3TO9A

Crystal structure of yeast esa1 e338q hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
275
Chain Sequence
EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase ESA1
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 83
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to9A02
2V79A 3HRUA 4EVYA 2STTA 5EEHA 2W25A 1U78A 2OA4A 3KP2A 4U7DA 2EV0A 1R00A 2ZW7A 4MTDA 1MD0A 2GQQA 3WTZA 4LK0F 1D3YA 4I0BA 3ZMSA 1QGPA 2XAJA 2HR3A 1FP2A 2YU3A 3J7AO 1N71A 3HTUA 3ZMUA 1TW3A 2VE8A 2QZ8A 5CVUA 3FM5A 3I9SA 3TO6A 2HUZA 4IXAA 4UVAA 1M4GA 2OZ6A 2EFQA 1SFUA 4CZZA 2Q04A 1WRJA 3CUOA 2HFHA 5FD5A 2XASA 1R57A 1S29A 4II9A 1O3QA 1CM0A 1JGSA 4MJ8A 4U9YA 1IN8A 3H3UA 1I6XA 3C18A 5L3GA 4GYGA 3J81K 2B3UA 1XDSA 3GXOA 2K5TA 2FNAA 1ZN2A 4L5IA 4Y17A 5BPDA 5CYVA 3ZMZA 2W24A 2G7UA 4AVBA 4I7HA 2EV5A 2IRFG 3PGPA 4N9IA 3MWMA 2Y0MA 3L2CA 2ZNYA 1B6AA 5K5RA 3E5XA 4O6JA 1LQ1A 1MZBA 1TW2A 5K5OA 3TT2A 2XAGA 4KOXA 1XGMA 2FNPA 1M1DA 1YVKA 1XN7A 2JRTA 3TOBA 3G73A 2DPUA 1I1SA 2QVOA 2P6FA 2IA2A 4CRYB 1J2XA 1KU3A 5LGNA 1K78B 1O3SA 4A6DA 1B1BA 1XMKA 3M8EA 1FY7A 4Y13A 1P4NA 4FD5A 4ZZLA 2E1CA 5ILSA 5K5QA 4A2UA 2H94A 3L00A 3ML6A 1WSUA 2Z0ZA 1HKTA 3TQNA 3QU6A 4PZJA 4CAWA 2JEVA 5DYMA 5C88A 5BPIA 2FSWA 4AIJA 5D6FA 2GIVA 5LGTA 1TIQA 4AIKA 1OYWA 4YFNF 2H6BA 4JXRA 3KLOA 3DEUA 3I4PA 1O7LA 5ICCA 1G6NA 2DAOA 3T90A 5L3BA 3FXQA 3I5UA 3T0YA 4ENNA 3QRFF 4R1HA 1T39A 2E7WA 1QSTA 1FBUA 3VODA 2QBYB 2STWA 1DDNA 4KOYA 1KQ9A 1MJ9A 3TTHA 2ZFWA 1YG2A 1J9IA 2Z99A 1YTYA 5LHGA 1TQIA 2D45A 1XSXA 1VKCA 2O8XA 1RO5A 2GE3A 1LB2A 2GWRA 2HQYA 4FD7A 5HVQC 3QPHA 3SXNA 4CYDA 4I2OA 1IYKA 1LVAA 6PAXA 3ZMVA 3T8TA 2RNJA 3ELKA 1BOBA 2O28A 1ZG3A 5EEGA 1GHCA 4HBLA 3N97A 2PR8A 3RDIA 2RDPA 3PFIA 3R60A 3GFIA 5D8KB 3BPXA 3MZYA 5E1XA 1XGSA 4CHUA 4RGXA 4H6ZA 5FFXA 2DW4A 3FXTA 2EFWA 1R7JA 3KE2A 4K2EA 2JTVA 1B9NA 2O6GE 2ATRA 2RGVA 4HX4A 1HKSA 5HDNA 1RXTA 3R1KA 3QU3A 1MDMA 2HKXA 1W5TA 2QYOA 5F6FA 1Y9WA 1Z9CA 2PMHA 3WTSC 2VXKA 4M6XA 1K79A 2VI7A 3KZZA 3SZTA 2ESHA 4KUMA 1U6GA 2CNMA 5KTAA 3IWGA 4AB7A 2K4BA 2V6CA 2QENA 1FX7A 1M44A 3NEUA 3H4QA 3RJPA 5L3FA 2PRBA 4I01A 3BJOA 4PCQA 3ZN1A 1HW2A 2FXFA 4L89A 2P5VA 4FD6A 3BJ8A 1BC8C 1SQHA 1XGOA 2G3AA 3JW4A 2BEOA 4M3SA 2EJRA 2FEZA 2FMYA 4EGZA 4KNYA 2CG4A 2PMUA 4XPDB 2QLZA 5EBVA 4B5PA 4U0WA 4IF5A 2VBXA 3U9GA 1DPRA 1SFXA 1OPCA 3CXSA 1YREA 1U5TA 4NHJA 2E7XA 1XB4A 4KIBA 4HF0A 4JBAA 4R9MA 4ZYGA 1UFHA 4O5VA 3E6CC 4WXHA 1T0FA 5F64A 5LGUA 3S2WA 2M1BA 5HLIA 4YIFA 2O0YA 5JQ4A 4Y49B 4NXYA 4MY0A 1IUYA 3ZN0A 1XE4A 3B02A 3HHGA 4MTEA 1KYZA 3K69A 4EM1A 3K1NA 5E17F 1OR7A 3FZVA 5ED4A 2B5GB 2G3TA 4XRFA 1WK4A 2WV0A 2XAQA 1P92A 5IT9Z 5I0CA 3P9CA 1R5HA 4WCGA 3B8GA 3CUQC 4L9NA 3F3XA 1H0MA 1BN5A 2DPDA 1PDNC 1BI0A 1WWXA 4HF1A 2CNTA 1XCVA 4UWIA 1BI1A 3CLOA 4CAVA 4IRGA 4A5NA 4P9FA 3EYIA 1H9TA 5C82A 2BV6A 1IIDA 3FMQA 4KMUX 1U5TC 3KP7A 4ZYHA 4XBFA 3HRTA 4HV6A 1RZ4A 3R6SA 1LDDA 3R4KA 5DWNA 2AE6A 1BOAA 3ZP5A 4KOWA 5ICFA 1BIAA 1F4KA 3RKWA 5F46A 3TO9A 1K6OA 1ULYA 3VEPA 5FLXK 3O2PE 2RKHA 2J8NA 5JHUA 3LAJA 4Y15A 5BS6A 3PQKA 2C6YA 4KOTA 4L8AA 1R23A 2FBHA 1U3EM 4P55A 3WU0A 2WC2A 2R98A 2RN7A 4EJWA 4RB1A 3J81Z 2FSRA 3U2RA 1AWCA 1L0OC 4KVME 1XSVA 2FXAA 1JHFA 2MLKA 2FE7A 2Z11A 2ISYA 3BLNA 4MBUA 5HLHA 2Q7BA 2HS5A 1Y7RA 1BO4A 3OV8A 4UXNA 4KVOE 2GANA 3BROA 5H6QA 3U1DA 3N4MA 3COAC 1KU9A 4R8HA 1S3ZA 1G3SA 2YX4A 4P9UA 4FX0A 2O03A 2J5PA 4DNCA 2YR2A 2F5DA 3UY5A 3EC4A 1FC3A 4LFUA 4OINF 3MGDA 1CGPA 4G94A 3R95A 1WQ2A 3GF2A 4KOVA 3TO7A 2B4DA 2RQPA 1HKQA 4MQ9F 4LJZF 1XMTA 4ENKA 1MJBA 2EK5A 4WK8F 3RPQA 4F7ZA 1FP1D 4M6YA 4PGHA 2REEA 2VE9A 4EJTA 3F8CA 1IAWA 4PSWA 4IPAA 5LBQA 1ON2A 2A6EF 1R58A 2FT0A 2P6EA 1KU7A 2FMLA 1YW8A 3F22A 2DK5A 3DPLC 2W57A 1OYYA 1IICA 4R79A 1XD7A 4KZTA 3KFWX 4GO1A 5J6XA 1JXSA 5LEJA 3JSOA 2BYVE 1QSNA 2A68F 2XUBA 3TFYA 4I02A 2OZGA 5CVIA 5H20A 4YIIA 3C1DA 3H92A 4U7BA 3HTSB 1YK3A 3DQVC 1PU9A 2X7BA 1G4DA 3C26A 3DDDA 1W7PB 4EJVA 4B5OA 3QP5A 4Q4ZF 4P5OA 2OU2A 2X0LA 1S8NA 3DF8A 4XLNF 3VWEA 3T1BA 3K9UA 1KUYA 2ARHA 3E6BA 4G7HF 3KZYA 2KRFA 2EA2A 5H86A 1TQMA 5HS8A 3R61A 2A69F 2P7VB 5BOXA 5JI6A 2F5IA 2QQAA 4NB5A 3WTWC 1BBYA 4WXCA 4LG0B 4OAEA 2LF8A 2NNNA 4Q5SF 2UXXA 2V1UA 1FBQA 4FX4A 2KJBA 4KOSA 1FSHA 2BGCA 5D4SA 5CLSA 3KCCA 3KEOA 4AVAA 4RB2C 4HQEA 3R9EA 3S6FA 1QO0D 5FFZA 3BOQA 4KUAA 1M4IA 5K1YA 1B6BA 3FHZA 3AAFA 1O3RA 3D0SA 2EV6A 4HYEA 2XROA 1LNWA 3I0TA 1BIBA 4B09A 3E5QA 5CVJA 3E97A 1FT9A 4KLVA 5DEQA 4KN4X 3LA3A 2Q44A 3D5LA 1P4WA 2YSRA 1R22A 4A5MA 3WTYC 3TDZC 2ZMEB 5H84A 3WTXC 3W6SA 4GYIA 4IJAA 4U0VA 4XNHB 3R96A 3M9AA 3WGHA 4YG2F 3VWDA 2MA3A 4JXQA 1SMYF 5ILVA 2VBZA 3F8KA 3CDHA 3GLXA 1GVJA 4ESBA 1XCBA 3M8FA 2P0WA 3BPVA 5E18F 4LB5A 4RB3C 2JDCA 4I49A 2F5CA 2K7LA 3JTGA 1J7KA 2G9WA 5DCMA 2EUIA 1S3JA 3MAJA 1QPMA 3IGRA 4NCZA 3E3VA 1I12A 4MHGA 1HW1A 1P4XA 2R7DA 3PQJA 4GS4A 1G3TA 3SFZA 3DV8A 2OQRA 1XGNA 2ZW4A 2CSOA 2VN2A 2GZWA 1ZH5A 2MD5A 2VQYA 2K27A 5HLGA 3P9KA 3D2PA 1CF7B 3F6OA 1S60A 3G8WA 3D3SA 3K1PA 4UUVA 4WF2A 2FS5A 2UZKA 4G8XA 2NAZA 5F47A 4RB0A 4PK2A 1EV7A 2R3SA 4CRZB 2HV2A 5F1RA 1RI7A 2Q4VA 4WXDA 