3TO9A

Crystal structure of yeast esa1 e338q hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Histone acetyltransferase ESA1
total genus 83
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to9A02
1RUNA 1ZG5A 3D2PA 1ON2A 1MDMB 2DT5A 4RGRA 4MI4A 3T9YA 4B09A 5IT3A 1SMTA 2OQGA 1ZRDA 4A5NA 2VOPA 1XGOA 4R57A 3CXQA 2Y0MA 3ELKA 1T98A 3TGNA 1TNTA 4H89A 1O3RA 2NNYA 1LDJA 1P4NA 2A4NA 4UVAA 2CG4A 2W85A 4MGRA 4L0ZB 3D2MA 2ATRA 3IWFA 2JDCA 2LKPA 4LGWA 3FM5A 3KP7A 1CGPA 3PFIA 1PUEE 2QVOA 1I27A 2G7UA 2R1IA 2GXBA 4KVOE 1OYIA 1L0OC 3SHFA 1LDKB 1K6OA 2HDCA 2O61A 1O3TA 5F1RA 3CXPA 1ZG3A 5LHIA 2BUEA 1HSJA 2BEIA 3HHHA 4MBUA 2QYOA 1FBSA 2ELHA 1P0HA 2EWNA 2YPRA 3TOBA 2PG4A 5E8GA 1Z6TA 1S7LA 4WWCA 3CTAA 1XB4A 4G8XA 4EVYA 2V6CA 2M1BA 3GZ5A 3M1EA 2OZGA 3NE7A 1QSMA 1BIAA 5D4SA 4IJAA 2L4MA 3M8EA 3QAHA 2IL4A 3F23A 1BJAA 4CRYB 2JSCA 2OB0A 2WV0A 1IUYA 3CDHA 1BM9A 1UHWA 4M71A 4XRFA 2B0LA 1BC8C 1HSTA 4AVAA 3R6SA 4L89A 2P6TA 2IJLA 5CVIA 3TO9A 2G3TA 3K2ZA 2ADUA 3GEZA 1J0RA 3PQKA 5ERIA 1GXQA 3L00A 1P92A 3FMQA 1YO5C 3B02A 3TCVA 3VEPA 2C27A 4KOYA 2A6EF 4G6DA 3RYPA 3J80K 2A5YB 1SD6A 2EV6A 1D8KA 3CJNA 5HDGA 2YX7A 4H6ZA 1MKMA 4KORA 5A2QK 2EUIA 4CZZA 2UZKA 2H94A 4HX8A 3PZJA 4O3MA 2PDOA 4M9ZA 2E7XA 3K1NA 4PSXA 4KIBA 2FT0A 2VT2A 1RNLA 4ASNA 3SHPA 2OZUA 3I9SA 3G73A 5DUKA 3HSFA 1ON0A 4LLNA 4KMUX 2ZNYA 2XHKA 1QBJA 5H86A 3GFMA 4JQFA 3T1BA 3R9GA 3D3SA 3T0YA 2XVCA 5D6EA 1AOYA 1FT9A 5CLSA 5JQ4A 1KUXA 3E6CC 3SXYA 1E2XA 4IRGA 2DK8A 1G3YA 3S2WA 3QOPA 3WTYC 4YGOA 2VC1A 2DAOA 3GF2A 1CF7A 1DUXC 3KZZA 3F8KA 5ILSA 4HA8A 1O3SA 3G8WA 1QPMA 5JI6A 4FD6A 3KP2A 2DW4A 4O6JA 1SFXA 2FMLA 3E3VA 4Q4ZF 3FB3A 2HKXA 2ZO4A 2IT0A 1KZFA 2W84A 1MGTA 4HQMA 2EK5A 4CXFA 4OINF 5F46A 4HZFA 2W25A 2OQRA 3F5BA 2ZW7A 2CGPA 3H4QA 2R3SA 3QRFF 4B5OA 1C0WA 3FBUA 1EV7A 1MDMA 1CF7B 4NHJA 4HKFA 2G0BA 4FX4A 3G3ZA 4HYEA 4UV8A 3VODA 2YSRA 5LLQA 2QZ8A 2CNSA 2IA1A 1KQ9A 3M9AA 3R60A 2VXKA 3MCZA 1W4MA 4AWXB 4IRHA 1M44A 1YS7A 2RNJA 2GWRA 1Y9WA 4Q5SF 5E96A 5HS8A 3J81Z 3I0TA 1O3QA 2ZW5A 4XLNF 5FFXA 4CICA 5FD5A 4P5OA 1MK4A 2DFIA 5F49A 4EMSA 3LFKA 4BAYA 1XSXA 4IXAA 3TO6A 1BI3A 1OYWA 4S05A 3QU3A 1LNWA 4BHPA 2V1UA 4CAVA 2DPDA 4I02A 3Q5FA 2F5EA 3WGGA 2XASA 4PGGA 3F6VA 4RI1A 1J75A 1FOKA 2Y75A 3ECHA 2PI0A 2P6GA 3VWEA 3GXOA 2VT3A 5H84A 4FD7A 3WTXC 2F5IA 1FP1D 4U0YA 1Q1HA 4AIHA 3QPTA 3V8KA 2KRFA 3WTUC 2V79A 1OPCA 3JW4A 2B3VA 1P4WA 4UWJA 4EM0B 5E8IA 4KUMA 2HWVA 5ICCA 4PSWA 3RYRA 2QQAA 2VI7A 4UVCA 3IRQA 3F8FA 3TQNA 2BE5F 2K4JA 1P6RA 4PK3A 1OKRA 3F0AA 3R0AA 1OMIA 2BL1A 1SAXA 2YR2A 1R5GA 5DYMA 4LLLA 2KIUA 3GZ6A 1CJWA 4DNCA 1OR7A 2HV2A 4HNXB 2VBXA 1M4DA 2VEZA 1K7AA 2ISYA 5DV5A 4KOSA 4GCVA 3GFLA 1Z9CA 2M5WA 1HXDA 3W91A 1MD0A 3D0SA 5EEGA 1BN5A 2MLGA 1K4JA 1ONVA 5F6FA 2DLLA 2PRBA 4M6YA 2Z99A 5AIQA 3H3ZA 3K0LA 3ZMVA 4RS2A 1SMYF 2W24A 2F5CA 2B4DB 2A6HF 3C7JA 1RO5A 3BPXA 3TKYA 2ZXJA 2FS5A 5CVVA 2PBIA 3FWEA 5BMZA 2QBYA 4KN7X 1YREA 1G3WA 2VBZA 3G3SA 3CXSA 2QIRA 2EFWA 4UXNA 3E5XA 2RC4A 1VKCA 1IIDA 4AG9A 1ODDA 4KN4X 2Q44A 3TOAA 1V0CA 4E8OA 4FD4A 2XKOA 1FC3A 2M30A 3JSPA 1EH6A 4M74A 3H92A 2O3FA 1O7FA 4TV7A 2AXLA 3DR8A 3EXNA 4AB7A 1F4KA 4R9MA 3KFWX 1WRJA 3H3UA 1XGMA 4I0BA 2VN2A 2J5PA 3BOQA 4HV6A 4M73A 4AIKA 1ZN2A 1WKMA 4IF5A 2FSWA 5HS9A 5HMNA 1J4JA 4BXUA 3ZJ0A 1K78B 2P6EA 5EBVA 5D5UB 2FRHA 5LHHA 4LG0B 2KKOA 1PDNC 3F8NA 3V7CA 2VOOA 3Q9VA 3MEXA 5E17F 1ZGJA 1FP2A 1W7PD 3RTRA 4ZYGA 3F3XA 5DD4A 1ZARA 3K69A 5LHGA 3ZPLA 5LGUA 2K4BA 3MZHA 3R61A 2P0WA 4KT5C 4Q47A 1W7PA 2FBKA 4UBRA 2P8TA 5L3DA 3ZN1A 3OWCA 4GGGA 3HRSA 5FB2A 1DP7P 3O6BB 3P9KA 4LLGF 2A68F 3W6XA 5L3GA 4HF1A 1B4AA 2DI3A 3E0KA 1JHFA 1R36A 2G9WA 3QP6A 1OYYA 4ONUA 2IA0A 3N4MA 1XGSA 4M72A 1IN4A 2PJPA 3MWMA 4ON0A 1R7JA 2VQYA 1IF1A 3OV8A 4EJTA 2QQ9A 4E0AA 2Q7BA 3JAMZ 4RGXA 3U1DA 4PK2A 2BYVE 1REPC 1BO4A 3FRMA 2FCKA 1QSRA 3WTSC 2PSWA 1YIOA 3I58A 3MQ0A 3V8JA 2F2EA 1Y7RA 4IVNA 5KK1A 5LGTA 4FD5A 5IB0A 2L02A 1YVOA 2Z9OA 1ZAOA 2JTVA 1P4XA 3I5UA 4L8AA 5GCNA 1Y0UA 3HIFA 2PLYA 4P96A 3I59A 2REEA 3E5QA 3KEQA 1UFHA 2PN6A 3GFJA 1R1UA 3GVAA 3J81K 1B59A 1YGHA 3P2FA 2FMYA 5IX3A 4II9A 3WE3A 3FXRA 1HQCA 5D4RA 2HYFA 3L2CA 1S8NA 1W7PB 1GXPA 1D8JA 1BI1A 3GO5A 2LSOA 2LDUA 4MTDA 4YFNF 1X3UA 2V1DA 1IYLA 4YRHA 4D0PA 1IYKA 1XSVA 1XMTA 2EV5A 1MJ9A 4EJWA 1LB2A 2FOKA 2ZPAA 4CAWA 3BPVA 3UY5A 3WE2A 2FIAA 1JGSA 5D5VB 3LQRA 4KLVA 2KIFA 3E5UA 1KGSA 3BP8A 2GAUA 3FIXA 3I3GA 4J3GA 4XNHB 1SFEA 3K9UA 3KE2A 1LQ1A 1KUYA 2PQ8A 1S7OA 5ED4A 3KP5A 5F47A 4U5YA 3DXJF 1TQIA 4ZBGA 3IWZA 3BJ8A 4FT8A 4BNCA 4R87A 4LD5A 1WWZA 3RKXA 3QU6A 2HZTA 3LQQA 2DO7A 1TW3A 4QBJA 4OLLA 1FY7A 3K1PA 5H6RA 5CVRA 4A6EA 1USTA 3WGHA 3EYIA 5AIPA 1V3FA 1I1SA 4JXQA 3K1MA 2CNTA 4I01A 5DDGA 3R9FA 2P7VB 1Q2CA 3NEUA 4PCQA 1XMAA 4HOBA 4IF4A 4U9YA 4YIIA 2B4DA 2PC1A 2A69F 2J8RA 1IN8A 2AS5F 3TE4A 1LVAA 3L09A 3JTHA 2ZMEA 4N9IA 2JEVA 3SZTA 3DKWA 3J80Z 4P9UA 3F8BA 4Z2YA 3CLOA 5AONA 1O57A 4Y15A 1KUVA 2FEZA 4A0XA 1O7LA 4HNWB 2EFPA 2WPXA 1B87A 2RV8A 1KU9A 5I0CA 2JDDA 3CUQC 3CO7C 4UV9A 1XD7A 4A0YA 4BYYA 3SXOA 1R1VA 1G4DA 2VE8A 4YG2F 2DXQA 2NRAC 3J7AO 