3TO9A

Crystal structure of yeast esa1 e338q hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Histone acetyltransferase ESA1
total genus 83
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to9A02
4HA8A 4OIOF 4ZZDA 1EH6A 5HLHA 3L00A 4KIGA 2EFOA 3GKRA 3QB8A 2OQGA 2IP2A 2G7HA 2R3SA 2A3SA 5F46A 2F5CA 3QRFF 1CF7A 4Q5SF 3MCZA 4UXNA 3LODA 4KOTA 5K5RA 3F21A 1W7PA 1ZRCA 3ZZIA 1XCBA 1I27A 3N4MA 3F3XA 4N9IA 1P4WA 1T39A 3GUDA 5F6FA 2EFWA 2NYXA 1PUEE 3RIRA 2Z99A 3F8BA 2RN7A 3WGIA 5FO5A 3P9KA 1R1TA 1QBJA 4RB3C 3DP7A 1BC7C 2PSWA 2RQPA 4HX7A 1U5TC 2CO5A 1BOBA 1R1UA 1XEBA 1A04A 3KZYA 1U78A 5FFXA 4IJAA 2UZKA 2OZGA 5FFZA 2VE9A 1RO5A 4OIRF 4CICA 4KYWA 2CWEA 3JAMZ 1RNLA 1K7AA 2C6YA 1OMIA 3F8FA 5F48A 3EQLF 3FYNA 2EFQA 1I6XA 1R1VA 4LK1F 1J5YA 2VC0A 5E1ZB 1S29A 2FOKA 2C27A 1S5KA 1T2KA 3KZZA 2B5GB 5HDNA 2UXNA 2FMLA 4D0PA 2Z11A 3C1DA 4PDKA 4P9UA 3G8WA 3EETA 1OYIA 2HFHA 2KJBA 3M9AA 3DSBA 4KOYA 2VT3A 2D1VA 4A12A 3H4QA 2L4MA 2GA2A 2M8EA 1XIXA 2OD5A 5BQTA 4MHDA 3U2RA 2M87A 4KDPA 1KU7A 5CLSA 4R3LA 1M4GA 2FNAA 1IUYA 3T90A 4L9VA 2RV8A 3KP5A 1NMTA 1FNNA 2LDUA 2PR8A 2EV5A 2FS5A 2JLMA 4KUAA 2JDCA 3FM3A 3P7NA 1YREA 5KTCA 1QSMA 2B4BA 5E96A 1SFEA 4YG2F 2E1NA 4M9ZA 2DW4A 2Y48A 4R79A 5DWMA 4DQ2A 1MK4A 3ELKA 5FLXZ 5E1WA 4XPLA 2A6HF 3GF2A 2K5TA 3HRSA 3GYAA 1JE8A 4JBAA 1YS7A 3BJOA 1V0CA 2P6FA 5D8LB 1B6BA 4HOBA 3JTHA 1IN8A 2BYVE 4CAVA 3FX3A 1JHFA 3K1PA 3TGNA 5DEQA 4U7DA 3S2WA 1YW7A 2DPUA 4FD4A 1D8KA 4HX4A 1T6SA 1B9MA 1N71A 2D4PA 1J0RA 3JSOA 2FRHA 1QO0D 4YIIA 4YIFA 4PCQA 3F6VA 5LBQA 1HSTA 4OU0A 3KEOA 1KA8A 3I5UA 1D8JA 3MWMA 3PFIA 2PRBA 3R0AA 2VT2A 2BBYA 2R98A 3IHUA 1I1SA 5DCMA 2JEVA 4ZZLA 5IV0A 1FP1D 3TFYA 5HMNA 5K1YA 3R9FA 3F22A 1OPCA 3HHGA 3K9UA 5D6EA 2DLLA 2MLKA 2AE6A 1FBSA 1K4JA 1KQ8A 2P8TA 4KA4A 4F0YA 2XAQA 1F9NA 1YYVA 2OH1A 2PG4A 4CYDA 5L3DA 4XPDC 2W57A 3J80Z 4B09A 3V8LA 2ELHA 2OQRA 3K9TA 1TIQA 4JQFA 3ZQ7A 3T1BA 1T0FA 4BYYA 1WWZA 1LQ1A 4GYIA 5LLQA 1XMAA 4YFKF 3EUHA 1IIDA 2GANA 5L3CA 1Y9KA 3NQOA 1WSUA 1ULYA 4NB5A 2EJRA 1BI1A 5H86A 2PI0A 4EVIA 1X3UA 3ZN1A 1STZA 1ZG3A 1PP7U 4NHJA 4JLYA 5F64A 1XSVA 4HNWB 3SZTA 4UHTA 3B8GA 2BE5F 2ZBKA 3ECHA 5L3FA 1CGPA 5K5QA 2AS5F 3H92A 4P9FA 2FSWA 3I71A 2D45A 1VHSA 2P4WA 3D2PA 2IW5A 5DV5A 1BJAA 6PAXA 2REFA 4B8XA 2DAOA 3WODF 3F72A 3IRRA 2YX4A 2NAZA 2WC2A 1MGTA 3DPLC 4LG0B 4OIPF 4E0AA 1GXQA 1U2WA 2FBHA 2JRTA 1G3WA 2ZCWA 1TW2A 4LJZF 1SMYF 2EB7A 3BP8A 4Y49B 1BM9A 5DUIA 3W6XA 1I21A 4XSZF 1FWZA 4ZYEA 1R57A 1M4DA 1WWXA 3V7CA 1G6NA 1LJ9A 3EYIA 2KIUA 3DXJF 2A6EF 4I0AA 4KMFA 5TRDA 2R7FA 2TDXA 2ZJ2A 4BAYA 4JXRA 1R00A 4M6XA 4MY3A 2W24A 1PU9A 3JSPA 4Q47A 4KVME 1TQMA 3GY9A 3ZN0A 3ZMDA 4FX0A 1M4IA 3BROA 3RKXA 5HDGA 5ERIA 4EM1A 2AJ6A 5D5UB 2O28A 4KLVA 1ZH5A 1J2XA 1BI0A 1BI3A 2FE3A 1KQ9A 2J8RA 2QM3A 5AONA 3F8MA 4UVCA 1JXSA 1HW5A 1TBXA 4NSQA 4E2AA 4ZYGA 1B87A 4M9SA 3IL2A 4KUMA 3WG9A 1KGSA 5D5XB 4S04A 4R57A 2PLYA 1DUXC 5ICEA 5IT3A 3DDDA 1R5HA 4OOIA 1DP7P 3M8FA 4IHSA 5LHIA 5ICGA 1TNSA 4MTDA 1TLHB 3LA3A 5EEGA 2GQQA 3IWFA 2DO7A 1CF7B 2ZFWA 1FP2A 5DD4A 2V9VA 1F4KA 3L9FA 1OZPA 3MAJA 3S6KA 1ODDA 2K4BA 3GFIA 3QPHA 2PEXA 3CTAA 1HKSA 3WU0A 5FD6A 3FMQA 4L0YB 1SD5A 5LEKA 4WXCA 4OMZA 4ENJA 1ZRDA 3EC4A 1ZLKA 2PJPA 2HS5A 1QSTA 1NE9A 4UWJA 2CQKA 4HBLA 1VTNC 3DV8A 2A5YB 2HYFA 2RDPA 2FBIA 2PQ8A 3KP3A 3RPUA 1FBQA 1FBUA 4RGXA 4AVAA 2O0YA 4KN4X 5DCFA 3TDZC 5HLIA 3MEXA 3I0TA 4M9XA 1J75A 4M72A 2XKPA 4IUSA 1ON1A 3Q9SA 2ISYA 3GW2A 1YTYA 4KOUA 2P5LC 1YVOA 3SHPA 3VWEA 4RGSA 3RPQA 1XB4A 3FXRA 1P2FA 2MH2A 5BOXA 2CNSA 3NRVA 1SMTA 4MQ9F 2YPRA 4HNXB 1YG2A 4MJ8A 5D8KB 3J80K 1E17A 4AB7A 2J5PA 3SXYA 2VONA 4NEXA 2FNPA 5ILUA 4H6ZA 1Z4EA 1YGHA 5FD5A 4AIJA 4G7HF 3F8NA 3SFZA 3CUQB 1D5VA 3R9GA 1IN4A 3ZP5A 3E6DA 3LA2A 4Y15A 3N97A 4EJVA 3J7AO 3HOTA 1FY7A 5ED4A 2V6CA 3KETA 1BIAA 4II9A 2Q2EA 2P6GA 4P55A 5JPHA 3VFZA 1I5ZA 1G3YA 4UA3A 3KFWX 4WCGA 4BNCA 2Y75A 2H5MA 4FD5A 3F23A 1FT9A 2RVCA 4ZYDA 3FF5A 4CO8A 2Z3YA 1H9TA 1UCRA 2H6CA 3WTSC 1YK3A 1G4DA 2AXLA 2WWYA 1Q2YA 1FYLA 1E2XA 3W91A 3D0SA 2EUIA 4L9JA 2W85A 4EM2A 4BHBA 3D5LA 2FXAA 3ABUA 4Q4ZF 4MBUA 4HV6A 4AVPA 2QQAA 2YX7A 1HBXG 2V79A 2XV4S 2O03A 2NRAC 4A6EA 1YLFA 3SZPA 2R7DA 4GYGA 1IXCA 5AIQA 2FF4A 5H6RA 4NCZA 3FXUA 2M45A 3I54A 2VOPA 4KOXA 3RTRA 5ILVA 4CHUA 4E70A 4HLYA 2ZW7A 2LF7A 2YSRA 5KTDA 5LEJA 4WXHA 2JZYA 4A0ZA 2E7XA 4GGGA 2P6SA 5D5WB 4L0ZB 4XLPF 5IB0A 3ZMUA 4EM0B 4ESFA 4FD6A 3R95A 1XDUA 3V4GA 1BC8C 2K86A 1UHWA 2PN6A 3KKWA 2H6BA 1USTA 3C7JA 2B3VA 2HQNA 2FE7A 2XRNA 1HSJA 1UHMA 2EV0A 3IWZA 4M74A 1M44A 2BGCA 1HKQA 5E8GA 2STTA 2BEIA 3TO7A 2E7WA 2HYGD 5DYMA 2A07F 2J8NA 1PDNC 3KP4A 3LA7A 4YFNF 1S60A 5BPIA 1S7NA 2GAUA 5KK1A 1F1ZA 3DNSA 1XSXA 3SQNA 1LNWA 3CO6C 3LSTA 1IYLA 5CYVA 3DFGA 3V8JA 2GWRA 2JPBA 1I1DA 3FXTA 4PSWA 1P4NA 2EWNA 2VBQA 5FGMA 4PGGA 1KU2A 5BMZA 4MQVA 3HOSA 1RZ4A 1O3TA 1FYKA 2F5EA 2PFBA 1U5TA 3I9SA 1IN7A 3FIXA 1OYYA 5LGTA 2GXBA 2VBWA 4ORFA 3QU3A 1IXRC 1YW8A 4HF0A 3GEZA 1ON2A 3Q9VA 4OINF 4ESBA 2XIGA 4BHCA 3IRQA 2YU3A 1YO5C 4U7BA 3JAMK 4UUVA 2KJCA 3FZVA 3S6FA 4LK0F 4G6DA 3REOA 3MQ0A 4Q48A 5HLGA 