3TO9A

Crystal structure of yeast esa1 e338q hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Histone acetyltransferase ESA1
total genus 83
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to9A02
2G9WA 3GZ6A 3U9GA 2AS5F 3ZP5A 1FYKA 5HVQC 4I49A 4XPDB 1ODDA 3OWCA 4WX9A 2M45A 2P0WA 4ZYDA 1P92A 4CICA 3HRTA 3PZJA 1QSMA 2L4MA 1R7JA 4AIHA 4CHUA 2GXBA 3PQKA 1XGNA 4PSWA 3Q5FA 3P2HA 4KUBA 2HDCA 1XDUA 3BPXA 1B1BA 1QSRA 1P0HA 2ZW7A 4ONUA 2HQNA 1BC7C 4KMUX 4EGZA 4MQ9F 4KOUA 3GFMA 2QBYA 2IW5A 2F5CA 4M72A 3L7WA 2QVOA 3J80Z 1J59A 1G4DA 2XKPA 3VFZA 2PSWA 3KLNA 3OOPA 3JW4A 4DNCA 3TT2A 5KTCA 3D2PA 3GY9A 3EUHA 4KVXA 2JTVA 3J81K 3F72A 2A07F 1GXPA 4L8AA 2PFBA 4JWPA 1IN7A 4HF0A 3HOSA 4IHSA 4PK2A 3CUQC 2ISZA 2QLZA 1OYIA 2X4HA 2Y48A 3F3XA 1VTNC 1P6RA 2GAUA 3MAJA 4JJXA 2IA0A 2REEA 3I59B 4FD6A 5KTDA 5HDNA 1Z05A 2RN7A 2GIVA 3CLOA 4WXHA 5DCFA 4L9TA 1PUEE 1TQIA 2FMYA 2CW0F 2FXFA 1RNLA 2P6SA 4U5YA 4NCZA 1ZHFA 2OU2A 3C26A 4EM0B 1D3YA 2STWA 1CGPA 1IXCA 3ELKA 5H20A 2GWRA 3JAMK 2A4NA 4HQEA 2DPUA 1BN5A 2ZKZA 3D8PA 3K69A 5L3DA 3F0AA 2OH1A 4M9XA 3GKRA 4PDKA 4CS0B 2A6EF 1QO0D 4IXAA 3L2CA 4LLNA 5ERIA 3WTTC 2A68F 2CWEA 1A04A 1WWZA 1LB2A 1BBYA 4L9JA 3R61A 2PRBA 4XLPF 1XCBA 2FMLA 3WE2A 2H94A 5HH1A 1YK3A 2HYGD 2FL4A 1IICA 2BV6A 5FLXZ 2JT1A 1Q2YA 1I5ZA 5JHUA 5KVRA 3V8KA 4F7ZA 4HLYA 1FNNA 4R3LA 1CF7B 5J6XA 2K27A 1R23A 1B6BA 4LD5A 4U7DA 3DFGA 4YIFA 4I0AA 2NYXA 3W6JB 3BJ7A 4XSXF 4YGOA 2KIFA 2GE3A 3NE7A 2A6HF 2JPBA 4RGSA 2ZMEA 3GFIA 1SD5A 4PK3A 3V8IA 3EY5A 2EFPA 3I71A 3JUWA 2Z0ZA 5D5XB 2H5MA 5LGNA 1YW7A 3SZTA 4YIIA 4D0PA 2HFHA 4PSXA 1CF7A 3K1NA 5F64A 4LMYA 2I00A 2WPXA 5DYMA 1D8JA 2ZW5A 1IF1A 3PFIA 1ZLKA 1C0WA 4HX7A 3RKWA 2EA2A 5K5QA 5KTAA 3S6FA 2Z3YA 2XIGA 4MGRA 4A0XA 2VOPA 4Q4ZF 1YX0A 4OIOF 5D5VB 4G8XA 2WWYA 2FEZA 4O6JA 5HS9A 1RO5A 1SD6A 1HKSA 2P6GA 1G3WA 4MEXF 3P2FA 1B6AA 4B5PA 2HEOA 4G9YA 3GXOA 2QQ9A 2BUEA 4MHGA 3T0YA 3DDDA 3I58A 5H86A 1FBQA 4Y15A 5ICFA 4RB2C 4WK8F 3ABUA 3GW2A 2H09A 1OYWA 3CXQA 2ARHA 3IWGA 4I7HA 1J2XA 3LA3A 5H84A 1KU2A 3F8CA 2TDXA 2OBPA 1YLEA 3PP9A 2B58A 4BHCA 4RGXA 1DUXC 3DQVC 4YG2F 1Q2CA 2B4DA 2PN6A 1YR0A 3RIRA 4EJTA 1IZ1A 4IRHA 1HKTA 4R57A 2EV0A 1EV7A 2PG4A 5CNPA 4RS8A 4ZZDA 4RB0A 5ICGA 3P7NA 2HR3A 2DPDA 4EQQA 5LLQA 2HTSA 3CUOA 4I2OA 3DPLC 1LNWA 4B09A 4ASNA 3E5QA 3LD2A 1XN7A 3TDZC 2IA1A 3I9SA 4RAZA 3QPTA 4AIKA 4U88A 3TE4A 3LWFA 1UFMA 3DV8A 3HSFA 5DD8A 2Z33A 2D2WA 1MZBA 4HF1A 5ILUA 3HTUA 2ZPAA 2RC4A 3L09A 1ZYRF 1FLIA 3U1DA 2VXKA 3VOEA 4A5MA 3MZHA 3EXNA 1T2KA 1RXTA 5I0CA 2XV4S 5D6FA 3IHUA 3GF2A 1OZPA 2VI7A 3BY6A 2WV0A 3NRVA 2CYYA 1BIAA 3ECOA 3WGHA 3TO7A 2KIUA 1EH6A 4PV6A 2F5DA 4HKFA 1R58A 1U6GA 1U8RA 1DDNA 1G3TA 3ZQ7A 2JRTA 3WTZA 1BIBA 5D5WB 3WTVC 4OMZA 4EM2A 2IPQX 3T8RA 2J8MA 4A6EA 4LJZF 1ONVA 2CG4A 3GFJA 4HNWB 2P5LC 1FSHA 2Q4YA 5LBQA 2W25A 2FIAA 1YQAA 3FM3A 3FXUA 3ZMSA 2P6TA 2ZW4A 2F5IA 1L0CA 2O61A 2EV6A 2KJCA 5DEQA 3GWZA 3RYPA 5FGMA 2IVMA 3P9IA 1KU7A 3LAJA 2X0LA 1UCRA 4EJOA 3HHHA 3WTSC 4H6UA 1V3FA 2H6BA 3TKYA 2QQBA 2E1NA 4A5NA 4BXUA 4Q47A 1HW2A 4OMYA 1FT9A 1WKMA 2XKOA 2ZCWA 2HZTA 1YW8A 2KCWA 1R1TA 4K30A 2F5EA 5FLXK 2AJ6A 2V79A 3G73A 2GZWA 2MA3A 3QRFF 3M8FA 1IYLA 1NHAA 2QWWA 2P7CB 2FBKA 2M87A 2R7HA 4WCGA 3ML6A 3B02A 4L18B 4G6DA 3D3SA 2XROA 3E6CC 1LJ9A 4GYIA 2O3FA 2W57A 2BGCA 3COAC 2QM3A 2KRFA 5E18F 4LUAA 3I0TA 5JFRA 4CAVA 5AIPA 1IN5A 1ZN2A 1LDKB 2XGXA 5FB2A 3FX3A 3HRUA 1TQMA 1QPMA 3WE3A 1S7FA 3TCVA 5ILSA 2DFIA 5F1RA 3FYNA 5D5UB 3F8MA 1S3ZA 3R9GA 4KOTA 3KLOA 1K79A 4KVME 4OINF 5JI6A 2D1VA 1I1GA 2BEOA 3M8EA 1KYZA 1QGPA 5IT3A 4NXYA 4R8HA 3ZN0A 2OB0A 3FMRA 1ZG5A 2L3DA 2G0BA 2O03A 4KLWA 2K4BA 1YG2A 3CUQB 3K2ZA 4HA8A 2J8RA 1G6NA 4H89A 5D8KB 2IRFG 3CO7C 3K9UA 4JBAA 4IVNA 2MC3A 3EETA 2JLMA 1JXSA 4A6DA 4LX9A 1IRGA 1TQPA 5J8CA 2DAOA 2RNJA 3G3SA 2P8TA 1GVJA 3FIXA 3MQ0A 3E5UA 2QECA 1BO4A 1Y9KA 4LK0F 4KIBA 4E70A 1QSTA 1R36A 3IKTA 2RVCA 1UFHA 5CVRA 3CUQA 5HLGA 4MTDA 2XASA 1W7PB 5E1ZB 2ZFWA 5D8LB 3L9FA 2LF8A 1S60A 5BMZA 1T98A 2RDPA 4EM1A 1U3EM 3K1MA 3KEQA 2IJLA 2STTA 5K5RA 3T90A 3QU6A 1F4KA 1XE4A 4AVAA 2BE5F 5AONA 2VODA 1I6XA 1O3QA 2XAGA 1MDMB 1KUYA 3DSBA 5CVJA 1B9MA 2B3UA 2H27A 3RDIA 5IB0A 4M6XA 4FT8A 4HV5A 2CNMA 2JDCA 3S6KA 4GO1A 3NQOA 3BJ8A 3DR6A 2HQYA 5LHIA 1SMTA 4HX4A 1Z4RA 3JVNA 5ICEA 3CO6C 3R1KA 5CYVA 1MGTA 3DF8A 3FF5A 2K86A 2CSOA 2G7UA 4EMSA 4NHJA 1IYKA 1QNTA 1XMKA 4IHTA 4XLNF 4ENNA 1ON1A 3FZVA 2OA4A 4LFUA 4U0WA 2P7VB 4EJUA 1S7KA 3KP2A 4HV6A 2VBQA 5CJ9A 1YW9A 2UXXA 4ETSA 4AVCA 1Z4EA 3V4GA 2YPRA 3BLNA 4HQMA 1YREA 2XAFA 5BPIA 5E96A 2E1CA 2L54A 4KLVA 4I0BA 4L5IA 4ORFA 2Z11A 1RUOA 4KZTA 4YFNF 1DP7P 4B5OA 2G3TA 3MFKA 1S7OA 3LODA 1ULYA 3F5BA 1USSA 3RYOA 4RI1A 1F5TA 3F8NA 4ZBGA 1LDDA 4YFJA 1WQ2A 1SD4A 2J5OA 1MJ9A 4KICA 4NQWA 1JGSA 4ESFA 3N97A 2QUFA 4UA3A 1FYLA 1RUNA 4ZZLA 4I02A 2PR8A 5K5OA 4ENJA 1ZGAA 3P9KA 2OZGA 5DWNA 2W84A 2OQGA 4WXDA 3KP5A 2UXNA 2NAZA 3LQQA 3LSTA 1NE9A 3F6VA 4HDVA 2ZJ2A 4L9NA 1P2FA 2B5GB 4KA4A 5AIQA 4R3KA 3C3WA 1N71A 2LDUA 3WU0A 3E5XA 3H92A 3CJNA 2O0YA 4EJVA 2FIWA 2JDDA 3T9YA 2ATRA 1FOKA 2COMA 4LB6B 