3TO9A

Crystal structure of yeast esa1 e338q hat domain bound to coenzyme a with active site lysine acetylated
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
276
structure length
275
Chain Sequence
b'EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPQKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone acetyltransferase ESA1
publication title MYST protein acetyltransferase activity requires active site lysine autoacetylation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 83
structure length 275
sequence length 276
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2011-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01853 MOZ_SAS MOZ/SAS family
A PF17772 zf-MYST MYST family zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3to9A03
3.30.60.60 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 N-acetyl transferase-like 3to9A01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3to9A02
5CJ9A 2R7DA 5FVJA 5L3DA 3TFYA 4B09A 1ONVA 4EJWA 1B59A 4Y17A 1FP1D 4ZZLA 1T6SA 2HKXA 5ILVA 4R87A 2ZO4A 4XLNF 1R1VA 5LEJA 1DP7P 2XKOA 1Z9CA 2F2EA 2HDCA 1QNTA 3JSOA 3FRMA 3RYOA 1DUXC 2EJRA 3P7NA 3I71A 2R7HA 4CAXA 1R23A 1ZRDA 2YPRA 1FSHA 3J7AO 2R98A 1E2XA 2CG4A 5E20A 4RI1A 4H89A 1IN7A 4L18B 4BHCA 2Q0YA 2QWWA 3LODA 4EGYA 4A0ZA 4AIHA 3NRVA 5D5UB 1KU3A 3MEXA 2ZJ2A 3FMQA 5AIQA 3BJAA 3FZVA 1IXSB 4U88A 2W25A 3G8WA 5FD5A 4LD5A 3PFIA 4LG0A 1FBUA 2OQGA 1WWZA 5C82A 2FNAA 2CO5A 4RB1A 4GXOA 3GUDA 1Z6TA 3ZJ0A 3HTSB 4BYYA 5FFXA 1L0CA 1W5SA 3JW4A 4FD6A 1XN7A 2EUIA 2JPBA 1DPUA 2VZZA 5F1RA 2A69F 3KZZA 1QQIA 1YREA 2OZHA 5LHIA 4EJUA 1QBJA 3CUQB 5D6EA 3V8LA 3RPUA 3WU0A 1S8NA 1LQ1A 4CS0B 3GKRA 1FZPB 3ABUA 2KIMA 1YO5C 2ZW7A 2KRFA 2HQNA 2B4DA 5J8CA 4BMHA 3FF5A 1XDSA 4JJXA 4GS4A 4ZZDA 1QSRA 2O0YA 2CNMA 3D8PA 4ESBA 2IP2A 1SD5A 1IYLA 3WTSC 4HF1A 4P96A 2XROA 3GX4X 4E70A 4P55A 4AG7A 4ON0A 1XF8A 3IWFA 3H3UA 3DFGA 5JR3A 3F8KA 2HOEA 2BL1A 4Q5SF 1OYWA 1U3EM 1ZAOA 2NYXA 4ENMA 1FX7A 3FB3A 2QUFA 3TO6A 1HSTA 1IN6A 4MTEA 1KQ9A 1J59A 1LJ9A 1ULYA 3IWGA 2H27A 4HLXA 3R9FA 5HH1A 5LRRA 1JE8A 2YX7A 1S7NA 4LGWA 5L3EA 2PEXA 1OZPA 1TIQA 3R60A 3M7GA 3S6FA 3HSFA 4I0AA 3I5UA 2B58A 3F0AA 2P6FA 4KOXA 2FBKA 3E6DA 5BOXA 3QB8A 1ON1A 3DSBA 5L3BA 3CLOA 5E8IA 5ISVA 3MWMA 2HYGD 2FMLA 2NNNA 4NXYA 2WTEA 1RO5A 2O6GE 2R1IA 4HQEA 2M87A 1RUNA 2RVCA 1BBYA 3DPTA 4MTDA 4MQVA 1B6BA 