1SD4A 1TBXA 1QSNA 4XBFA 1PUAA 3ZMSA 1K79A 3F22A 4M3SA 1RXTA 2R7FA 4MY3A 3BDDA 2B4BA 2CYYA 1QZYA 1YG2A 1M4IA 4R1HA 2MD5A 4ZZLA 4OIQF 2ACJA 2FNAA 3GX4X 4RAYA 2ARHA 2Q4YA 1R58A 2PMHA 1CM0A 1ZRCA 1S7KA 1UFMA 2MBFA 4IHTA 1MJAA 5D8KB 1U78A 2FBHA 4GS4A 1FBUA 5EEHA 2FSRA 4NEXA 3BJAA 3RKYA 4HLYA 3Q9SA 1TNSA 3DQVC 2H6CA 3HOTA 2A61A 1IICA 3MZYA 5KTCA 3DR6A 2VBWA 1J59A 2WWYA 2VODA 1TIQA 2J8MA 4WXCA 5D6FA 3C3WA 2HTSA 3C26A 1DPRA 6PAXA 5JFRA 3C1DA 1GVJA 1QSTA 1HBXG 5A2QZ 3R95A 2LF7A 1KA8A 3BJ7A 4UHTA 4G7ZF 1GHEA 2PEXA 1NSLA 5C88A 4XSZF 2R7HA 1TW2A 5E1WA 2AJ6A 4ZH4F 3R0JA 4B5PA 1IN7A 4OIPF 2QECA 5H20A 2ZMEB 3NQOA 2GA1A 4YFKF 2REFA 2Q2EA 1PP8F 1XF8A 2R7DA 1IN5A 3I4PA 3CUQA 1ZRFA 1I5ZA 4LJZF 3FXQA 1G3SA 1LEBA 1YX0A 3LSTA 1I1DA 3GKRA 2BBYA 4Y17A 2OZHA 1VHSA 1UHMA 5CYVA 2FQ3A 4P9FA 3FYNA 3D5LA 3DFGA 3R4KA 4U88A 4CYDA 1NHAA 3LWFA 2CQKA 2JPCA 3U9GA 3TFYA 3I64A 5LBQA 2MA3A 3HUGA 4AG7A 4KIGA 2MH2A 4PZJA 2OBPA 4HDUA 4KUBA 3TO7A 2HQRA 2Z0ZA 1Z4RA 4MY0A 3KKWA 3R96A 3LD2A 1WK4A 2IPQX 3FHZA 4NXYA 4BH9A 3AAFA 2PR8A 4I0AA 2DTRA 2QMLA 4AD9A 1S7FA 4HBLA 3B73A 1H9GA 1SD7A 5D5XB 5DWMA 3BJOA 4G94A 1NE9A 3FMSA 3SQNA 1FYMA 3WGIA 1YFHA 3ISPA 2HQYA 5IT9K 4L0YB 4KA4A 3GWZA 1XIXA 4LG0A 1XEBA 3RI4A 2EV0A 2PFBA 4HQEA 3JUWA 1U5TA 2GE3A 1TLHB 4WCGA 4MQ9F 2HEOA 2C6YA 2Q0OA 1SD5A 5JHUA 5FLXK 1V4RA 4CO8A 4PV6A 4KVXA 4RGUA 1DPUA 5BPDA 3HHGA 1YLFA 3MGDA 1H0MA 2A07F 4H6UA 4U7BA 2HOEA 2ZW6A 1U5TC 2P4WA 1R5HA 1TQPA 1M4GA 2STTA 5E20A 2R8VA 4JLYA 3JAMK 4CRZB 3E6BA 3R9EA 4QWQA 3P9CA 3T8RA 4G7OF 3RYOA 2V1XA 1IW7F 1U6GA 2BEOA 2O8XA 4R8HA 3FNCA 3VWDA 3ABUA 2H6BA 3D8PA 1YW8A 1FYLA 4P55A 2HKOA 5K1YA 4JWPA 4HDVA 1IN6A 1XCBA 5HLIA 1TQMA 5LEJA 3TDUC 4L9NA 1YTYA 2VBYA 3ECOA 4EM1A 4AIJA 2ETHA 2XV4S 2J5OA 1QNTA 1BOBA 1ON1A 1UB9A 3F8MA 4Y49C 1BI2A 1KYZA 2I79A 1UCRA 4HF0A 4LX9A 4KOVA 4UVBA 2FA5A 4LMYA 2XIGA 2XROA 2NAZA 2G3AA 1LDDA 5L3CA 4HV5A 1Z7UA 4RB1A 1M1DA 4Y13A 3IRRA 2GZWA 3GFIA 2RGVA 4B5PB 3ZMUA 2D1VA 4KUAA 2KJCA 4GYIA 5CJ9A 5ICFA 4QC6A 5BQTA 1U6MA 4OMYA 2XAFA 2XKPA 3I59B 2MH9A 2JT1A 3HTSB 2H27A 4HF2A 4HLXA 1QSOA 5ILUA 2XAQA 3O3KA 1EH8A 3C18A 2X7BA 1XCVA 3BLNA 2B3UA 3V8LA 1YW7A 5L3FA 5K5QA 2HS5A 3V7RA 4JD6A 3FXUA 1WQ2A 5IV0A 2O0YA 2QWWA 3WTTC 4BHCA 4HX7A 2A3SA 2Q4VA 3P7NA 1WSUA 5FLXZ 1R1TA 2ZNZA 5HVQC 1BIBA 3T90A 5TJJA 4IPAA 3W6SA 4EJVA 3CO6C 1BI0A 4R3LA 2JZYA 2OD5A 4ORFA 2OH1A 4XPLA 3S6KA 3IWGA 4LUAA 3JSOA 1IZ1A 1LJ9A 4KFCA 5ICEA 4BHBA 5DUIA 1XSDA 3LA2A 4LB5A 1AWCA 3EYYA 4OAEA 4OMZA 1ZH5A 1R23A 2E7WA 1ZG1A 3V4GA 3KP4A 4EM2A 4CAXA 3K9TA 3BWGA 2RDPA 3KETA 2X4HA 1D5VA 4WK8F 1WWXA 2OU2A 2YX4A 3IHUA 1B6AA 2GXGA 2K7LA 4F6AA 3DF8A 1T0FA 3WODF 1FSHA 4UNOA 2HR3A 4I98B 4I7HA 2GIVA 5JVTA 3PGPA 2RVCA 3EUHA 4OIRF 1GHCA 2WC2A 2XAHA 2R98A 3PP9A 4ENKA 4ESBA 3CUQB 2HTJA 1S5KA 1I1GA 3DDDA 4X5KA 3EO4A 2BV6A 4L5JA 4RAZA 5F64A 1BOAA 1TTYA 2VONA 1ZGAA 1SQHA 2DQLA 2ZCWA 4GYGA 1HKTA 1U3EM 1T38A 3I53A 4UWIA 3DNSA 4K2EA 1U8RA 2O28A 1KU7A 2Q0YA 1T2KA 5KTDA 1DDNA 3E97A 2K27A 2LF8A 2Z10A 2JPBA 4Y49B 1A04A 2L3DA 3S6FA 2ISZA 2M45A 3ZMDA 3T5XA 2OZ6A 1I21A 1KU2A 3RDIA 4I2OA 1E17A 2P6FA 2DBBA 2H5MA 4E70A 2EA2A 1FBQA 2L4AA 1YR0A 3ROUA 2JRTA 1HW5A 2Q04A 1IRGA 1KQ8A 1L3LA 5TRDA 3F21A 4WF2A 3FM3A 4KZTA 3U2RA 4KMFA 2QQBA 5H6QA 2P5LC 1S29A 4XNHC 4ENNA 1P2FA 3GUDA 1Z4EA 3KEOA 3HRMA 1ZYRF 5FVJA 3SZPA 3VOEA 4DQ2A 3KP3A 1ZLJA 2HFHA 1F9NA 1QQIA 5HS7A 2D4OA 5J6XA 2NS0A 3VB2A 4JK1X 3W6KB 2IP2A 5DCMB 3F72A 2K86A 2ZFWA 2CNMA 3LA3A 2HYGD 1NMTA 4WXHA 2DQRA 4RGSA 2ESNA 1Q2YA 4CGZA 3HSRA 2W57A 2XAGA 4NSQA 2ESHA 3WG9A 3B8GA 4UUVA 3DP7A 2EFNA 2JLMA 3DPLC 3WTWC 4A5MA 1Z6RA 1JE8A 2KIMA 2BSWA 3ZMTA 4ZYDA 4I49A 1ZREA 1Z91A 4GXOA 3KLOA 1L0CA 2GQQA 3HYIA 3T8TA 4F7ZA 2NYXA 5JPHA 2D4PA 3IKVA 5CVJA 4A12A 4PGHA 5ICGA 2KCWA 5LEKA 2H09A 3GLXA 5L3BA 3GYHX 4IHSA 4O5VA 3BZ6A 4L5IA 4FX0A 4EQQA 2BGCA 2QM3A 1J5YA 3QP5A 3OOPA 2HQNA 4K30A 4S04A 4M9XA 1FLIA 2GANA 4ESJA 4KICA 3MFKA 5ILVA 3HOSA 1G3TA 1HKQA 4HX4A 4QUSA 4H0EA 3BY6A 4JJXA 1WI9A 1XN7A 2QBYB 2NNNA 4MTEA 4MJ8A 5JR3A 2M8EA 2VBQA 1STZA 4N0BA 2D45A 1QZZA 2B58A 4G7HF 5C82A 2WPWA 1F5TA 2K02A 2DU9A 4QLCU 1N71A 4L9VA 2B5GA 4KDPA 1QGPA 2CFXA 3WU1B 3JVNA 1BBYA 1ULYA 4YFXF 2QUFA 3HRUA 3KZYA 2P5VA 3QB8A 4A0ZA 3BROA 1XDUA 3L9FA 2FXFA 1P4AA 3RKWA 1R00A 1YS6A 3ERED 1IXCA 2I00A 5F48A 1W5SA 4EJOA 3IL2A 3ZMZA 3F8CA 1YK3A 1FPQA 1B1BA 3P9IA 2PR1A 3FMRA 1U5TB 1B9MA 3EC4A 3VFZA 3ZN0A 3S6HA 5IT9Z 1YW9A 1YQAA 4GO1A 4L9JA 2L01A 2GA2A 3EDPA 2WTEA 1KQ0A 1HW2A 2VZYA 2G7HA 3M8FA 2DK5A 1S7NA 1KU3A 4KNYA 1JHHA 4OOIA 1IAWA 3PQJA 4KLWA 1LEAA 3NRVA 4RB0A 1YYVA 1R22A 5DD8A 2M87A 5FO5A 4B8XA 1KYWA 4AVBA 3RPQA 3IC7A 4ENMA 3WTZA 3RIRA 2EVNA 4XLPF 1Z1DA 1PP7U 3MAJA 2MC3A 3KP6A 1R57A 4XPDB 4QB9A 4E2AA 2IW5A 2LNBA 4EVIA 2RN7A 3EETA 1FZPB 4U0VA 4M6XA 3P2HA 1S6LA 5DEQA 5BPIA 2E1CA 5LRRA 2PMUA 1FYKA 3V7SA 3V8IA 5ISVA 1I6XA 2VZZA 3HSEA 4HAMA 4RB2C 3WR7A 2UXXA 5E1ZB 4RS8A 3WTVC 4OIOF 1RZ4A 2QENA 3TDZC 3R1KA 4CHUA 2Q8KA 2MLKA 4U9ZA 2V9VA 2CWEA 2UXNA 2RQPA 3O2PE 2FL4A 4NB5A 4PDKA 2IRFG 4OU0A 2P5KA 1PU9A 