1PP7U 3TFYA 3SZPA 2R7DA 5BQTA 1FPQA 4G94A 3QP6A 3K9TA 1YFHA 2HV2A 2HS5A 5FFXA 5F49A 3BOQA 4MEYF 2R3SA 3C18A 1USTA 2VE8A 1KQ8A 1UB9A 4GCVA 2MH9A 2QENA 1XGOA 3KFWX 1KU3A 4FX4A 4ENMA 3IWZA 3EYYA 1HSTA 1MKMA 1BC8C 2CO5A 4FHTA 3V7CA 1TNSA 2AXLA 4ESBA 1Z6TA 3ZPLA 4LG0B 2CY2A 2DQLA 2FSWA 3PQJA 2E7XA 2NMTA 2FXAA 3FRMA 3VWEA 3HYIA 4U0VA 1S5KA 3E0KA 3RJPA 1R57A 4OIQF 3U2RA 4QWQA 5LGUA 2GANA 1W5TA 1OR7A 4B5PB 4QC6A 1ZAOA 3FXRA 2EK5A 5CVIA 1Z9CA 2IP2A 4OOIA 1M4DA 4KT5C 4A0ZA 3EQLF 2LNBA 1B87A 1TNTA 4LG0A 3QB8A 4H6ZA 4KVOE 4ZYGA 2D4PA 1R1VA 1K4JA 5E8GA 3IC7A 2Q0OA 3G3ZA 1WWXA 4HYEA 3J80K 5CVUA 4PGGA 2FBIA 3HTSB 3WTUC 3BJAA 1J9IA 3VB2A 2YU3A 2A69F 3Q9VA 1QZYA 3B8GA 4QVTA 2DT5A 2L01A 3ZZIA 4E8OA 3F22A 3FB3A 4JLYA 3BPVA 3ZMDA 1PUAA 2VC0A 1XCVA 4KOXA 2XAQA 3IKVA 4BYYA 5HOOA 3RTRA 4AIJA 4IPAA 2UWMA 1FSEA 3HUGA 4FX0A 4RGUA 4N9HA 4G7OF 2FRHA 1J0RA 5FD5A 5FFZA 5LRSA 1FBUA 2ZNYA 4KN7X 4L9VA 2DK5A 1VKCA 2PJPA 4R87A 3KZYA 3TTHA 4NSQA 2Q2EA 2AE6A 2CNSA 1YO5C 2V6CA 1KZFA 2EFQA 1KGSA 1TBXA 4P55A 3ZJ0A 2ZO4A 4HX8A 4QUSA 1FP1D 2XHKA 2PQ8A 3JAMZ 1NMTA 4I98B 1S3JA 4XPKA 1E2XA 1Z7UA 4P96A 1X3UA 1HW1A 2M30A 3TO6A 1AWCA 4AG7A 3R60A 2LF7A 4CRZB 3T5XA 3BJ6A 3H3ZA 1LEBA 5DCMB 2V9VA 4Q48A 1XEBA 3SXNA 3FM5A 2V1DA 2ZMEB 4HZFA 5DUIA 4HNXB 5E20A 5L3CA 4MI4A 1R5HA 1GXQA 4I09A 5FO5A 3DKWA 4R79A 4LLGF 2EUIA 3E3VA 3P9CA 4HLXA 3SFZA 2G7HA 4HAMA 1BI0A 3W6SA 3C7JA 4WF2A 4BMHA 4GGGA 4OIRF 2HYFA 4KOSA 3F6OA 4WXCA 2ZBKA 1IXSB 5F48A 1KUXA 3N4MA 1ZLJA 4M9SA 1ON2A 4XNHB 2FU4A 5L3EA 1HSJA 1QSNA 1LRZA 4UHTA 3IRQA 2MBFA 3ERED 1FX7A 5IX3A 4OAEA 4MJ8A 1RIOH 3QU3A 2K7LA 5HMNA 2VT3A 1M1DA 1S29A 1YYVA 3N7ZA 3HSEA 3J7AO 3RKXA 3BWGA 3BP8A 3WTYC 4M85A 1LVAA 1Y0UA 4GS4A 4Z2YA 1S7AA 2VC1A 3SXYA 4A0YA 4AVPA 3V8JA 4U7BA 2FNAA 4LK1F 2CFXA 1FZPB 4Y13A 4UBRA 1KU9A 4I01A 2O6GE 4CO8A 3I4PA 3JSPA 1FBSA 1H9TA 2Q7BA 3F8BA 4PZJA 3R0AA 1P4WA 2NRAC 4JXRA 2WPWA 1S6LA 4E0AA 4RB3C 4G6QA 3QP5A 1OYYA 1XGSA 2EB7A 3GLXA 4XSZF 4AWXB 5F46A 5L3FA 1R1UA 5LHHA 2VE9A 4UV9A 2F5FA 3NEUA 2P5VA 5DCMA 3FHZA 3TOBA 3F21A 1IB1E 1HBXG 3REOA 3ULQB 2CNTA 3HRSA 2OQRA 1L0OC 4II9A 1STZA 1P4AA 2GXGA 4ESJA 2JPCA 1KA8A 1O7FA 5HDGA 4M3SA 1R5GA 3K0LA 4MY3A 1MK4A 2B3VA 3IL2A 2P5KA 4LB5A 4NB5A 4FD5A 1U5TC 2MD5A 4IRIA 2VQYA 3WTWC 2FE7A 3WTXC 2REFA 1D8KA 2LSOA 1S8NA 3HIFA 1U6MA 3B73A 2BEIA 2FQ3A 4BHBA 4CGZA 4L0YB 1Z1DA 3RI4A 2EFOA 5K1YA 4IF5A 4JXQA 1ON0A 2XAHA 3MWMA 2WTEA 2IL4A 1F1ZA 3K1PA 3DEUA 3D2MA 2P6FA 1TW2A 2W85A 5TRDA 1ZRCA 4KYWA 2VOOA 4GYGA 4KDPA 1XSDA 1UHMA 4UVBA 5HS8A 4ZYHA 5JR3A 3R9EA 3JTHA 2M8EA 3KP4A 2B4BA 2FOKA 5BPDA 4J3GA 1ZG1A 4XBFA 4MHDA 1YTYA 4KUAA 1Z91A 2VBXA 5ED4A 2Z10A 4IF4A 1J5YA 3CXSA 3FWEA 2P4WA 1I1DA 1IN4A 1BOAA 3MEXA 1Y9WA 5JPHA 2Z99A 1YGHA 2MH2A 2R7FA 4KNYA 2QZ8A 4RGRA 3KP7A 1DPRA 2ISYA 3V7RA 5EEGA 4BH9A 2O8XA 2DXQA 1U78A 4Y49C 3GVAA 4AVBA 3WGIA 3O2PE 5J8FA 3FMQA 4HNYB 3SXOA 1YLFA 1MJAA 1K6OA 2FNPA 1HKQA 4S04A 3KZZA 3TO9A 5F47A 2YSRA 4LLLA 4Q5SF 4F6AA 1YS6A 1ZRDA 1EH7A 2Q44A 2Q8KA 1FP2A 2HWVA 4A12A 1O3TA 1U5TA 2VBWA 2PI0A 4RS2A 2VN2A 4HBLA 2KIMA 2EV5A 4O3MA 2H6CA 1SD7A 1BJAA 2VT2A 3MCZA 3RPQA 3HRMA 4M73A 3HOTA 3ROUA 4UUVA 1PDNC 5C82A 4L89A 4TV7A 5L3BA 1J75A 2DI3A 1GHEA 1MD0A 3GFLA 1IN8A 2QIRA 1SQHA 4NEXA 4UVCA 1LQ1A 2Z9OA 4CDGA 1IUYA 1XB4A 2DBBA 2OZ6A 2FT0A 1G3SA 3WU1B 2FBHA 4KN4X 3E6BA 3HHGA 3TGNA 2X7BA 3R6SA 5IV0A 5D4SA 3JSOA 1VHSA 3Q9SA 4QLCU 3KE2A 1U2WA 3WG9A 4UWIA 4N9IA 1IXRC 5D6EA 2PC1A 2R1IA 3GUDA 1M4GA 3SHFA 1R22A 4B8XA 4YFKF 1B59A 1NSLA 4EVIA 2M1BA 5LEKA 2QQAA 3PGPA 2QBYB 1K78A 2FSRA 3EC4A 1BI1A 5GCNA 4ENKA 2IA2A 2BSWA 4K2EA 1F9NA 4GXOA 1SMYF 5ICCA 4MNUA 4RAYA 1FYMA 5E1WA 5DUKA 3CDHA 4PGHA 1XSXA 1W7PA 1SFUA 5LEJA 3MGDA 1XMTA 4U0YA 3GYHX 2PEXA 2R98A 2KJBA 4ON0A 4FD7A 3S6GA 5DDGA 2FF4A 1L3LA 3ABTA 3EDPA 2CGPA 4XRFA 5HLHA 3M7GA 3I59A 1R00A 4KMFA 3VODA 5ILVA 3I64A 4MTEA 3R9FA 1MDMA 2CQKA 5CVVA 4FD4A 1D5VA 3H4QA 2ETHA 2ACJA 3GZ5A 4JQFA 4M9ZA 2JEVA 5CLSA 3I54A 3CXPA 4RB1A 4R1HA 5F6FA 2B4DB 1O7LA 4CAXA 1XDSA 2YX7A 2JZYA 4AD9A 3FNCA 2R8VA 4BHPA 4XPDC 4UWJA 3AAFA 3VEPA 4BAYA 1E17A 2PMUA 2V1UA 2DQRA 2G3AA 2F2EA 2Y0MA 1XIXA 4UXNA 1XD7A 3ZMTA 1G3YA 2NNNA 4N0BA 2I79A 5EC4A 1ZG3A 2NNYA 1DPUA 3QOPA 1XMAA 2P6EA 5EEHA 2ZXVA 2XAJA 4UV8A 1Q1HA 2ELHA 4KUMA 5TJJA 3R96A 4HW0A 1FY7A 2A61A 2EFNA 3JTGA 2ADUA 1BM9A 2HKXA 5A2QK 3FXQA 2ESNA 4U9ZA 4Y49B 4KIFA 1H0MA 1JE8A 4XNHC 3MZYA 3KEOA 1IW7F 1KYWA 2XVCA 4L0ZB 3ZMUA 3KCCA 3ZN1A 4E2AA 4KOYA 3V8LA 3KP3A 4ZH4F 3RKYA 3G8WA 1T6SA 1LEAA 3EFAA 4U9YA 5LGTA 1PU9A 3DP7A 3ZMVA 3ISPA 2XUBA 3M9AA 2B5GA 6PAXA 2VXZA 2PMHA 1REPC 3TOAA 5DD4A 3D5LA 2Q4VA 4CYDA 4IRGA 4OIPF 3GX4X 2E7WA 2DLLA 3T1BA 2OZUA 2HKOA 1OMIA 2KKOA 4BQAA 4NF1A 3BJOA 4LGWA 4EJWA 1FC3A 2K02A 1W5SA 1P4XA 4UNOA 3FMSA 3ECHA 2YX4A 4YFXF 3IGRA 1OKRA 2VZYA 2FA5A 4M74A 5DV5A 2C27A 4HOBA 4G7ZF 1I21A 3R0JA 3TDUC 1J4JA 4R9MA 1QZZA 3M1EA 2RGVA 3DR8A 2HOEA 4KFCA 1M44A 2D1HA 2EJRA 2GA2A 1WK4A 2WC2A 2DW4A 3R4KA 1S7LA 2FS5A 2XRNA 2PDOA 3EYIA 1BI2A 1MJBA 3T8TA 4OADA 3LA2A 1I1SA 2IT0A 1YVKA 3WR7A 3FXTA 