ 3FX6A 3CDLA 1WH7A 4GXHA 7CPAA 1UCRA 4A2ZA 4ENKA 2K9SA 1Y1VJ 4BBRJ 3PJRA 5JM6A 1ZELA 4KICA 3HUGB 3BG5A 1SGDI 1ETQA 2EWBA 1U8BA 4ZDOA 2CGPA 4XN3A 4EGYA 1S3JA 2MG4A 4KUAA 2F7VA 2Q4ZA 5K5RA 1T08B 3BLNA 5DWMA 4MRIA 3NARA 1A31A 3V8IA 4H89A 4R79A 2X51A 2JUGA 4CGLA 1HW5A 2L4MA 3NWTA 2ELIA 1M4DA 1J75A 1R00A 3KPHA 5LHGA 2A6EF 4PK4A 5DM6F 4XL9A 3VYRB 1CGJI 3UGDA 3IWFA 2R7FA 4R76A 3KIOA 4X1EA 4XRSA 2EQRA 2IGNA 3NAUA 4II2A 4IVNA 2JDCA 1ETVA 3S1QJ 1PPFI 3JSPA 3HSFA 5HLIA 4XBFA 3D7HA 3PB8X 1KQ8A 2DXQA 1WJEA 5L3BA 3BR3A 3QWLA 4IUSA 2X1CA 3HL2A 4AVZA 1K79A 2N52A 1LFPA 4EJTA 1AMPA 4KN4X 4F92B 4Q4ZF 1YW6A 5F09A 2PJBA 4IQJA 2BY2A 3PEIA 2ELJA 2M5WA 1BC7C 2X6OA 4WP4A 2AHQA 3S15J 4UEEA 5E1WA 2HNHA 2PJAA 3C3WA 2DN0A 3W6XA 1IXRC 3IGRA 5J8FA 2GLFA 1ZG3A 4LIUA 3RPUD 1I6HJ 2ZEDA 3H5AA 3KYCB 2PDOA 1R4NB 1XB4A 2BE5F 1YI2I 5IY5H 5DUKA 2R8VA 4CCNA 2HTJA 4I01A 1EA3A 3D8PA 3GLXA 2JWTA 3BZKA 1F2PA 4E0AA 3MKLA 4WXDA 4YRVA 4CPAA 3LOCA 1Y0UA 1I5ZA 2KCXA 5BMZA 1Y1BA 1V55H 2VE8A 3TO6A 2HOAA 2BHYA 2ZFUA 2RC4A 2OH1A 4A94A 2AO9A 4OWRB 2QIRA 1K83J 2J5OA 1GV2A 3FVLA 1RFHA 1R7JA 3V7RA 4QPOA 1Z67A 4HAMA 2FEZA 2G3AA 3AL0C 4A3LJ 5HDNA 2FXFA 3MRUA 4A38A 5BWAB 2EVNA 4CAEA 1IXSB 2CFXA 2D5VA 4B12A 1WKMA 2ICWG 3BDDA 2UV1A 3JW4A 1CQTA 5KAFC 2ZENA 3S6HA 4LK0F 2JA6J 4MPIA 2HPMA 4MFQA 2NS8A 3GW2A 3DR6A 2KRCA 1CJWA 2K7LA 1VGYA 4MJ8A 3LNQA 5F0HA 2OQGA 4NUBA 1Z6RA 3CCUI 3CT9A 3LODA 5EBVA 5LYIA 3MCZA 3W2AA 3E6BA 2ISYA 3JRAA 3KFWX 2VKDA 1H8AC 3CJTB 3EYYA 3IWEA 4QC6A 4RAZA 5DCFA 3HOUJ 3E6MA 4Z6YA 1TL8A 4G7HF 1LEBA 2C27A 3DBHB 4OIRF 3G8WA 3R5AA 1R58A 3CLQA 5CVUA 3ZQGA 4E7LA 4UXJA 4IK2A 3CF2A 4A30A 2H27A 2DJIA 3BJOA 1R5GA 3LSPA 1UHMA 1WH5A 3GKRA 1V5FA 3CDXA 4PXDA 1LKXA 3WTXC 4O23A 2M5XA 3DFGA 1IJWC 3LWUA 3DDDA 2J5PA 4M9ZA 1CGPA 1G4DA 1YYVA 2M1BA 3WC7A 3I0TA 5HVHA 4HF0A 2UXXA 2NVQJ 4N0BA 1TC3C 2H8RA 3S17J 2GFQA 4BY7J 1LE8B 2K5CA 2WB1A 