5A2QK 5JPHA 5ISVA 3WE2A 2VT2A 1ZGJA 3JAMK 3HUGA 3SHFA 4YFKF 3V7CA 3GFLA 3GW2A 3Q9VA 4ZH4F 2VODA 4MEYF 5KTDA 4M85A 2I00A 3BP8A 2XRNA 2K4JA 4EV0A 2Z9OA 2WTEA 2R8VA 4E2AA 3HOSA 1Z05A 2DT5A 4ETSA 4XLPF 2LKPA 4BHPA 3I59A 4KORA 2BL1A 3TOAA 2P5KA 2I79A 5L3EA 3HSFA 3L9FA 1R36A 1Z4EA 3HRMA 2B4BA 4U5YA 1Y0UA 1Z1DA 2FL4A 2HTSA 3NRVA 3I54A 2FRHA 2DU9A 5FLXZ 1ZLJA 5H6RA 4BH9A 4M72A 4JJXA 1YS7A 3FX3A 4OOIA 1NMTA 1V3FA 2MC3A 2Z3YA 3N7ZA 4LD5A 1SMTA 2F5EA 2J8RA 3FB3A 5ICEA 1S7FA 1HBXG 1X3UA 5FGMA 1PUEE 2B4DB 4BMHA 1QZYA 2B3VA 1K4JA 1GHEA 1MK4A 2ZXJA 3F8BA 1PP7U 4DQ2A 4RS8A 3KP3A 1SD6A 3FMRA 1FNNA 2V9VA 3HSEA 2NRAC 1T6SA 1YO5C 2PDOA 2L4AA 4WX9A 3B73A 2W84A 4BHCA 3GEZA 1KYWA 3V4GA 2EWNA 4UNOA 2D1VA 1EH8A 2XKOA 4I0AA 3WE3A 3ZQ7A 5CVVA 3RPUA 1HSTA 3CXPA 3VOEA 2K86A 2Z10A 5DWMA 1LRZA 3L7WA 4EM2A 4HOBA 2KIUA 2YPRA 2O61A 3IWZA 3CUQA 4RGUA 4N9HA 2EFPA 1O3TA 3WU1B 1S6LA 2M8EA 2H09A 5HS7A 4HW0A 3RTRA 1R5GA 1IB1E 4A0ZA 4IRIA 1D5VA 5D6EA 5HOOA 2G0BA 3R0AA 3LAPA 4RGRA 2HTJA 1F1ZA 5BQTA 1IN7A 1P6RA 3QP6A 1NHAA 4IHTA 2FIAA 1TLHB 3WODF 1BI2A 3GZ5A 1TTYA 3CJNA 5DD8A 2XIGA 3FXRA 4BYYA 4GGGA 2DFIA 5ICGA 5DV5A 2IA0A 4ZYDA 3VB2A 3DPTA 4AVCA 3D8PA 4OMYA 1IF1A 4IHSA 1S7AA 2CWEA 3LWFA 1F9NA 2HQRA 3R9FA 4QWQA 3RI4A 3NQOA 1HQCA 1WWZA 1DUXC 4KT5C 4EMSA 3BZ6A 4AG9A 4KDPA 3TDUC 1NE9A 2PBIA 4RS2A 3V8IA 3LSTA 1R1TA 2H27A 2OZHA 5F48A 1YLEA 3EUHA 2HYFA 3O3KA 1I1GA 4UBRA 3FXUA 3W6KB 1G3WA 3KEQA 2UXNA 4CGZA 2PN6A 2PG4A 2Q8KA 1ZRCA 2ETHA 2QECA 4U88A 2FIWA 1I27A 5AIPA 5D8LB 2Q2EA 2VC0A 2Q0YA 4CDGA 2JDDA 5GCNA 3EQLF 1IN4A 3R0JA 5CVRA 4XPLA 2X4HA 4QUSA 1E2XA 4YRHA 4PSXA 1W5SA 2FU4A 1K78A 3IC7A 2PQ8A 4Z2YA 1OKRA 2QQ9A 4L5JA 5IX3A 2FBIA 1ZREA 4MEXF 4A6EA 3P9IA 1J4JA 1LEAA 3ROUA 3SXOA 1IXSB 4XSZF 4MI4A 3E6DA 2VOOA 1BJAA 5LRSA 2P7CB 4KMFA 3GO5A 5HMNA 2HKOA 3ABUA 3V8LA 4NEXA 4L9VA 1B59A 2XAFA 4J3GA 4YFJA 4E70A 3FF5A 5LHHA 2VEZA 2Q0OA 3GYAA 3ECHA 2OD5A 1FYLA 2DBBA 3S6HA 2M30A 3QPTA 4UV9A 3MQ0A 4KN7X 5ILUA 1T2KA 2QQBA 2KKOA 3HOTA 4G7ZF 3SQNA 4R57A 3SZPA 2XHKA 4HAMA 3F8FA 5AONA 3DKWA 5LRRA 4EM0B 1IRGA 4NSQA 5CNPA 1Z6TA 2QBYA 3RYPA 1RUOA 3EFAA 4NQWA 4MGRA 3V8JA 1E17A 1S7KA 3T5XA 3GYHX 4I98B 3W91A 4N0BA 2M5WA 1BM9A 1LJ9A 1Z7UA 2TDXA 1ONVA 1D8KA 2GXBA 1YLFA 4RI1A 4FT8A 2EFNA 3V7RA 1YW9A 1FSEA 4F0YA 2NS0A 3C3WA 4HKFA 1OYIA 4UHTA 4OADA 1FWZA 5JVTA 1ZRDA 4UWJA 2AS5F 1FZPB 3I53A 1ZRFA 2DQRA 3SXYA 2H5MA 1ON0A 2ISZA 4KOUA 1KA8A 3JAMZ 4OIQF 2DQLA 2PC1A 4NF1A 3M7GA 2D1HA 5D4RA 3ZMTA 2M87A 2EFOA 1L3LA 1QSMA 3TCVA 3BJAA 2KIMA 2ZKZA 4HX7A 2ADUA 4BAYA 4G7OF 2A5YB 5KTCA 1IXCA 2ZPAA 1LDKB 1SFEA 2DLLA 2HYGD 3IWFA 1TNTA 4AD9A 4MHDA 3H3ZA 5BMZA 5E8GA 3RIRA 1KZFA 2V1DA 2XAHA 1MDMB 3ECOA 3ABTA 1SAXA 1SD7A 3GKRA 1S7LA 4Q47A 5IT3A 4EJOA 5F49A 2ZJ2A 3ISPA 1IZ1A 1S5KA 1Y9KA 3JTHA 3OOPA 3DNSA 2P8TA 2FQ3A 1KUVA 1W4MA 5DCFA 1J0RA 2KJCA 1DPUA 4LLLA 2VXZA 1NSLA 3KP4A 4LGWA 2VBQA 2V1XA 2ESNA 4RAYA 2OH1A 3BY6A 2DXQA 1UHMA 2IPQX 1O7FA 1Q2DA 1ZGAA 3HRSA 1ODDA 4B5PB 3LODA 1BC7C 3EO4A 2RV8A 3F8NA 1LDJA 3TKYA 5IV0A 1U5TB 1TQPA 1UHWA 3CO7C 5D5WB 4KUBA 2P4WA 4X5KA 3WR7A 2FE3A 5ERIA 1WKMA 1GXPA 2D4OA 2B5GA 2HZTA 1J75A 2CYYA 1S7NA 4IVNA 3IKTA 4H0EA 4M73A 4R3LA 2NYXA 3S6KA 2IL4A 1Q2CA 2AXLA 3BWGA 4LB6B 2L02A 2ACJA 2REFA 2Y48A 1RNLA 3F8MA 4JD6A 3P7NA 2IJLA 4FHTA 1MKMA 4L9JA 3HHHA 4XPDC 4CAXA 4UV8A 2BUEA 4PV6A 4JQFA 2LDUA 4R87A 1W7PD 2VBWA 2WWYA 2UWMA 3K1MA 3SHPA 1FOKA 2IP2A 3I58A 3RYRA 1P0HA 1Z9UA 5HDGA 1YYVA 1P4AA 3Q5FA 3F72A 3KKWA 2VBYA 4MY3A 1YR0A 1DP7P 4Y49C 1IYLA 4JK1X 1I5ZA 4EGYA 1FYKA 2A07F 3CXQA 1GXQA 2PR1A 4U0YA 2FCKA 4UVBA 4M9SA 4KICA 2D4PA 1YS6A 1YQAA 2R1IA 3K2ZA 1CJWA 3DR8A 3MCZA 1QSRA 3L09A 3CO6C 2NNYA 3HYIA 2CO5A 1MJAA 2JLMA 4E0AA 4KA4A 2VONA 1KU2A 3RKXA 1KUXA 3R9GA 2CGPA 1QZZA 4M71A 4H6UA 2DI3A 4JLYA 3DP7A 3M1EA 4L0YB 1Z91A 5DD4A 4EQQA 4HDUA 4KFCA 4ZZDA 1K7AA 5J8FA 2BE5F 3ZMDA 4A0YA 2E1NA 3ULQB 1L0CA 4PK3A 3DR6A 2J8MA 1UB9A 2A6HF 4Q48A 1OZPA 3KP6A 3WGIA 1FPQA 4KLWA 1TNSA 3J80K 2YX7A 3EDPA 3LQQA 1V0CA 5LEKA 3FIXA 1A04A 3E6MA 5E20A 3T9YA 2PJPA 3V8KA 3F23A 2Y75A 5HS9A 4ONUA 4ON0A 5DUIA 3C7JA 3JSPA 1B87A 4E8OA 1G3YA 2XKPA 4HLYA 1XIXA 1FLIA 4G6DA 3Q9SA 4QBJA 2L3DA 1ZG5A 2VC1A 4B8XA 3DSBA 3EY5A 1STZA 4ENJA 4XPKA 4QB9A 2A61A 2MLGA 2ZCWA 3IRQA 1Q1HA 3JVNA 4HDVA 1T98A 5TRDA 5DUKA 2QIRA 1BI3A 3WTVC 2DO7A 1KQ8A 2KIFA 2P6GA 4TV7A 3O6BB 1YIOA 2IT0A 2CFXA 3HIFA 4HX8A 2K02A 3LA2A 2FF4A 4KIGA 4QC6A 5FD6A 2OQGA 3FM3A 1ZAOA 3I3GA 1USTA 3QOPA 3WG9A 5E1ZB 1W7PA 3BJ7A 3DFGA 4CXFA 2EA4A 2GAUA 2FOKA 5D5UB 2CNSA 3G3ZA 4HLXA 2LSOA 4LLNA 4IUSA 2C27A 1ZARA 3F0AA 3W6JB 1XDUA 2WPWA 2PFBA 4YGOA 2BBYA 1JHHA 1R1VA 3FBUA 1U6MA 1C0WA 5E1WA 1SD4A 2R7FA 1YFHA 1QNTA 4S05A 1ON1A 2FA5A 4LUAA 2A3SA 3G3SA 1QSOA 3FWEA 3TE4A 4QLCU 1XEBA 4LG0A 2HQNA 2R7HA 3LD2A 2IW5A 4ZBGA 3MFKA 2PLYA 2OB0A 2Z5UA 2JZYA 4KVXA 3ZJ0A 5KVRA 3FYNA 3GX4X 5HDKA 2CW0F 3NE7A 1B4AA 3F5BA 3F6VA 2P6SA 5DDGA 3FRMA 5JFRA 1XMAA 1EH6A 1P2FA 3P2HA 3K0LA 5FO5A 1WI9A 1XF8A 5FB2A 1XSDA 4RGSA 2GA2A 4M9XA 2KCWA 2MH9A 2ZW5A 3IL2A 1R1UA 4ESJA 3KETA 1J5YA 3BJ6A 2F2EA 3QAHA 