3C1DA 4KIGA 4G7HF 1IRFA 3BDDA 1WI9A 3WGGA 1I27A 1J7KA 2K5TA 4P9UA 1SFEA 3SHPA 4S05A 2ZXJA 3ZMZA 4AB7A 4WWCA 2PBIA 1XGMA 2M5WA 3LFKA 3TQNA 1QBJA 2B0LA 2DK8A 3V7SA 5H6RA 2VEZA 2RV8A 4HF2A 2OZHA 1WRJA 1IAWA 3HSRA 2Z5UA 2VBYA 1WSUA 3DNSA 1I12A 3E6DA 5BOXA 2L02A 2OAZA 2UZKA 1CM0A 3DPTA 1KQ0A 1XSVA 2PLYA 3J81Z 1GHCA 2VZZA 4KORA 2W24A 5JVTA 1CJWA 2O28A 5ISVA 5LRRA 2D4OA 3FBUA 4YRHA 4XPLA 5HS7A 3WODF 3QPHA 3VWDA 3I53A 1SAXA 1O3SA 2HQRA 5LHGA 2HUZA 2QYOA 1TTYA 4M71A 3KETA 3F8FA 1HXDA 4Y17A 2RQPA 1EH8A 1Z6RA 3RYRA 2RKHA 2VONA 2YR2A 1Z9UA 3BZ6A 1ZARA 1FWZA 5D4RA 1HQCA 2ESHA 1OPCA 5IT9K 3LAPA 1B4AA 2EFWA 1T0FA 5BS6A 4CXFA 4MBUA 1AOYA 4CRYB 1ZREA 3O6BB 2ZNZA 4MQVA 4JK1X 1M4IA 4QB9A 4O5VA 1ZH5A 3S6HA 2ZW6A 3H3UA 2D45A 3KP6A 4EV0A 3QAHA 1XF8A 2QMLA 3E6MA 4QBJA 3LA7A 4OU0A 1LDJA 1QSOA 4EVYA 4L5JA 1V4RA 5E1XA 2EVNA 1Y7RA 1SFXA 4JD6A 2NS0A 2DO7A 3L00A 1TW3A 4MY0A 1O57A 4P5OA 1PP8F 2PR1A 2HTJA 1TLHB 5HDKA 1Q2DA 4M6YA 2EWNA 1HW5A 1BI3A 4DQ2A 1P4NA 2LKPA 3GYAA 2FCKA 3R95A 2BBYA 4KOWA 1QQIA 3W6KB 1W4MA 5JQ4A 2GA1A 1JHHA 1B9NA 3GEZA 3I5UA 1YS7A 3BROA 1YVOA 1O3RA 5IT9Z 2MLGA 1K78B 5H6QA 4HDUA 4CZZA 1RI7A 2GQQA 4X5KA 1W7PD 2DTRA 3UY5A 3CTAA 4CAWA 2BYVE 1S7NA 1UHWA 5FD6A 3W6XA 3IRRA 3W91A 2J8NA 1ZGJA 1IN6A 2Q0YA 2OD5A 2MLKA 2V1XA 5DWMA 2VBZA 4EGYA 1IIDA 3IWFA 3SQNA 2EA4A 3O3KA 1KQ9A 3F23A 5KK1A 1T39A 2A3SA 4IUSA 5A2QZ 2J5PA 5C88A 2A5YB 2C6YA 2HGCA 3I3GA 1YIOA 4H0EA 4ZYEA 1H9GA 3EO4A 3GO5A 4A2UA 1TIQA 4IJAA 3OV8A 1U5TB 3DXJF 2L4AA 3KKWA 5E17F 4BNCA 4P9FA 4AG9A 5E8IA 1ZRFA 2K4JA 2Y75A 3S2WA 1T38A 3E97A 5FVJA 2BL1A 2DU9A 3RPUA 1V0CA 2JSCA 3D0SA 1KUVA 5HLIA 5L3GA 4OLLA 4UVAA 1BOBA 3LQRA 4KOVA 4F0YA 1RZ4A 1JHFA 4PCQA 3F8KA 1K7AA 5EBVA 2FE3A 2Q04A
chains in the Genus database with same CATH superfamily
2G9WA 3GZ6A 3DEWA 3U9GA 3OXGA 5I4MA 2AS5F 3ZP5A 2ELKA 1FYKA 3K4MA 5HVQC 3JREA 4I49A 1PUFB 4XPDB 1ODDA 3OWCA 3IU2A 4WX9A 2M45A 2DDAA 2P0WA 3CESA 4DYCA 2AFUA 4ZYDA 1P92A 3BT9A 4CICA 4NDLA 1SANA 3HRTA 3PZJA 1QSMA 3H8EA 1LAMA 2L4MA 2JVHA 2KDZA 1R7JA 3IUOA 4AIHA 3OYCA 4CHUA 1WH7A 3GCMA 3WG7H 2GXBA 3PQKA 1QVUA 3UKGA 1P9ZA 1UG2A 1XGNA 3IU1A 3SI2A 1YOVB 4PSWA 2R7UA 3Q5FA 3P2HA 2XEGA 4KUBA 2HDCA 1XDUA 3BPXA 3BI1A 1Y56A 1PTRA 4IO9F 4MFPA 1B1BA 1QSRA 1P0HA 2ZW7A 2JUGA 4P4EA 4ONUA 4OC2A 2JA8J 4D7NA 1X3ZB 4RM2A 3NARA 5GAEJ 2HQNA 3ASOH 3HJEA 4KMUX 4BEHB 1BC7C 1OMUA 1MMGA 1PUFA 4EGZA 2GLOA 4MQ9F 2F8HA 3V38A 4UEFA 4KOUA 3RAMA 3S9LA 4Q38A 3GFMA 2QBYA 2IW5A 2F5CA 4DIQA 4M72A 3L7WA 2QVOA 3J80Z 2NU3I 1J59A 1G4DA 2KRCA 5LYLA 2QYVA 2XKPA 3VFZA 5CCMA 2PSWA 3CDIA 3KLNA 1CGJI 4MXUA 4OIWA 3OOPA 3IEHA 5B1AH 3LSRA 2YNCA 5E3MA 4I99C 3JW4A 4DNCA 4BGDA 4J00A 3D2PA 3GY9A 4ONWA 1T33A 1Z0XA 3EUHA 3D7DA 3TT2A 5IB9A 2V8GA 2MC4A 3OYJA 4KVXA 2JK3A 2ZC2A 2JTVA 3CCEI 3J81K 3SFIA 3PJRA 2DMNA 3G2BA 4C2UA 4C2YA 4NNJA 1WGTA 4G12A 3A01B 2W4SA 3F72A 1GXPA 2A07F 2NU2I 4L8AA 2K3PA 2PFBA 4JWPA 1IN7A 2E60A 4HF0A 3HOSA 4IHSA 1X4PA 3A0HC 4PK2A 3ZQCA 1FTZA 3CUQC 2ISZA 3NFZA 2QLZA 4DW6A 1OYIA 2X4HA 2Y48A 1NG7A 3F3XA 3SDBA 4F55A 1B8IA 1HDUA 1VTNC 1P6RA 2GAUA 1FMWA 3MAJA 4JJXA 2IA0A 1H8AC 2REEA 2LBFA 5B66C 3I59B 4FD6A 5KTDA 5HDNA 1Z05A 2RN7A 4P44A 1CBXA 1A6IA 1RR8C 5C3EJ 2NU0I 2H1KA 2GIVA 3CLOA 3ZXSA 1FIAA 4WXHA 5DCFA 4L9TA 4UXJA 2Z3LA 3OXLA 3GB0A 1PUEE 1TQIA 2FMYA 4XNFA 2CW0F 3IV5A 2G0EA 2FXFA 3OR1C 4ZC3A 1RNLA 3H8FA 2P6SA 4U5YA 4NCZA 2VPLA 1ZHFA 3OIOA 1ZGWA 4A3CJ 2OU2A 3C26A 3HM5A 2G9DA 4EM0B 1D3YA 2STWA 3G1OA 2E34A 4BXFA 1CGPA 1AU7A 1IXCA 3ELKA 3LSMA 3ZQHA 3IH3A 4PJ0C 1JKPC 2PJ2A 5H20A 3VWBA 3CMEI 1KBFA 2GWRA 3JAMK 2A4NA 4HQEA 3PDNA 3QYFA 1HJAI 2DPUA 4OMEA 5JVGF 1BN5A 1X1CA 2BW3A 4PK4A 2LBFB 3PB6X 2L9NA 2ZKZA 4QIWN 5H2FC 2CWGA 3D8PA 3K69A 4I6ZA 2Z3OA 2VI6A 5M5YJ 5L3DA 3F0AA 2RAEA 3PB8X 2OH1A 3FXOA 2PJ6A 4M9XA 3GKRA 4R6TA 4PDKA 1K61A 4CS0B 2F4OB 4DBQA 2A6EF 2HOAA 2XGCA 5EGOB 3PFYA 1QO0D 2E5NA 2LKSA 4F8ZA 4IXAA 3L2NA 3L2CA 4LLNA 5ERIA 3CCYA 3WTTC 2A68F 2QGUA 2CWEA 4QPOA 2GVIA 1A04A 4UUSB 1WWZA 1LB2A 2BUSA 2VJ5A 2Z1DA 1BPNA 1BBYA 4L9JA 3R61A 2PRBA 1X1AA 4XLPF 1XCBA 4CCKA 4FKDA 2FMLA 3WE2A 2H94A 5J3LA 1V1IA 2QQCA 5FUXA 1YK3A 5HH1A 2HYGD 2VB6A 4RDUA 1N77A 2BOAA 3IIBA 2FL4A 4JX4A 1IICA 3D7FA 2BV6A 2ELIA 5K8MA 4E4HA 1UHSA 5FLXZ 2WA0A 3IFEA 2XB0X 2JT1A 2VXDA 5J4YA 4NC8A 2CXAA 2R5YB 1Q2YA 3AG2H 3R5DA 4PJMA 1I5ZA 1MBJA 1TUSA 1CQTA 2BOLA 5JHUA 4XN0A 2JJ7A 2M9HA 5KVRA 3OS2A 1IC8A 2PJRB 3V8KA 4F7ZA 4EFDA 3W3CA 4HLYA 3R5BA 1FNNA 2LH9A 2X1DA 4R3LA 3MKWB 2K9NA 1CF7B 5J6XA 2K27A 1R23A 2R7VA 4UCPA 1B6BA 2R5ZA 1ARMA 4LD5A 4U7DA 5EMIA 3BTLA 3FXKA 1OFCX 3DFGA 4XR6A 4YIFA 2YUUA 1BUSA 4MLOA 2ZEPA 4I0AA 2NYXA 4ZY1A 3W6JB 3G1MA 2AFSA 2UUZA 1HDDC 3OYGA 1WJBA 3BJ7A 4M6HA 1IW4A 4XSXF 1EKEA 3JTKA 4MCRA 4YGOA 2KIFA 2GE3A 3NE7A 2A6HF 1TBRR 2JPBA 1Q1VA 4RGSA 1KZHA 3A02A 2ZMEA 5FKLA 3GFIA 2JW6A 1SD5A 3W6XA 1ULKA 4PK3A 3RZAA 3V8IA 1U9OA 1MMSA 3EY5A 2FX0A 3SZGA 3X2QH 1NG6A 3JRFA 2EFPA 3I71A 3BHXA 3JUWA 2Z0ZA 5D5XB 2H5MA 5LGNA 3CCMI 1YW7A 3SZTA 4ZDOA 4YIIA 4GRIA 2R7SA 3VPRA 5KAIC 1WH5A 4D0PA 2I3CA 2HFHA 4PSXA 