4MNUA 3U9GA 3KP2A 1PUAA 3R4KA 5CVIA 1RIOH 2MD5A 2HEOA 4S05A 4L89A 2EK5A 4AWXB 4OMYA 1YS6A 4WK8F 4L18B 1ZN2A 4QB9A 2XAFA 4XLNF 2J5OA 1S7FA 4R87A 1S3JA 1Z91A 1B59A 2P6TA 1ZAOA 4RB1A 3WE2A 5JHUA 3J81Z 4IPAA 2RC4A 2O6GE 3F8KA 5HH1A 1MKMA 3L7WA 4PV6A 2PDOA 2ETHA 4JXQA 3LQRA 1FOKA 3IKTA 2HTJA 3GFMA 2Q44A 4KIFA 4U5YA 4Y49C 1R36A 4UV9A 3HHHA 4EJTA 2BSWA 3QAHA 1Z7UA 1ZREA 3IKVA 3OV8A 4RAZA 2F5DA 2IVMA 1LRZA 1SD7A 2ZW6A 3EYYA 1GHCA 3HIFA 2GA1A 1AOYA 2CYYA 3GYHX 1P4AA 1Z6TA 2JPCA 2DI3A 3TQNA 2DK8A 3IC7A 2VEZA 4JD6A 5D6FA 5H20A 2VBXA 5HS9A 4B5PB 1PP8F 3DPTA 2QLZA 2VZYA 2ADUA 1XCVA 4I7HA 3BY6A 4KT5C 1O7LA 1IRFA 4KLWA 4N0BA 4R3KA 2XVCA 3HRTA 4IRGA 1WI9A 3C26A 2D2WA 2Q7BA 4AVCA 2LKPA 4KNYA 1OYWA 4LLGF 4FX4A 4LMYA 4ETSA 4J3GA 3I59A 3G3SA 3BZ6A 4GXOA 4P5OA 4A0XA 4HQMA 2FIWA 1U5TB 5CJ9A 1DPUA 1R58A 4EGZA 3ABTA 2Z33A 1P0HA 2MC3A 4NXYA 2FL4A 2P0WA 3FXQA 4ZBGA 3F8CA 2B0LA 3RI4A 3RJPA 5JFRA 2DBBA 4AIKA 3L2CA 1T38A 4HYEA 1U6GA 4I98B 1TTYA 2L4AA 3PP9A 1V4RA 3V8KA 5JR3A 3J81K 1QQIA 4G7ZF 2XAJA 4HKFA 3KLNA 4IF5A 2FMYA 1ZYRF 2JT1A 4FT8A 5CNPA 3S6HA 4HQEA 4R9MA 2ZXVA 2EFPA 2P6EA 1R5GA 2Q0YA 3CLOA 4RGUA 3ECOA 1IYKA 4QVTA 2QYOA 2COMA 2EVNA 2HZTA 1IAWA 2K7LA 3PGPA 1B9NA 5E1XA 4ZH4F 2IL4A 2OZ6A 2DXQA 4CAWA 4Y17A 1I12A 4FD7A 4K2EA 1RXTA 4OAEA 2Z9OA 2NNNA 1VKCA 3QP5A 2H09A 4I09A 2XROA 2Q04A 1Z1DA 1QZZA 1BOAA 3EXNA 4U0YA 3BDDA 1IN5A 5E18F 2OU2A 4YFXF 3QP6A 2ACJA 4L8AA 1ZGJA 3RDIA 1UFHA 4P96A 1LDDA 2ZXJA 3CUOA 3T9YA 3CO7C 2R1IA 3RYRA 2P7VB 3SXOA 2IJLA 4UWIA 5J8CA 3I4PA 1L3LA 3DEUA 4KMUX 4UV8A 4KORA 3OWCA 2KKOA 4KVOE 4ZYHA 4R1HA 2CY2A 1XDSA 2GZWA 3HTSB 2VN2A 4M6YA 4G9YA 2XUBA 4MGRA 2JDDA 4M85A 2FXFA 1HW1A 2VXKA 3P2FA 4IHTA 2G3AA 2QIRA 1SD6A 1SFUA 1O7FA 1S6LA 3HTUA 1KUYA 2DPDA 1MD0A 1RUNA 3RKWA 1KYWA 3VWDA 4YRHA 4GS4A 4H6UA 3DQVC 3PZJA 2FU4A 3T0YA 2FBKA 1KUVA 3O2PE 4BXUA 2A69F 2XAGA 3GVAA 2QWWA 2QMLA 1J9IA 4B5OA 4WF2A 4JK1X 1W5SA 2Z5UA 1LDJA 4A2UA 5DUKA 2V1XA 3R60A 2PBIA 3M8EA 4Z2YA 3IWGA 4DNCA 4WX9A 2NS0A 2OZUA 2H94A 4EGYA 5AIPA 3TOBA 5J6XA 1YVKA 2ISZA 2XGXA 1ZARA 5FB2A 1HXDA 4HZFA 4K30A 4UNOA 3WTXC 2HDCA 3ISPA 3QPTA 4M73A 1IN6A 4HF2A 1B6AA 5J8FA 4LX9A 5H84A 3I58A 3LD2A 2FEZA 3M7GA 5F49A 4OLLA 3CUQA 3MZHA 1S7AA 2G9WA 4XPKA 3WTWC 4RB0A 2ZO4A 1EV7A 5FLXK 2MLGA 2DFIA 5IT9K 5JVTA 2F5FA 3FNCA 1LEBA 1XGMA 5TJJA 5DWNA 3V7SA 1ZGAA 1Q2DA 1YR0A 2WPXA 2XASA 5LHHA 4PZJA 3ZMSA 1TQIA 2Q8KA 2ZMEA 2MBFA 1J59A 5BPDA 1XSDA 4MHGA 3EY5A 4ENNA 2Z10A 4NQWA 1KQ0A 1W7PD 2UXXA 4AG7A 2JTVA 3CUQC 2KIFA 4MY0A 3ZMZA 3C3WA 3KCCA 3TO6A 2B3UA 2HTSA 1XGSA 2XHKA 3SXNA 5D5VB 1SAXA 2CNTA 1I1GA 5JI6A 4ENKA 4KVXA 2DTRA 2WTEA 4CRZB 3ERED 2D1HA 1H9GA 4H0EA 1MJBA 4EV0A 2IA0A 3EFAA 2K02A 4I49A 1REPC 4G7OF 1KZFA 1S3ZA 3GX4X 4IF4A 5LGNA 1ZHFA 4LFUA 3H3ZA 4LGWA 5H6QA 4AIHA 3D2MA 4XPDB 3K1MA 2O3FA 1ZG1A 3P9IA 2XKOA 3TT2A 1B4AA 3K69A 4PK2A 3HYIA 3FRMA 5DD8A 3G3ZA 2WV0A 2R7HA 1WKMA 1DPRA 4NF1A 4QBJA 1TNTA 1O3RA 4IVNA 4A6DA 3ZMTA 4HV5A 2ZNZA 4I0BA 3RYPA 1FX7A 1W7PB 2QECA 3E5UA 5KTAA 3HRMA 4KN7X 2HOEA 3LQQA 1IB1E 1H0MA 2ZW5A 2DQRA 2FA5A 5HVQC 4I02A 4O5VA 2DQLA 2G3TA 2CG4A 2HWVA 3KP6A 1XF8A 4QWQA 1L0CA 3JW4A 2F5IA 2CSOA 3B02A 3GZ5A 4KZTA 3COAC 5IT9Z 3ML6A 1ZG5A 1S8NA 2O8XA 4HLXA 3W6KB 4O3MA 2QBYB 2KCWA 1U3EM 4U0WA 5HDKA 4JJXA 4LLLA 4KFCA 4PGHA 2K27A 1WRJA 1SFXA 3E6CC 2VI7A 2VC1A 2CGPA 4GCVA 5LGUA 4HAMA 4RS2A 4YFJA 3HUGA 4CS0B 2K4JA 1NHAA 1OKRA 2NNYA 2VXZA 1UFMA 4M71A 3DR6A 1NSLA 2IA2A 3I59B 4PK3A 4GO1A 3KLOA 3HSRA 4XBFA 3VOEA 1G3SA 1IXSB 4WWCA 5ICCA 1XGNA 2EA2A 2PMUA 3T8TA 4LG0A 5GCNA 3DF8A 2Q0OA 3BJ7A 3RKYA 2G0BA 3I53A 4JWPA 3R1KA 2FSRA 3RYOA 1SD4A 1FYMA 3P9CA 1K78B 3GZ6A 2STWA 4AG9A 4H89A 1YIOA 1FSHA 2VQYA 1RUOA 3MGDA 1QZYA 1IICA 2DK5A 4ON0A 2ESNA 4RAYA 1XGOA 2NMTA 3LWFA 2LSOA 3JTGA 1JGSA 2QVOA 1T98A 2RKHA 2WPWA 4UVAA 4MEXF 2EA4A 4CAXA 2XAHA 3VEPA 5CVRA 3NEUA 5HOOA 1Y7RA 1XE4A 4LB5A 2BV6A 3TE4A 1GHEA 2Z0ZA 3K0LA 4AD9A 3R9EA 2GIVA 2G7UA 2MA3A 2ZKZA 1BI2A 3JVNA 5A2QK 2BL1A 2VODA 3JUWA 2UWMA 1S7OA 3HSFA 3BPXA 4Y13A 1BO4A 3M1EA 4L5IA 2Q4YA 2M5WA 2HGCA 2F2EA 3LFKA 3FB3A 3WR7A 4RI1A 3DKWA 3D3SA 2HV2A 2Y0MA 3R6SA 3AAFA 3GLXA 3ROUA 1O3QA 3CXPA 3QU6A 4LLNA 2RNJA 4L9NA 4G6QA 4FHTA 2EV6A 2FQ3A 1QSNA 3BJAA 4BMHA 2EFNA 2VBZA 5E20A 3TKYA 3CJNA 2DT5A 2IA1A 1FSEA 1YLEA 4QC6A 1MJ9A 4EJOA 4AVBA 3WTUC 1C0WA 3F5BA 4MI4A 2P5KA 4RGRA 4ENMA 2BEOA 3U1DA 1BBYA 5CVVA 3E0KA 3FMRA 3W6SA 4G94A 1ZLJA 3F0AA 4KOSA 3QOPA 4CGZA 1MZBA 1IF1A 1EH7A 1QGPA 1KU3A 2B4DA 1MDMA 2A4NA 4LD5A 2L3DA 3FMSA 3TO9A 3CXQA 3EO4A 3G73A 1U8RA 5E17F 3WGGA 4A0YA 2CW0F 4HDUA 4YGOA 2OAZA 3E5XA 3TOAA 1P92A 2L54A 3PQJA 1AWCA 1V3FA 3ZJ0A 4ASNA 3P2HA 1XD7A 1Z6RA 4L5JA 3KEQA 1BIBA 4BH9A 2VE8A 3T5XA 3GFJA 2V1DA 1QNTA 2HKOA 1HW2A 2REEA 2E1CA 2FCKA 1FC3A 4BHPA 1KYZA 1J7KA 2VZZA 3N7ZA 5CVUA 2V1UA 3O3KA 2ATRA 2RGVA 2D4OA 2X4HA 4U9ZA 5BS6A 1TQPA 3F6OA 2HUZA 4A5MA 3WTZA 1G3TA 3GXOA 2ESHA 3W6JB 2OB0A 1ON0A 1LEAA 2ZW4A 2ZNYA 3K1NA 1KUXA 4MTEA 4UVBA 5L3GA 5IX3A 2PR1A 1FZPB 2OZHA 3WE3A 4IRIA 2VOOA 4HX8A 4U88A 1Y0UA 3E3VA 3FHZA 4TV7A 4U9YA 