3DV8A 4CDGA 3IKTA 1JXSA 5HOOA 1J7KA 4EV0A 4ESFA 4KIFA 3W6JB 2D1HA 2ZJ2A 1I12A 2NMTA 2ZKZA 1K78A 1XGNA 5KTAA 3M7GA 5D5WB 2FF4A 5HDNA 3N97A 5CNPA 1XMKA 4BQAA 2XUBA 4MEYF 1T6SA 3I54A 5HDKA 4KOWA 2ZW4A 2FU4A 2XGXA 2YU3A 3LODA 4G6QA 4ZYHA 2QLZA 4IUSA 5BS6A 4ZZDA 2Y48A 2F5DA 4XPKA 4WXDA 3WU0A 4NCZA 3TT2A 1Y9KA 2IVMA 2J8NA 2EJRA 3E6MA 4XPDC 1Q2DA 4KOTA 1D3YA 4HW0A 5DCMA 4KOXA 2FBIA 3ZZIA 5L3EA 2UWMA 2EFQA 3COAC 4IRIA 5EC4A 4JBAA 5DCFA 3LAPA 3E6DA 1FWZA 3SFZA 3FXTA 4U7DA 1H9TA 4I09A 5FD6A 4FHTA 2ZXVA 4M85A 4BMHA 1S60A 1J9IA 2Z33A 4L18B 1FX7A 4XSXF 1LRZA 1RUOA 1YLEA 2P7CB 3KLNA 3ML6A 4RB3C 5HLHA 3GYAA 1S3ZA 1VTNC 3L7WA 3I71A 3ZQ7A 1HKSA 2OAZA 4NF1A 1XE4A 2CSOA 2E1NA 5K5RA 3EY5A 2CW0F 3DPTA 4MQVA 4QVTA 3BJ6A 5J8CA 3EQLF 1IXRC 1HW1A 5K5OA 2VXZA 4KYWA 1FSEA 5LGNA 4LFUA 1IB1E 4ETSA 1RIOH 4AVPA 4U0WA 4EGYA 2AE6A 2XRNA 1QO0D 1USSA 3RJPA 4A2UA 5LRSA 1EH7A 5HH1A 3FZVA 2VC0A 5FGMA 4LK1F 4MEXF 2STWA 4OADA 2B5GB 4YFJA 1XDSA 2OA4A 3RPUA 4HNYB 4MHGA 4MNUA 1J2XA 2EA4A 2XAJA 2FNPA 3REOA 3HRTA 3ABTA 2Z11A 1W5TA 4WX9A 3GW2A 4N9HA 1MZBA 4L9TA 2FIWA 5E1XA 1B6BA 3ULQB 4F0YA 3TTHA 3DSBA 1IRFA 3N7ZA 4R79A 1MJBA 2CY2A 3F6OA 3LA7A 2Z3YA 5FFZA 3HTUA 2EFOA 2TDXA 4JXRA 4ZYEA 1U2WA 4LK0F 4G9YA 5BOXA 5E18F 3QPHA 3DEUA 1B9NA 2HUZA 1BC7C 1G6NA 2DPUA 3SXNA 2HGCA 3FX3A 5J8FA 2ZBKA 2X0LA 1S3JA 5CVUA 3LAJA 5DWNA 1F1ZA 4Q48A 2P6SA 2D2WA 3GY9A 2COMA 4KVME 5HLGA 1Z05A 4AVCA 3FF5A 4NQWA 4CS0B 4M9SA 4A6DA 4EGZA 4EJUA 3EFAA 2KJBA 4R3KA 2FE7A 4ENJA 1OZPA 1ZHFA 4MHDA 4YIFA 2FE3A 2F5FA 2O6GE 2O03A 1ZLKA 2EB7A 1YVKA 1S7AA 4UA3A 3S6GA 1T39A 2FXAA 4LB6B 2Z5UA 4KOUA 2K5TA 2VE9A 1Z9UA 3IGRA 3JTGA 2L54A 2IA2A 5D8LB 1RI7A 2RKHA 3KCCA 1SFUA 3ZP5A 3CUOA 1IXSB 5KVRA 1FNNA 2CO5A
chains in the Genus database with same CATH superfamily
1RUNA 2JMWA 5ELYA 1ZG5A 1WHUA 3D2PA 3KQZA 2LD5A 2CW8A 1ON2A 3HGYA 2DT5A 3P5JA 1MDMB 1AKHA 4RGRA 2IXSA 4MI4A 4UIBA 3RCOA 3OSFA 3T9YA 4B09A 5IT3A 1SMTA 4A37A 2OQGA 2X85A 2EINH 1ZRDA 4A3CJ 1D1BA 4A5NA 1Y8FA 2VOPA 1HPTA 1XGOA 4OC2A 1SVLA 1XS9A 3L2RA 4R57A 5EX0A 1CBXA 3CXQA 2LB7A 2Y0MA 3ELKA 1T98A 3TGNA 1TNTA 4H89A 1O3RA 2NNYA 1LDJA 3JRFA 1P4NA 2A4NA 4UVAA 2CG4A 4ITVA 1DTDA 2W85A 2GIZA 4MGRA 3OR1C 4L0ZB 3D2MA 4X3RA 2ATRA 3IWFA 1JTXA 1YSJA 2JDCA 2LKPA 3FSXA 4LGWA 3CDXA 3FM5A 3PFEA 3KP7A 1CGPA 1VQNI 2VIXA 3PFIA 1MH3A 1PUEE 2QVOA 1Z8XA 1EA3A 3QPLA 1I27A 2G7UA 2CV2A 2R1IA 1OCTC 3B3TA 1S72I 2GXBA 4KVOE 1OYIA 2CUFA 1ZK8A 1L0OC 3BZCA 3CLQA 1LDKB 3SHFA 5D8NA 2NS8A 2E36A 1K6OA 4NBQA 2HDCA 1UG0A 2O61A 1O3TA 4CYCA 3G6EI 4P6YA 4P1WA 5F1RA 4S0HB 1ZG3A 3CXPA 5LHIA 4XONA 1AUGA 2BUEA 1HSJA 1LFWA 5FJ8J 3PO2J 2BEIA 3ISXA 3HHHA 3KL9A 4MBUA 3UGLA 2QYOA 1FOWA 2XF5A 2B9SA 1FBSA 2EZIA 4QSHA 2ELHA 2ME6A 1MSEC 1P0HA 2J9RA 2K9HA 2EWNA 3F0CA 4AM3A 4A95A 2YPRA 3KPHA 1XPXA 3TOBA 3WC6A 3TMOA 4G1PA 2PG4A 5E8GA 3TW6A 1Z6TA 4CCNA 1ZG9A 1S7LA 4WWCA 3CTAA 1XB4A 4G8XA 2V8HA 4EVYA 2CU7A 2MD0A 2V6CA 2M1BA 4ZDOA 4MCQA 2W82A 4A3IJ 3BG5A 3JRUA 3GZ5A 3M1EA 2OZGA 4PUSA 2C1CA 3NE7A 1MNMC 2L8EA 1XA6A 1BIAA 1NTCA 2H8RA 5D4SA 1QSMA 4IJAA 2K9SA 2L4MA 3M8EA 2X51A 5HLTA 1WGCA 2CQQA 3O8GA 4CGOA 3QAHA 5J40A 2IL4A 3F23A 1BJAA 2JN6A 2R7TA 2JSCA 3BC8A 2KFDA 2XSDC 2PMZA 2WV0A 2R7VA 3E1SA 2X6OA 1IUYA 2OB0A 3CDHA 3CJQB 1BM9A 1UHWA 1H0ZA 4M71A 4XRFA 1TKFA 4XN3A 3WHCA 2FX0A 2B0LA 5IP7J 1BA5A 4MCPA 1IV8A 2GKTI 1BC8C 5C3EJ 4AMLA 3HXLA 1BAVA 2VL8A 4KSIA 1HSTA 4ZC3A 3R6SA 4AVAA 4L89A 2P6TA 2V26A 4PPZA 2IJLA 5CVIA 4XICA 3TO9A 2G3TA 4RMNA 2E5NA 3K2ZA 1LKXA 2ADUA 2UV1A 2N52A 1O4XA 4X6AJ 3GBGA 3CCYA 3GIUA 2DA6A 3GEZA 1J0RA 1JT0A 2MGQA 3PQKA 5ERIA 1CPSA 4E7SA 4QPQA 1GXQA 3L00A 1P92A 2WAQN 3FMQA 2ZEMA 2ZEEA 5I4MA 1YO5C 2MSYA 3B02A 4BGDA 1Z7KB 2IMOA 2GKVA 4C2UA 2VQGA 3MEKA 3TCVA 1WKXA 2OVOA 1RETA 3SFIA 3H35A 3HEFA 3HOVJ 3BJIA 4OMEA 3VEPA 2C27A 4KOYA 2VKHA 2A6EF 4G6DA 3V42A 1TL8A 2DFHA 3RYPA 3M4OJ 2LLKA 1SFKA 2FUG2 3J80K 1OLTA 4V19K 2A5YB 4CGMA 1SD6A 2EV6A 2W1OA 2DFFA 1D8KA 1TUSA 2BO9A 3CJNA 5HDGA 2YUSA 4C3IJ 2YX7A 2L9SA 3ONQA 4H6ZA 1MKMA 4BQNA 3H8EA 4KORA 5A2QK 2EZHA 4QIWN 2A05A 2EUIA 4CZZA 3VYRB 4AVZA 2UZKA 2LG4A 2H94A 4HX8A 3PZJA 3FMCA 3PSIA 4O3MA 2PDOA 3SJFA 1J09A 4E1RA 1UWYA 3AG3H 2PJ7A 4M9ZA 2E7XA 3S9LA 2OF7A 3RKQA 3K1NA 3OWTA 3Q0WA 2JJ7A 3AG1H 4PSXA 1Z0XA 4KIBA 4B14A 2NVXJ 1ZLIA 2FT0A 2VT2A 3G1LA 1RNLA 4ASNA 2XGDA 3SHPA 3SDGA 5LYIA 5GADJ 2OZUA 3I9SA 3G73A 3SEQA 4B6DA 5DUKA 1IUFA 3HSFA 4Z6YA 3KHXA 4G6TB 2CXAA 1ON0A 5JVGF 1XTAA 4LLNA 4KMUX 2ZNYA 2XHKA 1QBJA 5H86A 3GFMA 1MMSA 2MW8A 4JQFA 1X2NA 3T1BA 3R9GA 3D3SA 4LITA 2O9LA 3CC4I 3OL0A 1DS2I 3T0YA 1KBEA 3J7AY 2DF5A 2XRLA 4LQGA 2XVCA 5D6EA 2OC6A 1AOYA 3NARA 1FT9A 5CLSA 5JQ4A 5GAGJ 1KUXA 4CYNA 3QYEA 1WVRA 4HSRA 3B3WA 2LH9A 3E6CC 1K4TA 3SXYA 1JKPC 5A28A 1E2XA 3VSLA 4IRGA 4MRIA 2DK8A 3AKZA 2R5ZB 1G3YA 3S2WA 2WY7Q 1YMEA 2HVSA 4ANJA 3QOPA 2ODFA 4FUUA 3WTYC 2K85A 2PJRB 4O23A 4YGOA 2VC1A 1LAPA 2DAOA 3GF2A 3QPSA 1CF7A 1DUXC 3KZZA 3RPUD 1CPXA 2IJZA 2R4GA 5ILSA 2XEGA 4HA8A 3SDBA 2PJBA 3F8KA 3HZJA 1O3SA 3VWBA 1P7IA 2JYYA 3BXMA 3G8WA 3PSFA 1QPMA 5JI6A 4FD6A 