2JMWA 1P7IA 1CF7A 4C7IA 3K1NA 5F64A 3LSJA 1TWAJ 2XGDA 4LMYA 2I00A 1ZO0A 3A03A 2WPXA 5DYMA 1D8JA 4X8IA 2ZW5A 4BXXJ 5HVGA 1IF1A 3PFIA 1ZLKA 3LFUA 4HX7A 1C0WA 3MVPA 4IL6C 3RKWA 4OC4A 1PYTB 1BAVA 2EA2A 5K5QA 1LOKA 3S6FA 5KTAA 3UFFA 2Z3YA 2ZEDA 2XIGA 3ABLH 1VNDA 2KDOA 4MGRA 2M3AA 1YMEA 4A0XA 1OCTC 4V19K 5D29A 2VOPA 4Q4ZF 2C6GA 1DP3A 1YX0A 4OIOF 5D5VB 2IS6A 2NVUB 4G8XA 2DYRH 2FEZA 2ZSIB 1P9QC 4O6JA 4W1UA 2WWYA 5HS9A 4SGBI 1QQ9A 3I3LA 1RO5A 1XG1A 4CCJA 1IGBA 1WPKA 2WZNA 1D0XA 2ZOFA 3QYEA 1PJRA 1SD6A 2XPWA 1HKSA 4Z6YA 2P6GA 1ZQ3P 1G3WA 4MEXF 2H8RA 3P2FA 1B6AA 1M1EB 1YI2I 2N71A 2SGQI 4B5PA 2OUMA 1MMAA 2HEOA 1HEEA 4G9YA 3GXOA 3BCAA 3OR2C 2QQ9A 2ME6A 3CCQI 2BUEA 2ZEFA 1BMOA 4MHGA 3D00A 3T0YA 3DDDA 3I58A 3OYMA 5H86A 1G2HA 1FBQA 3IWWA 4EEFG 2K9LA 2M0MA 3PSFA 4Y15A 5ICFA 2DDBA 4RB2C 4WK8F 3ABUA 2YUSA 3GW2A 1VGYA 2H09A 3HKZA 2JVGA 2DJNA 1Y0YA 2HOTA 2CTCA 2V6EA 2ZEGA 1OYWA 1Y0RA 3CXQA 2ARHA 4E7LA 2X1CA 1LVKA 3IWGA 2ME0A 5LFAA 3FBIB 4I7HA 5E3OA 1R49A 1J2XA 3LA3A 5H84A 3DLJA 1KU2A 3HOWJ 3F8CA 3V7ZA 1ZTRA 2TDXA 1LE8A 2RREA 3NA6A 3I9V2 4JYWA 2OBPA 1YLEA 2XF7A 2B58A 3PP9A 4BHCA 4IHXA 4BINA 2X85A 3NH5A 4RGXA 3OYKA 1DUXC 2AXTC 1H89C 3DQVC 2L2OA 3A1YA 1W3SA 4YG2F 3S3OA 2VQCA 1Q2CA 2B4DA 2FOWA 2COBA 1VQ7I 2PN6A 1YR0A 1QHHD 2CQQA 3RIRA 1WJEA 3B3SA 5IPAA 4C2XA 2HI3A 4FTHA 4EJTA 3GTJJ 1IZ1A 4IRHA 5JH9A 1HKTA 4R57A 2EV0A 1EV7A 2PG4A 2R5ZB 1Z8TA 5CNPA 4RS8A 4ZZDA 4RB0A 1MBFA 4B13A 5ICGA 3P7NA 2HR3A 2WSAA 1RESA 3C2BA 1ZKGA 1ETXA 2MW8A 2DPDA 4EQQA 5LLQA 2HTSA 3CUOA 4I2OA 4NGMA 3ZOBA 1ZG7A 3EPZA 4NJQA 3ZRGA 4MCPA 3VH9A 3M1CA 4CCLA 3DPLC 1LNWA 2EINH 4B09A 1LE8B 4ASNA 3E5QA 2HQ5A 3LD2A 1XN7A 3ONQA 3TDZC 2IA1A 4MIMA 1LKXA 3H1CA 3I9SA 1Z21A 4RAZA 3QPTA 5KAFC 4U88A 4AIKA 3KHXA 2NOGA 3TE4A 3LWFA 1UFMA 3DV8A 3AG3H 3HSFA 4A3KJ 5DD8A 1YSJA 2Z33A 3G71I 2D2WA 1MZBA 3JRIA 4CGLA 4HF1A 5ILUA 1UG0A 3HTUA 4OIDA 2ZPAA 3BR2A 2RC4A 3L09A 1ZYRF 1FLIA 3DU6A 3U1DA 4ZGYB 2VXKA 3VOEA 3CCVI 4A5MA 2ORWA 1TT0A 2CMPA 3MZHA 5DAEA 2ODFA 2ZSHB 3EXNA 2WAQA 4HNUA 5F0FA 2WYRA 3FKIJ 1T2KA 4MMOA 3BG9A 4F92B 2Y0SN 1ELLP 4M6GA 3BTJA 2DOAA 1RXTA 2XV4S 5I0CA 3VDPA 3ZQLA 5D6FA 3IHUA 3RU0A 4AXVA 2KMUA 3H0GJ 3GF2A 5GAHJ 1OZPA 2NU4I 4B47A 1YIJI 4LQ6A 2M4KA 2VI7A 6CPAA 1OR7C 5DS9A 3BY6A 2WV0A 3NRVA 2CYYA 3CP8A 1BIAA 3ECOA 3KEYA 2NOJB 3WGHA 1S20A 3TO7A 2KIUA 1EH6A 4A3BJ 1CG2A 4PV6A 2F5DA 3FDYA 3UGDA 4HKFA 1R58A 1U6GA 1U8RA 3AFHA 1XPXA 1DDNA 2VJ4A 1G3TA 2CQXA 4B3AA 3ZQ7A 1W4RA 2JRTA 3WTZA 1BIBA 1W5CC 5D5WB 5TGTA 3OYNA 3WTVC 4OMZA 4EM2A 2IPQX 3KPHA 3T8RA 2J8MA 3DWLE 1UUCA 4BJ5C 2QCOA 3EUKL 4A6EA 4LJZF 1ONVA 2CG4A 3GFJA 1GDTA 4HNWB 2JZMA 2P5LC 1FSHA 2Q4YA 5LBQA 2W25A 3SJMA 3N5FA 2FIAA 1YQAA 3FM3A 3FXUA 3ZMSA 2LUYA 1F2PA 2POKA 2P6TA 2EILH 2ODDA 1S5LC 1P7JA 2ZW4A 4UCMA 2F5IA 2ENZA 1L0CA 2O61A 3D4UA 2F7VA 2EV6A 1CP6A 2KJCA 5DEQA 3GWZA 3RYPA 5FGMA 2GM4A 5HODA 2Y2ZA 2IVMA 3P9IA 3PM1A 4F91B 3S93A 1KU7A 3LAJA 3S16J 2X0LA 1UCRA 3VSKA 3DTIA 4EJOA 4RBOA 3HHHA 3WTSC 2CV1A 1V3FA 4H6UA 4X2TA 2H6BA 3TKYA 2GIZA 2PJ8A 2QQBA 2E1NA 5FUWA 1LANA 2LB7A 4II2A 4A5NA 2B0UC 1LR7A 4BXUA 4Q47A 4XK4A 1HW2A 4OMYA 2XSJC 1FT9A 3SEKC 5G1ZA 2CH0A 4B10A 1WKMA 2VRWB 2XKOA 2ZCWA 3CPAA 2OJED 2QKMB 2HZTA 1YW8A 3S32A 2KCWA 1R1TA 3OSFA 4K30A 1X58A 2F5EA 3LWUA 5FLXK 2AJ6A 2V79A 3G73A 4PFPA 1HOMA 3IO1A 2GZWA 4B6ZA 4LITA 2QSFX 2MA3A 3QRFF 3HDDA 3M8FA 3TJQA 1IYLA 4II3A 5FKMA 5F0HA 4XMYA 1NHAA 2O5RA 2ABZA 3HH2C 8CPAA 2QWWA 3BTCA 2P7CB 1TWGJ 1PPFI 2FBKA 2P81A 2M87A 3CZ6A 3KZWA 3WC7A 1VQ6I 2OTLI 2R7HA 4WCGA 1QPIA 3ML6A 5HNFA 3B02A 4L18B 4G6DA 1TT5B 2ZJQF 5EX0A 1Y6IA 2IGKA 1B8IB 1APLC 3D3SA 4MFQA 4HNVA 2XROA 2NS7A 2ECCA 3E6CC 5JM6A 4A3LJ 1LJ9A 2V8HA 4GYIA 2K9MA 4B44A 2O3FA 2W57A 3VYTB 2BGCA 3COAC 1YRNA 2QM3A 1D0ZA 2KRFA 3QYBA 5FRMA 5E18F 1YW4A 2DPSA 2KL4A 1UHAA 4IHYA 4LUAA 3I0TA 4XRSA 5JFRA 2I10A 3HOVJ 1BPMA 3IWEA 4CAVA 5AIPA 4DJLA 1IN5A 1T95A 3HOYJ 1ZN2A 4WJBA 3WABA 1LDKB 2XGXA 5GAGJ 5FB2A 2F48A 3FX3A 2JA7J 2PIYA 3FK6A 3HRUA 1TQMA 1QPMA 3WE3A 2YU9J 3BR3A 3FISA 2L7XA 3B7IA 1DU6A 4N4NB 4A3FJ 2EZHA 1S7FA 4PXBA 3TCVA 5ILSA 3OL0A 2BHZA 2DFIA 4BJ6C 4ZYQA 3ZCOA 5F1RA 1TF8A 3FYNA 2EIMH 2ZELA 2KLOA 4PXCA 2Q2EB 3ZQIA 3PNVA 4F0XA 2V77A 5D5UB 3F8MA 1S3ZA 1ELMP 1UJ8A 3BTIA 4AM3A 1IOIA 3KLOA 4KOTA 3R9GA 1K79A 1POGA 3UR3C 1ENHA 4KVME 2QQEA 4OINF 5JI6A 2OF7A 2D1VA 2JRMA 1I1GA 2BEOA 3M8EA 1KYZA 1QGPA 5IT3A 2N52A 3HUVA 5K7ZA 4NXYA 4R8HA 5IOYA 4IK2A 3ZN0A 2OB0A 1IUFA 3WHBA 3G4SI 2JQ7A 3PFOA 4IZZA 3FMRA 1ZG5A 1ETOA 2L3DA 3HXLA 5C4XJ 2G0BA 2O03A 4A2ZA 4JP0A 4KLWA 3IH4A 2K4BA 1S9HA 1HEVA 1XA6A 1VQOI 1YG2A 5C4JJ 2VL1A 4KS9A 3CUQB 3K2ZA 3PO2J 3ABMH 4HA8A 2AFZA 1G6NA 2J8RA 4H89A 5D8KB 2CQ7A 2IRFG 2ZFUA 3CO7C 3JRHA 5BNGA 2JN6A 3HOXJ 3UEJA 3FEEA 2YQPA 3K9UA 4JBAA 1HC8A 4IVNA 2MC3A 1DE4C 3EETA 2JLMA 5F09A 1JXSA 1Y1WJ 4A6DA 3J7YJ 2J87A 4LX9A 3RQ4A 3G6EI 1IRGA 3B3WA 5FJ8J 1VZ0A 1WKXA 1TQPA 5J8CA 2DAOA 2E73A 3ZR8X 1YITI 2RNJA 4PJLA 2PJCA 3QPLA 4XOPA 3G3SA 2P8TA 1GVJA 3H9JA 2NS8A 3FIXA 4P45A 2BXYA 1SFKA 4HSTA 2E2IJ 3MQ0A 3FJUA 3E5UA 1A2ZA 2QECA 