4LB6B 4XSXF 4RB2C 2IT0A 1LDKB 4I2OA 1WK4A 2PC1A 4HF1A 1L0OC 5EBVA 4I01A 4KOWA 2QQ9A 5K5OA 1RI7A 2ARHA 3KP7A 1S7LA 5ICFA 1M1DA 3WTYC 1FLIA 4HDVA 4HNYB 1O57A 4CZZA 2BUEA 4EVYA 1B1BA 1HKTA 5FVJA 3C18A 4WXDA 4F7ZA 3BLNA 2FT0A 2QQBA 5LRRA 1YX0A 3WTTC 3R61A 4B5PA 2X0LA 2KRFA 1Q1HA 1TW3A 4RS8A 1U6MA 1KU9A 3IGRA 4KUBA 3BJ8A 3ZPLA 4KIBA 5F1RA 1IW7F 5CVJA 1J4JA 1UB9A 3VB2A 4ONUA 2ZMEB 2JSCA 1Q2CA 3SHFA 3S6GA 3E6BA 1YFHA 4EQQA 2HQRA 2QUFA 3LAJA 2B58A 2W25A 3EDPA 1LB2A 1LVAA 5C88A 1QSRA 4XNHC 4O6JA 1HQCA 3KE2A 2A68F 4EJUA 3B73A 5D4RA 3TCVA 2J8MA 3H3UA 5D4SA 4BQAA 4ESJA 1XN7A 2MH9A 3K2ZA 3CDHA 2IRFG 5DDGA 3E6MA 3R96A 2O61A 2VBYA 4IRHA 4HW0A 1SQHA 4OADA 4U0VA 3GWZA 3MFKA 1FPQA 3FBUA 3ULQB 3V8IA 4XRFA 3GO5A 2OBPA 2GXGA 2CFXA 1Z9CA 1W4MA 3BJ6A 2HR3A 2P7CB 4CXFA 3HSEA 3GFLA 2KIMA 3WU1B 5C82A 2QENA 5L3EA 5ILSA 2YR2A 2LNBA 1OR7A 3WGHA 1IZ1A 2Q4VA 1Z4RA 4EMSA 2HQYA 5L3BA 1DDNA 4R8HA 4XNHB 1XMTA 1K6OA 1GXPA 1R22A 3TTHA 2GE3A 1Z9UA 4CRYB 4X5KA 1P6RA 3OOPA 4QUSA 2PMHA 2QBYA 2LF8A 4LUAA 3TDUC 2M1BA 1MDMB 5LHGA 3BPVA 2M30A 3R0JA 5ISVA 2R8VA 1IRGA 3HRUA 4CDGA 2X7BA 1YW9A 1R7JA 2H27A 1GVJA 3E5QA 1O3SA 3NE7A 5KVRA 4QLCU 2CNMA 3Q5FA 3I64A 3MZYA 4PSXA 2FIAA 2QZ8A 2ZPAA 5F47A 3VODA 2I79A 3CXSA 1R23A 3FM5A 1D3YA 2A61A 3I3GA 1ZRFA 5JQ4A 4KOVA 1JHHA 1MJAA 1F5TA 4EJWA 3T8RA 3UY5A 4M3SA 3L09A 2P5VA 4IXAA 2HKXA 1ONVA 5HS7A 1S7KA 4N9HA 3BOQA 3LAPA 3PQKA 4KICA 5HS8A 1BN5A 1K79A 2DU9A 4G8XA 3FWEA 3E97A 2B5GA 2L02A 2B4DB 3O6BB 1W5TA 3WTVC 5DCMB 1K78A 2I00A 1USSA 2W84A 4F6AA 1CJWA 2OA4A 1EH8A 3DR8A 2IPQX 3V7RA 4OIQF 1Y9WA 4E8OA 4MEYF 3D8PA 4L9TA 5EEHA 1YQAA 2L01A 5I0CA 5A2QZ 5EC4A 1CM0A 5E8IA 1QSOA 4UBRA 4A5NA 1QPMA 1XMKA 1P4XA 3BWGA 5LRSA 1WQ2A 3ZMVA 1Z05A
chains in the Genus database with same CATH superfamily
3ISZA 4HA8A 2W1OA 1VGYA 4OIOF 4ZZDA 3CJRB 1EH6A 5HLHA 3L00A 4KIGA 2EFOA 3K7AJ 4K3NA 3RPUD 3GKRA 4UEEA 3RAMA 3QB8A 2OQGA 2IP2A 1B8IB 1DTDA 3N05A 4G1PA 4F93B 1LFPA 2G7HA 2R3SA 3W2WA 3S1RJ 2A3SA 1R6RA 1UG2A 2BW3B 3VYTB 5F46A 3R5CA 4BD9A 2F5CA 3QRFF 1CF7A 5IP7J 4Q5SF 3PO2J 4UCNA 3MCZA 4UXNA 4F91B 3LODA 4KOTA 2A20A 1GVDA 1PTQA 4X2TA 5K5RA 3F21A 1W7PA 2DOEA 1ZRCA 3HOZJ 1SGYI 3ZZIA 1XCBA 3A2KA 2M4KA 1I27A 2Z3NA 1MSEC 3KHXA 3N4MA 3F3XA 1S72I 4N9IA 5LYLA 1P4WA 2JMWA 3ASNH 4E7IA 1T39A 2WYRA 2IS4A 3GUDA 3O8HA 4J01A 1MBJA 5F6FA 2NYXA 3RIRA 2EFWA 1PUEE 1RKWA 1GDTA 2E36A 2E1MC 2ODFA 1FMWA 2Z99A 3F8BA 4ZJZA 4UXJA 3TW6A 2V77A 2RN7A 3WGIA 1FOWA 3B4VC 5FO5A 3P9KA 1R1TA 1IV6A 4RB3C 2HOAA 1QBJA 3DP7A 4N4OB 1BC7C 2HVQA 4R76A 5HQ8A 1QPIA 3SJXA 1Z77A 2PSWA 2RQPA 2DFEA 4HX7A 1AKHA 1HEEA 3S9MA 3SFIA 1U5TC 2CO5A 4RBOA 1BOBA 4NGRA 2GOXB 1R1UA 3DLLF 2AXTC 1XEBA 1ZR2A 1A04A 3KZYA 3RKQA 1U78A 5KCMA 1NTCA 2V26A 3OYEA 3IH2A 5FFXA 4IJAA 5C3EJ 2UZKA 3CXLA 2OZGA 5FFZA 5JHWC 2VE9A 1RO5A 4OIRF 3IUOA 2FQ4A 4CICA 2CWEA 3JAMZ 4KYWA 4HNUA 3HOVJ 5FKNA 1OYVI 3OXGA 2PVWA 1RNLA 3OYGA 1W36C 1JQGA 3CDIA 4RN7A 3BCAA 3OYMA 5J4YA 1K7AA 2C6PA 2X6XA 4AIDA 3M07A 2C6YA 5A28A 1OMIA 3F8FA 2PJ5A 3GB0A 5EYRA 2DKVA 4GFBA 4F55A 4A33A 5F48A 4AU7A 2N1AB 2F8HA 3EQLF 3W3CA 3FYNA 5GTIC 3MKWB 2EFQA 4XLEA 1S5LC 1M8BA 4BQNA 4D5CA 1V54H 3KX2A 4UUTA 1AU7A 1DU0A 1MNMC 2PJ3A 4NFRA 1I6XA 1I50J 1KBEA 1R1VA 2NOJB 5CQEA 2VLAA 4LK1F 1WJEA 2ABZA 1J5YA 4YIRX 4IO9F 2WAQN 2W82A 2VC0A 1SVLA 5E1ZB 1S29A 3CDXA 2FOKA 2C27A 4ONWA 1S5KA 4RM3A 1T2KA 2EINH 3KZZA 1R5ID 5HDNA 2B5GB 3CT9A 2UXNA 4MHNA 2FMLA 1XMBA 4IKFA 3F0CA 3CZXA 3IWEA 3SGBI 4D0PA 2Z11A 4B14A 2DOFA 3K4LA 2COBA 3C1DA 3MD2A 4PDKA 4RAGA 3EETA 4P9UA 5E3PA 1OYIA 3G8WA 2HFHA 2KJBA 3M9AA 4CCLA 5JLWA 3DSBA 1ETXA 4KOYA 3UEJA 1Y7EA 1D5YA 2DIPA 1VQ5I 3PNTA 2VT3A 2D1VA 4A12A 2LEOA 3H4QA 1YJ9I 2L4MA 5J47A 2YGWA 1W0TA 2JA2A 2GA2A 3SYTA 2M8EA 1OQYA 2OD5A 5BQTA 1XIXA 1Y8QB 4MHDA 2V1CA 1WJDA 1TF9A 3U2RA 2M87A 4KDPA 1KU7A 3PB6X 2XSDC 3CMYA 2F4OB 3PUFA 5CLSA 5E3LA 1SFOJ 4R3LA 3BQZA 1X58A 1M4GA 2FNAA 5F0CA 4XLCA 2R92J 1IUYA 3T90A 3GTKJ 3SZGA 3FIWA 4L9VA 3SI0A 2RV8A 3KP5A 3MEKA 3RQIA 1NMTA 1XFOA 1FNNA 1TKFA 1NG7A 2LDUA 2PR8A 3LSPA 1PYTB 2EV5A 3JRGA 4DYRA 2FS5A 3ZXSA 3H5AA 2JLMA 4XKCA 4KUAA 2M5XA 2JDCA 1TT0A 3FM3A 3P7NA 4HG2A 1YREA 4FUUA 1QSMA 2F3CI 2B4BA 5KTCA 5E96A 4HNVA 1SFEA 2R4GA 3MRUA 5F09A 4YG2F 3HGGA 2E1NA 1AYEA 5IOZA 4M9ZA 2DW4A 2Y48A 3JCUC 4JX4A 4R79A 5DWMA 4NNJA 2PX9A 2Q4ZA 4DQ2A 1WGTA 5K8NA 2ME0A 1MK4A 3ELKA 5FLXZ 2DA4A 1NK3P 2AFOA 2EZLA 5E1WA 1PUFB 2A6HF 3GF2A 4XPLA 1MBGA 2WB1A 6CPAA 1YHQI 3CCLI 4V2GA 2ZJQF 1UVFA 2SGPI 2K5TA 4UCMA 3HRSA 3GYAA 4RLFA 4JBAA 1VQMI 1JE8A 5C44J 1YS7A 3BJOA 1TWFJ 3GBGA 5TISC 1V0CA 4FWUA 2P6FA 5D8LB 4E7SA 4E7ZA 1OCOH 4FE4A 4HOBA 4XKBA 1B6BA 1Z2LA 3JTHA 2BO9A 1IN8A 3MN2A 4ZYAA 1A5JA 4BKXA 2BYVE 8CPAA 4CAVA 3FX3A 1JHFA 5HI7A 1QRYA 3ZR8X 5AG4A 3K1PA 3TGNA 4GRIA 5ELYA 5DEQA 1ETQA 3ZQIA 2WGCA 4PJJA 4TNUA 3CJQB 4BJ5C 3D7FA 4U7DA 1EA3A 2KFDA 3S2WA 1FTZA 1YW7A 2DPUA 2GKTI 2SGQI 4XK4A 4FD4A 1DGWY 1D8KA 4HX4A 1T6SA 3QYFA 3CF5F 2E2IJ 2HI3A 1B9MA 2R7VA 4Y52J 1N71A 4UCPA 1R4MB 3AG2H 4IHXA 2D4PA 1J0RA 3JSOA 2FRHA 3PB8X 4CAFA 1PTRA 3HOUJ 5EX0A 