4GXOA 1ZHFA 2ZMEA 2O3FA 3MZHA 3GZ6A 4G6QA 4F6AA 5HH1A 4O3MA 1JE8A 4BXUA 1V4RA 4S04A 1YW7A 3E0KA 3WGGA 1IN6A 4XSXF 2FBKA 4HQMA 3GUDA 3KP5A 4KIFA 3ZPLA 2B0LA 3P2FA 3OWCA 4PDKA 5JR3A 4BHBA 2VOPA 1YVOA 4AWXB 1HSJA 2PSWA 2J5OA 3HSRA 4ZYEA 1IN5A 2JPBA 2MH2A 5CJ9A 2DTRA 3FNCA 2W85A 1ZLKA 1HXDA 4OIRF 4A12A 2OAZA 1PP8F 4CO8A 4ENMA 5FVJA 5TJJA 2PI0A 4D0PA 1IW7F 1YGHA 1FYMA 5LHIA 2OBPA 2ZXVA 1D8JA 2XVCA 2L4MA 4HF2A 5DCMB 4L18B 5LLQA 3V7SA 1ZYRF 1CF7A 1FBSA 2F5FA 3MEXA 3VFZA 2QWWA 4RAZA 5L3CA 2IA1A 4OIPF 2B58A 4HV5A 3K9TA 4UA3A 3KLNA 4I09A 4GCVA 2P6TA 3GVAA 3RYOA 3GWZA 4P96A 3I64A 2VT3A 2Z33A 2HGCA 1U8RA 4JWPA 1VTNC 4XNHC 4OIOF 3GY9A 2MBFA 5D5VB 1O57A 4R3KA 3FMSA 2D2WA 4KYWA 4L9TA 4CICA 4L0ZB 2JSCA 2L54A 3IKVA 2VZZA 3CTAA 3LA7A 4AVPA 4CS0B 4MQVA 1QQIA 2EB7A 4HNYB 4YFXF 1OMIA 4OU0A 3PZJA 2RC4A 2EVNA 1RUNA 2QM3A 4PGGA 1AOYA 2HOEA 4HNXB 2OZUA 1IRFA 2XGXA 2VZYA 2XV4S 2L01A 4LLGF 3I71A 1Z6RA 2ZO4A 5E96A 1J59A 1Q2YA 2GXGA 4M74A 4UVCA 1VHSA 2ELHA 3ZZIA 2AJ6A 4K30A 3WTUC 4IRHA 3DXJF 4LK1F 3W6XA 3I59B 3T8RA 2G7HA 5L3DA 2CY2A 4EJUA 1TBXA 1T38A 1HW5A 3TGNA 1RIOH 4BNCA 2PEXA 2M45A 3QB8A 4MNUA 1S7OA 3E5UA 3GFJA 2A4NA 1H9GA 1I1DA 1SD5A 5A2QZ 4LX9A 3PP9A 3RKYA 1KGSA 3IHUA 2COMA 1KQ0A 3EXNA 1IXRC 1B9MA 4EVIA 2QUFA 5IB0A 1MGTA 3REOA 3LFKA 3D2MA 1YX0A 1Z4RA 3GFMA 4H89A 4OLLA 2HEOA 4AG7A 2LF7A 3IRRA 4AIHA 4QVTA 1QBJA 4A0XA 5EC4A 2RVCA 2LNBA 4ORFA 2CQKA 2H6CA 2HDCA 2BEIA 4ESFA 5KK1A 3EETA 1ZG1A 3J80Z 5D5XB 2P5LC 2WPXA 2NMTA 3WTTC 1U2WA 4OMZA 2ZBKA 4HZFA 4HA8A 3F21A 4FD4A 4LMYA 1REPC 3EYYA 4IF4A 2Q4YA 3LQRA 4WWCA 5E8IA 3JUWA 5AIQA 3BDDA 1USSA 4G9YA 3ERED 2JPCA 4ASNA 1LEBA 4HNWB 1PUAA 1M4DA 2QMLA 2IVMA 2BSWA 2ZW6A 2DK8A 2ZNZA 5IT9K 5J8CA 4BQAA 4M9ZA 1F5TA 3CUQB 2GA1A 1I21A 3S6GA 2JT1A 4U9ZA 1UFMA 1UCRA 2HWVA 1EH7A
chains in the Genus database with same CATH superfamily
1RETA 2L7KA 2V79A 3HRUA 4F55A 3M4OJ 4EVYA 2STTA 5EEHA 2W25A 4CAEA 1MIJA 1Q9BA 3AG4H 1U78A 2OA4A 5LD2C 3KP2A 4U7DA 2AQEA 2EV0A 3IH3A 1R00A 2ZW7A 4E7KA 4MTDA 2OCEA 1MD0A 2VJ4A 4MO7A 4WWVA 2GQQA 4EATA 3WTZA 2VRWB 4LK0F 3NFZA 5GTIC 2B0UC 1YW6A 1D3YA 4I0BA 3ZMSA 2ZJRF 5F0FA 4F93B 1QGPA 5BNGA 1X3WB 3KQZA 2XAJA 2HR3A 1FP2A 3H5AA 2YU3A 3J7AO 4DOZA 1N71A 3QNVA 2JA6J 4MHPA 3HTUA 4FTHA 1R3NA 1XMBA 3ZMUA 2Z3NA 1TW3A 4BBHA 2VE8A 2QZ8A 5CVUA 3FM5A 2X6YA 3PO2J 3I9SA 4CCMA 1PUFB 2LRDA 2BOAA 2YNCC 3TO6A 2LR8A 2HUZA 2GLOA 3IU1A 4IL6C 4IXAA 1VQ7I 3BTJA 4UVAA 1M4GA 2OZ6A 2VASA 3H3VK 5BWAB 2EFQA 1SFUA 4CZZA 2Q04A 1WRJA 2W48A 2Q1ZB 3CUOA 2HFHA 5FD5A 2XASA 2EH3A 4CGMA 1R57A 1S29A 5D8NA 4II9A 1P9GA 1O3QA 1B72A 1CM0A 2ZOGA 1JGSA 2CJJA 2HNHA 1IN8A 3H3UA 1I6XA 4OAZA 4MJ8A 3C18A 3VSLA 4U9YA 3VARA 5L3GA 2HOSA 2NU2I 4GYGA 2DYRH 3J81K 2KPMA 3OL4A 1P7IA 3OYJA 2B3UA 4OIDA 1XDSA 1TKHA 3IWWA 1WPKA 1D0ZA 2NSMA 3HJEA 1Z67A 3GXOA 2K5TA 2FNAA 1ZN2A 4L5IA 4ITVA 4Y17A 5BPDA 3D1NI 3DPUA 2XF5A 4X0GA 2QA4I 5CYVA 3PNVA 3KX2A 4V2FA 2DDBA 3ZMZA 1EJ9A 2QQCA 3FC3A 2ANPA 2W24A 2G7UA 3BHXA 2DF5A 4AVBA 4I7HA 2EV5A 4LOCA 2PJ7A 4UFVA 2IRFG 3PGPA 4BACA 4N9IA 1D0XA 3MWMA 3HUVA 2GKVA 1U8BA 1ULKA 2OC6A 5JVGF 4CYNA 2Y0MA 3L2CA 2ZOFA 3FSXA 3KEYA 3K4MA 4HRIA 5J1UA 3HKZN 3LNQA 4F0XA 1CT0I 2ZNYA 1B6AA 5K5RA 4UFWA 2HZDA 4DGWB 3E5XA 4O6JA 1LQ1A 1MZBA 1TW2A 2BY2A 1QRYA 2BHYA 5K5OA 3TT2A 2XAGA 5KNLA 5JM6A 3ZQCA 4KOXA 1XGMA 4B6DA 4M3GA 5FJ8J 2Q2EB 4XR6A 2FNPA 4XLAA 1S72I 4AM3A 1M1DA 2DMTA 1XRYA 1YVKA 1XN7A 2ZEMA 5LYLA 1YHQI 2JRTA 3TOBA 3G73A 2DPUA 1I1SA 2QVOA 2WCYA 2X9DA 2P6FA 2IA2A 2PJRA 4CRYB 1J2XA 1YTPA 1LPQA 4J01A 3A4CA 1KU3A 4Y3OA 5LGNA 1LAPA 2O53A 3L1PA 3BZCA 2PJ3A 3TMOA 1K78B 3S1NJ 3ESWB 1O3SA 4A6DA 5HNFA 1B1BA 2W00A 1XMKA 3M8EA 4XKVA 3FDYA 1FMWA 1VHEA 1FY7A 4Y13A 1NUBA 1P4NA 4FD5A 4ZZLA 2E1CA 1IY5A 5ILSA 1PYVA 1SEUA 3HDDA 5K5QA 4LITA 4A2UA 3BG6A 2H94A 3L00A 3ML6A 1WSUA 1F43A 1HKTA 2XRCA 2Z0ZA 3TQNA 2VB6A 3QU6A 2R7VA 1WJCA 5JGFA 4PZJA 4NNJA 4CAWA 4MCPA 3CP8A 2JEVA 5DYMA 2PMZN 5C88A 5BPIA 4IX7A 2FSWA 4AIJA 4OMEA 5D6FA 2GIVA 1TWHJ 5LGTA 1TIQA 4OC0A 4AIKA 3QYBA 3D7FA 1OYWA 4YFNF 4CYQA 4XRSG 3D67A 2H6BA 2NVYJ 2VKDA 3KR5A 1YE9A 2E2JJ 4JXRA 4PXDA 1KBFA 2HI3A 3KLOA 2Q43A 3SYTA 5IPAA 3DEWA 1VF9A 2GIZA 2M4GA 3DEUA 4UF4A 3BR2A 3I4PA 1UHSA 1A31A 3CC7I 1O7LA 5ICCA 4C30A 2PMZA 1OISA 1G6NA 2VL1A 1DE4C 2AFUA 2E35A 2H1LA 2DAOA 2ZB9A 5CQGA 4CCLA 5L3BA 1VQMI 3T90A 3FXQA 4BXXJ 2XF6A 4OIWA 3I5UA 3T0YA 2IEKA 2LTPA 2HQAA 4ENNA 3HC7A 3QRFF 1ULNA 1MBGA 4R1HA 1T39A 2E7WA 3QWPA 1RC9A 1QSTA 4FCYA 1FBUA 3VODA 2VIXA 4F52A 2QBYB 2STWA 2MABA 1DDNA 1Y1BA 4KOYA 1KQ9A 2AQFA 3W3CA 4NC7A 1MJ9A 3RQIA 4NQWB 2LYCA 2DTZA 3TTHA 2LMDA 2ZFWA 1IG7A 2ZEFA 1YG2A 4DYOA 3L2WA 1J9IA 2IQ6A 2Z99A 1RRJA 1YTYA 1JI8A 2GKTI 1ZG9A 5LHGA 1W3SA 4NJRA 3IFEA 1TQIA 3KIOA 2D45A 1XSXA 5KHDA 4IEJA 3JRIA 1VKCA 2O8XA 4ZGYB 2M34A 3KYDB 1RO5A 2GE3A 1LB2A 2GWRA 2HQYA 4FD7A 1F2OA 3GTQJ 3S32A 3BR6A 3QPHA 4CYDA 5HVQC 4I2OA 1IYKA 3SXNA 1LVAA 1SGNI 4V19K 2L9SA 1NH3A 6PAXA 3ZMVA 3T8TA 2RNJA 2QSFX 3ELKA 1BOBA 4OC4A 2LD5A 2O28A 1ZG3A 3M3YJ 3R5AA 5EEGA 1GHCA 1HJAI 5GTHC 4HBLA 3BR3A 3N97A 3S9LA 4IOCF 