1BO4A 1Y9KA 5M5WJ 4UEZA 4LK0F 1YJWI 4AC0A 4KIBA 4B1RA 4E70A 1QSTA 4CYNA 3SJEA 3PBEA 1R36A 1JJ6C 3IKTA 2RVCA 1UFHA 4A32A 2M2EA 5CVRA 3CUQA 5HLGA 1MBKA 2JBJA 4MTDA 2XASA 1W7PB 5E1ZB 2ZFWA 5D8LB 3VYSB 1G8XA 2PJ1A 4NFRA 1VI0A 3L9FA 2LF8A 5GPAA 1S60A 2EK9A 5BMZA 3PNYA 3L2WA 1T98A 2RDPA 4EM1A 4BY1J 4AUXA 1TURA 1I50J 4CPAA 1U3EM 1WHUA 5HLTA 3K1MA 2FUG2 2EBIA 1MBEA 2DA6A 1D1AA 3KEQA 2IJLA 1S7EA 2YGWA 4A30A 5B1BH 5K5RA 2STTA 3B3TA 3T90A 3QU6A 3E7LA 4IQ4A 1F4KA 2W0TA 1XE4A 4AVAA 2BE5F 5AONA 2VODA 2E2HJ 2BHYA 3PNTA 1UWYA 2AFXA 1S72I 1I6XA 3DCFA 2XAGA 3BG3A 1O3QA 1MDMB 1KUYA 3DSBA 5CVJA 1B9MA 1CSOI 3OXFA 2B3UA 2W48A 2H27A 3RDIA 1WJDA 1CPSA 5IB0A 4M6XA 2LD5A 5K8OA 3GOXA 4FT8A 4KSIA 2QQ8A 3DU5A 1U0JA 1SVOA 1FIPA 3TP3A 5E3NA 4XLFA 2VQGA 1N13A 3W2AA 4HV5A 3S3NA 2CNMA 2JDCA 3S6KA 4GO1A 3NQOA 4NC7A 3BJ8A 2R93J 2HU9A 2PJ7A 5FLMJ 3DR6A 2HQYA 3AG1H 5LHIA 5EEAA 5TISC 1QRYA 1A35A 1SMTA 4HX4A 1Z4RA 3JVNA 2R4GA 5ICEA 3CO6C 3R1KA 5C44J 2CU7A 1KWMA 5CYVA 1MGTA 3DF8A 3RCOA 2NYQA 3FF5A 3VDUA 3QODA 2K86A 4Q36A 3CDXA 1OCPA 2CSOA 2G7UA 4EMSA 2B8TA 1MSFC 1BJZA 4NHJA 2JA1A 1R3NA 1UELB 1IYKA 2K9QA 1QNTA 1XMKA 4IHTA 2E1OA 4XLNF 4ENNA 1XX5A 3KASA 1ON1A 1CHOI 3FZVA 5F27A 2OA4A 1YJ9I 4LFUA 4U0WA 4QPQA 2ARPF 2P7VB 4EJUA 1S7KA 3KP2A 4HV6A 2VBQA 5CJ9A 4RA2A 2Y0SA 1YW9A 2UXXA 1AA7A 4ETSA 7WGAA 1TZLA 4CGNA 4AVCA 1Z4EA 3RBUA 3V4GA 3S2DJ 2YPRA 1VQ8I 3BLNA 4RUHA 2EH3A 4HQMA 1YREA 4U87A 4OC1A 2XAFA 3UNGC 1HF0A 5BPIA 5E96A 2E1CA 3K4BA 4FWUA 2L54A 4KLVA 4I0BA 4L5IA 4ORFA 3LNQA 2Z11A 1GVDA 3BZCA 5FKNA 1RUOA 4KZTA 1PCAA 2DA3A 4YFNF 1XOVA 1GLNA 3RYOA 3TX8A 5FRNA 4B14A 1E3OC 1DP7P 4B5OA 2G3TA 1XRYA 4JCVE 3MFKA 1S7OA 3KYDB 1ULYA 3MZ8A 1USSA 2LK2A 4UUSA 3F5BA 4D1QA 1OCRH 4RI1A 1F5TA 2WVJA 1X2MA 3GTPJ 3OL3A 3F8NA 2V1CC 4ZBGA 1LDDA 1W1WE 5CCLA 1FNOA 2ZEMA 3KQXA 4HEA2 1WQ2A 3K2AA 4YFJA 1SD4A 1WCMJ 1MJ9A 2J5OA 3ESWB 4KICA 4NQWA 4XL9A 1JGSA 3NH4A 4ESFA 3N97A 2EO8A 4JX5A 5GTIC 1TC3C 2QUFA 4UB8C 3ZGKA 1FYLA 1IU8A 4UA3A 1RUNA 2LP0A 4ZZLA 1R4MB 4I02A 3S1QJ 1RTQA 2IS1A 2PR8A 5K5OA 3CCSI 4ENJA 3O8GA 2JBKA 1WJFA 1ZGAA 2LYCA 3P9KA 2OZGA 4AU7A 1BR4A 2EPFA 4E7HA 2QJ8A 5J1RA 5DWNA 2W84A 3QTLD 2OQGA 4UCNA 4WXDA 3KP5A 5IYBJ 2UXNA 2NAZA 3LQQA 3LSTA 3DBHB 4BE0A 1LPQA 1NE9A 3F6VA 4HDVA 1FOYA 2ZJ2A 4L9NA 2R5YA 1P2FA 2B5GB 5J1QA 4KA4A 5AIQA 2DA1A 3NH8A 4R3KA 4ZX8A 3C3WA 3BR6A 2Z3PA 1N71A 4MFZA 1SGNI 2LDUA 2OPTA 2WBMA 3WU0A 5GADJ 3E5XA 3H92A 3CJNA 4YELA 2O0YA 2LR8A 3JR9A 1YHQI 4Y52J 2BCOA 2PJBA 4X3RA 3KZIC 4EJVA 2ELJA 3OIQA 4CZCA 2FIWA 2FVGA 4UXIA 2JDDA 4UF4A 3H0DA 2V8DA 3T9YA 2XSDC 2ATRA 1ZLIA 3FH4A 1FOKA 2COMA 2F4MB 5FKKA 3GBGA 3U21A 1KMAA 4P4DA 5DS0A 3GLLA 4LB6B 3PIOF 1PP7U 4P4BA 2WB1A 3TFYA 1SGQI 3K4NA 3SZPA 2R7DA 2CWFA 4G6TB 5BQTA 5D8NA 1FPQA 2LY9A 4G94A 4BUPA 3QP6A 3WHCA 2V26A 3NAUA 3K9TA 1YFHA 2LFBA 2HV2A 2I8DA 3OYEA 2HS5A 5FFXA 5F49A 1LFWA 3BOQA 5IP6A 1R71A 1D5YA 3RNZA 1RPWA 4MEYF 5E3LA 3B6AA 2R3SA 3BR5A 1OISA 2HVSA 3GTGJ 3C18A 1SGYI 2L7FP 2O4HA 4UB6C 1USTA 2VE8A 1KQ8A 2FD5A 2WV1A 4NJRA 1UB9A 4GCVA 4UUTA 2K5CA 3F0CA 2MH9A 3VDXA 3OYFA 2QENA 1XGOA 1F57A 3K4KA 3KFWX 3PL8A 1KU3A 1WI3A 3PIPF 4FX4A 4XN3A 3IWZA 4ENMA 3EYYA 1HSTA 1MKMA 1BC8C 2CO5A 4FHTA 1DS3I 3V7CA 1Z8LA 3DTEA 3CMMA 2KT0A 4FE4A 5E79C 1TWCJ 3A2KA 2L0KA 4XLCA 2MGQA 3SI1A 1ULMA 4LQGA 1TNSA 4D5FA 3NWTA 3Q0WA 2AXLA 3CD6I 1M8CA 4ESBA 1Z6TA 3ZPLA 4LG0B 1OVOA 2DQLA 2FSWA 3PQJA 2E7XA 1VHEA 3ZQFA 2CY2A 2NMTA 2FXAA 2V53A 3FRMA 3HLPA 5ELYA 3VWEA 2VKDA 2KMQA 3HYIA 4U0VA 1UZCA 1S5KA 3E0KA 4OC5A 4MFLA 5AG5A 3RJPA 2VLAA 1HLVA 4OIQF 4B6DA 1R57A 2D5VA 4IEJA 4CUGA 3TBIA 4P4JA 1XFOA 3SI0A 3U2RA 1QVTA 2WY8Q 4QWQA 4ABZA 5LGUA 4NGTA 4UFVA 2CUJA 5IYCJ 2GANA 1W5TA 2AFMA 2CF4A 2Z3MA 1OR7A 2MSYA 3FEDA 3ABKH 1ERDA 4B5PB 4QC6A 2E36A 1ZAOA 3FXRA 2FNFX 1Q9BA 2EK5A 5CVIA 3LSGA 2IP2A 1Z9CA 2ZEEA 5G22A 4OOIA 4C3JJ 2LTPA 1M4DA 4KT5C 5CPRB 4A0ZA 3J7AY 3EQLF 4IX7A 1SEUA 2LNBA 2R7XA 1EJ9A 5LRGA 3MKZA 4BE2A 2RIJA 1B87A 1TNTA 4LG0A 3QB8A 5FROA 4H6ZA 3CT9A 4KVOE 4ZYGA 2D4PA 2W7NA 1R1VA 5CBMA 1K4JA 5EF6A 4P10A 3E2IA 5E8GA 3I55I 3IC7A 2Q0OA 3G3ZA 1WWXA 4GDFA 4A31A 4HYEA 3J80K 3D7HA 1Y7EA 5CVUA 4PGGA 4YRVA 1MNMC 2FBIA 4M6VA 2ZMEC 4DZJA 4HNTA 1FYBA 4BQNA 3HTSB 1V54H 3CMAI 2VL8A 3WTUC 3BJAA 1J9IA 2WAFA 3VB2A 2YU3A 2A69F 2DFEA 1QZYA 2L9SA 3Q9VA 1VQ4I 2HOSA 2B63J 3S17J 3B8GA 2BW3B 4QVTA 1X19A 4NUBA 2R92J 2DT5A 2L01A 2DCEA 3ZZIA 3UOEA 3F22A 4E8OA 4MHYA 1BR2A 1BR1A 5KTCA 3FB3A 2KCXA 2XEIA 1Y8QB 4JLYA 4CYPA 3BPVA 1X4SA 2RFHA 2R7OA 3FVLA 4E6KG 4XORA 3ZMDA 1PUAA 2V9PA 1VDDA 3WU2C 1YQEA 3OYBA 1GT0C 3HGYA 2VC0A 1XCVA 2WUUA 4KOXA 2XAQA 3IKVA 4BYYA 5HOOA 5LRJA 2E71A 2Z16A 3RTRA 4AIJA 4IPAA 2UWMA 4Y3OA 1FSEA 1XS9A 1MH4A 1VF9A 3HUGA 4FX0A 4RGUA 4N9HA 1V5EA 4BY7J 4G7OF 2FRHA 2AQFA 3Q0UA 2R7RA 4OKOA 1J0RA 1YX3A 2E5ZA 5FD5A 5FFZA 1FBUA 2ZNYA 5LRSA 4KN7X 4L9VA 2DK5A 1W0UA 2CWHA 1MIJA 2PJPA 4Y33A 2FJ1A 2VUMJ 2OVOA 1VKCA 4R87A 1Y1VJ 3KZYA 1BW5A 3TTHA 4NSQA 2Q2EA 4BS9A 1VHOA 2AE6A 4YWYA 1W36C 1YO5C 3B4VC 2CNSA 4ANJA 4OP4A 2V6CA 1KZFA 1UMQA 3CF2A 1X74A 3R5CA 