1QO0D 5K7HA 1SVOA 4YIIA 1HEVA 2CQQA 3OOUA 4YIFA 2PJ1A 4PCQA 1ZG8A 3HG9A 3I4MJ 3F6VA 1YMEA 1V5EA 4XRMA 3BR1A 5LBQA 3LSGA 5DS0A 3A0BC 1HSTA 4OU0A 2LBFB 3KEOA 1KA8A 2KMPA 3V7ZA 3I5UA 1D8JA 3MWMA 2L7FP 1Q1VA 2Z1DA 3H8EA 2XRCA 1ZR4A 3KL9A 3PFIA 5BWAB 2PRBA 3R0AA 2VT2A 2BBYA 2R98A 3IHUA 1I1SA 4E1PA 1X4OA 2LFBA 3KR5A 5DCMA 2JEVA 3MKZA 1ETWA 4ZZLA 3SEKC 2WAQA 2X1EA 1FP1D 5IV0A 4B6ZA 3QPLA 4C2XA 3A02A 3DBLB 2H8RA 2FJ1A 3TFYA 5HMNA 5KAIC 5K1YA 1CGJI 3R9FA 2DA3A 3F22A 1OPCA 3HHGA 3K9UA 5GAHJ 5D6EA 5EEAA 2DLLA 2MLKA 2AE6A 3DEWA 2L7MP 3L2RA 1FBSA 5DTDA 1WI3A 1P9ZA 1K4JA 1VFCA 4P1WA 3FDYA 5GPAA 2DFFA 2N71A 2SGDI 4CGNA 1KQ8A 4E1RA 1LVKA 1B72A 1RFHA 2P8TA 4KA4A 4F0YA 2NU1I 2XAQA 4A3DJ 3FEDA 1F9NA 1YYVA 2OH1A 3R5BA 3B35A 3B3CA 3QAYA 2PG4A 2YU9J 4CYDA 5L3DA 4XPDC 2W57A 3J80Z 2QSGX 1LR8A 4B09A 1UHAA 2HPMA 3V8LA 1F2OA 2DPTA 2ELHA 2OQRA 3CCSI 2V8HA 1MMAA 3K9TA 5B66C 1TIQA 4JQFA 3ZQ7A 4XIDA 3T1BA 2LD5A 1MNDA 1TWAJ 2KMUA 4I6ZA 4AMLA 3S1NJ 4AYBA 1T0FA 5FLMJ 4BYYA 1WWZA 1YX3A 4GYIA 5LLQA 3CCEI 1LQ1A 1OCRH 4B48A 2QVPA 4AM3A 1XMAA 4YFKF 3EUHA 4UEZA 2ZB9A 1IIDA 2AFZA 2GANA 5L3CA 1Y9KA 3IU2A 2KT0A 3NQOA 1WSUA 2NU2I 4MFKA 2JVHA 2MG4A 1ULYA 4NB5A 2K9QA 3G6EI 2JA5J 2EJRA 3L1PA 1BI1A 2SGFI 5H86A 3CC4I 4A69C 2PI0A 4EVIA 3BI1A 3L2NA 3IH4A 2WSAA 4CCOA 1X3UA 4XOPA 3ZN1A 1IOIA 1STZA 1ZG3A 1PP7U 3QWLA 4NHJA 3S3NA 2ZMEC 5F64A 2VQCA 4UY8I 2AFMA 2J9AA 2EH3A 1XSVA 2X48A 3ABKH 1BL0A 1UVGA 2FOWA 3SZTA 4HNWB 4UHTA 1JKOC 3EUAA 4RM2A 3AL0B 3B8GA 2BE5F 1NXUA 1W0UA 2VI6A 2Q1ZB 2MFZA 1ZGWA 2ZBKA 3ECHA 2E2HJ 1CT4I 5L3FA 1HDDC 1CGPA 1CT0I 1FMVA 5K5QA 3HC7A 3H9JA 1LANA 3G1MA 2L7ZA 1WVRA 2AS5F 3H92A 4BY7J 4P9FA 2FSWA 3GTPJ 2ROWA 4ZX9A 3I71A 5GPCA 2D45A 1K7UA 2P4WA 1VHSA 3JRBA 1Y56A 3NH5A 3D2PA 5E3OA 2IW5A 3AFHA 2UV1A 2WCYA 1D1AA 3E0JB 5DV5A 1BJAA 1ETYA 2VL1A 2X1DA 2YNDA 6PAXA 4W97A 3LNQA 2REFA 4B8XA 2DAOA 3H8FA 1CP7A 4P4DA 3WODF 3F72A 3IRRA 2YX4A 2NAZA 5KAFC 1JJ8C 5IP6A 2WC2A 1MGTA 3DPLC 4LG0B 4OIPF 1Y6IA 1Z8TA 2M0CA 2CW8A 2H8WA 1X19A 2O5RA 4BY1J 4PXDA 2IMOA 1GXQA 4E0AA 1U2WA 5FKKA 1BA5A 2XF5A 2FBHA 4CCMA 1E0EA 2JRTA 3U21A 5TGTA 1G3WA 2ZCWA 3BTIA 1WJAA 3CMMA 1TW2A 1A36A 2UUZA 3KQXA 4LJZF 2LTPA 5FUXA 1SMYF 2EB7A 4C3HJ 1U5KA 2LBFA 4F9UA 3BP8A 4Y49B 4XONA 2RAEA 1BM9A 3BTCA 4B43A 3OS0A 5DUIA 4MO7A 3W6XA 1LUJB 4XORA 3CMEI 4CYCA 3GIUA 1I21A 4XSZF 3MKLA 2NVQJ 1FWZA 4ZYEA 3H5ZA 4OKOA 1WH5A 1CGII 2V7FA 3FECA 3SI2A 1R57A 1T56A 1M4DA 1WWXA 1MBKA 4HGUA 3V7CA 1G6NA 1TURA 2HVSA 2W00A 2XPWA 1GYTA 1LJ9A 2LY9A 2KIUA 1Z21A 3EYIA 1DU6A 1V1HA 3OR1C 3TP0A 3DXJF 2A6EF 2L7KA 2LR8A 4I0AA 5TRDA 2R7FA 4KMFA 2EZHA 1GV5A 2TDXA 1X4SA 2ZJ2A 4BAYA 2E19A 4JXRA 1R00A 2VQHA 4M6XA 1FAQA 4MY3A 2W24A 3LSKA 1JI8A 1PU9A 2BY1A 4Q47A 3JSPA 4KVME 3RBUA 1TQMA 3GY9A 3ZN0A 2NVUB 3ZMDA 4E7JA 3KIOA 4FX0A 5IB9A 1M4IA 4ZTFA 1T8IA 4IHVA 4QPOA 2Z3KA 3BROA 3RKXA 3WC6A 5HDGA 3G4SI 4CYPA 5ERIA 2OUMA 3HPHA 4MFEA 4EM1A 2AJ6A 2EZKA 5D5UB 2O28A 4P10A 4KLVA 1ZH5A 4E7KA 2KL4A 1J2XA 2XGEA 1BI3A 1BI0A 1RR8C 3OVOA 2FE3A 1KQ9A 2DB6A 2GIZA 4UFVA 2J8RA 2QM3A 5AONA 3F8MA 5C4XJ 4UVCA 1JXSA 1HW5A 1TBXA 2Y0SA 4NSQA 2VL8A 4M6IA 4E2AA 4ZYGA 3K70D 1A35A 4XLHA 1B87A 4M9SA 4KUMA 3WG9A 3IL2A 1NSAA 2DF5A 4A31A 1KGSA 5D5XB 4S04A 4PFOA 3KZWA 2K5CA 1RC9A 2LG4A 1QHHD 5AG6A 3BT9A 4R57A 2PLYA 1T08B 4DZPA 1IDZA 1DUXC 1I6HJ 2WAEA 5ICEA 5IT3A 3DDDA 2AFWA 4D7MA 3OYHA 4BE2A 1BMOA 1TWCJ 1R5HA 3FXLA 4OOIA 1DP7P 3M8FA 3FXTA 3NH8A 5LHIA 4IHSA 3ISXA 5ICGA 1TNSA 4XL9A 4MTDA 4DYOA 2BHZA 2ZSIB 1TLHB 1N25A 3D4UA 3LA3A 3W6VA 1Z2IA 4UXIA 3BZCA 5EEGA 3QWPA 4BE1A 3CC7I 2GQQA 3NA6A 3IWFA 1MW7A 2DO7A 1TZLA 3VSKA 1CF7B 3FJUA 2ZFWA 1FP2A 5BNGA 4DYQA 2DMQA 5DD4A 2V9VA 5FJ8J 2PJ0A 1K6YA 1F4KA 3LSMA 4NC6A 3L9FA 2MABA 3H5RA 2BHYA 4DGWB 1MH3A 2CFOA 2LK2A 3RZDJ 1OZPA 3MAJA 3S6KA 4A38A 1ODDA 5KHDA 4NGSA 2K4BA 4UIAA 3GFIA 3QPHA 2HNHA 2PEXA 3CTAA 4RAFA 1HKSA 2KZGA 3WU0A 5FD6A 4A3FJ 4A39A 3FMQA 2PIYA 4L0YB 1SD5A 5LEKA 2BCOA 4WXCA 1IW4A 4NGQA 3I55I 4TWEA 2K85A 4WJBA 4OMZA 4CPAA 4ENJA 2DN0A 2JRMA 3OYLA 1ZRDA 3EC4A 4MFZA 5K8MA 2DCEA 1ZLKA 2HS5A 2PJPA 1QSTA 1AKHB 2PJ2A 4KSAA 4M3EA 1NE9A 4UWJA 2CQKA 4HBLA 1VTNC 2TRTA 2XB0X 3DV8A 4H4KC 2A5YB 2OV7A 2HYFA 5FUWA 4BXFA 2RDPA 3S3OA 2PJCA 1X1AA 2FBIA 2PQ8A 2EK9A 3TJQA 3KP3A 2J87A 3RPUA 1Y0NA 1FBQA 1FBUA 1LKXA 4RGXA 2NXNB 2O0YA 3LMSA 4KN4X 5DCFA 1XTAA 3TDZC 4AVAA 5HLIA 2PJAA 2PJRB 1XRYA 3MEXA 2R5YB 4OC3A 2BOLA 4XMYA 2IS6A 2IGKA 3I0TA 4M9XA 2Q43A 1J75A 3LMMA 1K4TA 2V1CC 2M9HA 2BXZA 4M72A 5B3SH 3JRDA 1I3AA 2CQ7A 2XKPA 4NC8A 1QU3A 1U9NA 2GVIA 4IHMA 1ON1A 1SAUA 3DLJA 2ELIA 4IUSA 4PXBA 3Q9SA 2QGUA 2ISYA 2NVXJ 2LY1A 3GW2A 1YTYA 3K4BA 1OBRA 1R43A 2P5LC 4KOUA 1YVOA 2XGDA 2DMTA 3SHPA 3VWEA 2IQ6A 2F4MB 4C68A 2CWHA 3B3TA 4RGSA 2MC4A 1HDPA 1YU6C 3RPQA 1XB4A 1YW6A 3PB4X 3BR5A 4BGDA 2H1LA 3FXRA 4QTRA 1P2FA 2JA1A 3ZRGA 2MH2A 5BOXA 2CNSA 1DQUA 1ZK8A 3NRVA 1SMTA 1ETOA 4MQ9F 9ANTA 2YPRA 4DJLA 2B0UC 2PJ7A 4HNXB 1YG2A 4U87A 4MJ8A 5F08A 2VPRA 5D8KB 3J80K 1E17A 4A94A 2J5PA 3SXYA 4AB7A 4RUHA 2VONA 4NEXA 2FNPA 5ILUA 4H6ZA 1Z4EA 1YGHA 3HOWJ 