2PR8A 5FUVA 3RDIA 2L9VA 2RDPA 2E36A 3PFIA 4XKCA 3CLQA 4A3CJ 3PUFA 3R60A 1YLOA 3GFIA 1R9TJ 2CJSC 1ITYA 5D8KB 3Q0VA 3BPXA 3MZYA 5E1XA 2GREA 3KZWA 1JJ8C 5CPRB 3A0BC 2ODDA 1HEEA 4GRIA 1LE8B 1Z5RA 2AFMA 1XGSA 1ZR2A 4CHUA 4RGXA 4H6ZA 5FFXA 4NBQA 2DW4A 4RUHA 3FXTA 1XBTA 2EFWA 1R7JA 3KE2A 1BLLE 3DBLB 3ZR8X 2K3PA 3KL9A 5IOYA 4K2EA 2ABZA 2JTVA 4P10A 2WA0A 3I4MJ 3CZXA 3K10A 1B9NA 4HNUA 2O6GE 1CSOI 2JVHA 2ATRA 2H8RA 4B48A 5F04A 4MHZA 2RGVA 4HX4A 5CPAA 3ZQIA 2OOTA 1HKSA 5HDNA 5M5YJ 1RXTA 4W97A 5B5EC 3R1KA 3ZQHA 5E3QA 3QU3A 1MDMA 3M1CA 3BJIA 2HKXA 1W5TA 2QYOA 5F6FA 1Y9WA 1Z9CA 2PMHA 2Y30A 2QSGX 3WTSC 1GDTA 2YUUA 4CGOA 1HEVA 1CGJI 4G1PA 4A39A 4ZDOA 4CH7A 2VXKA 1JQGA 4M6XA 2QVPA 3RZDJ 4KT6A 4XLFA 1K79A 4X6AJ 2VI7A 4XKBA 4Z65A 3KZZA 3SZTA 2XC7A 3OY9A 3B3WA 3OS0A 2ESHA 4KUMA 2AFXA 3LACA 1U6GA 2L2OA 2CNMA 2JA2A 3IWGA 5KTAA 2R5ZA 4IK2A 4AB7A 2K4BA 2V6CA 3I56I 2QENA 1FX7A 2OTLI 1AMPA 2L7ZA 3VYUB 1M44A 3NEUA 3H4QA 3AG3H 3RJPA 5L3FA 2VKVA 2PRBA 2M7AA 4I01A 3BJOA 3UEYA 3SI2A 3E7LA 4PCQA 3ZN1A 1HW2A 2R92J 2FXFA 4L89A 2OJED 2P5VA 3S1RJ 3BJ8A 1JTXA 4FD6A 1BC8C 1SQHA 1XGOA 2G3AA 4XLEA 1VNDA 3PDNA 2M7BA 3JW4A 4XKWA 1BW6A 1N78A 2BEOA 3OIQA 1Z7LA 2COBA 4M3SA 3MVPA 2HVSA 2EJRA 2DKVA 1TT5B 3CC4I 2FEZA 2FMYA 4EGZA 1YRNB 4M6IA 2LBFA 3SFIA 4KNYA 2CG4A 2PMUA 4XPDB 1JKRC 2K9MA 4A3LJ 1NXUA 2QLZA 4BDZA 5EBVA 5DM7F 1K4TA 4B5PA 4U0WA 4IF5A 5HQ8A 2VBXA 1HPTA 4KITB 3G71I 3U9GA 2BO9A 4CGLA 1DPRA 1SFXA 1YW4A 1OPCA 3CXSA 1YREA 3HM5A 4HPSA 3D00A 1LKXA 3ZGKA 1U5TA 5K7FA 1FT7A 1FTZA 1WJ5A 4NHJA 1CPSA 2QQ0A 2E7XA 1XB4A 4KIBA 4HF0A 4QIWN 1VIXA 4JBAA 1SGYI 1PCEA 4R9MA 4X2TA 3ZRGA 2DN0A 4ZYGA 1UFHA 4A38A 3BQZA 4O5VA 3E6CC 3VPRA 4RMNA 2CXAA 5K8MA 3CESA 4WXHA 4IKFA 1T0FA 5F64A 3JRAA 2C6CA 3IP4B 5LGUA 3S2WA 4YIRX 2M1BA 4NC8A 5HLIA 2O0YA 4YIFA 1ARLA 4GDFA 5JQ4A 4Y49B 4NXYA 2EIKH 4MY0A 3HPHA 1IUYA 2XEGA 4FAIA 2ZENA 5EMIA 3ZN0A 1XE4A 3B02A 2IGOA 3HHGA 3J7AY 1EF4A 3UOEA 4MTEA 2DA1A 1KYZA 3K69A 4EM1A 1GUUA 3K1NA 1QZEA 5E17F 1OR7A 4F91B 1X1BA 3FZVA 2JRMA 3HXLA 3QWLA 5ED4A 4Q38A 3BTLA 4RN7A 2QQ8A 1UMQA 3WHCA 3OXFA 3TX8A 2B5GB 2G3TA 4XRFA 2Y9ZA 2KLOA 1WK4A 3CJRB 2WV0A 3DU5A 4I99C 1IV6A 1WCMJ 2XAQA 1P92A 5IT9Z 1WTJA 2DA5A 3AG2H 1VQ9I 1CE3A 5I0CA 2QF7A 3P9CA 1R5HA 3RSNA 4WCGA 3RZAA 3B8GA 1R49A 1DS3I 2HDDA 3CUQC 3ZQQA 4L9NA 3H36A 4C2TA 3F3XA 4IHVA 1H0MA 4BE0A 2N52A 1BN5A 2DPDA 1PDNC 1BI0A 3NH4A 4CYCB 1WWXA 4JX6A 2VQHA 3OSFA 4HF1A 1XCVA 1V1HA 2CNTA 4UWIA 1XS9A 3L2NA 3BI1A 1LUJB 3B3CA 1BI1A 2Z3LA 2PRQA 3CLOA 1TBQR 4RLFA 4CAVA 2LY2A 4DUKA 1IGBA 1Y8FA 4IRGA 3AL0B 2OUMA 4A5NA 4FBEA 4P9FA 3EYIA 1H9TA 5C82A 2BV6A 1IIDA 3C2BA 3FMQA 4KMUX 2L8EA 1U5TC 3QODA 3KP7A 4ZYHA 2LREA 2RQQA 1ZK8A 3DKYA 3HRTA 4HV6A 4XBFA 1ZLIA 3FX6A 3GB0A 1RZ4A 2LC2A 3R6SA 4BE1A 4UEFA 1LDDA 2XPVA 3R4KA 2OVOA 5DWNA 2WY7Q 3I3LA 4P44A 4PPZA 2AE6A 2XB0X 2QQDA 1BOAA 3OMYA 3ZP5A 2Z3OA 4KOWA 5ICFA 1BIAA 1F4KA 3PB7X 3RKWA 1T0FC 2UZ3A 1Y39A 5F46A 4HNVA 3TO9A 1K6OA 1ULYA 1TL8A 1OJLA 3VEPA 5FLXK 3O2PE 2RKHA 2J8NA 5JHUA 3LAJA 2ZEGA 1AKHB 4Y15A 1EA3A 5BS6A 3PQKA 4UCMA 1MBKA 1ETOA 2C6YA 1HA8A 4PJMA 2YNDA 4KOTA 3HG9A 1H0ZA 4L8AA 1ZLHA 1XJOA 1R23A 2W1OA 2FBHA 1U3EM 1GT0C 4XLCA 4AYBN 3MRUA 4P55A 3WU0A 2WBMA 2WC2A 2R98A 3TEDA 1FNOA 2DIPA 5E3RA 4B3XA 2SGFI 2RN7A 1YJNI 4IHYA 4EJWA 3UFFA 5FKLA 4RB1A 2JVGA 3J81Z 3D66A 1XTAA 4MCQA 4EFDA 4UXHA 2FSRA 4X3RA 3U2RA 4FE7A 3OOUA 1AWCA 1L0OC 4KVME 3H9JA 2OR4A 1XSVA 2FXAA 1M1EB 1JHFA 1TUSA 2N71A 4A33A 3FKIJ 2MLKA 1WJAA 2FE7A 2Z11A 2ISYA 4CGPA 2LY9A 4XLHA 3BLNA 4MBUA 3T8WA 5HLHA 4NGQA 2Q7BA 3S1QJ 2HS5A 1Y7RA 2Y2ZA 4AYBA 2R7XA 5IP6A 1BO4A 1IW4A 3ASOH 1ZGWA 2DMNA 2EIJH 4NUBA 3OV8A 2GM4A 2J87A 1Z8TA 4UCNA 3A1YA 3QYFA 4UXNA 4KVOE 4FE4A 1CHOI 2GANA 3BROA 4PJNA 4Y33A 2N17A 5H6QA 3U1DA 3N4MA 3PB9X 3COAC 4D7MA 1KU9A 4R8HA 1SGPI 1ZG8A 3E1SA 1S3ZA 4LG3A 1G3SA 3JRGA 3KHXA 2YX4A 3JRCA 4P9UA 3TL4X 1A35A 1R79A 5LRKA 4FX0A 5J3LA 2O03A 3CMMA 2J5PA 4DNCA 2NVXJ 3GTGJ 2YR2A 1OYVI 4NGSA 2F5DA 1OCRH 3GTLJ 2JMWA 3UY5A 3EC4A 1FC3A 4DBQA 4LFUA 3DTIA 4OINF 3MGDA 1CGPA 1ARMA 1S9HA 1OCTC 4G94A 2RAEA 1X1DA 5THWA 3VYTB 3CCVI 4PXBA 1WQ2A 3GF2A 3R95A 4KOVA 3TO7A 2E1MB 1UELB 2RQPA 2B4DA 1HKQA 4MQ9F 4LJZF 1XMTA 4ENKA 4G12A 3A01B 1MJBA 2EK5A 1SVOA 4WK8F 1BR2A 3RPQA 3LSMA 5FKMA 4F7ZA 3WC5A 2Y69H 2IS4A 1FP1D 3PL8A 3OYNA 4M6YA 2X1DA 4QPQA 2LK2A 2BW3A 2JQ7A 4CCJA 4PGHA 2REEA 2VE9A 1PCAA 4EJTA 2KMUA 3F8CA 2SGDI 1IAWA 1BMOA 4PSWA 4IPAA 4UB8C 4MFKA 5LBQA 1ON2A 2R7UA 4TNUA 3S3OA 1E3PA 2A6EF 3B6AA 5G1ZA 1R58A 2FT0A 1IDYA 2P6EA 1D5YA 1KU7A 2NVQJ 2GBYA 3W2AA 2FMLA 4FKDA 1B8IA 1X58A 1YW8A 4NGRA 3G1OA 3F22A 2DK5A 3DPLC 2W57A 1R0RI 1OYYA 3OYAA 1TXRA 4MXUA 3FH4A 4AC0A 3UNGC 1QPIA 1IICA 4R79A 4PJJA 1R4NB 1XD7A 4KZTA 1CGII 2OV7A 2CF4A 3KFWX 3U1KA 4JYKA 4P4DA 4GO1A 5HLTA 5FKNA 5J6XA 1JXSA 1CT4I 2DYSH 5LEJA 3JSOA 2BYVE 3BZKA 2A68F 2XUBA 1QSNA 3TFYA 4ZY0A 4I02A 2ZXWH 2OZGA 1Z8XA 2VL8A 1I6HJ 3W2WA 5CVIA 2YNCA 3CCLI 4Q7AA 5H20A 1FARA 2NU1I 4CAFA 2L9RA 4YIIA 1TP4A 3C1DA 4XONA 5J4VA 4XICA 3H92A 2OCCH 4U7BA 3HTSB 5CCMA 1YK3A 2W7NA 2CUJA 3DEEA 