2EFQA 3FF3A 1TXRA 5KHDA 1IY6A 1KGSA 3FC3A 2F6CA 1VQ5I 2VQLA 3MMYB 3LODA 1TBXA 1PYVA 2IBDA 4P55A 4V2FA 3JRAA 3ZJ0A 2ZO4A 4B11A 4HX8A 2SGPI 4M3BA 4QUSA 1FP1D 2XHKA 1ORKA 2PQ8A 4RM3A 4CGPA 4DYRA 3JAMZ 3JRBA 1X4OA 4LIVA 1NMTA 4I98B 1S3JA 4B4CA 4XPKA 1E2XA 3WC6A 1Z7UA 2CRGA 4P96A 1PVEA 4DBRA 1X3UA 1E3HA 1HW1A 2M30A 3TO6A 1AWCA 1NK2P 4AG7A 3R60A 2LF7A 4P6YA 4CRZB 2EIKH 2DMUA 4UIAA 4F93B 2Z2SB 3T5XA 2MFZA 3CCJI 3BJ6A 1YE9A 3H3ZA 1LEBA 1RKTA 5DCMB 2V9VA 4Q48A 1XEBA 3SXNA 2HXIA 4CCNA 4N4OB 3FM5A 5IY5H 2V1DA 2ZMEB 3BXMA 4HZFA 5DUIA 5K8PA 1X3WB 4MFDA 5IP7J 1QZEA 5E20A 5L3CA 4HNXB 4MI4A 1R5HA 1GXQA 3FECA 4I09A 3K10A 3K70C 1VQKI 2HDDA 2UZ3A 5FO5A 3BCBA 3DKWA 2PCUA 3ZQQA 4R79A 5J47A 3LSKA 4LLGF 3RSNA 3BG7A 3E3VA 3P9CA 2EUIA 2JA6J 2X6XA 1GV2A 2G7HA 4HLXA 1KONA 3SFZA 4HAMA 1BI0A 1PCEA 2ZOGA 3PFEA 1K6YA 3OL4A 5JGFA 3W6SA 3W6VA 1JQGA 1PJUA 4CAFA 2N8GA 1MBHA 2OTJI 3C7JA 2E5RA 3DEEA 2JWTA 4WF2A 4H2KA 2PVVA 4BMHA 2L7ZA 2XF5A 5F0CA 4GGGA 4OIRF 2HYFA 4XONA 4KOSA 3C2HA 1R43A 3H8GA 3F6OA 3CJQB 3RQIA 1M4LA 4WXCA 3PBBA 2ZBKA 1AKHA 2H8WA 2AQEA 1IXSB 3H9GA 1IGNA 5F48A 1KUXA 2PJ0A 4DUKA 4X0GA 1ZLJA 4M9SA 1DGRM 1ON2A 3N4MA 4XNHB 2XB5A 1Z8XA 2FU4A 5L3EA 1LR8A 4JYKA 1F36A 2PJAA 2ERWA 1HSJA 2HVRA 1QSNA 4CAWA 1LRZA 2BY3A 4UHTA 3IRQA 2MBFA 3ERED 2L5QA 5B3SH 2DYSH 3HPHA 4A69C 4J01A 2IEKA 4C7HA 1FX7A 5IX3A 4OAEA 1X2NA 4L9MA 4MJ8A 4DJAA 2K40A 1RIOH 4KJZA 3Q0VA 2A5WA 2KRHA 3QU3A 4IHWA 2K7LA 4CYCA 2TRTA 3D5RC 5HMNA 2VT3A 3J7ZI 2CW8A 3VARA 4W97A 3QWPA 1M1DA 1S29A 4BU2A 1CT2I 1K7TA 4RMNA 1YYVA 1OJLA 2JEWA 3HSEA 3N7ZA 3WC5A 3J7AO 3RKXA 3BWGA 4IQJA 3BP8A 5HVFA 3HEFA 3V42A 1G59A 1B72B 3JRCA 3WTYC 3GIUA 2NU1I 3KR5A 3GTQJ 1XMXA 4M85A 1LVAA 4XOTA 2DF5A 3C2GA 4C3HJ 5EDNA 5FUVA 2IS2A 1Y0UA 4GS4A 4Z2YA 1SC7A 1S7AA 4BBHA 2VC1A 3SXYA 1WFXA 4A0YA 4AVPA 4XLHA 5CQEA 1KBEA 3V8JA 4R76A 2KPMA 1MNEA 2FNAA 3FXLA 4U7BA 4PJJA 1H0ZA 3CCRI 4LK1F 1K7UA 2CFXA 1HDPA 1FZPB 4Y13A 2V1CA 1CGII 3VE5A 4UBRA 1KU9A 4I01A 4B3XA 2O6GE 4CO8A 4S0HB 1OCCH 1OCZH 3I4PA 1FBSA 4OAYA 3JSPA 1H9TA 1QA6A 2DOEA 4HSRA 4ZTFA 2DA5A 4CCMA 2Q7BA 2QQDA 3F8BA 4PZJA 1Z2LA 3R0AA 4BDYA 1P4WA 3OYIA 5JHFA 2NRAC 5HQ8A 4JXRA 2WPWA 1S6LA 4MRIA 4E0AA 4A3EJ 2Q51A 3L1PA 4RB3C 3NWSA 4G6QA 3AKZA 2RNGA 3QP5A 1Z7LA 3M07A 5GPCA 2BVLA 2J9AA 1OYYA 1XGSA 3I4MJ 3H35A 2EB7A 1CT0I 3GLXA 4XSZF 4AWXB 1TKHA 5A27A 2ECBA 5L3FA 5F46A 1R1UA 1WTJA 2QPOA 5LHHA 2VE9A 4UV9A 1VQ9I 2F5FA 3NEUA 1CT4I 1JT6A 3SJGA 5A28A 2P5VA 5DCMA 3B2YA 3FHZA 4EWTA 3HBLA 5IOZA 3TOBA 3F21A 4ZY0A 1IB1E 2VPRA 2BY0A 3LOCA 1HBXG 2YNDA 2ICWG 1FOXA 1D0YA 3REOA 3QQAA 3ULQB 4YIRX 2XPUA 2CNTA 4GI3C 3HRSA 4NGQA 4DYQA 2OQRA 3GTKJ 3JCUC 1L0OC 2HDWA 4OWRB 2DA4A 4C30A 4II9A 2JA5J 1QHGA 2PJ5A 2X48A 2WCYA 2C6PA 1STZA 1P4AA 2GXGA 3EUHC 4ESJA 2GOMA 2HZDA 3AL0B 2JPCA 2VASA 1KA8A 1O7FA 2YNCC 5HDGA 1RKWA 3LL7A 5M3MJ 4M3SA 1ZG8A 1R5GA 4RLFA 5GP9A 3K0LA 3M3YJ 4KITB 4QSHA 2KISA 2IGOA 4MY3A 5K8NA 1MK4A 3SEQA 3BG5A 1V5GA 1NXUA 2B3VA 1NH3A 3IL2A 1TBOA 1SGRI 2P5KA 1JTXA 4ZTJA 2OCEA 1E0EA 4LB5A 1UAAA 4NB5A 3S14J 3BJIA 4FD5A 3E0JB 2IQ6A 1U5TC 2MD5A 2NXNB 4IRIA 1EF4A 2VQYA 3WTWC 3MN8A 2FE7A 1SGPI 2LY1A 3DTKA 5FKOA 3WTXC 1Y1BA 2REFA 1D8KA 1XTAA 2LSOA 2DB6A 1JUSA 1S8NA 3HIFA 1U6MA 3B73A 2BEIA 4CYQA 1ZELA 1DGWY 2FQ3A 1XJOA 4BHBA 4CGZA 1W0TA 4L0YB 1Z1DA 3RI4A 2EFOA 5EX3A 1YLOA 4AIDA 5EZHA 1Y0NA 2LREA 5K1YA 4BD9A 4IF5A 4JXQA 1ON0A 4M3EA 2CS3A 2DPTA 2XAHA 3MWMA 2WTEA 2C1CA 3S9MA 2IL4A 1F1ZA 3K1PA 2QQ0A 2DMQA 3DEUA 1IJWC 4E1PA 2XC7A 3D2MA 2P6FA 1TW2A 2W85A 5TRDA 5J40A 1ZRCA 4KYWA 1SAUA 1BLLE 3FBNB 2VOOA 3GTMJ 4GYGA 4KDPA 4E7ZA 1XSDA 1UHMA 4UVBA 3RZOJ 3S8PA 1ZLHA 1OLTA 5F08A 5HS8A 4XRMA 2LKXA 4Y4RA 4ZYHA 4A95A 5JR3A 1JGGA 4A3DJ 3R9EA 3JTHA 4A3IJ 2M8EA 3IH2A 2X6WA 3KP4A 3D1NI 3A4CA 4BDZA 2FOKA 2SGDI 2B4BA 2BXZA 2VJJA 4KT6A 5BPDA 4J3GA 2Q43A 2DJIA 1ZG1A 4XBFA 4MHDA 1YTYA 1ETWA 4KUAA 1Z91A 4V2GA 2Y69H 2K3FA 2VBXA 3W2VA 5ED4A 1CPXA 4IF4A 2Z10A 5THWA 1J5YA 1JTYA 3CXSA 3CQZJ 3FWEA 2P4WA 1DU0A 1I1DA 1LAPA 3MKYB 1BL0A 1XMBA 1IN4A 3DLAA 1V55H 2KQRA 3DPUA 2BY2A 1BOAA 3MEXA 3KI9A 5B5EC 1Y9WA 5JPHA 2F3CI 2Z99A 1YGHA 5K7HA 2MH2A 2HYJA 3H5ZA 2R7FA 4UXHA 4KNYA 2QZ8A 4RGRA 3KP7A 1DPRA 2ISYA 4O23A 4OC3A 2EZKA 2MABA 5EEGA 3V7RA 4BH9A 2DEAA 1WGXA 2O8XA 5JLXA 1U78A 2DXQA 3GVAA 4Y49C 4AVBA 2QEXI 3NE8A 4CAEA 1WVRA 3IAM2 4BACA 2ORVA 2GU2A 3CCUI 3SJFA 3LMSA 4E7JA 4RN7A 3WGIA 2NVXJ 1CP7A 3O2PE 4MFJA 5J8FA 3RPUD 1IOFA 5CPAA 3FIWA 3FMQA 2V1NA 4A3GJ 2VJIA 1YLFA 1MJAA 3OSGA 4HNYB 3SXOA 1K6OA 2FNPA 2Y9ZA 2K9SA 2ID6A 3F9KA 1HKQA 4S04A 3KZZA 3TO9A 2BZTA 5F47A 2M4GA 2YSRA 5DTDA 4LLLA 4Q5SF 4F6AA 1FJLA 1FOWA 1YS6A 2ZENA 2CV0A 3OIPA 3OWTA 1ZRDA 3ISXA 1EH7A 4A33A 2Q44A 2Q8KA 7CPAA 1FP2A 2HWVA 4P4IA 4A12A 1O3TA 3CDLA 1U5TA 3K7AJ 2VBWA 2PI0A 3B35A 4RS2A 2VN2A 4HBLA 3D7GA 2KIMA 1JI8A 2O53A 2EV5A 2XRLA 4O3MA 4OAZA 4UY8I 1I3QJ 2H6CA 1SD7A 2NSMA 1BJAA 2YNEA 2VT2A 3MCZA 3RPQA 3HRMA 3HOUJ 3S9NA 4M73A 2V7FA 3K70D 3BC8A 4D9JA 3HOTA 5LYIA 4MHNA 3ROUA 2HPMA 1PDNC 4UUVA 4XKBA 2IGNA 2A20A 5C82A 4TNUA 2JXDA 2ZXWH 2UVOA 2MD0A 