4EMEA 5FD5A 4AXVA 2JYYA 4AIJA 4G7HF 1IC8A 4UIBA 3BR6A 4WWVA 3F8NA 3SFZA 4CCNA 3CUQB 1D5VA 1F57A 5AGEA 3R9GA 3U1KA 4ZGYB 4RLQA 1IN4A 1N75A 4C3IJ 3ZP5A 3E6DA 2K9LA 1H0ZA 1U0JA 3LA2A 4FISA 4Y15A 4EJVA 3N97A 3J7AO 3HOTA 1YLOA 1FY7A 5ED4A 1CP6A 1GT0C 2CUZA 2IXSA 2V6CA 3OIQA 4PXEA 3KETA 3WU2C 1BIAA 4II9A 2A05A 2Q2EA 3HPGA 2P6GA 4P55A 2KMRA 1TF8A 3BZKA 4Q7AA 1YQEA 5JPHA 3VFZA 2LKSA 1I5ZA 4D7NA 1ULMA 4C2YA 4KISA 1G3YA 4UA3A 3A4CA 1PUFA 3KFWX 4WCGA 4BNCA 2Y75A 1HA8A 2H5MA 4FD5A 3F23A 1E3OC 3UR3C 1FT9A 2RVCA 4ZYDA 4ZTJA 3IH3A 1VQOI 5JH9A 2ENNA 1LFWA 3GCMA 3FF5A 4CO8A 3CCMI 2Z3YA 4IK2A 2LOOA 1WJ5A 1H9TA 1UCRA 2ZC2A 4BBHA 2H6CA 2JK3A 3WTSC 1K4SA 4BDYA 2JWTA 1YK3A 2HXOA 1G4DA 2AXLA 2BZTA 2FUG2 2WWYA 4F8ZA 1KWMA 1Q2YA 1FYLA 4OAZA 4DBQA 2P81A 1E2XA 3W91A 5J1YA 3UGLA 4FAIA 3D0SA 4BL0B 2M3AA 4L9JA 2W85A 1R71A 2EUIA 4EM2A 2Z3MA 1XC5A 1CG2A 4BHBA 5F27A 3D5LA 4JLYA 3B7IA 2FXAA 3ABUA 4Q4ZF 4QSHA 4MBUA 4HV6A 4AVPA 1XBUA 1XBTA 2QQAA 2CQXA 2YX7A 4BEHB 3JRAA 1HBXG 2Y2ZA 2V79A 2XV4S 2O03A 1WFXA 2NRAC 2ZFUA 1I39A 4AUXA 4A6EA 2ZEGA 1YLFA 3SZPA 2R7DA 2XPVA 5FKMA 2KDOA 4IQ4A 3IWWA 1LPQA 1ZKGA 3S9LA 5HVFA 3FK6A 4GYGA 1IXCA 2K9MA 7WGAA 5AIQA 2E73A 3S3MA 2FF4A 1H8LA 3B3WA 3MZ8A 4B3XA 2XEFA 3TC8A 1S20A 5H6RA 2E60A 1V1IA 4NCZA 3FXUA 2CJJA 2M45A 2PMZA 3I54A 3RZOJ 2JZMA 5CBMA 2DMNA 2JN6A 2B8TA 3BHXA 1R3NA 2N52A 2VOPA 3V38A 2DMPA 1R49A 4KOXA 1VIXA 3CMAI 1SGPI 3RTRA 4NGTA 5ILVA 4CHUA 2JXDA 4E70A 1IU8A 5B1BH 2YUSA 3NAUA 4HLYA 2ZW7A 1OCPA 2LF7A 2YSRA 5KTDA 3BR3A 5LEJA 2BY2A 4WXHA 1TWHJ 3OYNA 1NUBA 3AG4H 5EG0A 1P9GA 2JZYA 4A0ZA 2E7XA 4GGGA 3M8JA 2P6SA 4UB8C 5D5WB 4ZDPA 1TXRA 2VKVA 1FARA 4L0ZB 2KP6A 4UEFA 3K4CA 4XLPF 1Y1BA 2BUSA 5THWA 5F04A 5IB0A 3ZMUA 1XJOA 4EM0B 4YU9A 4NGPA 2Y0SN 4ESFA 3IU1A 4FD6A 2XDVA 3ZGKA 3R95A 2ZELA 4C7IA 1KMAA 1XDUA 2GXAA 3V4GA 4A3JJ 2K86A 1BC8C 4LQ6A 1UHWA 2PN6A 2CXAA 4XN3A 3LL7A 2RIJA 5J3LA 3KKWA 2H6BA 2IGOA 2GREA 1USTA 4MMOA 3GLJA 2VKHA 1ZO0A 2QF7A 4D5FA 3SJGA 3C7JA 2AQEA 3D5RC 2HQNA 2B3VA 2XRNA 1HSJA 1TOTA 4V2FA 2FE7A 1UHMA 2HQAA 5C4JJ 3FSYA 3E2IA 1FOYA 1Z3YA 3FH4A 2EV0A 2AFSA 1PJRA 3IWZA 2HZDA 3IAS2 4KSIA 3H35A 2WY7Q 4MXUA 2C6GA 4M74A 4X3RA 3ESWB 2IS2A 3H1CA 2FNFX 1M44A 2BGCA 2HQ5A 2PJ4A 5HNHA 1HKQA 1WCMJ 5E8GA 2STTA 2BEIA 2XEJA 3TO7A 1IUFA 2E7WA 2HYGD 5DYMA 2LC2A 2A07F 2J8NA 1PDNC 2M0MA 3KP4A 2H1KA 3LA7A 3PFOA 4YFNF 4OVOA 1S60A 5BPIA 1S7NA 1XOVA 2GAUA 4MFLA 3K4KA 5KK1A 3I3LA 1F1ZA 3QTLD 2JVGA 2O7OA 1Z8WA 3DNSA 2I8DA 1XSXA 3SQNA 1Y8RB 1LNWA 3B6AA 3QYEA 3CO6C 3LSTA 1IYLA 2ZEEA 5CYVA 3LWUA 3MKYB 3DFGA 2TCTA 2X6OA 3V8JA 2GWRA 3NFZA 2JPBA 3HUGB 4PSWA 1I1DA 2MD0A 2R7WA 1P4NA 2EWNA 2OR4A 2VBQA 2XPUA 1IO2A 3RQ4A 4IEJA 5FGMA 4PGGA 1KU2A 2QCOA 2AHQA 5BMZA 1B8IA 4MQVA 2CWFA 3HOSA 1RZ4A 3G1OA 1O3TA 1FYKA 2F5EA 5J1UA 2ZEDA 1MBFA 2DODA 1U5TA 2PFBA 3I9SA 1IN7A 4XRSG 3EPZA 2JA8J 3FIXA 1OYYA 4NGNA 5LGTA 4Y4RA 2BXYA 2GXBA 3DEEA 3LSIA 2R5ZA 3ABLH 2VBWA 1R4NB 4ORFA 1FIPA 4KSFA 3QU3A 4PFPA 3H0DA 1NK2P 1IXRC 1YW8A 2CS3A 1VHEA 3FKJA 3OSGA 4HF0A 3Q3SA 5G21A 3GEZA 1ON2A 2L9RA 3Q9VA 4QIWN 4NGMA 2CW7A 5CKTA 2EIJH 4OINF 4ESBA 2XIGA 1Z7LA 2CH0A 4BHCA 5EGOB 3DBRB 3GTLJ 3IRQA 2WADA 2YU3A 1YO5C 4U7BA 1P9QC 3JAMK 3QOEA 4UUVA 2KJCA 3FZVA 3WHCA 3S6FA 4LK0F 4Z65A 4G6DA 3REOA 1AHDP 1U9OA 3MQ0A 1ULNA 2GFQA 4A95A 2ID6A 4Q48A 3OYCA 4I76A 5HLGA 4MNUA 3U9GA 3KP2A 1PUAA 1Y0YA 3R4KA 2DJIA 5CVIA 1RIOH 2MD5A 2HEOA 4S05A 3KYLA 3UGDA 2EK5A 3CCYA 4L89A 4AWXB 2JA7J 4OMYA 3OR2C 1YS6A 1SGDI 2X6WA 1X12A 2HDWA 4WK8F 4L18B 1ZN2A 1SGEI 1A6IA 4QB9A 2XAFA 3BR2A 4XLNF 1MBHA 3QPSA 4DOZA 1H8AC 4CGMA 3HH2C 2J5OA 1OVOA 1S7FA 2JEWA 4XKVA 4R87A 4A37A 4CUGA 2SGEI 4FE7A 1ARMA 4UF4A 1S3JA 1Z91A 1B59A 2P6TA 1ZAOA 4RB1A 5I4MA 3WE2A 5JHUA 3FK7A 3J81Z 4IPAA 3IFEA 3PBBA 2RC4A 2O6GE 1B72B 3F8KA 5HH1A 4HPQA 1MKMA 2E1MB 2Q2EB 4EEFG 3L7WA 2DT7B 2QQCA 4A3BJ 4FTHA 3G1LA 2PDOA 4PV6A 1BAVA 2KMQA 2ETHA 4JXQA 1TBRR 3LQRA 1OMTA 1FOKA 3IKTA 3D7HA 1FEXA 5H2FC 1Z67A 1H89C 4ZYQA 2HTJA 3CCQI 3GFMA 5IP9J 2Q44A 4GI3C 3B2YA 3VH9A 2LB7A 4KIFA 2E5ZA 3K4MA 2LLKA 3D7GA 4MHPA 5JVGF 1SC7A 2EO8A 2MYSA 4GXHA 5CPRB 4U5YA 2OCEA 4Y49C 2OPTA 1R36A 1GLNA 4UV9A 1CBXA 2VJ5A 2QA4I 3HHHA 4MFQA 1VF9A 2CRGA 2G0EA 5K7FA 2LVSA 3QAHA 4KT6A 4EJTA 1Z7UA 1ZREA 1DP3A 2GKVA 2BSWA 3IKVA 3BCBA 3OV8A 4RAZA 4ABZA 2F5DA 2IVMA 1ZLHA 1LRZA 1SD7A 2ZW6A 1T95A 3EYYA 3NWTA 1GHCA 3BI0A 3JRHA 4BINA 3HIFA 2GA1A 2M8GX 1FYBA 1AOYA 2CYYA 2JSPA 2L2OA 1P4AA 1Z6TA 3GYHX 4P4JA 1DS3I 2JPCA 2DI3A 1YRNB 3TQNA 2DK8A 2VJ4A 3HJEA 3IC7A 4CSWA 2K3FA 1QA6A 2PCUA 2VEZA 4JX6A 5D6FA 4JD6A 4ANJA 3WC7A 5LRJA 1VQLI 2R7QA 3VDPA 5H20A 3HXLA 2VBXA 5HS9A 1SEUA 1IJWC 5EDNA 4B5PB 4BE0A 1PP8F 3DPTA 2QLZA 2VZYA 2ADUA 5GAEJ 1LR7A 2KMOA 3F9KA 2YS9A 5D29A 4OC4A 2XEGA 1XCVA 4I7HA 2NS7A 2XRLA 3BY6A 3HL2A 5M5WJ 1Y1CA 4KT5C 3LACA 1O7LA 4P6YA 3J7ZI 2XC7A 2W0TA 4CGPA 3GMEA 1IRFA 4KLWA 1FOXA 4N0BA 4R3KA 4ZY0A 2YNEA 1MBEA 2XVCA 3WG7H 4BBRJ 4DYCA 2QSHX 3HRTA 1Z5RA 5LYDA 4IRGA 1WI9A 5CQGA 4ZC3A 3BC8A 1CE3A 3HZJA 3SJEA 3S1QJ 1PCAA 3C26A 2D2WA 2ZOFA 3GLLA 2M4GA 2Q7BA 