3KP2A 3FBNB 3BR6A 2DW4A 4O6JA 1Y39A 1SFXA 2FMLA 4J19A 3E3VA 2EO8A 1EKEA 4Q4ZF 4DBRA 3FB3A 3KQXA 5F0HA 3PEIA 2JRMA 2E35A 2HKXA 2ZO4A 1D1AA 2IT0A 1DE4C 1KZFA 4I76A 1VQ7I 2W84A 5GP9A 3PB4X 1MGTA 4HQMA 2EK5A 4CXFA 4OINF 3HL2A 4A3EJ 5F46A 4HZFA 2W25A 2OQRA 4Y33A 3F5BA 1QPIA 2ZW7A 2ZEDA 2CGPA 2HB6A 2AFMA 3H4QA 2R3SA 2QYVA 1FIAA 3QRFF 2F8HA 4B5OA 1C0WA 1WCMJ 3LSGA 3FVLA 3PM1A 1G59A 3QNVA 1MW7A 3FBUA 3JRBA 4RDUA 1EV7A 1MDMA 1MBGA 1CF7B 4NHJA 4HKFA 2G0BA 4FX4A 3G3ZA 3LMMA 4HYEA 3IJ3A 4UV8A 3VODA 3ZQIA 2ZMEC 2YSRA 2EBJA 2DDBA 2KMPA 5LLQA 2DA7A 1Q9BA 2QZ8A 2CNSA 2IA1A 1KQ9A 3M9AA 4XOPA 3L2QA 4A3BJ 2PJ5A 1B72B 4RN7A 2BY2A 3R60A 3H9QA 5F04A 2VXKA 5E79C 3MCZA 1W4MA 4AWXB 4IRHA 1M44A 1YS7A 2RNJA 1FIPA 2GWRA 5TISC 3CC2I 4Q5SF 3UOEA 5HS8A 1Y9WA 3KASA 3KI9A 3J81Z 4MFZA 5E96A 3I0TA 3B2YA 4NGSA 4XR6A 1O3QA 2ZW5A 3D7GA 3ZQFA 4XLNF 3HM5A 3PIPF 5FFXA 4CICA 3W2AA 5FD5A 1OMTA 4P5OA 1SGPI 1MK4A 2DFIA 1UVFA 4Q7AA 5F49A 2P81A 4A31A 3EPZA 4EMSA 3S17J 3LFKA 4BAYA 2PJ3A 4DJAA 1XSXA 4IXAA 3TO6A 3TL4X 2NVTJ 1BI3A 1B72A 1OYWA 3FXMA 4R7MA 4S05A 3WHBA 3KGQA 3QU3A 2PJ1A 1LNWA 4BHPA 2V1UA 3TBIA 3SI1A 3OL3A 4A39A 4CAVA 2DPDA 4I02A 3Q5FA 3QYFA 2F5EA 5EF6A 3WGGA 3DEWA 2XASA 2Y69H 4PGGA 3F6VA 5IYBJ 4RUHA 4RI1A 1J75A 4TNUA 1VQLI 1FOKA 2WB1N 1GT0C 2Y75A 3ECHA 2PI0A 2P6GA 3VWEA 1IW4A 5IY5H 4EATA 3GXOA 2IS4A 2VT3A 2COBA 5H84A 1TF9A 4FD7A 3WTXC 2F5IA 1FP1D 2ZELA 4U0YA 1Q1HA 4AIHA 1OISA 5E3QA 3QPTA 2LFBA 2SGFI 3GTJJ 2QQ8A 1MMDA 4A24A 1N25A 2QJ8A 3V8KA 2KRFA 4W97A 3BG7A 3ZXSA 3WTUC 2H8WA 3MVPA 2DIPA 2V79A 1OPCA 3JW4A 2B3VA 1P4WA 1X10A 1R4MB 3S32A 4K3NA 4UWJA 4EM0B 1OR7C 5E8IA 4KUMA 4MHZA 2HWVA 5ICCA 2CTCA 4PSWA 3CC7I 1OYVI 1HDLA 3RYRA 2QQAA 2VI7A 4UVCA 3IRQA 3F8FA 3TQNA 1ARLA 3BR2A 2KZGA 3BR5A 2BXYA 2BE5F 2K4JA 1P6RA 1TT5B 4PK3A 3DTKA 1OKRA 4JYKA 3F0AA 4FASD 2E2HJ 4UXHA 3GUXA 3OL4A 2XSJC 3R0AA 1OMIA 3W6VA 2BL1A 2PJ8A 3SJGA 2DJIA 3IH3A 4IOAF 4BXXJ 1UHAA 1SAXA 2YR2A 2O4HA 1R5GA 5DM7F 4P4DA 3H5RA 1YRNA 5DYMA 4M3EA 2JXDA 2JEWA 4LLLA 2KIUA 4AC0A 1YOVB 3GZ6A 1PUFA 4UUTA 1TKJA 1F43A 2Z3NA 3LSIA 4A3FJ 1CJWA 4DNCA 4AIDA 4DIQA 2M7AA 1OR7A 2HV2A 4HNXB 3H5NA 2VBXA 2XPWA 3SYTA 1M4DA 2VEZA 3ABMH 1K7AA 2ISYA 5DV5A 1Y1WJ 3GTPJ 2XF7A 4KOSA 4GCVA 3GFLA 1Z9CA 1HDUA 2H1KA 2M5WA 1HXDA 3W91A 1X19A 3BQYA 1MD0A 3D0SA 5EEGA 1BN5A 2MLGA 3T8WA 5M5XJ 5C4JJ 4M3DA 2ABZA 2WY8Q 1K4JA 1ONVA 2BY1A 1IGNA 5F6FA 2DLLA 4OIWA 2PRBA 1ZELA 1IG7A 1SAUA 2KRCA 4A2ZA 2ZXHA 3K70D 5B5EC 1A36A 4M6YA 2Z99A 3X2QH 3PB7X 4F3QA 5AIQA 1ENHA 3H3ZA 2Y0SA 3K0LA 3ZMVA 4NJRA 2KQRA 4RS2A 2EZLA 5FLMJ 1SMYF 2W24A 2F5CA 2E1MB 4DBQA 2B4DB 1I50J 2A6HF 2E5ZA 3C7JA 1RO5A 1NSAA 3BPXA 3TKYA 1IU8A 1XFOA 2ZXJA 1TWCJ 2R7OA 3J7ZI 3JRCA 1Z3YA 2FS5A 5LRGA 5CVVA 3EUKL 2LBFA 2Q4ZA 3JRDA 3CPXA 4IZZA 2BW3A 1AA7A 2PBIA 3DBHB 3FWEA 3LSJA 4CH7A 5BMZA 2C6GA 2V8GA 2Z3OA 3AG2H 2QBYA 3IP4B 2Q1ZB 4KN7X 2E2IJ 1JUSA 3AFHA 1HEVA 4XKVA 1YREA 2NU3I 1G3WA 5EX3A 2VKDA 2VBZA 4AYBA 2KP6A 3G3SA 3CXSA 2QIRA 2DA5A 2EFWA 3PJRA 4UXNA 3ZQCA 5G1ZA 5CCMA 5G20A 1VF9A 3E5XA 3WU2C 1NG6A 2RC4A 4JP0A 2QPOA 1VKCA 2R7RA 1IIDA 4DYOA 1LAMA 1WGXA 4AG9A 1ODDA 4KN4X 4BY7J 2Q44A 3TOAA 1P9QC 1V0CA 1TWGJ 1TIHA 5EG0B 4E8OA 1WJEA 2ICWG 4FD4A 3TC8A 3H5AA 2XKOA 2J9AA 3CPAA 4DGWB 1FJLA 1FC3A 1YJ9I 2JW6A 2M30A 1OCOH 1JT6A 3JSPA 2V4JC 3UEYA 2KMRA 2JBJA 1EH6A 4M74A 3H92A 2O3FA 2BVMA 2SGDI 3N5FA 1O7FA 4TV7A 2GU2A 3QYBA 1H88C 4OC5A 3MD2A 2UZ3A 2AXLA 1Y7EA 3DR8A 3PFYA 1FMWA 5JLWA 3D68A 2JA2A 4BDYA 3EXNA 4FE4A 4AB7A 1F4KA 3ZQQA 2WZNA 2V9PA 3KFWX 1IRZA 1CP7A 4R9MA 2W0TA 3CZ6A 1WRJA 3H5ZA 3H3UA 1XGMA 4I0BA 4XNFA 4OC4A 2VN2A 2J5PA 3BOQA 2R7XA 1IJWC 4HV6A 2R93J 4M73A 1ARMA 3S93A 2H1LA 4AIKA 1ZN2A 1DS3I 3TW7A 1WKMA 1P7JA 3SJXA 5F08A 4IF5A 2FSWA 5HS9A 5HMNA 2QGUA 1J4JA 4BD9A 4BBHA 4BXUA 3ZJ0A 1K78B 2P6EA 5EBVA 5D5UB 2FRHA 2WYRA 5LHHA 4LG0B 2KKOA 1PDNC 3F8NA 1CT4I 3V7CA 3LL7A 2VOOA 3Q9VA 3OXFA 3MEXA 2PCUA 5E17F 1ZGJA 1FP2A 1W7PD 3RTRA 2DB6A 2QKLB 3F3XA 5DD4A 4ZYGA 5EGOA 3K4CA 2VPLA 3HH2C 5LRKA 4D1QA 1ZARA 3K69A 1AMPA 2BY3A 5LHGA 3ZPLA 3WT4A 2AFWA 5LGUA 2K4BA 3MZHA 1Y8RB 1RR7A 3R61A 4KSAA 2P0WA 4KT5C 2QSGX 3DKYA 4Q47A 1JQGA 1W7PA 2YNCC 1IRXA 4A33A 1K83J 2FBKA 4UBRA 3OS2A 1DGRM 1V1IA 2P8TA 5L3DA 1Z2LA 3FIWA 3ZN1A 3OWCA 4GGGA 2ECCA 4PQAA 3HRSA 1UVGA 4XKBA 5FB2A 3PBEA 1DP7P 3QODA 1QVTA 1Z8WA 3HKZN 3IIBA 5E3MA 1QMUA 3O6BB 3P9KA 1NK2P 4LLGF 2A68F 2DMUA 5L3GA 3W6XA 4HF1A 1DP3A 1B4AA 2DI3A 4A3GJ 5M5WJ 3E0KA 1JHFA 3FH4A 1R36A 5IOYA 2G9WA 4FBEA 3QP6A 5IP9J 3WG7H 1OYYA 4ONUA 2HXIA 2IA0A 2O5RA 1HDQA 5EGOB 3N4MA 4L9MA 1XGSA 5FKKA 1BMOA 4M72A 1IN4A 2PJPA 1NUBA 2LYCA 2R7QA 3MWMA 4R76A 4ON0A 1R7JA 1EF4A 2CUEA 1I3AA 2VQYA 5CBMA 2DOEA 4CCLA 1IF1A 2GLOA 1OCCH 3OV8A 4EJTA 2Y9ZA 3GTQJ 1OMUA 3KZWA 1Z3XA 4XKCA 4NGMA 2JA6J 2GREA 2QQ9A 4E0AA 2Q7BA 2ORVA 2ARPF 3JAMZ 4RGXA 3U1DA 1PPFI 4PK2A 2BYVE 1REPC 5DM6F 1BO4A 2FCKA 1QSRA 3WTSC 2PSWA 2LY9A 3FRMA 1W36C 3H0DA 2L7XA 1YIOA 2VUMJ 6CPAA 1BUSA 1PVEA 3I58A 2XB5A 3MQ0A 3V8JA 2XPVA 3HBLA 4CSWA 2F2EA 1Y7RA 2NSMA 4C30A 4IVNA 5KK1A 5LGTA 4FD5A 5B1AH 5IB0A 