4L89A 4TV7A 3KX2A 2L9VA 5EG0B 2PJRA 5L3BA 1J75A 1YW6A 4ZDLA 4YU9A 3BZKA 2DI3A 2Y31A 4XICA 2QVPA 1GHEA 2B9SA 1X10A 1MD0A 3EUAA 2ZB9A 1HCRA 4KSFA 4KSAA 4D7MA 1AYEA 2UV1A 1VFCA 1TWHJ 2XPVA 4CSWA 3GFLA 4JX6A 4XKCA 1IN8A 2QIRA 1SQHA 4NEXA 4CGMA 4XLAA 3E1SA 4UVCA 1LQ1A 2Z9OA 4CDGA 1K83J 1IUYA 1Z8WA 1XB4A 2DBBA 2E35A 2OZ6A 2FT0A 1G3SA 4IOCF 4CA0A 3WU1B 2FBHA 1SVLA 4KN4X 3QAYA 4NQWB 3E6BA 3HHGA 3BR0A 4L5EA 3TGNA 1LFBA 3TW6A 3R6SA 2X7BA 5IV0A 3H5NA 2F5VA 2IGMA 5D4SA 3JSOA 3OS0A 1VHSA 4XLEA 3RZDJ 3Q9SA 4QLCU 3KE2A 1U2WA 3G1LA 3WG9A 5J4VA 4UWIA 4N9IA 5AGEA 3CJTB 1IXRC 5D6EA 4C9YA 3D67A 2HQAA 1GYTA 2PC1A 2R1IA 4D5CA 3GUDA 1SGDI 2H1LA 3HL2A 4MHPA 2PMZN 4HPQA 1M4GA 3SHFA 1R22A 4FETA 3PO3J 1ITYA 4BKXA 1YJNI 1I6HJ 4FISA 4B8XA 4YFKF 2IS4A 1B59A 2IMOA 2GOXB 1NSLA 2A6TA 4R8FA 4M3DA 4FCYA 2M7BA 1U9NA 4BQQA 4EVIA 1Z3YA 2DA2A 2M1BA 5LEKA 2QQAA 3A01A 2QBYB 3N05A 1K78A 5KNLA 2WGCA 3PGPA 4TWEA 1NTCA 4HRIA 2FSRA 3IC1A 3VATA 3EC4A 4LG3A 3M4OJ 1BI1A 4C2TA 4ENKA 2IA2A 2JUCA 2AFOA 5GCNA 1K4SA 2BSWA 4K2EA 4AYBN 4IHVA 1F9NA 5E3QA 2X9DA 4GXOA 1SMYF 5ICCA 4MNUA 2QSHX 1TBQR 2DA7A 3H5RA 4RAYA 1FYMA 4B12A 5E1WA 2AFWA 3B3CA 3DGVA 5DUKA 3CDHA 5EZGA 4PGHA 1XSXA 2GKRI 1W7PA 1SFUA 2R0QC 2GLFA 1Z3XA 2K9HA 4MCQA 2CUEA 5LEJA 4DYOA 3H36A 1X1PA 2DTZA 3MGDA 1XMTA 4U0YA 1LUJB 3GYHX 2PEXA 1IV8A 2R98A 2ZEHA 2KJBA 5HI7A 2TCTA 2W82A 3BQZA 3S1RJ 4ON0A 4A93J 4P4FA 4FD7A 2E1MC 3SJXA 1UVFA 3I1UA 3S6GA 5DDGA 2FF4A 1L3LA 3ABTA 3EDPA 2CGPA 4XRFA 1WZ2A 4OVOA 4A94A 2L7KA 5AG6A 2LMDA 5LRKA 3M7GA 5HLHA 3I59A 4F9VA 3TMOA 5M3FJ 1R00A 4KMFA 2MYSA 2I5UA 2VKHA 3MKLA 3LSPA 4AMLA 3VODA 5ILVA 2L8EA 1IDYA 1Z5RA 3I64A 2Q4ZA 1OCOH 3OY9A 3HC7A 1R6RA 4KISA 4MTEA 5LD2C 3R9FA 2R7TA 1MDMA 1DQUA 2CQKA 5CVVA 4ZYAA 4FD4A 5EYRA 4C2MJ 2HVQA 1D5VA 1SGEI 3H4QA 2ETHA 2ACJA 3GZ5A 1WJCA 4JQFA 4M9ZA 3OS1A 2JEVA 5CLSA 2X6OA 3I54A 1YU6C 2X52A 3MEKA 4W9YA 3CXPA 3QNVA 4RB1A 4R1HA 1R0RI 5F6FA 3QOEA 2B4DB 3ISZA 1O7LA 4CAXA 1VQPI 1XDSA 3S2HJ 2OCCH 2YX7A 2JZYA 4AD9A 4A3JJ 1ULNA 3FSXA 3FNCA 4F3QA 1ETYA 1A5JA 4BHPA 2R8VA 3OMYA 4XPDC 2ZXIA 3DBRB 1TIHA 2HNHA 4UWJA 1WJ5A 3AAFA 3VEPA 4BAYA 1E17A 1TOTA 1TKFA 1X12A 2PJ3A 2PMUA 2X51A 3LACA 3HGGA 4RAFA 4RLQA 2V1UA 4FBEA 1MT1A 5CKTA 3H3VK 2KMPA 1AHDP 2WAEA 1K4TA 1A6QA 5EJCA 2RQQA 5CQGA 2DQRA 5EGOA 2CJJA 3OOUA 2G3AA 1MSEC 3S1MJ 2F2EA 3HG9A 3AG4H 2M7AA 4LOCA 3UEYA 4NGSA 3LMMA 2Y0MA 2NVYJ 1H8LA 1XIXA 1MBGA 4UXNA 1XD7A 3BR1A 1G3YA 2DMTA 2NNNA 2EIJH 3ZMTA 5FUYA 2GKVA 2WB1N 4N0BA 2SGEI 1DS2I 3ERMA 2VIXA 2X3TA 1TKJA 2CJSC 2I79A 4MHZA 3HOZJ 1ZG3A 5EC4A 2NNYA 1DPUA 4XM3A 2C6CA 2PRQA 3QOPA 1CE3A 1XMAA 2P6EA 5EEHA 1ACIA 2ZXVA 2XAJA 3SEZA 1ETVA 2FQ4A 4C2ZA 4MO7A 1Q1HA 1GV5A 2ELHA 4KUMA 4UV8A 3OYLA 1RRJA 3KQZA 1MH3A 4CYOA 3PSIA 5TJJA 4E7KA 3R96A 4CH7A 3K2KA 4HW0A 1FY7A 2A61A 2EFNA 3JTGA 2X1EA 4M3GA 2ADUA 3L2VA 3CXLA 3DBLB 3HUGB 2CIJA 3B3VA 1CX8A 4X6AJ 1BM9A 1U5KA 2HKXA 4GM5A 5A2QK 1YTPA 3FXQA 3KL9A 2ESNA 4CCOA 1R4NB 4HGUA 4HPSA 4U9ZA 4Y49B 2KP6A 2PJ9A 4KIFA 4AVZA 1IG7A 1P9GA 4A39A 1H0MA 1JE8A 3D66A 3MZYA 3KEOA 2DFFA 1IW7F 1KYWA 2XVCA 4XNHC 4L0ZB 2P6AC 1FT7A 3ZMUA 4RAGA 4LIUA 3KCCA 2WADA 5J1UA 2DT6A 1I3AA 2KMRA 3ZN1A 3BLYA 3FKJA 2AHQA 4E2AA 4BEHA 2LVSA 4KOYA 2ENNA 3V8LA 3RO0A 3KP3A 4ZH4F 1FMVA 3RKYA 3TP0A 1JJ8C 4E7IA 2PE3A 1D1BA 1T6SA 2MG4A 1LEAA 1IDZA 1NSAA 3EFAA 3G8WA 4U9YA 2EWBA 2X6YA 5LGTA 3VYUB 1PU9A 3DP7A 3ZMVA 3ISPA 3S15J 2XUBA 3M9AA 2E1MB 1TL8A 4BL0B 3CLQA 4ZY2A 2B5GA 4FE7A 6PAXA 2AO9A 5F04A 2VXZA 4NC6A 3BI0A 2PMHA 4B43A 2NVTJ 1REPC 3TOAA 5DD4A 3D5LA 2Q4VA 4CYDA 2NVQJ 1Y8FA 4OC0A 1Z7KB 1ETQA 4IRGA 4OIPF 3GX4X 2VKEA 4MCSA 2E7WA 4MFKA 2DLLA 3IJ3A 3T1BA 3SGQI 2OZUA 2HKOA 1LFUP 2L9RA 1OMIA 2KKOA 1JKQC 1I39A 4BQAA 4NF1A 2W1OA 2GFQA 1EE3P 3CC7I 1RC9A 1TP4A 4IKFA 4BBSJ 3BJOA 4LGWA 4M3FA 1N78A 3CMYA 4EJWA 2L7MP 5HVHA 4MFEA 4WWVA 2CQNA 4PJNA 1FC3A 2M5XA 3FX6A 2K02A 1W5SA 1ZR2A 1FAQA 1P4XA 1XBUA 3GLJA 2PJ4A 2Y9YA 1Y39A 4UNOA 1TBNA 4A24A 5LYFA 1BW6A 3ECHA 3FMSA 2ZJPF 2YX4A 3KGQA 3ASNH 4H4KC 4YFXF 1OKRA 1NK3P 2VZYA 3IGRA 2FA5A 4M74A 5DV5A 2C27A 4HOBA 4G7ZF 2JYYA 2GLJA 1I21A 4G1PA 1T0FC 3R0JA 3DKXA 3TDUC 1JUPA 3K6GA 2XGEA 2CW7A 1JKRC 1O4XA 1J4JA 2PX9A 4R9MA 1MMNA 2CTBA 2ROWA 1QZZA 3M1EA 2QKLB 2RGVA 1M8BA 3DR8A 2HOEA 5BWAB 2JSPA 4KFCA 1M44A 1VIXA 2Z3KA 2D1HA 2EJRA 3CC2I 2GA2A 2R7ZJ 5G21A 1R79A 1WK4A 2WC2A 2WY7Q 2DW4A 2VQHA 3R4KA 1S7LA 2FS5A 4A37A 2XRNA 2PDOA 3EYIA 1BI2A 1MJBA 1Y8RB 3PUBA 3T8TA 3K4CA 3LA2A 2ZJRF 4OADA 5J1YA 1T8IA 2LG4A 4NGPA 5AG7A 1I1SA 2IT0A 3I4NJ 3H5AA 1YVKA 4ZJZA 3WR7A 1XX6A 1HPTA 3FXTA 3C1DA 4KIGA 4G7HF 1IRFA 3BDDA 1WI9A 2DT7B 3GZNB 3WGGA 2BVMA 4GFBA 4Z65A 1JUMA 1I27A 1J7KA 2VKVA 2K5TA 4P9UA 4Y7NJ 4PXDA 1SFEA 3GMEA 5DM7F 1LR9A 3SHPA 3A9LA 4XRSG 4S05A 4CYCB 2ZXJA 3ZMZA 4AB7A 4WWCA 2PBIA 1IY7A 1XGMA 2M5WA 3VSLA 3LFKA 4R7MA 1HA8A 1PTQA 3TQNA 4UIBA 1QBJA 2B0LA 2DK8A 1OMTA 3V7SA 5H6RA 1JWQA 2XF6A 4EMEA 2GXAA 2VEZA 2RV8A 4HF2A 2OZHA 4A38A 1WRJA 4XKWA 3OVOA 1JT0A 1DTDA 1ZK8A 1JKOC 1IAWA 2E19A 1NUBA 4IAVA 1U8BA 2EQRA 3HSRA 2A05A 2Z5UA 2VBYA 2BO9A 2DN0A 