4DYQA 3DQVC 3SEKC 1PU9A 3H8FA 3V38A 3V7ZA 3DCFA 2X7BA 1G4DA 3C26A 4OKOA 4A3BJ 2JEWA 3DDDA 1W7PB 4EJVA 4B5OA 3SJFA 1T08B 4A3EJ 2YS9A 3QP5A 2PJAA 1JUPA 4Q4ZF 4P5OA 9WGAA 2DPTA 3J7ZI 2WUUA 2OU2A 3DF8A 1S8NA 2X0LA 4XLNF 1OMUA 3T1BA 3K9UA 2ICWG 4X8IA 3VWEA 5E3PA 1KUYA 2ARHA 5I4MA 4BEHB 4A3JJ 3E6BA 2F48A 3NWTA 3HB9A 2UVOA 4G7HF 3KZYA 2KRFA 1TGSI 2AFWA 2EA2A 2PJ2A 5H86A 1KZHA 1TQMA 5HS8A 5K8NA 1FOYA 3R61A 2IBDA 5EDNA 2A69F 2EQRA 2P7VB 4L9MA 2CU7A 5BOXA 5JI6A 1D1AA 4OC2A 2X51A 3IC1A 3C2HA 2F5IA 4ONWA 4P4JA 2QQAA 1VQPI 4OC3A 4NB5A 3WTWC 2ZSIB 1BBYA 4WXCA 4KSAA 4LIUA 3JREA 4LG0B 4OAEA 1Z3YA 1GYTA 2GOXB 2LF8A 2NNNA 3H9GA 2EINH 4Q5SF 2UXXA 2V1UA 2UV1A 1FBQA 4FX4A 3DLJA 2KJBA 4KOSA 4KISA 2BGCA 5D4SA 1FSHA 5CLSA 3KCCA 3KEOA 4AVAA 4RB2C 2HVRA 4HQEA 1DU6A 3R9EA 3S6FA 4UY8I 3FF3A 2CQNA 4XOPA 1JKPC 1QO0D 5FFZA 4D5CA 2JA7J 4B6ZA 3BOQA 4KUAA 2DFEA 1M4IA 2CMPA 5K1YA 1B6BA 3FHZA 3AAFA 2W82A 1O3RA 2ODFA 3D0SA 4J19A 2EV6A 1ACIA 4HYEA 2XROA 1LNWA 4MHYA 3OWTA 3I0TA 3G2BA 2ZEHA 1BIBA 4B09A 3E5QA 1ELLP 2MSYA 5CVJA 1K61A 4IHMA 3E97A 1FT9A 3OS1A 2QKMB 2PVVA 2CV2A 4KLVA 3BQYA 5DEQA 3GIUA 2HOAA 4KN4X 3LA3A 2B7EA 3WHBA 1ELMP 2Q44A 1TKJA 3IUOA 3D5LA 1P4WA 2YSRA 2FOWA 1R22A 2L9NA 4A5MA 3WTYC 3TDZC 2EZKA 2R7OA 1TC3C 2ZMEB 1DGRM 5H84A 3E59A 3WTXC 3W6SA 4C2YA 4GYIA 4MFLA 1IJWC 4IJAA 4U0VA 4E6KG 4XNHB 1X74A 3R96A 2QYVA 3FMCA 2ZEPA 3M9AA 1MMDA 2XAUA 4A24A 4A3KJ 3WGHA 4YG2F 3CDXA 4BBSJ 1FMVA 2DJNA 3WG7H 3VWDA 1UZCA 2MA3A 4KJZA 4JXQA 4P4IA 1SMYF 2LB7A 5ILVA 2VBZA 3WC6A 4GI3C 2SGEI 1H88C 3F8KA 1MMGA 3CDHA 4C2MJ 3GLXA 3R5BA 1GVJA 4ESBA 1XCBA 3M8FA 2W0TA 2P0WA 4O23A 3BPVA 2L7MP 1JKOC 5E18F 1WJBA 4LB5A 1MNDA 4RB3C 2JDCA 4I49A 2F5CA 4QTRA 2K7LA 1FIPA 1YIJI 3JTGA 1HF0A 1RPWA 4LQGA 2WAFA 4ZX8A 1J7KA 2G9WA 5DCMA 2EUIA 1S3JA 4Y4RA 2ROWA 1DQUA 1ZELA 4IHWA 3LMMA 3OL3A 3MAJA 1QPMA 2FVGA 3IGRA 4NCZA 3E3VA 1I12A 4MHGA 1TWAJ 1HW1A 3SZGA 4IQ4A 4X1EA 3S2DJ 2DFFA 5AG7A 1P4XA 2R7DA 2ZXIA 3P5JA 3PQJA 4GS4A 1G3TA 5LFAA 3SFZA 3DV8A 2OQRA 2AFOA 1XGNA 3HGYA 2CSOA 1HC8A 2VN2A 3RPUD 4S0HB 2ZW4A 4RAFA 3KR4A 2GZWA 1V5FA 1ZH5A 2MD5A 2YNEA 2FD5A 3HKZA 2G0EA 3NAUA 2DOFA 2VQYA 2K27A 5HLGA 3P9KA 1MW7A 3D2PA 4ZTJA 4YRVA 2XGEA 2LOOA 3CDLA 2JJ7A 2E34A 3F6OA 3GCMA 3OYCA 1CF7B 1AUGA 2F4IA 2LG4A 1S60A 3G8WA 2KZVA 3D3SA 2AFZA 3K1PA 2X6OA 4UUVA 2NU4I 3QYEA 4WF2A 5E79C 3GOXA 2FS5A 2UZKA 4G8XA 2R93J 1KWMA 3W6VA 1LFPA 1MBHA 3ISZA 2XGDA 2IMOA 5K8OA 1O4XA 1UHAA 4M3FA 2NAZA 5F47A 2R7TA 4RB0A 4BBRJ 2BZTA 3D5SC 1ZTRA 1EV7A 2R3SA 4CSWA 4PK2A 1W4RA 2HV2A 5F1RA 2K9LA 4P4FA 1RI7A 1OCOH 2Q4VA 4WXDA 2LH9A 2QPOA 5A2QK 1Z8WA 1TKFA 5JPHA 5ISVA 3WE2A 2VT2A 1MMNA 1ZGJA 2PJBA 3CJQB 3JAMK 3HUGA 1WHUA 3SHFA 4YFKF 3DU6A 3V7CA 4UUSA 1K4SA 4GFBA 1OVOA 2JBKA 1X4SA 3GFLA 4IOAF 3GW2A 3Q9VA 3CPXA 4ZH4F 2YU9J 2VODA 4MEYF 5KTDA 3BT9A 2ARPF 4M85A 2I00A 2VQLA 2YUSA 1WGCA 4E7ZA 3BP8A 4GXHA 2XRNA 4ZX9A 3BTCA 2K4JA 4EV0A 3MZ8A 1DP3A 1UG2A 2Z9OA 2K9NA 2WTEA 2A5WA 2R8VA 2HOTA 2CUEA 2VXDA 3GBGA 3KPHA 3NWSA 1YI2I 1QU3A 3NE8A 3KYLA 3NH8A 4E2AA 1ORKA 3HOSA 3CC2I 1Z05A 4A3GJ 1I50J 1AU7A 2DT5A 2JA1A 4ETSA 4XLPF 3BXMA 3A9LA 2LKPA 2RNGA 4BHPA 1RTQA 3I59A 5JHWC 2R7RA 2ELIA 1HDPA 2BXYA 4KORA 2UUZA 2BL1A 2I5UA 1S5LC 3TOAA 1VQLI 3MKZA 2P5KA 2I79A 3BG5A 3HSFA 4I76A 2OF7A 2XPWA 4MIMA 3L9FA 1R36A 5L3EA 2ID6A 1HCRA 1Z4EA 3HRMA 2B4BA 2QGUA 5EGOA 3TJQA 1VQNI 4U5YA 4G6TB 1Y0UA 1Z1DA 2HC9A 2FL4A 4QPOA 2HTSA 1FAQA 3NRVA 5AG4A 3FISA 3I54A 3LSIA 2FRHA 1BA5A 1JWQA 2CV1A 3HL2A 2DU9A 3PB8X 5FLXZ 3IH4A 3CF5F 1ZLJA 5H6RA 4BH9A 4M72A 4CZCA 5FRMA 3UEJA 4JJXA 1YS7A 3FX3A 2V4JC 4OOIA 1NMTA 3VDPA 2KMOA 1V3FA 2QQEA 2MC3A 2Z3YA 3N7ZA 4LD5A 4W1UA 3R5CA 1SMTA 3LL7A 2F5EA 2J8RA 3FB3A 5ICEA 5KAFC 1TF8A 4CPAA 4C3HJ 1S7FA 1HBXG 1X3UA 3U21A 5FGMA 4HGUA 1PUEE 4FUUA 3MMYB 4D7NA 1S7EA 2B4DB 2JA8J 4BMHA 4RAGA 1QZYA 2B3VA 2ZC2A 1K4JA 1APLC 3FK7A 1YJ9I 1GHEA 3H0GJ 3HPGA 1TBOA 2XPUA 2JXDA 5EG0A 1MK4A 2V8GA 1CX8A 1JKQC 3H9QA 2V8HA 1LR7A 1GVDA 5B1AH 2IS6A 1WJDA 3GUXA 2WADA 2EILH 1YOVB 2ZXJA 3CCRI 3HOYJ 3F8BA 1PP7U 4DQ2A 3RBUA 2Y31A 4RS8A 3FBNB 2RB7A 3KP3A 3S3NA 1QVUA 1SD6A 1FNNA 2V9VA 3BCAA 3FMRA 3HSEA 2NRAC 1HDQA 3OXLA 4EWTA 1T6SA 3R5DA 2WAEA 1YO5C 2PDOA 1ETVA 4UFXA 2L4AA 4WX9A 3B73A 3EPZA 2W84A 2BVMA 4BHCA 1VZ0A 3GEZA 1KYWA 4B1RA 2V8VA 4BQQA 3WABA 4JCVE 3V4GA 2EWNA 2CTBA 2BY0A 4UNOA 2KRHA 5TISC 2D1VA 2ZEOA 5E3LA 1EH8A 2XKOA 2PJ0A 4I0AA 3WE3A 3ZQ7A 5CVVA 1LFUP 4JP0A 2KDZA 4JZ0A 2WB1N 3M07A 2CWGA 3Q0UA 5G22A 3N05A 1HSTA 3RPUA 1M8BA 2XSJC 3H0DA 2NU0I 3CXPA 3VOEA 2PIYA 2FX0A 2K86A 2Z10A 3VE5A 1X4PA 2JUCA 5DWMA 5K8PA 4BY7J 1LRZA 3L7WA 4W9YA 4EM2A 4LQ6A 1SFKA 4HOBA 2R5YA 3LSPA 4DW6A 1QA6A 2KIUA 2YPRA 3ZXSA 2O61A 1R4MB 3IWZA 4MRIA 3CUQA 4RGUA 1AHDP 4N9HA 2V1NA 4I6ZA 2JW6A 2EFPA 5DAEA 1X12A 2DA4A 1O3TA 2VPRA 4BJTA 1S6LA 3WU1B 2M8EA 2H09A 3WU2C 3MKYB 4DZJA 2PX9A 2VQCA 4RM3A 4HW0A 5HS7A 3RTRA 1LOKA 4C2XA 1R5GA 4M3EA 2WB1A 1IB1E 4UB6C 2Q7SA 1MH3A 4A0ZA 5J1YA 4IRIA 3BR5A 4RA2A 4DBRA 1D5VA 2J9RA 4A30A 2X1CA 5D6EA 3SEZA 4R8FA 5HOOA 4BQNA 2G0BA 3R0AA 3LAPA 4RGRA 2X3TA 2HTJA 