4AVCA 2LKPA 5G22A 4KNYA 3ZQCA 1OYWA 3K6GA 4LLGF 4LMYA 3HOXJ 4ETSA 4FX4A 4J3GA 3C2GA 3X2QH 1MH4A 1QVTA 1V5GA 4PJLA 4L9MA 3I59A 3G3SA 2AO9A 3BZ6A 1YOVB 4GXOA 3S2DJ 4B11A 1X4PA 4P5OA 3DLAA 4A0XA 3QNVA 4HQMA 2FIWA 1U5TB 2OF7A 2QQ0A 5CJ9A 1DPUA 1R0RI 3C2HA 1R58A 4EGZA 3ABTA 2K9HA 2Z33A 2QQEA 3KYDB 2ZXHA 2N8GA 1P0HA 2MC3A 4NXYA 3L2WA 2P0WA 3L2VA 2FL4A 5CPAA 3FXQA 3PNYA 3F8CA 2B0LA 3OIOA 3RI4A 4P4BA 3IC1A 4ZBGA 3RJPA 4F92B 4A3IJ 1UMQA 5JFRA 2DBBA 2OCCH 4AIKA 4ZX8A 5FKOA 3L2CA 1T38A 4HYEA 1U6GA 1ITYA 5E3MA 2L7XA 4I98B 1TTYA 2L4AA 3AG3H 5F1JA 3PP9A 1V4RA 5DS9A 5CCMA 3V8KA 5JR3A 3J81K 2C6CA 1E3PA 1QQIA 4G7ZF 4HSRA 2KLOA 2XAJA 3IAM2 4G12A 1UG0A 2KCXA 2O53A 4HKFA 3KLNA 2RFHA 2FMYA 4XRSA 4IF5A 3JRCA 1ZYRF 2JT1A 3BG5A 2ZEPA 4M3BA 4FT8A 3AKZA 4P4IA 5CNPA 2NSMA 4ZDOA 4A30A 3S6HA 2CMPA 4HQEA 4BQQA 4R9MA 2ZXVA 4OC5A 2EFPA 2P6EA 1R5GA 3DTKA 3LFUA 4OAYA 2Q0YA 1ZTRA 3UFFA 3CLOA 4RGUA 3ECOA 1IYKA 2L9SA 4Q38A 4QVTA 4MHZA 2R7OA 2QYOA 1X1CA 2YQPA 2KZVA 4Y7NJ 2COMA 2EVNA 2HZTA 2ICWG 1IAWA 2K7LA 2JUCA 3PGPA 1B9NA 3TW7A 5E1XA 2Y9ZA 4ZH4F 1K7VA 2IL4A 2OZ6A 2DXQA 3KR4A 4CAEA 4Y17A 1I12A 3Q0WA 4K2EA 4FD7A 4CAWA 3GUXA 1RXTA 2GBYA 5FKLA 1BPMA 4OAEA 5HXDA 3TBIA 2Z9OA 4H2KA 1GUUA 2NNNA 1VKCA 3IIBA 4AVZA 4BS9A 3QP5A 2PJBA 4JZ0A 2H09A 3DPUA 3UGIA 4I09A 2XROA 5EZHA 4A93J 3Q0UA 3N5FA 2JUGA 3S1MJ 2RREA 2W4SA 1IY7A 2Q04A 1Z1DA 2E1OA 1QZZA 2R7TA 1BOAA 2WV1A 3EXNA 5E3QA 3VATA 1NG6A 4U0YA 3M4OJ 5IYDJ 3FKIJ 3BDDA 1HC8A 1IN5A 4JX5A 3SGQI 1A6QA 5E18F 2OU2A 3FHNA 4YFXF 4V19K 3I9V2 3QP6A 3KASA 2ACJA 4L8AA 1ZGJA 2NVTJ 3RDIA 1UFHA 4DIQA 4P96A 1LDDA 2ZXJA 3CUOA 3GTQJ 3T9YA 1IGNA 2PVVA 1XG1A 1RESA 2X85A 3H36A 3RYRA 3CO7C 2R1IA 2P7VB 2ZJPF 3SXOA 2IJLA 4RMNA 4IL6C 4UWIA 1SANA 1JUPA 3OXLA 5J8CA 2IS1A 3I4PA 1L3LA 1VDDA 3DEUA 5E3RA 4BXXJ 1IOFA 4KMUX 3KGQA 4UV8A 2RQQA 1KBFA 3OYAA 4KORA 5FUYA 3E59A 4S0HB 1YJWI 4Z6YA 3OWCA 2KKOA 2WY8Q 4KVOE 2ZXIA 4ZYHA 2FD5A 4R1HA 1HDLA 2CY2A 3SI1A 1XDSA 2Y69H 3TEDA 2GZWA 2VQGA 5J4VA 3HTSB 1OJLA 2VN2A 4M6YA 3VDUA 4G9YA 2K9SA 3OWTA 2XUBA 2K3PA 2P6AC 2R0QC 4MGRA 2JDDA 2DA6A 4M85A 3I1UA 2DA2A 2FXFA 1HW1A 2VXKA 3P2FA 4M3FA 4IHTA 3IEHA 2IGMA 2L5QA 2G3AA 4YELA 2QIRA 2ECBA 3OSFA 1ETKA 1VZ0A 2B9SA 1YITI 3FXOA 1SD6A 1SFUA 1VQ9I 2KIQA 3OIPA 1O7FA 1LAPA 1JWQA 1S6LA 3HTUA 4PQAA 1KUYA 3FX6A 2DPDA 1OMUA 1FT7A 2K40A 1MD0A 4E7HA 1RUNA 3PFYA 3BJIA 3NH4A 3RKWA 2CQNA 2DOAA 4IHWA 1KYWA 1WJCA 2VASA 3CP8A 3VWDA 4WP4A 3RO0A 4YRHA 3LSRA 1ZELA 5K8OA 3ZQGA 3A01A 3FEEA 4GS4A 3DQVC 3WHBA 2J9RA 2FU4A 3PZJA 3T0YA 4BBSJ 4H6UA 2FBKA 2ZEHA 2HU9A 3CPAA 4NJQA 3ZQFA 1KUVA 3O2PE 1BR2A 1K7TA 4BXUA 2A69F 2XAGA 4CA0A 1QZEA 1LE8A 1RR7A 2QKMB 2QWWA 3GVAA 4Y3OA 4F3QA 3D66A 2NOGA 1W5CC 2QMLA 1J9IA 2GU2A 4B5OA 4WF2A 5KNLA 4IQJA 3CJTB 4JYKA 1T33A 1YE9A 4JK1X 3CD6I 1SFKA 1CSOI 1W5SA 3A9LA 2Z5UA 5JHFA 5FRNA 1LDJA 5EMIA 4A2UA 4CYQA 1ACIA 1IRXA 5DUKA 3D7DA 2V1XA 3R60A 1XX6A 2PBIA 3M8EA 4Z2YA 2YUUA 2MW8A 3D1NI 1TT5B 3B3VA 2NU4I 3IWGA 4DNCA 4LITA 4WX9A 3HOYJ 2NS0A 2OZUA 1TBQR 4XLFA 2H94A 2E34A 4EGYA 5AIPA 3TOBA 2A5WA 1SGNI 5J6XA 5F0FA 1YVKA 4M6GA 4PUSA 2ISZA 2XGXA 2B63J 1M1EB 3D00A 1ZARA 5FB2A 1HXDA 4HZFA 4UUSA 3HBLA 5M5XJ 3PL8A 3S15J 4UNOA 2UVOA 4C9YA 4UUSB 4K30A 2CUFA 4YEJA 3WTXC 3OL3A 5DM7F 2HDCA 4PXCA 2V8GA 1V5FA 1D1CA 3ISPA 2VUMJ 1N13A 2L8EA 3QPTA 3RU0A 1W1WE 4XN0A 4M73A 4X1EA 1IN6A 4HF2A 1B6AA 3OL4A 1CPSA 3ABMH 2R93J 5J8FA 4LX9A 3A03A 2CJSC 1JUMA 5H84A 3I58A 2ECCA 1O4XA 1ARLA 2JW6A 3LD2A 2Z3PA 2FEZA 4MCQA 4B1RA 3M7GA 2ERWA 5F49A 3WC5A 4OLLA 3CUQA 3MZHA 3PRTA 1S7AA 3PEIA 2JBJA 3FVLA 1TWGJ 2G9WA 3WTWC 4XPKA 4OWRB 4RB0A 2ZO4A 4A3GJ 3DBHB 4GM5A 1EV7A 1YI2I 1TL8A 5FLXK 4MPIA 2BY3A 2MLGA 2DFIA 5IT9K 5JVTA 4ZY1A 3T8WA 2F5FA 3MN8A 4MFPA 2DPSA 2BW3A 1Z0XA 1QQ9A 3FNCA 3HKZN 1LEBA 1XGMA 5TJJA 2IEKA 2XAUA 2F7VA 3V7SA 5DWNA 1K83J 1ZGAA 1NH3A 1Q2DA 1YR0A 3KI9A 1MIJA 3VE5A 2RNGA 2WPXA 2XASA 5LHHA 3G2BA 2E2JJ 4PZJA 2QKLB 5GADJ 3K70C 3ZMSA 1TQIA 3DGVA 3GTJJ 1DGRM 2Q8KA 2ZMEA 5HNFA 2MBFA 1J59A 5BPDA 4B44A 1XSDA 1X1DA 3FF3A 4MHGA 3EY5A 4ENNA 2Z10A 4NQWA 1N77A 1DE4C 4J19A 1KQ0A 1W7PD 3DTEA 4NQWB 2UXXA 5EGOA 5IYBJ 4AG7A 3DTIA 2W7NA 2JTVA 2HYJA 4CCJA 1X2NA 4HEA2 3CUQC 4NDLA 3GOXA 2KIFA 4MY0A 4NBQA 3ZMZA 3C3WA 1JKPC 3KCCA 3TO6A 1CT2I 2HTSA 1CQTA 2B3UA 1XGSA 2XHKA 5LRKA 3SXNA 5D5VB 2DA7A 1SAXA 2CF4A 2IAIA 1KZHA 2CNTA 1I1GA 4ZI6A 5JI6A 3KYCB 4ENKA 1RRJA 4KVXA 1IGBA 4F0XA 1MMDA 3DKXA 3K4JA 4LG3A 1WKXA 2DTRA 2DTZA 2ENZA 2WTEA 3S14J 2PRQA 3VWBA 2Z16A 4EATA 2ORWA 2E71A 3ERED 4X8IA 2D1HA 4CRZB 1H9GA 4H0EA 2BY0A 4MRIA 1MJBA 1FTTA 2LYCA 4M3DA 2V9KA 1SGQI 3FMCA 3H8GA 4EV0A 3PDNA 2IA0A 3EFAA 2E5NA 1QHGA 2K02A 5EG0B 2HDDA 4I49A 1REPC 4G7OF 1KZFA 4CYCB 1S3ZA 3GX4X 1LR9A 4IF4A 4BU2A 2I10A 3CQZJ 1CX8A 3PIPF 5LGNA 1ZHFA 3JRFA 4LFUA 3H3ZA 3TL4X 4OMEA 2DA5A 2WUUA 3K10A 4F9VA 4LGWA 5H6QA 2CV1A 3BLYA 4AIHA 2LKXA 3D2MA 4XPDB 3K1MA 2O3FA 1FJLA 3QQAA 3SJMA 2QJ8A 1ZG1A 2XF6A 2XKOA 3P9IA 3TT2A 3PB7X 1B4AA 1AMPA 3K69A 4PK2A 3HYIA 3FRMA 5DD8A 3G3ZA 4B47A 2WV0A 1TIHA 5GTHC 2GLOA 2R7HA 2EILH 1WKMA 1DPRA 4NF1A 