1WSUA 3B6CA 1I12A 3DNSA 3E6DA 3MD2A 3D68A 1XC5A 2CFOA 5BOXA 2DIPA 3RKQA 3PUFA 2L02A 3CJRB 3T8WA 2OAZA 2UZKA 1X1BA 1CM0A 1IRXA 3DPTA 1KQ0A 4BJTA 1XSVA 2PLYA 3DLLF 1B72A 3J81Z 1F2OA 1UVGA 2DOFA 2O9LA 1GHCA 2VZZA 5IP9J 3FSYA 4K3NA 4KORA 2W24A 1RR7A 4E7SA 5JVTA 1CJWA 3SDGA 2O28A 2OR4A 2QA4I 5ISVA 5LRRA 2D4OA 3FBUA 1AMPA 4FAIA 2CUFA 3OYAA 3DKYA 3LSHA 3KHZA 4YRHA 4XPLA 3K4LA 3TEDA 5HS7A 3WODF 2LRDA 3PRTA 3QPHA 3VWDA 4PXEA 1K7VA 9WGAA 3I53A 1SAXA 1GUUA 1O3SA 4CGOA 1MW7A 2HQRA 2Z3NA 4GXHA 5LHGA 2HUZA 3R5AA 2QYOA 1IO2A 1TTYA 4M71A 3ZQGA 3KETA 1SFOJ 5KCMA 3F8FA 1HXDA 2M34A 2RQPA 4JOMA 4Y17A 3SYTA 1EH8A 1Z6RA 3RYRA 3SGBI 2Q7SA 3A0BC 2OV7A 4PPZA 2XRCA 2RKHA 2VONA 2YR2A 1Z9UA 4UEEA 4ZI6A 3KYLA 3BZ6A 1EA3A 3KIOA 1ZARA 1FWZA 2E2JJ 5D4RA 2PIZA 1HQCA 2BY1A 2ESHA 4Q7AA 5AG4A 1OPCA 5IT9K 3LAPA 2ID3A 1B4AA 2EFWA 1T0FA 5BS6A 4WP4A 1Z2IA 4CXFA 2IJZA 1BA5A 4MBUA 4I76A 2LY2A 3JRDA 1AOYA 1H88C 2KIQA 2KZGA 4YEJA 4CRYB 1N75A 1VQLI 3WT4A 1ZREA 1MMDA 3O6BB 4HG2A 1TWFJ 2ZNZA 4MQVA 1R9TJ 3GUXA 3FK7A 1IY5A 4JK1X 4F52A 2DODA 4O5VA 4BE1A 1M4IA 4QB9A 1AN1I 2HB6A 2CUZA 2V9KA 4PUSA 1ZH5A 2ZW6A 3H3UA 3PB7X 2D45A 2GKTI 3S6HA 3KP6A 4EV0A 3QAHA 1XF8A 1LCPA 3E6MA 1OBRA 2QMLA 1RFHA 4QBJA 1T56A 3LA7A 4XQFA 2GBYA 4OU0A 4ITVA 1LDJA 1QSOA 4EVYA 3H9QA 4L5JA 1Y1CA 1Q7LA 1V4RA 5E1XA 5E3RA 4A3MJ 2EVNA 1Y7RA 5FLVA 5DM6F 3KY9A 1A31A 1YX5A 1IRZA 2N17A 3OYHA 4XIDA 1SFXA 4JD6A 4DZPA 2NS0A 2DO7A 3L00A 3LSIA 4NBQA 1TW3A 3VYRB 3L2RA 5IYDJ 2ZEOA 4MY0A 3PEIA 1O57A 2EBJA 2LC2A 3Q3SA 3CC4I 4P5OA 4IOAF 3JRUA 5F1JA 1PP8F 5JHWC 3FHNA 2HTJA 1RETA 1TLHB 2PR1A 2WAQN 5HDKA 1TGSI 1Q2DA 4M6YA 3CPXA 4MPIA 5HXDA 2EWNA 1HW5A 1X1DA 1BI3A 2YS9A 3I56I 4IHMA 1J09A 4DQ2A 1P4NA 2LKPA 3GYAA 3O8HA 4FASD 4EATA 1VQMI 1F43A 2FCKA 2M0CA 3R95A 2O7OA 2BBYA 1HDQA 4KOWA 2HXOA 3TL4X 4DGWB 1R5ID 4FUUA 3QPSA 1QQIA 3W6KB 3P5JA 1ZR4A 1W4MA 4ZDPA 1ETKA 2KZVA 5JQ4A 4C68A 2GA1A 2LLKA 1JHHA 2N1AB 3E59A 1QMUA 2XAUA 1AKHB 2O8KA 4NGNA 4B48A 2LEOA 4C3IJ 1B9NA 2EZIA 3GEZA 3I5UA 1Z67A 3U1KA 1YS7A 2QSGX 3BROA 1QU3A 1YVOA 3KR4A 2DKVA 1O3RA 2CV2A 5IT9Z 2MLGA 1K78B 4BBRJ 1WGCA 2XDVA 5G20A 2R7QA 2R7WA 5H6QA 4HDUA 3MRUA 5M5XJ 4CZZA 1RI7A 2GQQA 3L2UA 4X5KA 1W7PD 2DTRA 2KHMA 1OYVI 2HPIA 2KMOA 3UY5A 3FXJA 3CTAA 1N25A 2GREA 1XBTA 2BYVE 1S7NA 1E3PA 3GTOJ 3BG6A 3IAS2 1UHWA 5FD6A 1ARLA 1ZG9A 4X1EA 1W36D 4ZX9A 3PB9X 4UFWA 3KYCB 3IRRA 2EK8A 5JLWA 3W91A 2J8NA 2DMPA 2KFDA 4NGRA 2W00A 1ZGJA 2F4IA 1IN6A 3JRGA 4F9UA 2LOOA 2Q0YA 2OD5A 3FMCA 2MLKA 2V1XA 4DOZA 4BQOA 5DWMA 3TW7A 2VBZA 3HB9A 1HDLA 1V5FA 3PB4X 1V1HA 1D1CA 4EGYA 4FQGA 2Y30A 1IIDA 1YRNB 3IWFA 3SQNA 2B7EA 3S3MA 2EA4A 3FXMA 2ANPA 5GTHC 3K4JA 3O3KA 1KQ9A 3UGLA 3CP2A 5LYDA 3F23A 5KK1A 3D5SC 2OD1A 3UGIA 1T39A 3IP4B 1AUGA 1Z77A 2HC9A 2QF7A 2A3SA 3AL0C 3HZJA 4IUSA 1OQYA 5A2QZ 1VQNI 4JZ0A 2J5PA 5C88A 2XEJA 2A5YB 5K7FA 2JA2A 2PVWA 2C6YA 1IV6A 2HGCA 3GTLJ 2XEFA 3CCLI 3HKZN 4QTRA 1T08B 3I3GA 1YIOA 3HPGA 2IAIA 4H0EA 4ZYEA 5E3PA 1H9GA 2J9RA 3EO4A 4XKVA 2SGFI 3S1NJ 2RB7A 3GO5A 4A2UA 1TIQA 4IJAA 1FTTA 3OV8A 1U5TB 3DXJF 2IXSA 4J19A 2L4AA 2M8GX 1MNDA 1LFPA 3OYDA 1FEXA 3KKWA 5E17F 4BNCA 4P9FA 3QWLA 4AG9A 2OC6A 1TF9A 2EZLA 3CF5F 1SVMA 5E8IA 4P1WA 2K4JA 1ZRFA 4PQAA 2OOTA 2Y75A 3S2WA 5HNHA 1A36A 1T38A 3E97A 4E1RA 3W2WA 5FVJA 2V8VA 3TC8A 2BL1A 4M6IA 2DXIA 2PMZA 2DU9A 3RPUA 1V0CA 2JSCA 3D0SA 2V4JC 3M8JA 4AYBA 5HLIA 1KUVA 3MN2A 9ANTA 5L3GA 4OLLA 4UVAA 2K85A 2DFHA 2Q1ZB 1BOBA 3LQRA 1WJAA 4KOVA 1RZ4A 3L2QA 1JHFA 4F0YA 4PCQA 3CZXA 5EG0A 4UFXA 4PFOA 1FARA 3F8KA 3BQYA 1K7AA 5EBVA 2FE3A 2Q04A 2ZXHA
chains in the Genus database with same CATH topology
2G9WA 3GZ6A 3U9GA 2AS5F 3ZP5A 1FYKA 5HVQC 4I49A 4XPDB 1ODDA 3OWCA 3IU2A 4WX9A 2M45A 2P0WA 4ZYDA 1P92A 4CICA 3HRTA 3PZJA 1QSMA 2L4MA 1R7JA 4AIHA 4CHUA 2GXBA 3PQKA 1XGNA 3IU1A 4PSWA 3Q5FA 3P2HA 4KUBA 2HDCA 1XDUA 3BPXA 4MFPA 1B1BA 1QSRA 1P0HA 2ZW7A 4ONUA 2HQNA 1BC7C 4KMUX 4EGZA 4MQ9F 4KOUA 4Q38A 3GFMA 2QBYA 2IW5A 2F5CA 4M72A 3L7WA 2QVOA 3J80Z 1J59A 1G4DA 2XKPA 3VFZA 2PSWA 3KLNA 3OOPA 2YNCA 3JW4A 4DNCA 3TT2A 5KTCA 3D2PA 3GY9A 3EUHA 4KVXA 2JTVA 3J81K 4C2YA 3F72A 2A07F 1GXPA 4L8AA 2PFBA 4JWPA 1IN7A 4HF0A 3HOSA 4IHSA 4PK2A 3CUQC 2ISZA 2QLZA 1OYIA 2X4HA 2Y48A 3F3XA 1VTNC 1P6RA 2GAUA 3MAJA 4JJXA 2IA0A 2REEA 3I59B 4FD6A 5KTDA 5HDNA 1Z05A 2RN7A 2GIVA 3CLOA 4WXHA 5DCFA 4L9TA 2Z3LA 1PUEE 1TQIA 2FMYA 2CW0F 2FXFA 1RNLA 2P6SA 4U5YA 4NCZA 1ZHFA 2OU2A 3C26A 4EM0B 1D3YA 2STWA 1CGPA 1IXCA 3ELKA 5H20A 2GWRA 3JAMK 2A4NA 4HQEA 2DPUA 1BN5A 2ZKZA 3D8PA 3K69A 2Z3OA 5L3DA 3F0AA 2OH1A 4M9XA 3GKRA 4PDKA 4CS0B 2A6EF 1QO0D 4IXAA 3L2CA 4LLNA 5ERIA 3WTTC 2A68F 2CWEA 1A04A 1WWZA 1LB2A 1BBYA 4L9JA 3R61A 2PRBA 4XLPF 1XCBA 2FMLA 3WE2A 2H94A 5HH1A 1YK3A 2HYGD 2FL4A 1IICA 2BV6A 5FLXZ 2JT1A 2CXAA 1Q2YA 1I5ZA 5JHUA 5KVRA 3V8KA 4F7ZA 4HLYA 1FNNA 4R3LA 1CF7B 5J6XA 2K27A 1R23A 4UCPA 1B6BA 4LD5A 4U7DA 3DFGA 4YIFA 4I0AA 2NYXA 3W6JB 3BJ7A 4XSXF 3JTKA 4YGOA 2KIFA 2GE3A 3NE7A 2A6HF 2JPBA 4RGSA 2ZMEA 3GFIA 1SD5A 4PK3A 3V8IA 3EY5A 2EFPA 3I71A 3JUWA 2Z0ZA 5D5XB 2H5MA 5LGNA 1YW7A 3SZTA