2POKA 1F1ZA 5BQTA 1IN7A 1P6RA 3QP6A 1NHAA 4B12A 2IGNA 1AYEA 4IHTA 2FIAA 1TLHB 3WODF 5J1RA 2R7QA 1XMXA 1BI2A 3CMEI 3GZ5A 5EYRA 1TTYA 3CJNA 5DD8A 3KY9A 2XIGA 3L2RA 3FXRA 3LFUA 3D7HA 3PIPF 4BYYA 2CFOA 1R43A 2AXTC 4F9VA 4GGGA 3OYMA 2DFIA 3FBIB 5ICGA 3SGQI 1YMEA 3D7DA 4C7IA 5F09A 2B8TA 2SGPI 5DV5A 1TWCJ 2IA0A 4ZYDA 3VB2A 1HLVA 3DPTA 3OXGA 3D8PA 4AVCA 4OMYA 2DOAA 2I8DA 1IF1A 4IHSA 1S7AA 4MLOA 1X1PA 1PUFA 2ORVA 2CWEA 2P6AC 4P4EA 1X19A 2CRGA 2IGMA 5CQEA 5LYIA 5AG5A 3OYDA 1OCCH 1N75A 5EEAA 2X6WA 3LWFA 3MEKA 3JRBA 1RESA 1F9NA 3PM1A 2N1AB 2HQRA 3R9FA 1HDLA 1WGXA 2RIJA 2F5VA 4JX4A 1ETWA 3CPAA 1XX6A 4QWQA 1TIHA 3RI4A 1CPXA 3AFHA 3NQOA 1HQCA 1QHHD 1WWZA 1DUXC 1WH5A 1X1AA 4KT5C 4EMSA 3BZ6A 1BR4A 3VWBA 1CP6A 4AG9A 2NOJB 4KDPA 3TDUC 4JX5A 4HEA2 2ZXHA 2XEFA 1NE9A 3S3MA 1MMSA 2PBIA 4RS2A 3V8IA 3LSTA 2JWTA 2CWFA 2PJ1A 2KT0A 1A2ZA 4NGPA 1R1TA 4BL0B 3E2IA 4DIQA 2QEXI 1OLTA 2H27A 1SANA 5JLXA 3KGQA 2OZHA 2X85A 5F48A 2DA7A 1SAUA 3BG9A 1YLEA 3KQXA 2JN6A 4B47A 3PFEA 1YJWI 4ZDPA 3FJUA 3EUHA 2HYFA 3FIWA 3O3KA 1I1GA 4XL9A 1B72B 4UBRA 5IYCJ 3FXUA 3W6KB 4E7HA 2ID3A 1G3WA 3KEQA 5F27A 2UXNA 4C2UA 3LSHA 1F2PA 4CGZA 2PN6A 3H5RA 2R7ZJ 2PG4A 3OYEA 1P9ZA 2BHZA 2X52A 1IUFA 2Q8KA 1ZRCA 3SJXA 1V54H 5A27A 4A3DJ 2ETHA 2QECA 2XF7A 3K4KA 1YX3A 4U88A 2XB5A 2WVJA 2FIWA 2PE3A 1I27A 2VJ5A 3BG7A 5AIPA 3CCQI 5D8LB 3N5FA 2Q2EA 2VC0A 3HGGA 3OSGA 5HODA 2Q0YA 3MN8A 4CDGA 2VUMJ 2O9LA 1T33A 4XMYA 1Z8LA 3LOCA 2JDDA 5GCNA 5M3MJ 2O5RA 3EQLF 1UUCA 1IN4A 3R0JA 1X1CA 3RKQA 5CVRA 4RLQA 1PTRA 1QVTA 4XPLA 3S8PA 2X4HA 4QUSA 1E2XA 4YRHA 5FUWA 4BE2A 5IY5H 2ENNA 4PSXA 1W5SA 2FU4A 1K78A 3IC7A 2M0CA 2PQ8A 4Z2YA 1OKRA 2QQ9A 4L5JA 5IX3A 4PFOA 2FBIA 1ZREA 4WP4A 2LY1A 5F08A 4MEXF 2R7WA 1BPMA 2LLKA 4A6EA 2CV0A 3P9IA 3DLLF 4PXEA 2MG4A 1U5KA 3CCEI 1ERDA 2IS2A 1J4JA 1LEAA 3ROUA 4J00A 1IXSB 3SXOA 4XSZF 4MI4A 3E6DA 2PJRB 2VOOA 1BJAA 5LRSA 2EO8A 5F0CA 2P7CB 4KMFA 3GO5A 3QAYA 4B11A 4DJLA 4BD9A 5HMNA 2HKOA 3ABUA 3V8LA 3OYGA 4DYCA 1K7TA 3K2KA 4NEXA 1FEXA 4L9VA 1B59A 1S20A 2XAFA 4J3GA 1SFOJ 4YFJA 4B44A 1X2MA 4ZY1A 4E70A 1GLNA 3FF5A 5LHHA 2VEZA 3NH5A 2Q0OA 3GYAA 3ECHA 2OD5A 4AVZA 2DBBA 3C2GA 3RCOA 3OYFA 1FYLA 3S2HJ 1BR1A 3S6HA 2M30A 4LIVA 3QPTA 4D9JA 4UV9A 5EX3A 3MQ0A 4KN7X 5ILUA 3IV5A 4M6GA 5GPAA 3JRFA 1T2KA 3EUHC 5J1QA 2QQBA 3OIPA 2KKOA 2BVLA 3HOTA 4G7ZF 3SQNA 4R57A 1IOIA 3OYLA 3SZPA 3QPSA 3ZQGA 2XHKA 4HAMA 4A2ZA 1VQ5I 3F8FA 2AO9A 1EE3P 5AONA 3DKWA 3FK6A 4UUSB 2HU9A 1H8AC 5LRRA 2P81A 5EX0A 1HDDC 3HZJA 4EM0B 1IRGA 2KMRA 2CTCA 3IEHA 4NSQA 5CNPA 1Z6TA 3S9MA 1ZQ3P 5FKKA 2QBYA 3RYPA 1VHOA 1RUOA 2EK8A 2PJ8A 2ELJA 5B66C 2R7SA 4MMOA 4A94A 3EFAA 4CYPA 1Y1VJ 2BY3A 3W2VA 1RR8C 3IO1A 2FUG2 1FOWA 4NQWA 2IXSA 4MGRA 3V8JA 1E17A 4XN3A 4ZDLA 1I39A 1I3QJ 2O7OA 1Z21A 2PVWA 1S7KA 1CG2A 1H8LA 3D4UA 1WJFA 2L5QA 3T5XA 3TW7A 3GYHX 1WGTA 4I98B 3W91A 3G6EI 3IH2A 3L2QA 4N0BA 1M4LA 2ZEEA 3FSYA 5IP7J 2M5WA 4HSTA 1BM9A 1LJ9A 1Z7UA 2TDXA 4XN0A 4QSHA 4CA0A 1CP7A 1G2HA 1ONVA 2CQ7A 4C2ZA 1D8KA 2GXBA 4UEZA 4C68A 1YLFA 2K85A 4RI1A 4FT8A 5HNHA 1SGQI 2QKLB 2EFNA 3RAMA 2DMPA 5FROA 3V7RA 1T8IA 1YW9A 1IY7A 3JRUA 1AN1I 2Z1DA 1VQOI 1FSEA 3GLLA 4F0YA 2NS0A 3C3WA 4HKFA 1WKXA 5LYFA 3IIBA 2CWHA 2EZHA 1OYIA 2EZIA 4UHTA 4OADA 1Z3XA 1JJ6C 4ZI6A 1FWZA 5JVTA 1ZRDA 1IO2A 4F9UA 3I55I 1IRZA 4SGBI 4UWJA 2AS5F 1M8CA 1LE8A 1FZPB 3BG3A 3I53A 2LKSA 1IC8A 1ZRFA 3SI1A 2MGQA 2DQRA 1Z0XA 3SXYA 1TWGJ 2H5MA 2DFHA 3DWLE 2M4KA 2ISZA 1ON0A 1KA8A 4KOUA 4A3FJ 3JAMZ 4OIQF 3WT4A 2DQLA 2PC1A 2M2EA 4OWRB 4NF1A 3M7GA 3MKLA 1PJRA 2D1HA 9ANTA 5D4RA 4RDUA 1RKTA 3RZOJ 3ZMTA 1Y0YA 2M87A 1VI0A 4CCOA 4M6HA 4P45A 1NTCA 2EFOA 1L3LA 1QSMA 1Y56A 2E19A 4Z6YA 3OL0A 3TCVA 3HOXJ 3BJAA 1MSFC 5C4JJ 2ENZA 3UR3C 4HNTA 3SDBA 2KIMA 2ZKZA 2SGQI 4HX7A 1ETYA 2ADUA 4BAYA 4G7OF 2A5YB 2QSHX 5KTCA 1OQYA 1IXCA 1N13A 2ZPAA 1IU8A 1LDKB 1JGGA 1GV5A 3KYCB 2E1OA 1SFEA 1Q1VA 2DLLA 1JTYA 4N4NB 3PBEA 3QTLD 2HYGD 3IWFA 1TNTA 4AD9A 4MHDA 3A0HC 3H3ZA 5E8GA 4PJ0C 4BXFA 5BMZA 2NVTJ 4CUGA 4NDLA 4AIDA 2E2HJ 3B4VC 5HVFA 3RIRA 1KZFA 2V1DA 2XAHA 3HOVJ 2OTJI 3AG1H 3CCSI 1MDMB 1U9NA 2GVIA 3HOZJ 2F7VA 4B4CA 3ECOA 5HVHA 3ABTA 1SAXA 1SD7A 3GKRA 1S7LA 4Q47A 5IT3A 3HOUJ 1NG7A 2HPIA 3D7GA 2VKEA 2KHMA 2R4GA 3OIOA 2ZJ2A 1ETQA 3ISPA 4EJOA 4F3QA 5E3MA 1IZ1A 1R71A 1S5KA 2PCUA 4UIBA 3X2QH 1Y9KA 1ETKA 2PJ4A 2ZJQF 3JTHA 2R5ZB 3OOPA 1Z77A 1YU6C 3DNSA 3GTPJ 3IAS2 1YRNA 2ORWA 1E0EA 3RNZA 1IY6A 2V26A 3K4JA 2P8TA 1LCPA 2ERWA 2XDVA 1WI3A 2FQ3A 4XRMA 1KUVA 1W4MA 1KMAA 6CPAA 2BUSA 2X1EA 5FUXA 4KSFA 1H89C 5DCFA 4XIDA 1J0RA 2KJCA 2L0KA 4YWYA 1DPUA 4LLLA 4IQJA 2VXZA 3G1LA 1NSLA 2DA6A 3KP4A 4LGWA 2VBQA 3CD6I 1SGDI 2V1XA 1KBEA 3H8EA 2ESNA 4RAYA 3G4SI 1Y7EA 2BY1A 3BY6A 3CF2A 2OH1A 4U87A 2CUFA 2GOMA 2DXQA 5ELYA 1VDDA 2JK3A 3BTIA 2CS3A 2LBFB 1UHMA 2IPQX 1O7FA 3MD2A 4WJBA 1Q2DA 1ZGAA 3HRSA 3VYRB 1E3OC 4R7MA 2DPSA 1ODDA 1POGA 2DT6A 1FOXA 4B5PB 4UCPA 1MT1A 1W5CC 3NARA 1BC7C 3LODA 5K7ZA 1TURA 1BAVA 4UIAA 3EO4A 3CP2A 2RV8A 2DA2A 3PBBA 2ZELA 1LR8A 3F8NA 1LDJA 3TKYA 5IV0A 1LANA 3M8JA 1U5TB 1TQPA 1UHWA 3I9V2 5TGTA 3CO7C 5D5WB 4KUBA 2HXIA 2P4WA 