4QBJA 1TNTA 1O3RA 1RETA 3CCVI 1XS9A 4IVNA 2GLJA 3UKGA 4A6DA 3ZMTA 2V4JC 3SDGA 3VSLA 3I56I 3S16J 1MT1A 4HV5A 1Y8FA 2ODDA 2ZNZA 1BUSA 1LOKA 1X3ZB 4I0BA 2Q7SA 1OFCX 3RYPA 4PJMA 4JCVE 2C1CA 1FX7A 1W7PB 1X1PA 2QECA 3A0HC 4PK4A 3MMYB 3CCRI 3E5UA 4M6HA 5KTAA 3R5AA 3HRMA 4KN7X 2HOEA 3LQQA 1MMSA 4N4NB 2M7BA 1IB1E 1H0MA 2ZW5A 2DQRA 1ZLIA 2FA5A 5HVQC 2ZSHB 7CPAA 4I02A 2L9NA 2VQLA 4O5VA 2DQLA 2G3TA 2CG4A 4DZJA 1TBNA 2HWVA 3KP6A 3BG6A 2QSFX 3HB9A 5FUVA 1XF8A 4QWQA 1L0CA 2OTLI 3JW4A 2F5IA 1BR1A 2CSOA 3B02A 3GZ5A 3UNGC 4OIDA 4X0GA 4KZTA 3COAC 3O8GA 5IT9Z 2DDBA 1JUSA 3ML6A 1ZG5A 1S8NA 2O8XA 4HLXA 1YIJI 3BQYA 4X6AJ 3W6KB 4O3MA 1MSFC 2Q51A 1OCCH 4II2A 2QBYB 2KCWA 3SEQA 1UJ8A 1U3EM 2DT6A 3EUKL 4U0WA 4A3CJ 1JJ6C 1BLLE 3HDDA 5HDKA 4JJXA 4LLLA 4ZDLA 4KFCA 4MHYA 4PGHA 1IY5A 2K27A 3D5SC 1WRJA 4B13A 1SFXA 3E6CC 2X52A 2X9DA 3KQZA 1BJZA 3L2UA 5JGFA 2VI7A 2VC1A 2CGPA 4GCVA 5LGUA 4HAMA 4RS2A 4YFJA 3HUGA 4CS0B 2K4JA 2IJZA 1FNOA 1NHAA 1OKRA 2V1NA 2VXZA 2NNYA 3M3YJ 4GDFA 1UFMA 3PUBA 4M71A 2EBJA 3DR6A 2XGCA 3DCFA 3CP2A 3BG7A 1PCEA 1NSLA 2IA2A 2DJNA 5FROA 3I59B 4KS9A 4HSTA 2VPLA 1LCPA 4GO1A 4IOCF 2PIZA 4PK3A 4P4FA 3KLOA 3HSRA 4XBFA 3VOEA 1G3SA 1IXSB 4WWCA 1HDQA 5ICCA 1XGNA 2EA2A 2PMUA 3T8TA 3JRUA 4LG0A 1MMGA 5GCNA 3PNVA 3DF8A 2Q0OA 4II3A 2JJ7A 4BUPA 3PM1A 3RKYA 2G0BA 3BJ7A 3I53A 2PJ9A 4JWPA 3R1KA 2FSRA 3RYOA 4CYNA 1SD4A 3BG9A 1FYMA 1HOMA 3P9CA 4NC7A 1K78B 3E7LA 2WAFA 3GZ6A 2STWA 4AG9A 3B6CA 2HB6A 4H89A 1YIOA 1FSHA 2MGQA 2VQYA 1RUOA 3MGDA 1QZYA 9WGAA 1XX5A 4PPZA 1EE3P 1FIAA 1IICA 4EWTA 4B12A 3HLPA 2DK5A 1AA7A 1JKRC 3OL0A 3TX8A 4ON0A 2ESNA 3KPHA 4P45A 4RAYA 1XGOA 4SGBI 1YX5A 4BJTA 3LWFA 2NMTA 2HXIA 3DKYA 2LSOA 2OVOA 2NVYJ 4F52A 2IGNA 3JTGA 4D1QA 2R7RA 1JGSA 2QVOA 1T98A 2PJ8A 3IV5A 2LMDA 2RKHA 1WHUA 2GOMA 1HCRA 3H9QA 3NARA 2WPWA 4Q36A 1UZCA 3FISA 4UVAA 5EJCA 4MEXF 2N17A 2EA4A 4CAXA 2XAHA 4E4HA 3VEPA 4O23A 1JT6A 5CVRA 3HM5A 1IDYA 4DJAA 3NEUA 5HOOA 1Y7RA 2L0KA 4E7LA 1XE4A 4LB5A 4JYWA 2BV6A 3VDXA 4LOCA 3LSHA 1UWYA 4P4EA 2ZJRF 3TE4A 1GHEA 2Z0ZA 3K0LA 4AD9A 3R9EA 2GIVA 1GV2A 4C2MJ 3FBIB 1WZ2A 2G7UA 5IPAA 4A3LJ 2MA3A 2ZKZA 1BI2A 3JVNA 3BTJA 5A2QK 2BL1A 2VODA 2CUEA 3DU6A 3JUWA 1N78A 2UWMA 2WA0A 1S7OA 3HSFA 3BPXA 4Y13A 1BO4A 3M1EA 4L5IA 2Q4YA 3B3SA 4ZY2A 2M5WA 2HGCA 1P7IA 5AG7A 2F2EA 3LFKA 2M2EA 4DW6A 3FB3A 2HPIA 3GTGJ 3WR7A 4EFDA 2I3CA 3M1CA 4RI1A 2KISA 1VQ6I 2VRWB 3DKWA 3D3SA 2HV2A 3WT4A 2Y0MA 3OYFA 3KZIC 3QODA 3R6SA 3AAFA 4OC1A 3GLXA 3K2AA 4C2UA 1W3SA 5EX3A 3ROUA 1HF0A 3OS1A 1O3QA 3ONQA 1Y39A 2QQDA 5LYIA 1F43A 3CXPA 3QU6A 4LLNA 2AFXA 2RNJA 4L9NA 4G6QA 2WZNA 2VIXA 4FHTA 4W9YA 2EV6A 4W1UA 4MIMA 2F5VA 2FQ3A 1F2PA 1EKEA 4HPSA 1QSNA 3BJAA 4BMHA 1MMNA 2XEIA 1D0XA 1R79A 4C2TA 3J7YJ 2EFNA 3RSNA 2VBZA 3ZCOA 5E20A 4MCPA 3TKYA 3CJNA 2DT5A 2IA1A 4CH7A 1FSEA 3S8PA 1YLEA 4QC6A 1MJ9A 2LH9A 4EJOA 1WH7A 1ELMP 4AVBA 3WTUC 4OP4A 1C0WA 2ELKA 3F5BA 4MI4A 2BVMA 4I99C 1EJ9A 2EIMH 2P5KA 4B10A 4RGRA 4ENMA 2BEOA 3U1DA 1OLTA 1BBYA 3GTMJ 3H3VK 3SDBA 3KHZA 5CVVA 2JA6J 1XMXA 3FMRA 2ANPA 3E0KA 3W6SA 4G94A 2MSYA 5AG5A 5GAGJ 1ZLJA 3F0AA 4KOSA 1RKTA 3QOPA 4R8FA 3JTKA 2Z3OA 2KRHA 3W2VA 4CGZA 1MZBA 3PBEA 1IF1A 1EH7A 1LFBA 2VKEA 2VJIA 1QGPA 3G71I 3J7AY 1BPNA 3H5NA 4FASD 2O4HA 1KU3A 2B4DA 3LSJA 1A31A 1MDMA 4UXHA 4LD5A 2A4NA 2F6CA 2L3DA 3FMSA 3TO9A 1M8CA 3JR9A 2R7XA 3OXFA 2HOTA 2CWGA 3CXQA 5A27A 3OYJA 4FETA 2AFUA 3G73A 3EO4A 1HPTA 3CCUI 3S32A 1U8RA 3CDLA 2KDZA 5E17F 3WGGA 2EZIA 2XB5A 1TGSI 4ITVA 2Y9YA 5F0HA 3UEYA 4A0YA 2CW0F 4HDUA 4YGOA 5M3MJ 2OAZA 4BACA 3E5XA 1OCTC 4IHYA 1Z8XA 2L9VA 5J40A 3H9GA 3TOAA 1P92A 2KPMA 3QYBA 2L54A 3UOEA 4C2ZA 4G6TB 1Z7KB 3Q0VA 4UFXA 3PQJA 1AWCA 1VQKI 1V3FA 3ZJ0A 4ASNA 3KEYA 4Y33A 4DBRA 1XD7A 3RCOA 1BR4A 2QEXI 3CCJI 3SEZA 3AL0C 1SGRI 3P2HA 1Z6RA 3BG3A 4XOTA 4FBEA 4L5JA 3KEQA 3PFEA 3PSIA 1BIBA 4KITB 4BH9A 4DUKA 4JOMA 4C7HA 1CPXA 2VE8A 5E3NA 3T5XA 2DXIA 1OCZH 3BTLA 2PMZN 5HODA 2D5VA 4B4CA 3GFJA 2PJRA 2V1DA 1IG7A 2Y31A 1D0YA 4AC0A 1QNTA 5B5EC 2R5YA 2HKOA 1HW2A 1IY6A 5IYCJ 4IX7A 2REEA 4OIWA 2E1CA 2FCKA 4FCYA 3CPXA 3DU5A 1VQ8I 2JQ7A 1APLC 1FC3A 4BHPA 1KYZA 1S9HA 3VARA 2ZXWH 1J7KA 2OD1A 2VZZA 3N7ZA 4OC2A 5CVUA 2ME6A 2V1UA 3O3KA 2V9PA 4IZZA 2ATRA 1S7EA 2WB1N 2X6YA 3C2BA 5E79C 2RGVA 2D4OA 1Y1VJ 2X4HA 1D1BA 5BS6A 4U9ZA 1TQPA 3F6OA 2HUZA 4A5MA 2RB7A 3WTZA 2AQFA 3VYSB 4LQGA 1G3TA 3GXOA 2ESHA 2YNCA 2M7AA 1JKQC 3W6JB 2OB0A 3S93A 5LFAA 2NYQA 1ON0A 1LEAA 1OISA 2M34A 2ZW4A 1I3QJ 2ZNYA 3K1NA 1KUXA 3VYUB 1WGXA 4MTEA 4UVBA 5L3GA 3OYBA 3RNZA 5IX3A 2PR1A 1FZPB 3I4NJ 4CZCA 2OZHA 1PJUA 3WE3A 4IRIA 2VOOA 3BR0A 2I5UA 2CUJA 4HX8A 4U88A 1Y0UA 3E3VA 3FHZA 4TV7A 4U9YA 4LB6B 4XSXF 4RB2C 4BDZA 2OJED 1WGCA 2VKDA 2GKRI 2IT0A 1CHOI 4LIUA 1LDKB 4I2OA 1WK4A 4C3JJ 2BOAA 2UZ3A 1AUGA 1Z8LA 2PC1A 4HF1A 1L0OC 4E6KG 1BW6A 4NJRA 5EBVA 2IBDA 1LFUP 3ERMA 1X3WB 2KHMA 1LAMA 4XICA 2CTCA 1A2ZA 4I01A 4LIVA 2NU0I 4KOWA 3GZNB 2QQ9A 5K5OA 1RI7A 2ARHA 3HUVA 4MCRA 3KP7A 1KONA 1S7LA 5ICFA 1M1DA 4FKDA 1G2HA 3TP3A 4P44A 3WTYC 1PVEA 2NS8A 3ZQHA 4HDVA 1FLIA 4HNYB 1O57A 5IY5H 1WPKA 4CZZA 4MFJA 5B1AH 