2R7UA 1XBUA 2L02A 4HPQA 1YVOA 2Z9OA 1ZAOA 2JTVA 4CCKA 1YHQI 3OXLA 1P4XA 2CQNA 3I5UA 4L8AA 5GCNA 1Y0UA 3HIFA 1ELLP 3MMYB 3CT9A 2PLYA 4IAVA 4P4JA 1YJWI 3DU5A 2VJJA 4JX6A 1Z5RA 4P96A 4HNVA 2ERWA 3I59A 4FISA 3E5QA 2JUCA 4Y52J 2REEA 4MFDA 3IU1A 3FEDA 3HDDA 3GTKJ 1ZTRA 3KEQA 1UFHA 2DPSA 2PN6A 3GFJA 1R1UA 3GVAA 4KT6A 5M3FJ 4ZTJA 3UGIA 3J81K 1B59A 1YGHA 2N8GA 4UIAA 1ULKA 2G9DA 1XBTA 3P2FA 4WWVA 2FMYA 5IX3A 4II9A 2A5WA 4C3JJ 5FUWA 1SGEI 3WE3A 3HUVA 2DYSH 4C7IA 3FXRA 1HQCA 5D4RA 2VL1A 2HYFA 3L2CA 3JRAA 4MCRA 1S8NA 1W7PB 1GXPA 2HQ5A 1Q1VA 4HEA2 5KNLA 1D8JA 1BI1A 3GO5A 2LSOA 1VIXA 2LDUA 4XRMA 4MTDA 4YFNF 1X3UA 2V1DA 1IYLA 5JHWC 4YRHA 5E3RA 4L5EA 3ESWB 4D0PA 1IYKA 2VJ5A 1PYTB 1XSVA 1E3OC 1VQ5I 1XMTA 1ERDA 2EV5A 2VQCA 5G22A 1MJ9A 4EJWA 3OS0A 1X1PA 4E7IA 1LB2A 2FOKA 3CJRB 2K40A 4P4BA 4A32A 2QQEA 1I3QJ 2I5UA 3FKJA 3PFOA 2ZPAA 2ZOFA 4CAWA 3NWSA 5M5YJ 5EDNA 4HG2A 2HC9A 4BE0A 4HGUA 3BPVA 1X58A 3K7AJ 3WE2A 2FIAA 1JGSA 5D5VB 3LQRA 3BI0A 4KLVA 3UY5A 2KIFA 3E5UA 4BJ5C 1KGSA 2BVLA 3A0BC 3BP8A 1XMBA 3ZQHA 5GPAA 2GAUA 3FIXA 3I3GA 4J3GA 1D5YA 4XNHB 4ZX8A 1SFEA 4N4OB 3K9UA 4I6ZA 1T95A 3KE2A 4Y4RA 1LQ1A 3DEEA 3RU0A 3RAMA 1KUYA 4WJBA 2PQ8A 1S7OA 5ED4A 5J1UA 2OPTA 3KP5A 4A3LJ 3SGQI 5F47A 3MN2A 2O8KA 4U5YA 2NU1I 2Z3PA 3CP2A 1LFBA 1ZKGA 1TQIA 3DXJF 5EZGA 5B66C 4EWTA 4ZBGA 3IWZA 4CCJA 4FT8A 1MT1A 3BJ8A 3C2BA 3CMAI 4BNCA 4ZTFA 1KZHA 4MFPA 1TBNA 4R87A 5CCLA 4LD5A 4PJLA 1S5LC 1PTRA 1WWZA 3RKXA 1LR8A 3QU6A 2HZTA 1APLC 4C2YA 1K7VA 2O53A 2CMPA 3LQQA 5E3OA 2DO7A 2NVQJ 3PB8X 1TW3A 2M34A 5HODA 4QBJA 2K9QA 1FY7A 1RC9A 3LSHA 4OLLA 1VHEA 1JTYA 1QHHD 1Z7LA 3K1PA 5F1JA 3NA6A 5H6RA 5CVRA 4A6EA 1OCZH 1R0RI 1USTA 3CD6I 3WGHA 1UG2A 3OYHA 3RQ4A 3DCFA 1VNDA 2X6YA 4LG3A 4RAGA 1A5JA 2LEOA 4II3A 3H9JA 1BW5A 4EMEA 4NJQA 5EYRA 3EYIA 3GB0A 5AIPA 4M6HA 1V3FA 4NGTA 3B7IA 1I1SA 3FKIJ 1MBFA 1KONA 2MC4A 4JXQA 3K1MA 1Z67A 1IDZA 4I01A 5DDGA 2CNTA 1UJ8A 2P7VB 2JA8J 3R9FA 1Q2CA 3G4SI 3NFZA 4TWEA 3K2KA 5HXDA 4XLFA 1I39A 1W5CC 1VQ4I 2F48A 4P4EA 3NEUA 4PCQA 1F36A 3A1YA 4XLAA 1XMAA 1U5KA 2PVVA 4HOBA 4IF4A 1TURA 2E34A 4XLCA 3VDPA 5IB9A 2NU2I 4U9YA 4YIIA 1ITYA 2DFEA 2B4DA 2PC1A 2A69F 4XORA 2J8RA 1QRYA 1IN8A 1D0ZA 2EIKH 2N1AB 2AS5F 3TE4A 1LVAA 2L7FP 3L09A 4RBOA 1VQMI 2NVYJ 1AYEA 3FEEA 4UEEA 2OTJI 2FJ1A 2ZEOA 1IV6A 3JTHA 2ZMEA 4N9IA 2JEVA 3SZTA 3DKWA 3S9MA 4HNUA 3J80Z 4P9UA 3F8BA 4Z2YA 3CLOA 1P9GA 5AONA 2F4IA 1O57A 4Y15A 2DN0A 4IQJA 1MIJA 1TBOA 1KUVA 2FEZA 1VHOA 1XX5A 4F8ZA 2ZENA 4A0XA 1O7LA 4HNWB 4IHXA 3OIOA 2EFPA 2M4KA 2WPXA 4F9UA 5D29A 1B87A 2PIZA 4BQQA 2RV8A 1KU9A 2KIQA 2M4GA 2NU0I 4J01A 3DKXA 4CZCA 5I0CA 2UUZA 3VPRA 3CUQC 3CO7C 2JDDA 4UV9A 1XD7A 1YX5A 3KR4A 4A0YA 4DZPA 3K6GA 4BYYA 3SXOA 1R1VA 3L2NA 1G4DA 2VE8A 1V5FA 2JA5J 5E3NA 4YG2F 2DXQA 4DOZA 2NRAC 4AYBN 3RNZA 1EE3P 3J7AO 1SD4A 1TBXA 1QSNA 2NU4I 4XBFA 1FEXA 4FTHA 2PJRA 1PTQA 4MFKA 1PUAA 1A35A 3K4MA 3ZMSA 4M3FA 3QQAA 1R5ID 3F22A 1K79A 4M3SA 5DTDA 2HVRA 1RXTA 1F2OA 2R7FA 4MY3A 3B3SA 3PB6X 3BDDA 2B4BA 3H8GA 1WJFA 5J4VA 3S2DJ 5FLVA 4UY8I 4ZJZA 3H3VK 1X1AA 2CYYA 1QZYA 3S14J 1YG2A 1M4IA 1TXRA 4R1HA 5F0CA 1JKOC 2QVPA 2LRDA 3LSRA 4OC3A 4ZY1A 4HRIA 2AFUA 2MD5A 4ZZLA 2ACJA 4OIQF 4XRSA 2FNAA 3GX4X 2MG4A 2XB0X 4RAYA 2GOMA 4BY1J 2ELIA 2ARHA 4B47A 3PIOF 3IH4A 2Q4YA 1R58A 2PMHA 1E3HA 1CM0A 2L9RA 3BG9A 1X3ZB 4BDZA 1ZRCA 1S7KA 4DUKA 2N71A 1UFMA 2MBFA 4IHTA 3I55I 3BCAA 4J00A 1MJAA 5D8KB 1U78A 2QQDA 3QWPA 1R49A 2PJ6A 5IPAA 2CJSC 3OY9A 4YEJA 2FBHA 4GS4A 1S20A 2HI3A 2BCOA 1FBUA 5EEHA 4MMOA 2FSRA 4NEXA 3BJAA 3RKYA 1D0YA 4HLYA 4E7HA 3A03A 1MSFC 1XMXA 1X4SA 3Q9SA 2WUUA 3FISA 2DODA 1TNSA 3DPUA 3VYUB 3DQVC 5BNGA 2H6CA 4RAFA 3PDNA 2Z3LA 4ZDLA 1B8IB 2AFXA 2CQ7A 5F0FA 3HOTA 1SGNI 2A61A 3GTGJ 3MZYA 1ELMP 1IICA 2DMNA 2KL4A 5KTCA 3DR6A 3IEHA 5FUYA 5JHFA 2VBWA 1J59A 2WWYA 2VODA 1TIQA 3N05A 4WXCA 2J8MA 3D7DA 5D6FA 2HOTA 4MHPA 4CAFA 3C3WA 2HQAA 3BG6A 3DU6A 2HTSA 3C26A 2Y9YA 1DPRA 3BTLA 4OAZA 5JFRA 6PAXA 1SGQI 3C1DA 5FUVA 1GVJA 2NVUB 1UMQA 4CUGA 1QSTA 3UR3C 2LUYA 1HBXG 5A2QZ 3DLLF 2N17A 3R95A 2LF7A 1KA8A 3BJ7A 1QZEA 4UHTA 4G7ZF 5F27A 3HPHA 3RO0A 5FKOA 4BKXA 1GHEA 2PJ2A 1SVMA 2PEXA 1HLVA 1NSLA 5C88A 2VASA 4XSZF 5HNFA 2R7HA 1TW2A 5E1WA 3FBIB 2AJ6A 4ZH4F 3R0JA 2OTLI 4B5PA 3A2KA 3K2AA 3ZRGA 3CCUI 1IN7A 4UFXA 2NS7A 2VJIA 3D1NI 1TWHJ 4UCPA 4OIPF 4E1PA 2QECA 2DXIA 5H20A 4BQOA 2ZMEB 3NQOA 3OYAA 4NUBA 2GA1A 3J7YJ 4CYOA 3OSGA 2GLFA 4YFKF 2DOAA 2CIJA 2Q2EA 4FE7A 3K70C 1PP8F 2REFA 1XF8A 2R7DA 4AXVA 1IN5A 1GYTA 4D9JA 3I4PA 3I3LA 4N4NB 3CUQA 3IFEA 1ZRFA 1I5ZA 1TP4A 3AL0C 4LJZF 3FXQA 1R71A 1RFHA 1G3SA 2R5YA 1TOTA 2JVGA 1LEBA 5AG7A 3HOYJ 5F09A 3GLLA 2L9VA 3D66A 4F0XA 1YX0A 3LSTA 1I1DA 3GKRA 9ANTA 3VYSB 2BBYA 4Y17A 2OZHA 5GAEJ 5J4YA 1UHMA 1VHSA 2X1CA 4UF4A 5CYVA 2FQ3A 4P9FA 4JYWA 4Q36A 3FYNA 3D5LA 3PRTA 2GBYA 4IQ4A 3DFGA 3R4KA 4U88A 3MKLA 4UCNA 2RREA 2GLJA 2DEAA 4CYDA 1NHAA 3LWFA 1DU0A 2VQHA 2CQKA 2JPCA 3ABKH 3U9GA 4XRSG 3I64A 3TFYA 5LBQA 2MA3A 2KDZA 3VYTB 3HUGA 4AG7A 2DKVA 4KIGA 4KS9A 2MH2A 4PZJA 2OBPA 4BU2A 2CTBA 2X6WA 2PE3A 3F9KA 4HDUA 2POKA 4KUBA 