2FT0A 3QU3A 5FLXZ 1D3YA 2X0LA 2NRAC 5LHGA 4OIQF 1RNLA 4HQMA 3JAMZ 5DWMA 1Y0UA 1KUXA 4TV7A 2QM3A 1KUVA 2VXKA 2BE5F 4EMSA 4YFNF 1Y7RA 2Z10A 3ZP5A 1H9TA 2ACJA 2X7BA 3REOA 1MJBA 1SMTA 1AOYA 4MY0A 2FNPA 1KU7A 2J8RA 3KP7A 1ON2A 3MAJA 4H0EA 1STZA 1YS6A 4U0WA 4WK8F 4IHSA 1I1DA 3CTAA 2FEZA 4KA4A 3E6BA 1DDNA 2ZMEB 2RKHA 4IRHA 5L3GA 3P9CA 2GZWA 5ED4A 1RXTA 2EA4A 2Z0ZA 3WU1B 4WXCA 2OD5A 4G8XA 2ELHA 1SD7A 2B5GB 1T98A 1SAXA 2PLYA 2Z99A 4B5PA 5HDNA 4G7ZF 1RUOA 4XPKA 3JTHA 1J7KA 2M45A 4HNXB 2EV5A 4PGHA 4YIFA 1BIAA 4AWXB 4ESJA 2HV2A 3FNCA 3EC4A 3FIXA 3E5QA 4K2EA 2OZGA 2E7WA 1WQ2A 2P7VB 4AVBA 5LGTA 1HW2A 4I98B 2DFIA 1I21A 4LUAA 1DPRA 3I0TA 1XMAA 3HIFA 4NF1A 2XIGA 1YW9A 1R7JA 3TOBA 5D6FA 2HGCA 2GAUA 1UFMA 1LB2A 1OKRA 4AVPA 3WTXC 1NE9A 5DV5A 2DAOA 4UVBA 1Z9UA 2OB0A 4KOUA 2FOKA 1Q2DA 3M8FA 5JVTA 1P92A 2DI3A 1QSNA 5E17F 4L5IA 2FXFA 3BP8A 3V7SA 3C18A 3VWEA 3R6SA 5E96A 5CYVA 3BY6A 3G73A 3NEUA 2O03A 3D5LA 5EBVA 4KOTA 2FBHA 3I3GA 3D2PA 1P4AA 2E1CA 4A6EA 4AIKA 5J8FA 3L2CA 4QB9A 2C27A 2IRFG 5JHUA 4G6DA 2CYYA 2EB7A 2Q7BA 3DKWA 2REFA 4E8OA 2DPDA 2QBYB 3FMSA 2IJLA 2A5YB 1YVOA 2XV4S 2XAJA 4PSXA 4A12A 5HLHA 4AG9A 2HYFA 2Q2EA 4XRFA 4FD7A 3L00A 2OQRA 4LK1F 4MHDA 3K9TA 3RTRA 1F5TA 4M9XA 2FU4A 3HSRA 5JFRA 4OMZA 3QRFF 4KOSA 5FO5A 1EH8A 3I59A 1I1SA 5JQ4A 2P5KA 1PP7U 3VWDA 5H20A 2WPXA 2K02A 2I00A 4L0YB 1I12A 1U5TA 1K79A 3O2PE 4KVOE 1O3SA 5ILUA 1HKTA 1E17A 4KORA 1ZGAA 3J81K 3F22A 4NEXA 1MZBA 3V7CA 4M6XA 2OBPA 3RKXA 5DUKA 4ZYEA 2BSWA 4M74A 1FOKA 3LA7A 1O3RA 2HQYA 3ZZIA 1Z1DA 4NB5A 5FD6A 3ZQ7A 1BI3A 3C7JA 3DDDA 3RI4A 1OMIA 4KT5C 2H09A 3GZ5A 1BI0A 4ZYGA 2CW0F 4XSZF 2R3SA 2G0BA 2LNBA 1RIOH 2P8TA 1TW3A 5TRDA 4PDKA 2MBFA 2DK8A 3I53A 3ABTA 3G3SA 3FXRA 2F5EA 4RGUA 2DQLA 2XRNA 2PDOA 3FBUA 3K0LA 4KIGA 3BPXA 3F72A 1W7PD 2D1VA 4IHTA 1KZFA 2DK5A 4LJZF 5ILSA 3GFMA 2ISYA 2V1UA 2FSRA 1USTA 4RB3C 2RDPA 4A5NA 1MDMA 2UWMA 5BS6A 4U7DA 4CRZB 3IGRA 5K1YA 1P4NA 4Y49C 2O8XA 4II9A 4ORFA 2CWEA 3ZMVA 1MGTA 4EJTA 4J3GA 4WF2A 3RIRA 3DR6A 4KVME 4ENNA 4XNHC 4YIIA 3S6HA 2JT1A 4FHTA 4L5JA 3T0YA 2ESHA 3CXQA 3E6MA 4MY3A 1BC7C 1M1DA 3SZPA 4UBRA 2CQKA 4IRGA 1BM9A 4WXDA 2EVNA 1U5TC 2B3UA 4IJAA 1KA8A 2COMA 4ONUA 1G3TA 4OIOF 3RKWA 4R9MA 1ZLJA 1W7PA 2ZPAA 1IUYA 1HXDA 3K1PA 3FXUA 4QBJA 4KOWA 4H6UA 1CF7B 3FM5A 1JGSA 2QECA 4LX9A 4ZH4F 4ZYDA 4EJOA 3AAFA 2TDXA 1D8JA 4NQWA 4XPLA 3RKYA 4MGRA 2A6EF 1HW1A 4U9ZA 