2BUEA 4EVYA 4J00A 2F48A 1PYVA 4MFDA 1B1BA 3ZQLA 1HKTA 5FVJA 3C18A 4WXDA 1WJBA 1X10A 4F7ZA 2FX0A 1EF4A 3BLNA 2FT0A 2QQBA 2LRDA 2QQ8A 3PSFA 5LRRA 3WTTC 1TKJA 1YX0A 1U8BA 5K8PA 3R61A 3CLQA 4B5PA 2X0LA 2ELJA 5K7ZA 4A3EJ 2KRFA 1WTJA 1Q1HA 2R7UA 1TW3A 4RS8A 1PPFI 4OC0A 5F47A 5G20A 1JT0A 1YJNI 1U6MA 1KU9A 1VQPI 2R7SA 3IGRA 4KUBA 3BJ8A 2DYRH 3ZPLA 4KIBA 5F1RA 1IW7F 2EK8A 1ENHA 4YWYA 5CVJA 4BEHA 1UB9A 1J4JA 2X51A 3BXMA 1K61A 3VB2A 1RTQA 4ONUA 2ZMEB 1IRZA 2JSCA 1Q2CA 3SHFA 3S6GA 3E6BA 2PJ6A 1YFHA 4EQQA 3PJRA 2HQRA 2QUFA 1DS2I 1VQNI 3LAJA 2B58A 2W25A 4QPQA 3EDPA 1LB2A 1ELLP 4CCKA 2ID3A 2O9LA 1LVAA 3FXKA 1Q7LA 5G1ZA 5C88A 1QSRA 4XNHC 4O6JA 1HQCA 3ZOBA 3KE2A 2A68F 2XSJC 3B73A 1WJFA 4EJUA 2Y30A 1VNDA 4FQGA 5GP9A 5D4RA 3TCVA 3FXMA 1TKHA 2J8MA 3H3UA 2DEAA 4XQFA 5D4SA 4BQAA 1XN7A 2MH9A 3K2ZA 4ESJA 1H88C 3H0GJ 4MLOA 3CDHA 5EZGA 2IRFG 5DDGA 3E6MA 3AG1H 3IJ3A 3R96A 3VPRA 2OTJI 2O61A 1G59A 2VBYA 4IRHA 1OR7C 4HW0A 1TBOA 1SQHA 4D9JA 4OADA 2V8VA 3HKZA 4U0VA 3OYDA 2ZOGA 2VJJA 3A01B 2QPOA 3GWZA 3MFKA 3VYRB 1FPQA 3FBUA 2EPFA 3ULQB 4A24A 1JTXA 4XRFA 3V8IA 3GO5A 2OBPA 1VQ4I 2GXGA 2EBIA 2E5RA 2ZEFA 2X1CA 2CFXA 2W48A 2ZEOA 1Z9CA 2A6TA 3RZAA 1W4MA 3BJ6A 1LE8B 3FC3A 1YSJA 2HR3A 2P7CB 4CXFA 2YNCC 3HSEA 3GFLA 2POKA 1ETVA 5D8NA 2EIKH 3FXJA 2KIMA 3WU1B 5C82A 3R5DA 2DDAA 5M3FJ 2QENA 2WBMA 4IOAF 3D68A 5L3EA 2V8DA 3KY9A 4CGOA 5ILSA 2YR2A 1YTPA 2EWBA 2G9DA 2LNBA 5EF6A 2CIJA 1QMUA 1XPXA 1J09A 3LOCA 1OR7A 3WGHA 1IZ1A 3FBNB 3PO3J 2PE3A 4PJ0C 1Z4RA 2Q4VA 1UUCA 4EMSA 3CESA 2GLFA 2HQYA 2ZEMA 5L3BA 1DDNA 5FLVA 5CCLA 4R8HA 4XNHB 1XMTA 1K6OA 1GXPA 3IO1A 1R22A 3K2KA 1VI0A 4AYBN 3TTHA 4YRVA 5DAEA 2GE3A 4XNFA 4IAVA 1Z9UA 3W2AA 4CRYB 4X5KA 1P6RA 3OOPA 2V53A 4QUSA 2PMHA 5J1QA 3A1YA 2QBYA 2FVGA 2QYVA 1X1BA 2LF8A 4LUAA 3S9NA 3TDUC 3K4NA 3D67A 5FRMA 2B7EA 2M1BA 3CZ6A 1MDMB 4B3AA 5LHGA 1SVMA 1YRNA 2CU7A 3BPVA 2XF7A 1BW5A 2M30A 3EUHC 3R0JA 5ISVA 2HVRA 2CV0A 1RPWA 2R8VA 1XA6A 3NWSA 1R9TJ 4HRIA 2HOSA 3PB9X 4M6VA 2Z2SB 1IRGA 3MVPA 3HRUA 4L5EA 4CDGA 2CV2A 1TUSA 2X7BA 1YW4A 2E35A 3P5JA 1YW9A 1R7JA 2H27A 1GVJA 2HC9A 1HLVA 3ASOH 2K9NA 2ZENA 3E5QA 1O3SA 3NE7A 5KVRA 2DYSH 4QLCU 2CNMA 5JM6A 4A3MJ 2VXDA 2LREA 3E1SA 3HEFA 3Q5FA 1UHSA 1Q9BA 4XKWA 1VHOA 3I64A 3MZYA 2DFHA 2F4IA 2KQRA 2EQRA 4PSXA 4HNTA 1HDUA 2QZ8A 2FIAA 2R7ZJ 2ZPAA 3VODA 2I79A 2LY2A 3CXSA 1R23A 3FM5A 1D3YA 2A61A 3I3GA 4MCSA 5J1RA 1M4LA 1E3HA 1ZRFA 5JQ4A 1QVUA 1G8XA 4KOVA 4R7MA 2WVJA 2OOTA 1JHHA 1JTYA 4CGLA 1MJAA 2R5ZB 2BVLA 4EJWA 1F5TA 2LUYA 3T8RA 3FSXA 3SJFA 3UY5A 4M3SA 4UB6C 2DA1A 5HVGA 3L09A 4XR6A 2P5VA 4IXAA 2HKXA 1ONVA 4CYOA 3CC2I 5HS7A 2ARPF 1S7KA 3CF2A 4N9HA 5M5YJ 3BOQA 4NUBA 1W4RA 3LAPA 2V6EA 3PQKA 3HGYA 4PJNA 1JGGA 1V55H 4KICA 1Y1WJ 5HS8A 1BN5A 1TC3C 3L2QA 1P7JA 3DWLE 4B6DA 5JLXA 1K79A 2ORVA 2DU9A 1HJAI 4G8XA 3FWEA 3OYIA 1VQ7I 3PIOF 3OY9A 5IOYA 4A2ZA 3OYKA 3E97A 2B5GA 5LD2C 3WABA 2L02A 4C30A 1Z3XA 2B4DB 5LYFA 1X2MA 3O6BB 1W5TA 2O8KA 3WTVC 3JRIA 5DCMB 4BJ6C 2X3TA 1Y0RA 1K78A 4UFWA 1ORKA 2NU3I 3IP4B 4XLAA 2VB6A 1X74A 2I00A 1USSA 2W84A 4F6AA 1ZG7A 1CJWA 3OMYA 5HVHA 2OA4A 1EH8A 4A3KJ 1AN1I 3GTOJ 2Z3LA 1T0FC 3S17J 3DR8A 4KJZA 4BQOA 2KRCA 4XM3A 1ZQ3P 3S2HJ 2IPQX 3V7RA 1IV8A 3ZQQA 4OIQF 1TP4A 3JREA 3TMOA 4M3GA 1Y9WA 4A32A 5LRGA 1D0ZA 1MNEA 4E8OA 5DM6F 1W36D 4MEYF 2JBKA 1UAAA 3D8PA 4L9TA 5HLTA 1ZG9A 5EEHA 1YQAA 2L01A 4R6TA 5I0CA 2OC6A 1F36A 1POGA 5A2QZ 4JP0A 5EC4A 1CM0A 5E8IA 2GM4A 4RA2A 1QSOA 4UBRA 2DMUA 4A5NA 1ERDA 2LP0A 3OS2A 1QPMA 1XMKA 3V42A 1ULKA 4RDUA 1UELB 2CTBA 1P4XA 3BWGA 5LRSA 1WQ2A 3ZMVA 3NE8A 1Z05A
chains in the Genus database with same CATH topology
4HA8A 4OIOF 4ZZDA 1EH6A 5HLHA 3L00A 4KIGA 2EFOA 3GKRA 3QB8A 2OQGA 2IP2A 2G7HA 2R3SA 2A3SA 5F46A 2F5CA 3QRFF 1CF7A 4Q5SF 4UCNA 3MCZA 4UXNA 3LODA 4KOTA 5K5RA 3F21A 1W7PA 1ZRCA 3ZZIA 1XCBA 1I27A 2Z3NA 3N4MA 3F3XA 4N9IA 1P4WA 1T39A 3GUDA 5F6FA 2EFWA 2NYXA 1PUEE 3RIRA 2Z99A 3F8BA 2RN7A 3WGIA 5FO5A 3P9KA 1R1TA 1QBJA 4RB3C 3DP7A 1BC7C 2PSWA 2RQPA 4HX7A 1U5TC 2CO5A 1BOBA 1R1UA 1XEBA 1A04A 3KZYA 1U78A 5FFXA 4IJAA 2UZKA 2OZGA 5FFZA 2VE9A 1RO5A 4OIRF 4CICA 4KYWA 2CWEA 3JAMZ 1RNLA 1K7AA 2C6YA 5A28A 1OMIA 3F8FA 4A33A 5F48A 3EQLF 3FYNA 2EFQA 1I6XA 1R1VA 4LK1F 1J5YA 2VC0A 5E1ZB 1S29A 2FOKA 2C27A 1S5KA 1T2KA 3KZZA 2B5GB 5HDNA 2UXNA 2FMLA 3IWEA 4D0PA 2Z11A 4B14A 3C1DA 4PDKA 4P9UA 3G8WA 3EETA 1OYIA 2HFHA 2KJBA 3M9AA 3DSBA 4KOYA 2VT3A 2D1VA 4A12A 3H4QA 2L4MA 2YGWA 2GA2A 2M8EA 1XIXA 2OD5A 5BQTA 4MHDA 3U2RA 2M87A 4KDPA 1KU7A 5CLSA 4R3LA 1M4GA 2FNAA 1IUYA 3T90A 4L9VA 2RV8A 3KP5A 1NMTA 1FNNA 2LDUA 2PR8A 2EV5A 2FS5A 2JLMA 4KUAA 2JDCA 3FM3A 3P7NA 1YREA 5KTCA 1QSMA 2B4BA 5E96A 1SFEA 4YG2F 2E1NA 4M9ZA 2DW4A 2Y48A 4R79A 5DWMA 4DQ2A 1MK4A 3ELKA 5FLXZ 5E1WA 4XPLA 2A6HF 3GF2A 4UCMA 2K5TA 3HRSA 3GYAA 1JE8A 4JBAA 1YS7A 3BJOA 1V0CA 2P6FA 5D8LB 1B6BA 4HOBA 3JTHA 1IN8A 2BYVE 4CAVA 3FX3A 1JHFA 5AG4A 3K1PA 3TGNA 5DEQA 4U7DA 3S2WA 1YW7A 2DPUA 4FD4A 1D8KA 4HX4A 1T6SA 1B9MA 1N71A 4UCPA 2D4PA 1J0RA 3JSOA 2FRHA 4CAFA 1QO0D 4YIIA 4YIFA 4PCQA 3F6VA 5LBQA 1HSTA 4OU0A 3KEOA 1KA8A