3OYKA 3BG7A 3F23A 2DBBA 1BIAA 3G3ZA 4MHYA 4A5NA 4HW0A 4A32A 3AG3H 3TL4X 2KKOA 3TW6A 3B3CA 3R9FA 4XPDC 2FA5A 2Z16A 4LFUA 4FD4A 3V8KA 2A20A 4NF1A 2K9MA 4HV6A 2PJ7A 3S2DJ 2VQHA 2O6GE 2LD5A 2KDZA 1TBNA 3N4MA 4ZH4F 1ZG8A 3WG7H 2Y30A 4MCQA 4XKWA 1BI1A 4A12A 1O3RA 2V9PA 3QOPA 1FMVA 3E7LA 4JX6A 3FIWA 3LA2A 3R4KA 4KMUX 4M3DA 4UB6C 3SDBA 4F91B 1N75A 2P6EA 4ZY0A 5LHIA 3FZVA 3A01B 2DQRA 4JOMA 2QWWA 4OAYA
chains in the Genus database with same CATH topology
1GXPA 5JR3A 3C18A 3RPUA 2VE9A 2VBZA 2UWMA 3F8CA 3BJ6A 4YIIA 4JQFA 5HDGA 3ISPA 1YVKA 5DUIA 4CGPA 2O0YA 5D5XB 2RV8A 1Z05A 4CHUA 1MDMB 1XGMA 1BM9A 1VTNC 3EUHA 1HW1A 4YRHA 1PUAA 1HXDA 3MZHA 4MFZA 1QSOA 5HDKA 2DPUA 4CYDA 4I02A 1YLFA 2BBYA 1WWXA 2A69F 3DV8A 1S7LA 4K30A 5F48A 1RXTA 1R36A 2ZXJA 4G6DA 4KVXA 2LSOA 2VC1A 4ETSA 1U5TC 1HSTA 1PUEE 1ZLKA 3CUOA 4Q5SF 3K9UA 5BS6A 4M74A 5A2QZ 2Y48A 2J8NA 4A0ZA 3RIRA 1FY7A 4AVPA 4GCVA 3TKYA 2G3TA 3U1DA 5CVVA 4B8XA 3GO5A 1Z1DA 1IYKA 2PI0A 2VZZA 4UWIA 2HKXA 5LGUA 3P2FA 2VT2A 3IC7A 3GFLA 5LLQA 4CYOA 4A95A 1WRJA 2CNMA 3KP3A 2IJLA 1G3WA 1I21A 1BBYA 3BJ8A 2K27A 1EH8A 3TOBA 3DXJF 1KYWA 1YW7A 1U6GA 4B10A 1YIOA 4FT8A 5HMNA 1TTYA 3VOEA 4LLNA 2EA4A 1J4JA 3MGDA 2OAZA 5EEGA 4AVCA 2VI7A 5G1ZA 1YLEA 5E1ZB 5L3GA 4KSFA 2ETHA 3EQLF 2P7VB 4G9YA 4ENNA 3BJ7A 1PP8F 4EVYA 3H5ZA 1FC3A 2L02A 3N7ZA 2XASA 3ZP5A 4UFWA 1RIOH 1RZ4A 3CXSA 5IV0A 2GIVA 4Q36A 5E17F 1O7FA 3F22A 5KTCA 2ZO4A 4L18B 3PFIA 1IAWA 3F8BA 1QO0D 4PSWA 2G7HA 5K5OA 2OZUA 1YO5C 2HQYA 3K2ZA 4LLGF 3SXNA 1R1VA 5FB2A 2JTVA 2WV0A 3NQOA 4KOWA 2ZKZA 2REFA 1MKMA 1K4JA 1V4RA 2EB7A 1ULYA 4M72A 3RYRA 2BUEA 4JD6A 3TOAA 3KEQA 5C88A 1YK3A 4IJAA 2D2WA 1J5YA 3M8FA 1F1ZA 1JGSA 2B4DB 2HQNA 1FP2A 3BY6A 3TO9A 3E5UA 3DSBA 1KUYA 1B9NA 3JTGA 4L9JA 3V8JA 2RVCA 2M87A 4A2UA 1SFUA 3ZN1A 1XCVA 2ACJA 3T8TA 1F9NA 3NRVA 3CTAA 4EJWA 4GGGA 4N9IA 5ILSA 1OZPA 3DNSA 1P4WA 1Z91A 3M1EA 3DPTA 4KVME 1OYIA