4X5KA 4E7LA 1FYBA 1FJLA 1PTQA 2EPFA 3WR7A 3ASNH 3DLAA 3H35A 1WZ2A 2FE3A 5ERIA 1WKMA 1GXPA 2D5VA 2D4OA 2B5GA 1MMAA 1K6YA 3SDGA 2K9HA 1A36A 5F49A 1MNMC 2WAQN 4D5FA 4XM3A 2Z3KA 2E71A 2HZTA 1W36D 2K5CA 1J75A 2CYYA 1S7NA 4IVNA 3H5ZA 3A03A 3IKTA 2E5RA 4H0EA 1Y6IA 4M73A 2DXIA 4MFJA 1K83J 1P7JA 4R3LA 3B7IA 2NYXA 2WY8Q 3S6KA 2IL4A 4CYOA 2KRCA 1TF9A 1Q2CA 2AXLA 3BWGA 1D0YA 4LB6B 4CYCA 2L02A 2ACJA 1XBUA 2REFA 2Y48A 1RNLA 3F8MA 3OS2A 3JCUC 2PJCA 4JD6A 3P7NA 4YEJA 2IJLA 4FHTA 1MKMA 3SGBI 4L9JA 2KCXA 3HHHA 1ZO0A 4ANJA 3KI9A 2WAQA 3ABMH 2CIJA 4XPDC 5C3EJ 4XK4A 5E3NA 1NSAA 4CAXA 2Z3MA 3CT9A 3JRHA 2CQQA 2MW8A 2J9AA 4MFPA 4MFEA 2K40A 2ME0A 4NGMA 4UV8A 3LSRA 5DM6F 2V53A 2BUEA 4PV6A 3VYSB 2CW7A 3ZQFA 3JTKA 2PJ9A 2LP0A 2LDUA 4JQFA 1W7PD 2VBWA 2WWYA 3CXLA 4R87A 1U0JA 2EZLA 2UWMA 3FXOA 3K1MA 3SHPA 1FOKA 2IP2A 3I58A 3RYRA 1P0HA 1Z9UA 5HDGA 4D1QA 4XRSA 1YYVA 1PJUA 2I3CA 3SEQA 5GAHJ 1P4AA 1XC5A 3Q5FA 1PPFI 3F72A 3KKWA 2VBYA 4MY3A 1YR0A 1DP7P 4A69C 4Y49C 2O8KA 3ONQA 2KL4A 3K4NA 4JK1X 5F1JA 1AKHA 5M5XJ 1IYLA 1I5ZA 4BUPA 3A02A 4EGYA 1FYKA 2A07F 3CXQA 2IGKA 5K7HA 1GXQA 3UKGA 3B3VA 2H8WA 2PR1A 4U0YA 2FCKA 4UVBA 4M9SA 4KICA 5DS9A 4AMLA 2D4PA 5IYBJ 1YS6A 1YQAA 3PSIA 2R1IA 3FXKA 2V8DA 3K2ZA 1CJWA 2E2IJ 3DR8A 1I3AA 3MCZA 2Y9YA 5IP9J 1QSRA 3BCBA 3L09A 2F3CI 3CO6C 2NNYA 2V77A 3HYIA 3PJRA 5M5WJ 1UVFA 2CO5A 1MJAA 3CZ6A 1N77A 4B43A 1XFOA 2GLFA 2JLMA 3CCJI 4E0AA 1BW5A 4KA4A 2VONA 1KU2A 3RKXA 1TT0A 2NVUB 1KUXA 3R9GA 2CGPA 3SJEA 4CGNA 2GFQA 4E7JA 1NG6A 4BGDA 2JBJA 4XNFA 1QZZA 4M71A 2A6TA 3JR9A 4GM5A 4H6UA 2DI3A 4JLYA 2FNFX 3DP7A 3M1EA 1DU0A 4L0YB 4EMEA 1Z91A 5DD4A 4EQQA 4HDUA 3OYHA 4KFCA 4ZYQA 4MCRA 4ZZDA 4E7IA 2CW8A 3H5NA 4OVOA 2O4HA 3VDXA 1K7AA 2F4MB 3CQZJ 5J8FA 4IHXA 1DTDA 2BE5F 3ZMDA 4A0YA 2E1NA 3FVLA 3ULQB 1L0CA 4NGNA 2DODA 2NOGA 2MYSA 3AL0C 1W0UA 4RBOA 4PK3A 3IAM2 3DR6A 2J8MA 1UB9A 2A6HF 4Q48A 3GZNB 3KP6A 5GAEJ 3WGIA 1FPQA 1OZPA 4KLWA 2XEIA 1TNSA 3J80K 2WGCA 2YX7A 3EDPA 3LQQA 1V0CA 3KHZA 5LEKA 1U9OA 3FIXA 1ULMA 1A04A 3E6MA 5E20A 1SGRI 3LSJA 3NA6A 3PNTA 2C6PA 3T9YA 2PJPA 1UVGA 3O8GA 4OC5A 3V8KA 2HDWA 3A01A 2Y75A 5HS9A 3J7YJ 3F23A 4ONUA 4ON0A 1G8XA 1V55H 4BDYA 1RR7A 5DUIA 3C7JA 3JSPA 2BXZA 1B87A 1JUSA 2KZGA 3Q3SA 1G3YA 2XKPA 2LFBA 4E8OA 3OYIA 1CBXA 2VJIA 4HLYA 1XIXA 2ECBA 5KAIC 3B3SA 2M3AA 1FLIA 5GADJ 1FTTA 1PYTB 2WZNA 4OAYA 4G6DA 1DGWY 3WC7A 3PB4X 3Q9SA 4QBJA 2L3DA 1ZG5A 2VC1A 4B8XA 3CMYA 3DSBA 3EY5A 2FQ4A 5FLMJ 1STZA 1V1IA 4DJAA 4ENJA 2JZMA 4QB9A 1ENHA 1WH7A 2A61A 5EJCA 4XPKA 4CCKA 2KMPA 2MLGA 3OR1C 2ZCWA 3E0JB 3IRQA 1IGNA 1Q1HA 1ZR4A 3JVNA 4HDVA 1T98A 4H2KA 5F0HA 1Y0RA 5TRDA 2BW3B 5DUKA 2TCTA 2QIRA 1BI3A 3WTVC 1T95A 5D29A 4M3DA 2DO7A 1KQ8A 2KIFA 2EWBA 2XEJA 2P6GA 4TV7A 3DKXA 2HXOA 3O6BB 2F4OB 1CQTA 1B8IB 1YIOA 2IT0A 2CFXA 3ZCOA 2E5NA 3HIFA 2TRTA 4HX8A 2ZEDA 2K02A 1JT6A 2FJ1A 2FF4A 3LA2A 4PUSA 3V42A 5GAGJ 5FLVA 4KIGA 3OVOA 4QC6A 3OYBA 2DOEA 4IO9F 2E60A 5FD6A 4YELA 2OQGA 3FM3A 4MFZA 1ZAOA 4UUTA 3I3GA 2CQXA 3SJGA 1WVRA 1USTA 2DJIA 3MN2A 3QOPA 3WG9A 2GKRI 5E1ZB 4R6TA 3OR2C 1W7PA 3BJ7A 3DFGA 4CXFA 2EA4A 2VJJA 2GAUA 1MNEA 2FOKA 3TC8A 4RM2A 5D5UB 2CNSA 5J47A 1N25A 3G3ZA 2A20A 2ME6A 4TWEA 3I1UA 2GU2A 2PJ6A 4HLXA 3DTKA 4P6YA 2LSOA 3QOEA 5JLWA 2HPMA 4LLNA 1F57A 4EEFG 2C27A 4IUSA 1ZARA 4BEHA 3FKJA 3B35A 3F0AA 4UEEA 5EF6A 2DA3A 3W6JB 1IRXA 2E1MC 1XDUA 2BOLA 2WPWA 2PFBA 1MH4A 2ELKA 3F9KA 4YGOA 2BBYA 1RKWA 3LWUA 1UJ8A 1JHHA 1R1VA 5GP9A 3FBUA 4II3A 3I4NJ 5FKOA 5E1WA 1C0WA 1U6MA 3PRTA 3RO0A 1SD4A 2R7FA 2F8HA 1YFHA 1QNTA 2Q4ZA 4S05A 5CCLA 1ON1A 2FA5A 3K70D 2ZJPF 2A3SA 1VQKI 2E73A 2A05A 4LUAA 5M3FJ 3VATA 4PFPA 2Z2SB 2KDOA 3G1MA 1BUSA 1QSOA 2Y0SN 3BI0A 3G3SA 2JUGA 3KZIC 5GPCA 3FWEA 1IDZA 3TE4A 4QLCU 3QQAA 2AFSA 1XEBA 3TBIA 4LG0A 2HQNA 2GXAA 3HBLA 2R7HA 3LD2A 2IS1A 4XQFA 2IW5A 2Z3PA 4ZBGA 5JH9A 2X48A 3MFKA 1W36C 2PLYA 4C3JJ 2OB0A 3PNYA 1HOMA 4A37A 4B13A 2Z5UA 4BKXA 1LFWA 2HB6A 2JZYA 4XOTA 3PFOA 4KVXA 3ZJ0A 3FEDA 5KVRA 4CCNA 3FYNA 3GX4X 4L5EA 4BY1J 3TP0A 5HDKA 3GLJA 2CW0F 3NE7A 1B4AA 2XSDC 1TBRR 3F6VA 3F5BA 5G21A 4BJ6C 2P6SA 3ABLH 2LEOA 5DDGA 3FRMA 4B14A 1TWFJ 5JFRA 3ERMA 1XMAA 2V7FA 2Y0SA 1EH6A 3GMEA 1P2FA 4A3IJ 5J40A 4Q36A 3P2HA 5IOZA 1UG0A 4KSIA 3VSKA 3K0LA 5KCMA 2MD0A 2QJ8A 3GTOJ 4DYRA 1VQ8I 1Z2IA 5FO5A 1WI9A 1XF8A 3HH2C 4P4BA 5FB2A 1XSDA 2L7FP 4KS9A 4A93J 4RGSA 4ZC3A 3IU2A 2GA2A 4M9XA 2KCWA 4V2GA 2MH9A 3AKZA 5CKTA 1Z7KB 4B3AA 3K2AA 3A2KA 2M5XA 2ZW5A 3K4CA 4PK4A 3IL2A 1A5JA 3S93A 3PUBA 1MBEA 2M8GX 1R1UA 2M0MA 3KETA 4ESJA 1J5YA 5C4XJ 5G20A 3BJ6A 2F2EA 3QAHA 4HG2A 5FRNA 3DTEA 1R6RA 4GXOA 3HEFA 1ZHFA 2ZMEA 1F36A 2O3FA 3MZHA 3GZ6A 1MBFA 3PFYA 4G6QA 3EUAA 5B3SH 5AGEA 2V1CA 2Q51A 5DS0A 2LKXA 4F6AA 4NFRA 1RFHA 1Y1CA 3B2YA 2KIQA 5HH1A 4O3MA 1GV2A 4A3MJ 1JE8A 3PEIA 4BXUA 2PIZA 1X2NA 1V4RA 4S04A 4MFQA 2VKHA 1YW7A 2AHQA 2EIMH 3E0KA 4CRZB 4C9YA 1W1WE 1IN6A 3WGGA 2XRLA 4XSXF 3EUKL 2FBKA 4ZJZA 4ABZA 4PXCA 4HQMA 3GUDA 3KP5A 4KIFA 2VPLA 4YU9A 4C3IJ 3ZPLA 2B0LA 1OFCX 3P2FA 3OWCA 4PDKA 5JR3A 4BHBA 2VOPA 1YVOA 4MFDA 5DTDA 2DMQA 3F0CA 4AWXB 1HSJA 1T56A 3L2UA 2PSWA 2J5OA 