1DGWY 1ORKA 4JX5A 3TO7A 2HQRA 2Z0ZA 2M3AA 2UVOA 2X1EA 2L7ZA 4OVOA 1Z4RA 4MY0A 3KKWA 3R96A 3LD2A 3FXOA 1WK4A 2V77A 2IPQX 3FHZA 2PMZN 4NXYA 3HG9A 1TKHA 1PJUA 4BH9A 3AAFA 3HOWJ 2PR8A 5FROA 4CYPA 1CGII 4F52A 1K7TA 4I0AA 1GLNA 2DTRA 5BWAB 2E60A 2EIMH 2QMLA 2VB6A 3TP0A 4AD9A 1ETYA 1S7FA 4Z65A 3PNTA 4HBLA 3B73A 2V8DA 1H9GA 1SD7A 5C4XJ 2G0EA 5D5XB 5DWMA 2W48A 3BJOA 2BOLA 4NGQA 4G94A 2C6CA 1NE9A 3FMSA 3SQNA 1FYMA 3WGIA 1YFHA 1IDYA 3ISPA 1F2PA 3V38A 2HQYA 1OQYA 2KLOA 5IT9K 4L0YB 2ZFUA 4KA4A 1MH4A 2V9KA 1Q7LA 1Y0RA 1IO2A 3GWZA 4IK2A 5JM6A 1XIXA 4H2KA 4P44A 4LG0A 1XEBA 1OCRH 3RI4A 2EV0A 4NGPA 2PFBA 4UXJA 3TP3A 4HQEA 2VRWB 1U5TA 3A9LA 2GE3A 3JUWA 1TLHB 1YTPA 2EWBA 4WCGA 1U0JA 1SANA 2B0UC 4MQ9F 2HEOA 2C6YA 2Q51A 2Q0OA 1SD5A 3CDIA 5JHUA 3HLPA 4MFQA 5FKMA 5FLXK 1V4RA 3LMSA 2WAEA 1BPNA 1PJRA 2DT7B 4ONWA 4CO8A 4PV6A 3GLJA 4KVXA 2ELJA 1G8XA 4RGUA 1FTZA 1DPUA 5IOZA 5BPDA 3E59A 1ETOA 1LOKA 3HHGA 1YLFA 2M0MA 3MGDA 2FOWA 1H0MA 2A07F 1E3PA 2XC7A 4AUXA 3S9NA 2KT0A 1FARA 1IY6A 4H6UA 4U7BA 2HOEA 2ZW6A 1U5TC 2ME0A 2HYJA 2P4WA 2ENZA 1TC3C 1Z8LA 2CRGA 1R5HA 1TQPA 3SZGA 2LP0A 2STTA 1M4GA 3BR3A 2YNEA 5E20A 2R8VA 4JLYA 4MFJA 3JAMK 3Q0UA 2PJ4A 4CRZB 3S3NA 3E6BA 3R9EA 4DYRA 3VSKA 1YE9A 4QWQA 3OYDA 3JRGA 3P9CA 4IOCF 1MNEA 1S9HA 3T8RA 4G7OF 2VXDA 3RYOA 4ZY2A 2V1XA 1IW7F 3HC7A 1U6GA 2BEOA 2DJNA 2O8XA 4R8HA 4CA0A 3G71I 3AG4H 3FNCA 3ABUA 3ZGKA 2H6BA 4A3JJ 3CF5F 3D8PA 5H2FC 2QCOA 1SGDI 1YW8A 2IGMA 1FYLA 2BZTA 3S1NJ 4P55A 2HKOA 5CQGA 4PFPA 4ZI6A 5K1YA 4JWPA 2IEKA 1HF0A 4FETA 4XMYA 3GOXA 4HDVA 1IN6A 1XCBA 5HLIA 4F92B 1TQMA 2XEJA 5LEJA 3NWTA 2B63J 4ZY0A 3LSPA 3OR2C 3TDUC 2ZEPA 3V7ZA 4L9NA 4Y3OA 1YTYA 3Q3SA 2VBYA 3JRIA 3ECOA 1A31A 1QU3A 2CF4A 1AN1I 3UNGC 4EM1A 3BG3A 3S3MA 4AIJA 1UAAA 3IU2A 2ETHA 2XV4S 2J5OA 1QNTA 4W9YA 1BOBA 1ON1A 1YU6C 1UB9A 3F8MA 3BHXA 4Y49C 3ZQGA 2WV1A 2LY2A 1BI2A 1KYZA 3IO1A 1TF8A 2I79A 1UCRA 2ZC2A 4HF0A 1YIJI 1NXUA 3TX8A 4LX9A 1IOIA 4KOVA 1WJBA 2LK2A 4UVBA 2FA5A 4LMYA 2XIGA 2VJ4A 4E4HA 2XROA 2NAZA 2DT6A 2G3AA 2CW7A 5M3MJ 2Q43A 1LDDA 2WVJA 4YU9A 4M3GA 5THWA 4MFEA 1YW6A 2CV1A 3SI2A 3RZAA 5L3CA 3DGVA 1NH3A 4KITB 1XG1A 4HV5A 1Z7UA 5GTHC 4RB1A 1IGBA 1M1DA 1LANA 4Y13A 4CRYB 3E0JB 3IRRA 2L0KA 2GZWA 3GFIA 2RGVA 4B5PB 3ZMUA 2D1VA 4KUAA 1A6IA 2KJCA 4GYIA 1EJ9A 5CJ9A 5ICFA 3CCVI 4IKFA 3GTMJ 4QC6A 3GTOJ 1Z77A 4LIVA 5BQTA 3MRUA 3GZNB 1U6MA 3GCMA 2Z16A 4OMYA 3L2VA 1B8IA 4CCOA 2E5RA 5E3PA 2XAFA 1IY7A 3SEKC 2XKPA 3I59B 1RKWA 2EQRA 4PXDA 2MH9A 2RFHA 1KMAA 2OD1A 2JT1A 1RTQA 2PJCA 4NGRA 3HTSB 1AU7A 2H27A 4HLXA 4HF2A 2OUMA 1QSOA 4UB6C 1MBKA 5ILUA 3OYBA 2XAQA 3O3KA 4NC7A 4GI3C 2DA4A 1EH8A 3A01A 3C18A 1VQ9I 1DU6A 2X7BA 1XCVA 5K8PA 3BLNA 2B3UA 3V8LA 3I4NJ 1YW7A 5L3FA 5K5QA 2HS5A 3V7RA 4DZJA 3D7FA 3FXUA 4JD6A 4ZYQA 3CCJI 1NK3P 4B3AA 2JA7J 3NE8A 1X1DA 1WQ2A 5IV0A 2EK8A 3KYLA 2O0YA 2QWWA 4PJJA 3WTTC 4BHCA 2ROWA 2R7ZJ 2CWGA 4HX7A 2A3SA 2Q4VA 2L9NA 3DTIA 3P7NA 4DYQA 1WSUA 5FLXZ 2HPIA 1OBRA 4P45A 4PXEA 1R1TA 2ZNZA 5HVQC 2KMQA 1BIBA 2XDVA 4HPSA 4BL0B 2KHMA 4UUSB 2M2EA 5TJJA 3T90A 3U1KA 4IPAA 5EZHA 4Y7NJ 2E2JJ 1QA6A 3PNVA 2B8TA 5E3LA 3W6SA 4EJVA 1TT0A 1BI0A 3CO6C 1IOFA 4R3LA 2JZYA 2OD5A 4ORFA 1SGRI 2DA3A 5EMIA 4NC6A 3W3CA 2B7EA 4II2A 4C9YA 2OH1A 2RAEA 4CGNA 1FMVA 4XPLA 3IWGA 2AXTC 2MYSA 3S6KA 4LUAA 3JSOA 1IZ1A 3C2HA 1Y6IA 1LJ9A 4HSTA 4KFCA 3QTLD 5ICEA 1TZLA 4BHBA 5DUIA 2W4SA 4BACA 4OC1A 1XSDA 5GPCA 1FNOA 3LA2A 4LB5A 1AWCA 1MBEA 4X0GA 2ZEFA 2KPMA 3EYYA 4OAEA 4OMZA 1ZH5A 1R23A 2D5VA 2E7WA 1ZG1A 3V4GA 1YJNI 3A4CA 3KP4A 4B3XA 3FECA 4NGNA 4EM2A 3R5DA 4CAXA 4UUSA 3BTCA 3K9TA 2E1MC 3BWGA 2RDPA 1FOYA 4BXFA 3KETA 1PCAA 2X4HA 1D5VA 4WK8F 1HDPA 2JA1A 2V1CA 1WWXA 4WP4A 2OU2A 4W1UA 2YX4A 2WB1A 3IHUA 2GKRI 4UFVA 1B6AA 4B13A 3SJEA 2GXGA 2ELKA 2K7LA 4F6AA 3DF8A 4RM2A 1T0FA 3B4VC 2ZEHA 5AG6A 2NYQA 1DQUA 2CS3A 1D0XA 4ZYAA 4E6KG 3CF2A 3WODF 4B4CA 1FSHA 2F5VA 2HR3A 2X1DA 4UNOA 2SGEI 4I98B 1SVOA 4I7HA 2GIVA 5JVTA 3PGPA 4MXUA 2RVCA 3EUHA 4OIRF 1GHCA 1WJAA 2WAFA 2WC2A 2XAHA 1GV2A 3ZR8X 3NH5A 2R98A 3PP9A 1OJLA 4XIDA 2JQ7A 4ENKA 4R6TA 4ESBA 2XEIA 2DMQA 5CQEA 2A20A 3CUQB 1WH7A 2HTJA 1I1GA 1N13A 1ETVA 1H8LA 1S5KA 3DDDA 3B35A 4X5KA 3EO4A 2BV6A 4L5JA 4RAZA 5F64A 1BOAA 4BEHB 1TTYA 1KBFA 4Q38A 2Q2EB 3CMYA 2VONA 1R43A 1ZGAA 1SQHA 2DQLA 2ZCWA 4GYGA 3ZOBA 2PJ0A 2E71A 1HKTA 2MFZA 1U3EM 3ISZA 1X4OA 1BR1A 2QA4I 3I53A 1T38A 4NFRA 3IAS2 3DNSA 4UWIA 4K2EA 3VWDA 4CPAA 3S15J 1U8RA 1R4NB 2O28A 5JH9A 1KU7A 2Q0YA 1T2KA 2ZSIB 1ZLHA 1JJ8C 3WC7A 1NG7A 5KTDA 3HUGB 1HC8A 5HQ8A 1F57A 3LSMA 3S8PA 1DDNA 3E97A 2RQQA 3L1PA 2OCCH 2K3PA 2K27A 2LF8A 2Z10A 2E19A 2JPBA 4JCVE 3DLAA 1HCRA 4Y49B 1A04A 2L3DA 3S6FA 2NXNB 4CGPA 1SFOJ 2ISZA 5DS0A 5GTIC 4FWUA 2WADA 4ABZA 2M45A 3A01B 3ZMDA 1CP6A 3T5XA 3IWWA 3JTKA 2OZ6A 1I21A 2J87A 1KU2A 3RDIA 4I2OA 4RLQA 1E17A 2P6FA 2DBBA 4XKWA 4E70A 2H5MA 3PB9X 2OJED 5K7ZA 2EA2A 1FBQA 1R79A 2PJAA 5EJCA 2L4AA 1IC8A 2A6TA 1YR0A 3ROUA 3FXKA 2YUUA 3WABA 2JRTA 2GM4A 3FX6A 5IYDJ 5A27A 4KSFA 3UFFA 1HW5A 3UEJA 2Q04A 3KR5A 1IRGA 1KQ8A 1L3LA 5TRDA 5HVFA 3F21A 4WF2A 3FM3A 4KZTA 3U2RA 