3HSRA 2LUYA 3JRDA 4ZYEA 3LMSA 1IN5A 2JPBA 2MH2A 5CJ9A 3PO3J 2DTRA 5EZHA 4MCSA 3SI0A 3FXLA 4JOMA 3FNCA 4AUXA 4NJQA 1OMTA 2W85A 2WV1A 3O8HA 4M6VA 2EBJA 1WJEA 2K9QA 1ZLKA 1HXDA 4OIRF 2IAIA 4A12A 4JYWA 2OAZA 1D1BA 5B1BH 1PP8F 4CO8A 4ENMA 5FVJA 2C6GA 2B9SA 4HSRA 1J09A 5TJJA 1Y8QB 2PI0A 4IAVA 4D0PA 1IW7F 1A6QA 1E3HA 3KASA 1NK3P 1YGHA 3ZOBA 4Y7NJ 1FYMA 5LHIA 2OBPA 2VI6A 2ZXVA 1Y0NA 5FUYA 1D8JA 2XVCA 4F92B 1VFCA 2L4MA 3BR1A 4HF2A 5DCMB 2H1KA 4L18B 2OD1A 5LLQA 1ZYRF 3V7SA 1CF7A 1FBSA 2F5FA 3MEXA 3VFZA 2QWWA 4RAZA 3ZQLA 2N8GA 5L3CA 4BJ5C 2NS7A 2IA1A 1QHGA 4UXIA 3Q0WA 4OIPF 2B58A 5C44J 4HV5A 3FEEA 4NGTA 2KFDA 1JUMA 3ABKH 3K9TA 2IJZA 4FWUA 4N4OB 4UA3A 3S9NA 3D5RC 1QQ9A 3KLNA 4I09A 1VGYA 4GCVA 2C1CA 2E5ZA 2P6TA 3GVAA 1G59A 1NK2P 3IWEA 3GWZA 3RYOA 4NC6A 2V9PA 4P96A 3I64A 2VT3A 2ZMEC 3RU0A 2ZFUA 2EBIA 2Z33A 3ISXA 2HGCA 3GTJJ 1U8RA 4JWPA 4ZYAA 1XG1A 1VTNC 2YQPA 4AU7A 1Q7LA 2M9HA 2V1CC 4XNHC 4OIOF 2DDAA 5HVGA 3GY9A 2MBFA 5D5VB 1LVKA 2OPTA 1MSEC 4B10A 1O57A 4R3KA 3FMSA 2D2WA 1X3ZB 3TW6A 5E3OA 4KYWA 4L9TA 4CICA 4L0ZB 3B3TA 2JSCA 5JHFA 3MKWB 2L54A 1OR7C 2R0QC 2GLJA 2VLAA 3IKVA 2VZZA 1XOVA 3CTAA 2K9SA 3LA7A 3GTMJ 1ZG7A 2HVQA 4HPQA 4AVPA 2HYJA 4CS0B 4MQVA 5HI7A 1QQIA 4BU2A 2EB7A 2BCOA 7WGAA 1OCZH 4HNYB 4P1WA 4PJLA 4YFXF 8CPAA 1OMIA 4OU0A 3PZJA 2RC4A 2JSPA 4IZZA 3HUGB 2B63J 5CBMA 2ECCA 2LVSA 3B6CA 1CT2I 2EVNA 2DMUA 1RUNA 2G9DA 2QM3A 3H1CA 3FHNA 4H4KC 4PGGA 1AOYA 2HOEA 3LSKA 4HNXB 3SJMA 3UGDA 2OZUA 3IJ3A 1IRFA 2XGXA 3GTKJ 2XV4S 1XA6A 2X6XA 2VZYA 2L01A 4DZPA 2NYQA 4LLGF 5H2FC 3I71A 3S17J 4Y52J 4BQOA 1Z6RA 2ZO4A 1DS2I 2HQ5A 5E96A 1XX5A 1YITI 1V5GA 1J59A 1Q2YA 2GXGA 1P9QC 4M74A 4UVCA 5A28A 1VHSA 4C7HA 2V6EA 3FXMA 1A6IA 2ELHA 4A32A 3TP3A 2AJ6A 4K30A 3WTUC 3ZZIA 4IRHA 3DXJF 4LK1F 3PB6X 4OC1A 3K4BA 3W6XA 4FQGA 3I59B 4OP4A 3T8RA 1TZLA 2CH0A 2F6CA 2VQGA 2G7HA 5L3DA 1TBNA 2CY2A 4EJUA 3H8GA 1JT0A 1TBXA 2ZSHB 1T38A 1HW5A 5EZGA 4F8ZA 2CUZA 3DBRB 4E1PA 3TGNA 2MFZA 2I10A 2NU3I 1RIOH 4BNCA 5EGOB 3DBHB 4FISA 3VDUA 3K7AJ 2PEXA 3L2VA 2PJ5A 2M45A 1TOTA 2JA5J 3QB8A 4MNUA 1S7OA 2NS8A 3S1MJ 1SGEI 3E5UA 3GFJA 1PVEA 2A4NA 1XPXA 1IV8A 1BPNA 1H9GA 5LRGA 5HXDA 1I1DA 3OYKA 1W0TA 1SD5A 1SVLA 5A2QZ 3UGIA 1SVMA 2Z16A 4PQAA 5IYDJ 1YX5A 3CCMI 1HDUA 4LX9A 4E4HA 3PP9A 3RKYA 1KGSA 3IHUA 2COMA 4ZTFA 1OBRA 1KQ0A 4II2A 1LR9A 3EXNA 3K70C 1V5EA 1IXRC 1B9MA 3CDIA 4MPIA 2V9KA 4R76A 5J4YA 4E1RA 2NXNB 4BINA 4EVIA 1Y8RB 2DB6A 2QUFA 2RREA 1YQEA 5IB0A 3S14J 1MGTA 3REOA 2DEAA 3LFKA 3D2MA 2DT7B 1YX0A 3GFMA 1Z4RA 4H89A 4OLLA 1X4OA 2HEOA 5EG0B 3K6GA 2LF7A 3IRRA 4AG7A 3BR0A 3QPLA 4AIHA 2RFHA 4QVTA 1QBJA 4A0XA 5EC4A 2JYYA 2RVCA 4UXJA 2LNBA 4ZY2A 4ORFA 2CQKA 1K7VA 2H6CA 2WYRA 4M3BA 3LSGA 2HDCA 2BEIA 4A31A 1VQ6I 2DCEA 5KK1A 4ESFA 3EETA 1ZG1A 1IOFA 3J80Z 1WFXA 5D5XB 2P5LC 2NMTA 2WPXA 2QCOA 3WTTC 1MBJA 1KONA 2KP6A 1U2WA 4FETA 4OMZA 1Y1WJ 3S16J 4K3NA 2MC4A 2ZBKA 3K4LA 5IB9A 1LFBA 4HA8A 4HZFA 3UGLA 4BS9A 3F21A 4XORA 1SC7A 4LMYA 4FD4A 1REPC 1ETXA 4AXVA 2EK9A 1BL0A 3EYYA 4IF4A 5AG6A 2Q4YA 3LQRA 4WWCA 3D68A 5E8IA 3JUWA 1FIAA 1LAMA 5AIQA 3BDDA 1USSA 4G9YA 3ERED 2JPCA 4ASNA 1LEBA 4HNWB 3RQ4A 1PUAA 1UAAA 1M4DA 2IVMA 1Z2LA 2BSWA 2QMLA 3HLPA 1X10A 2ZW6A 2DK8A 1BJZA 3BLYA 2WSAA 5LYDA 2ZNZA 2KISA 3CCUI 5IT9K 3FXJA 3HOWJ 4A95A 3BC8A 1OCPA 5J8CA 2XGCA 2KQRA 3CMAI 4BQAA 4M9ZA 2KMQA 2R5YB 1F5TA 2YGWA 5LRJA 3CCYA 1EKEA 1ZKGA 4FASD 3CUQB 4MHNA 2GA1A 1I21A 3S15J 2L7XA 1YSJA 3FECA 3S6GA 1AA7A 2W4SA 1QMUA 1UWYA 3PIOF 2JT1A 3DGVA 4U9ZA 1UFMA 1UCRA 1K7UA 1R5ID 3CJTB 3PSFA 2HWVA 4E7SA 7CPAA 1VQ4I 1D1CA 1EH7A 3VH9A 2K3FA
chains in the Genus database with same CATH topology
2V79A 3HRUA 4EVYA 2STTA 5EEHA 2W25A 4CAEA 1U78A 2OA4A 3KP2A 4U7DA 2EV0A 1R00A 2ZW7A 4MTDA 1MD0A 2GQQA 3WTZA 4LK0F 1D3YA 4I0BA 3ZMSA 1QGPA 2XAJA 2HR3A 1FP2A 2YU3A 3J7AO 1N71A 3HTUA 2Z3NA 3ZMUA 4BBHA 1TW3A 2VE8A 2QZ8A 5CVUA 3FM5A 3I9SA 2YNCC 3TO6A 2HUZA 3IU1A 4IXAA 4UVAA 1M4GA 2OZ6A 5BWAB 2EFQA 1SFUA 4CZZA 2Q04A 1WRJA 3CUOA 2HFHA 5FD5A 2XASA 4CGMA 1R57A 1S29A 4II9A 1O3QA 1CM0A 1JGSA 4MJ8A 4U9YA 1IN8A 3H3UA 1I6XA 3C18A 5L3GA 4GYGA 3J81K 2B3UA 1XDSA 3GXOA 2K5TA 2FNAA 1ZN2A 4L5IA 4Y17A 5BPDA 5CYVA 3ZMZA 2W24A 2G7UA 4AVBA 4I7HA 2EV5A 4UFVA 2IRFG 3PGPA 4N9IA 3MWMA 4CYNA 2Y0MA 3L2CA 4F0XA 2ZNYA 1B6AA 5K5RA 4UFWA 3E5XA 4O6JA 1LQ1A 1MZBA 1TW2A 5K5OA 3TT2A 2XAGA 4KOXA 1XGMA 2FNPA 1M1DA 1YVKA 1XN7A 2JRTA 3TOBA 3G73A 2DPUA 1I1SA 2QVOA 2P6FA 2IA2A 4CRYB 1J2XA 1KU3A 5LGNA 1K78B 1O3SA 4A6DA 1B1BA 1XMKA 3M8EA 1FY7A 4Y13A 1P4NA 4FD5A 4ZZLA 2E1CA 5ILSA 5K5QA 4A2UA 2H94A 3L00A 3ML6A 1WSUA 2Z0ZA 1HKTA 3TQNA 3QU6A 4PZJA 4CAWA 2JEVA 5DYMA 5C88A 5BPIA 2FSWA 4AIJA 5D6FA 2GIVA 5LGTA 1TIQA 4AIKA 1OYWA 4YFNF 4CYQA 2H6BA 4JXRA 3KLOA 3DEUA 3I4PA 1O7LA 5ICCA 1G6NA 2DAOA 3T90A 5L3BA 3FXQA 3I5UA 3T0YA 4ENNA 3QRFF 4R1HA 1T39A 2E7WA 1QSTA 1FBUA 3VODA 2QBYB 2STWA 1DDNA 4KOYA 1KQ9A 1MJ9A 3TTHA 2ZFWA 1YG2A 1J9IA 2Z99A 1YTYA 5LHGA 1TQIA 2D45A 1XSXA 4ZGYB 1VKCA 2O8XA 1RO5A 2GE3A 1LB2A 2GWRA 2HQYA 4FD7A 5HVQC 3QPHA 3SXNA 4CYDA 4I2OA 1IYKA 1LVAA 6PAXA 3ZMVA 3T8TA 2RNJA 3ELKA