4KMFA 2QQBA 3M1CA 5H6QA 4A69C 1ULMA 2P5LC 1S29A 4XNHC 2XPUA 4ENNA 1LFUP 1CHOI 2CUZA 1TBQR 1BPMA 4CAEA 4NDLA 1P2FA 3GUDA 1Z4EA 4M6IA 3KEOA 3ZQLA 2V6EA 3HRMA 1ZYRF 5FVJA 1WI3A 1AKHB 4IHWA 1LVKA 1ZR2A 3FSYA 5GAHJ 2ID3A 5IP6A 3SZPA 1QQ9A 3VOEA 3KP3A 4DQ2A 1Y8QB 1ZLJA 2HFHA 3IUOA 1X2MA 2XGCA 3S1QJ 2WSAA 3QAYA 3PNYA 1F9NA 3KIOA 2R5ZA 1QQIA 1FOXA 5HS7A 1CT2I 2GVIA 2R7WA 2K9MA 2D4OA 5J6XA 3OMYA 2I3CA 4F9VA 2NS0A 3VB2A 4JK1X 1QVUA 3W6KB 2IP2A 3BI1A 5DCMB 4PXCA 3FDYA 3BZKA 5KAFC 3U21A 1W4RA 3F72A 2K86A 4IX7A 3M07A 2ZFWA 2E1OA 2CNMA 3LA3A 2HYGD 1NMTA 4WXHA 2DQRA 4RGSA 3IV5A 3JCUC 4YIRX 4OIDA 2PX9A 3OIQA 2ESNA 1Q2YA 2Z3KA 1VQPI 3HSRA 2W57A 2XAGA 4C3HJ 4CGZA 2ESHA 2WAQA 4NSQA 4C2MJ 3WG9A 4D5CA 2RIJA 4E7ZA 1X12A 3B8GA 4UUVA 2BHYA 1BJZA 3DP7A 2EFNA 2RNGA 1E0EA 2JLMA 3DPLC 3WTWC 4A5MA 3G1MA 1Z6RA 2OCEA 1JE8A 3BR0A 2JSPA 4B44A 2KIMA 2ZSHB 2BSWA 2K9NA 3ZMTA 4ZYDA 2DOFA 3B3CA 4I49A 2P6AC 1PUFB 1ZREA 1Z91A 2KZVA 3KLOA 4GXOA 2HOAA 1L0CA 2PIYA 2GQQA 3HYIA 1Y1BA 1V1HA 5HVGA 4FCYA 3T8TA 4F7ZA 2NYXA 1K7UA 5JPHA 2D4PA 3IKVA 5FUXA 1LFPA 3OYGA 2O7OA 5CVJA 4A12A 4PGHA 2XGEA 1K4SA 1YLOA 2FD5A 3RQIA 3UKGA 1N78A 4ZGYB 1X1BA 2AFOA 5ICGA 2KCWA 2K3FA 4OKOA 3ERMA 4F93B 5LEKA 2I8DA 2H09A 2ZXIA 3GLXA 5L3BA 3PBBA 3GYHX 4IHSA 3S1MJ 2V7FA 1T56A 4O5VA 2KCXA 3BZ6A 4L5IA 4YWYA 4FX0A 2M0CA 4EQQA 1HJAI 3DBLB 2BGCA 2QM3A 1J5YA 1W1WE 2QF7A 3OOPA 1V5EA 2HQNA 3QP5A 3HGGA 2AFSA 4K30A 2XAUA 3DLJA 2IS2A 4S04A 4C7HA 1X1CA 3VATA 2HNHA 4QPOA 4M9XA 2YGWA 5K8MA 1FLIA 2GANA 1I6HJ 4ESJA 4KICA 3MFKA 5ILVA 3HOSA 1G3TA 2HXOA 1HKQA 2X9DA 3CMMA 4E7LA 4HX4A 1U8BA 4QUSA 4H0EA 4UFWA 1V54H 2LR8A 3BY6A 4JJXA 2F4OB 4OWRB 1W0TA 1WI9A 3I56I 1XN7A 2QBYB 2NNNA 4MTEA 4MJ8A 4BJTA 5JR3A 2M8EA 2AQEA 2Y31A 3LFUA 5K7FA 3M3YJ 7WGAA 5CKTA 1KWMA 2FQ4A 2JUGA 2VBQA 2VPRA 4BEHA 1STZA 5B1BH 4N0BA 4PXBA 2TRTA 4SGBI 4C68A 1SEUA 2D45A 2LMDA 1QZZA 2B58A 4G7HF 9WGAA 2HDDA 3H0GJ 2WPWA 5C82A 1F5TA 2K02A 2DU9A 2TCTA 4H4KC 4QLCU 3HOZJ 3R5AA 3K4JA 1N71A 2ORWA 4L9VA 4UCMA 3ABLH 2B5GA 4KDPA 2EPFA 1QGPA 3AL0B 4JZ0A 2CFXA 1UZCA 1WZ2A 2QSHX 3WU1B 3OYKA 1M1EB 2AO9A 1BBYA 3H9GA 4XN0A 3OYFA 1ULYA 4PJ0C 3JVNA 4P4FA 4YFXF 2QUFA 2VKVA 3HRUA 3OS1A 3KZYA 4GDFA 1V55H 4YRVA 2P5VA 3QB8A 1K6YA 1OVOA 4V2GA 1JKQC 1TGSI 4A0ZA 3BROA 1XDUA 2ID6A 3KX2A 2Y30A 1LCPA 3L9FA 1BR2A 1BLLE 1P4AA 2FXFA 1JUPA 3RKWA 1H8AC 1R00A 1VQ6I 2R92J 2F3CI 4BINA 1YS6A 5IYCJ 2V1CC 3KHZA 4LOCA 2LVSA 3ERED 4MIMA 4E7KA 1IXCA 5EEAA 2CV0A 1UUCA 2I00A 3GMEA 3I1UA 1X74A 5F48A 1PCEA 1RESA 1W5SA 3K4KA 4EJOA 4IHYA 3KY9A 3SI0A 4V2FA 1D1CA 1VGYA 2VI6A 2DA2A 3ZMZA 3F8CA 3IL2A 1M4LA 1YK3A 1FPQA 1B1BA 4ZDPA 1UHSA 4DW6A 3HOUJ 3LWUA 3P9IA 2X52A 5K8NA 5LYFA 2PR1A 1WTJA 3FMRA 2X6XA 5CPAA 1U5TB 3FF3A 1B9MA 3EC4A 4MHNA 3VFZA 2EK9A 3FXLA 3CESA 3ZN0A 5LYDA 2LKXA 5KCMA 3S6HA 5IT9Z 1YW9A 1CE3A 4R8FA 4GFBA 5HI7A 1XC5A 1YQAA 3LOCA 4GO1A 3CCRI 4L9JA 2L01A 1FTTA 2GA2A 3EDPA 1ZG8A 2WTEA 1KQ0A 3H1CA 1HW2A 2G7HA 2VZYA 4P4IA 1LE8B 1T33A 3M8FA 3BQZA 4XK4A 2R7SA 2DK5A 1MMAA 1S7NA 4XLEA 1KU3A 2LOOA 4A94A 4KNYA 1JHHA 4OOIA 3CMEI 4M3BA 1YITI 3JRHA 1IAWA 3PQJA 1OCPA 1JUMA 4KLWA 1UELB 1LEAA 3NRVA 4PK4A 4RB0A 1LR9A 1WJ5A 1YYVA 2L7KA 1MBHA 1R22A 1XRYA 5DD8A 2M87A 5FO5A 4B8XA 1KYWA 4RA2A 2DPTA 3NAUA 2K9LA 3Q0VA 4AVBA 3RPQA 4A30A 3ASOH 3IC7A 4ENMA 2CJJA 2IAIA 1YI2I 1JWQA 3E2IA 3WTZA 3RIRA 2EVNA 4XLPF 1Z1DA 1PP7U 3KZIC 3MAJA 2X48A 2MC3A 3KP6A 1VI0A 1R57A 4XPDB 2IBDA 4P10A 4QB9A 4A3KJ 4E2AA 2IW5A 2LNBA 4XLHA 4EVIA 2RN7A 3OYLA 3EETA 4B12A 1XX6A 1Z21A 4U0VA 1FZPB 5J47A 3TEDA 4M6XA 2QEXI 3P2HA 2QKMB 1S6LA 2LBFB 2ZJPF 3I9V2 1ACIA 5DEQA 5BPIA 1JI8A 2E1CA 2ANPA 5LRRA 3ZCOA 3OIPA 3H8FA 4GXHA 2PMUA 1FYKA 5LRJA 3V7SA 3V8IA 4XL9A 5ISVA 1I6XA 4A3DJ 1WPKA 4QTRA 2VZZA 2CUJA 3PO3J 1G2HA 1YQEA 3HSEA 3VARA 2CQXA 3FXJA 4HAMA 4RB2C 3QOEA 3WR7A 2UXXA 5E1ZB 1BL0A 4UEFA 4RS8A 3WTVC 4OIOF 3GTLJ 1IY5A 2EIJH 2W00A 3EUAA 1BW6A 2ZJQF 3OXGA 1RZ4A 1A6QA 2QENA 3TDZC 4A93J 3CP8A 3R1KA 4OC0A 4CHUA 2Q8KA 1Y1VJ 2JBKA 1HOMA 2MLKA 2M8GX 2Y0SN 3CDLA 4B48A 2CWHA 2WCYA 4IL6C 4U9ZA 2V9VA 2CWEA 2UXNA 4UEZA 1XOVA 2RQPA 3O2PE 2FL4A 4B10A 4NB5A 3BT9A 4PDKA 4CCMA 5B3SH 3L2WA 2IRFG 4OU0A 5AG5A 2DMTA 1BR4A 1POGA 2P5KA 5FKNA 4BS9A 2AQFA 1PU9A 3DV8A 4CDGA 4DYCA 5FRMA 3IKTA 1JXSA 3KYCB 5HOOA 1J7KA 2KMOA 4M6GA 1WH5A 5J1RA 4EV0A 4ESFA 4NQWB 4KIFA 1WGTA 2BOAA 3W6JB 2D1HA 2ZJ2A 1OFCX 2DYRH 2XRCA 1ZO0A 5G21A 1I12A 3IWEA 1R6RA 2NMTA 4XOTA 2RB7A 2BY0A 5J3LA 2ZKZA 1K78A 3MN8A 1XGNA 3PL8A 5KTAA 3OYJA 5LFAA 3M7GA 1T8IA 5D5WB 2FF4A 1R9TJ 8CPAA 5HDNA 3N97A 4KISA 5CNPA 5JLXA 1XMKA 3H36A 2VLAA 3L2UA 2GOXB 4BQAA 2XUBA 4MEYF 1YX3A 4XQFA 1T6SA 3I54A 5HDKA 1A2ZA 1ETXA 4KOWA 2GFQA 2ZW4A 1AHDP 2FU4A 2XGXA 2YU3A 3JR9A 4G6QA 4BE2A 3LODA 3VH9A 3WC5A 2QQCA 4D7MA 4ZYHA 1WJCA 1ULNA 4X2TA 1Z2IA 2QLZA 4IUSA 5BS6A 4I99C 4ZZDA 4IO9F 3MKWB 2CWFA 2F6CA 2Y48A 2F5DA 3D00A 4XPKA 3SGBI 4WXDA 3HKZA 3WU0A 1ZR4A 1VFCA 4NCZA 3SEZA 3TT2A 3VDXA 1Y0NA 4F55A 2EZKA 1W0UA 3PUBA 1Y9KA 2IVMA 2JWTA 2XF6A 4CYCB 2J8NA 2HU9A 1GUUA 2HPMA 2EJRA 5C44J 3KEYA 4D5FA 2OR4A 1GVDA 1SGYI 3E6MA 1Y1CA 3NH4A 2QSFX 4PJNA 4XPDC 2KMUA 3BLYA 1Q2DA 2ECBA 2IS6A 3DTEA 4KOTA 1D3YA 2L5QA 3R5BA 4HW0A 2BUSA 1U9OA 2VKEA 1HA8A 5DCMA 4KOXA 2BXZA 1P9ZA 2FBIA 4B1RA 3ZZIA 2AFZA 2OOTA 5L3EA 2UWMA 4G12A 3JREA 2DCEA 2EFQA 1X4PA 1QHGA 2IGKA 4PJMA 3COAC 3DWLE 5K7HA 4IRIA 4JBAA 5DCFA 3LAPA 5EC4A 1CGJI 4EEFG 3E6DA 1FWZA 3SFZA 3CCSI 2AHQA 3S3OA 3FXTA 2OV7A 3HJEA 4U7DA 1PYVA 3OVOA 4NNJA 1H9TA 1S7EA 4I09A 1VDDA 5FD6A 2X3TA 5HVHA 5AG4A 4M6VA 4FHTA 2ZXVA 2C6PA 4M85A 2I10A 2V8VA 4BMHA 2Z3MA 1S60A 3R5CA 2CFOA 1J9IA 2Z33A 3CJTB 2KRHA 2ZEGA 3FK7A 1TWFJ 3BTIA 3FHNA 4L18B 1FX7A 4XSXF 2ZJRF 5CPRB 2PJ9A 1LRZA 2PVWA 3BR1A 2DMPA 4E7JA 1RUOA 1YLEA 2P7CB 3KLNA 3ML6A 7CPAA 3K4BA 3RBUA 4RB3C 5HLHA 3S1RJ 3GYAA 1S3ZA 4BJ6C 2EBIA 4UXIA 4BBRJ 3FC3A 4LIUA 3CCLI 5JGFA 3MZ8A 4XM3A 3CQZJ 1VTNC 3UGDA 3L7WA 3I71A 3ZQ7A 1HKSA 2OAZA 2R0QC 1LR7A 2JK3A 4NF1A 2NOGA 1XE4A 5DS9A 4CYQA 2CSOA 3RSNA 4FKDA 2GXAA 3D4UA 3IC1A 2E1NA 5K5RA 3EY5A 2CW0F 3K4LA 4A38A 4JX4A 3DPTA 4MQVA 1YW4A 3DBRB 4QVTA 3BJ6A 1H89C 5J8CA 1N75A 3D7HA 3HPGA 3EQLF 2YNDA 1IXRC 4GRIA 4RM3A 1HW1A 3IH2A 5K5OA 3LACA 1Y0YA 2YU9J 2VXZA 2F4MB 4KYWA 4OP4A 1FSEA 4JOMA 2FVGA 5LGNA 4MHYA 4LFUA 1IB1E 4ETSA 3W2VA 3OYMA 3VE5A 1VQOI 4C2TA 2SGQI 2DDAA 1RIOH 1T08B 1TWAJ 1GV5A 3D5RC 4AVPA 4U0WA 4EGYA 1VQ8I 3E7LA 2AE6A 1RKTA 1Z8TA 2XRNA 3CXLA 1ZGWA 1QO0D 4PFOA 3S2HJ 3FJUA 1USSA 2IGNA 1T0FC 4B11A 2DTZA 3NH8A 4X1EA 4U87A 1VZ0A 1U9NA 1ZQ3P 2M7BA 1Y56A 2LY1A 3RJPA 4A2UA 5LRSA 5K8OA 1FT7A 2BW3B 1EH7A 4RLFA 5HH1A 2W7NA 3EUHC 2ZB9A 4AU7A 5DAEA 2HDWA 3FZVA 3CCEI 2IGOA 2VC0A 5FGMA 1MNDA 3O8HA 4LK1F 2R5YB 4MEXF 5HNHA 2STWA 1CG2A 2ZOGA 4OADA 2HZDA 2B5GB 2F7VA 4YFJA 1XDSA 2YS9A 2HOSA 1XJOA 2OA4A 3RPUA 2L7MP 3W2WA 3OYIA 4HNYB 2KISA 4MNUA 4MHGA 1J2XA 4C2XA 2EA4A 2XAJA 2QQ0A 3MKZA 2FNPA 5AGEA 4ZX9A 3REOA 3HRTA 1LUJB 3ABTA 5EG0A 2JVHA 2Z11A 1RPWA 1W5TA 4WX9A 3OYCA 1HEEA 3GW2A 4FQGA 1CT0I 4N9HA 1W36D 3FK6A 2ENNA 1MZBA 3G2BA 4FAIA 3A02A 4L9TA 4YELA 2FIWA 3B3VA 3BCBA 5E1XA 2YQPA 2LKSA 1B6BA 1ZG7A 3ULQB 2MABA 4IHMA 4F0YA 2DA1A 3TTHA 1V5GA 4B6ZA 3G1OA 3DSBA 1RR8C 4IHVA 4X8IA 1IRFA 3QWLA 4C2ZA 5KHDA 4R79A 3N7ZA 1CSOI 4DJLA 2KDOA 3HOXJ 1MJBA 2CY2A 3F6OA 3LA7A 2Z3YA 2LREA 5FFZA 3HTUA 2EFOA 5J1QA 3D5SC 2TDXA 2JZMA 4JXRA 4ZYEA 1U2WA 4LK0F 1ETQA 3M8JA 1YRNB 2IS1A 1CX8A 4MCSA 4G9YA 4HNTA 5FKLA 5BOXA 4BBSJ 5E18F 2XEFA 3QPHA 1TBRR 3DEUA 3I4MJ 1B9NA 2BHZA 2EH3A 3MKYB 1RRJA 2HUZA 5LYLA 1BC7C 1G6NA 1MBJA 1MMNA 3OYNA 2DPUA 2HGCA 3FX3A 3SXNA 5J8FA 1LE8A 2ZBKA 2ODDA 2X0LA 2Q7SA 1ETWA 1S3JA 5CVUA 3LAJA 4A3MJ 1F1ZA 4Q48A 5DWNA 2P6SA 2D2WA 5LD2C 4EFDA 3SJMA 3GY9A 2M5XA 1MMGA 2COMA 4KVME 2M9HA 5HLGA 3A0HC 3RZDJ 1JKRC 1Z05A 2WGCA 2Z2SB 1M8BA 3VDUA 1FYBA 4AVCA 1WFXA 3LSKA 3FF5A 4GM5A 1JJ6C 2CH0A 5FRNA 3RZOJ 1WJDA 4NQWA 2V53A 4MLOA 5TGTA 1GDTA 4OAYA 4CS0B 3ASNH 4MO7A 4M9SA 4A6DA 4EGZA 2LTPA 4NC8A 4EJUA 2Y2ZA 2HVQA 3EFAA 1VQKI 2KJBA 4R3KA 2FE7A 4MPIA 4CGLA 3K10A 4ENJA 3B6AA 1OZPA 1CQTA 3K4NA 3B6CA 4D7NA 1ZHFA 5J1YA 2WA0A 1FAQA 2YNCA 4YIFA 4MHDA 2FE3A 1X3WB 3TJQA 2F5FA 1JGGA 2K5CA 3CCMI 3CCQI 2O6GE 3IAM2 2NOJB 1R3NA 2LC2A 2O03A 1ZLKA 2VQLA 1ETKA 2EB7A 2ZXWH 2EILH 2L2OA 1YVKA 3D67A 2SGPI 1N77A 2V1NA 2WBMA 3HB9A 1S7AA 4F91B 1HDDC 3S16J 4UA3A 2FNFX 3S6GA 4KJZA 3LNQA 1SC7A 1T39A 2FXAA 4LB6B 2Z5UA 1LPQA 4KOUA 2K5TA 4B43A 2VE9A 1Z9UA 3C2GA 4IEJA 3OYEA 3CZXA 4LQ6A 4MFLA 4BE1A 1K61A 3BTJA 3IGRA 3JTGA 2L54A 1W3SA 2IA2A 2IQ6A 3PUFA 5D8LB 1RI7A 3KYDB 4BUPA 2RKHA 4UB8C 3KCCA 2E73A 2Z1DA 3OOUA 1SFUA 5KAIC 3ZP5A 1M8CA 2PRQA 3CUOA 1IXSB 5KVRA 1FNNA 2CO5A
chains in the Genus database with same CATH topology
1RUNA 1ZG5A 3D2PA 1ON2A 1MDMB 2DT5A 4RGRA 4MI4A 3T9YA 4B09A 5IT3A 1SMTA 2OQGA 1ZRDA 4A5NA 2VOPA 1XGOA 4R57A 3CXQA 2Y0MA 3ELKA 1T98A 3TGNA 1TNTA 4H89A 1O3RA 2NNYA 1LDJA 1P4NA 2A4NA 4UVAA 2CG4A 2W85A 4MGRA 4L0ZB 3D2MA 2ATRA 3IWFA 2JDCA 2LKPA 4LGWA 3FM5A 3KP7A 1CGPA 3PFIA 1PUEE 2QVOA 1I27A 2G7UA 2R1IA 2GXBA 4KVOE 1OYIA 1L0OC 3SHFA 1LDKB 1K6OA 2HDCA 2O61A 1O3TA 5F1RA 3CXPA 1ZG3A 5LHIA 2BUEA 1HSJA 2BEIA 3HHHA 4MBUA 2QYOA 1FBSA 2ELHA 1P0HA 4A95A 2EWNA 2YPRA 3TOBA 2PG4A 5E8GA 1Z6TA 1S7LA 4WWCA 3CTAA 1XB4A 4G8XA 4EVYA 2V6CA 2M1BA 3GZ5A 3M1EA 2OZGA 3NE7A 1QSMA 1BIAA 5D4SA 4IJAA 2L4MA 3M8EA 4CGOA 3QAHA 2IL4A 3F23A 1BJAA 4CRYB 2JSCA 2OB0A 2WV0A 1IUYA 3CDHA 1BM9A 1UHWA 4M71A 4XRFA 2B0LA 1BC8C 1HSTA 4AVAA 3R6SA 4L89A 2P6TA 2IJLA 5CVIA 3TO9A 2G3TA 3K2ZA 2ADUA 3GEZA 1J0RA 3PQKA 5ERIA 1GXQA 3L00A 1P92A 3FMQA 1YO5C 3B02A 3TCVA 3VEPA 2C27A 4KOYA 2A6EF 4G6DA 3RYPA 3J80K 2A5YB 4CGMA 1SD6A 2EV6A 1D8KA 3CJNA 5HDGA 2YX7A 4H6ZA 1MKMA 4KORA 5A2QK 2EUIA 4CZZA 2UZKA 2H94A 4HX8A 3PZJA 4O3MA 2PDOA 4M9ZA 2E7XA 3K1NA 4PSXA 4KIBA 4B14A 2FT0A 2VT2A 1RNLA 4ASNA 3SHPA 2OZUA 3I9SA 3G73A 5DUKA 3HSFA 2CXAA 1ON0A 4LLNA 4KMUX 2ZNYA 2XHKA 1QBJA 5H86A 3GFMA 4JQFA 3T1BA 3R9GA 3D3SA 3T0YA 2XVCA 5D6EA 1AOYA 1FT9A 5CLSA 5JQ4A 1KUXA 4CYNA 3E6CC 3SXYA 5A28A 1E2XA 4IRGA 2DK8A 1G3YA 3S2WA 3QOPA 3WTYC 4YGOA 2VC1A 2DAOA 3GF2A 1CF7A 5G20A 1DUXC 3KZZA 3F8KA 5ILSA 4HA8A 1O3SA 3G8WA 1QPMA