3TDZC 2CGPA 2DTRA 2P4WA 4HBLA 2P7CB 5KTDA 5ICFA 2D45A 3F8MA 3LQQA 3BOQA 4UWJA 5D5XB 3IKTA 1ZHFA 2WPWA 3O3KA 4RAZA 3BJ6A 5LBQA 2ISZA 1YGHA 2NAZA 4ENKA 2F5FA 4ZBGA 3WG9A 1MK4A 5HDKA 4LFUA 4OINF 2M30A 1M4DA 1Z4RA 3JUWA 3PZJA 3R9EA 4KFCA 1YW8A 3H3ZA 2JPCA 1YIOA 1F9NA 3ELKA 1IYKA 3OV8A 4I02A 4OMYA 2VE9A 3I58A 1FYLA 2FF4A 2MD5A 2CNSA 2Z33A 4JK1X 1VHSA 2LKPA 3QAHA 4IRIA 2FL4A 5DDGA 2OH1A 1BN5A 1BIBA 4KVXA 3LAJA 1HQCA 5DD8A 4RGRA 3E5UA 4XPDC 1WK4A 5E1XA 1UFHA 2W85A 4MHGA 3OOPA 3N4MA 1R36A 4BHPA 2J5PA 2PBIA 5LRSA 1OYYA 5E1ZB 4R57A 2IW5A 2PJPA 2YX4A 4B8XA 4OADA 2BEIA 4S05A 1QGPA 1XDUA 4O5VA 3WE2A 1SFXA 3ECOA 5I0CA 5D8LB 4HX7A 5EEGA 2DU9A 5HDGA 1QSOA 3EETA 4BAYA 4GYIA 4JXRA 2FBIA 2VZYA 2ATRA 3QOPA 3BJOA 4IF4A 3P2FA 3VOEA 2A68F 3CUQA 1K7AA 2HQRA 2VC1A 2FRHA 3E97A 2QQAA 5C88A 4OIRF 3KP5A 1P2FA 3C1DA 3J81Z 2VQYA 3GEZA 3F8FA 3I64A 2VE8A 4HA8A 1J2XA 2L4AA 1S7FA 2VN2A 5IB0A 1BI1A 1LNWA 4ENJA 1HKQA 5DCMB 1TW2A 3DF8A 5HLGA 4KDPA 5KTAA 2XAFA 1IN5A 5LEKA 4G94A 2FE3A 3ERED 2EA2A 2IA1A 2Y48A 1XGOA 1J9IA 2RGVA 2P5LC 4CDGA 2Q04A 2V1XA 3E5XA 5D5WB 4KIFA 3GXOA 4BHBA 3MZYA 2KJBA 2D2WA 2X4HA 3BROA 1IN4A 4N9HA 3EYIA 3DPLC 2EFPA 4F6AA 4BH9A 5F48A 1PUEE 1XGNA 1M4GA 3HRMA 1GVJA 1YQAA 1NHAA 2YU3A 4WX9A 1XMTA 3K1NA 3W6KB 2PR8A 4O3MA 2HFHA 1M44A 5AONA 2VI7A 3COAC 1S7OA 4HX8A 2D4OA 5ICCA 3EUHA 2KIFA 4CRYB 3GVAA 1IZ1A 5EEHA 4CAVA 4HDUA 2W24A 2VONA 2ZCWA 1ZLKA 3T8TA 5D5VB 5CVJA 4MJ8A 3EFAA 3FHZA 4JD6A 1G6NA 4M73A 3U2RA 2ZBKA 1T2KA 3KEOA 2OAZA 2Z3YA 1Y9WA 2HWVA 3W6JB 3I4PA 4Y13A 4HNWB 3KFWX 3ZMUA 3KP4A 4AVAA 1K78B 2P6TA 3HRSA 3LSTA 5CVUA 2EV6A 2H6CA 2FXAA 1M4IA 3DNSA 1EV7A 2XAHA 3KLOA 1FLIA 2Z9OA 3MQ0A 5KVRA 1YR0A 5DWNA 2FQ3A 2BGCA 3PQJA 3D3SA 1U6GA 2JTVA 4UVAA 4LLLA 3GFLA 1OR7A 2ZMEA 2WWYA 1MKMA 4I7HA 3N97A 1J4JA 1R57A 2YR2A 2QYOA 2LF7A 2G9WA 2PSWA 1XIXA 4QC6A 3W6SA 2ZW4A 2B5GA 2MLKA 1G3YA 4N0BA 1QZZA 4EVIA 4FX4A 3QU6A 3Q9SA 2XUBA 1XEBA 4U5YA 2A3SA 4YGOA 3FWEA 4G9YA 4MBUA 4RB2C 4GCVA 2Q0OA 2DT5A 3CJNA 2RV8A 3KP3A 3IHUA 1U8RA 4ESFA 3W6XA 1JHHA 2QQBA 3CO7C 1KYZA 1IN8A 3CDHA 2DW4A 3HOTA 5CVRA 4KOVA 1T39A 2VBWA 4M6YA 3ULQB 4IUSA 2HTJA 4HF2A 3V7RA 3V8JA 5DYMA 2XAGA 2H6BA 2C6YA 3ZN0A 5L3CA 3IL2A 3DR8A 2A6HF 1YLFA 4JQFA 2FIWA 6PAXA 1MJ9A 4HAMA 2RN7A 2GA2A 2KJCA 1S3ZA 4PCQA 5L3FA 2OA4A 3T9YA 3LA3A 1SD4A 4WWCA 4P9FA 1S60A 4JBAA 4XBFA 4HW0A 1XD7A 2QIRA 2XKPA 3MCZA 4F0YA 4MEYF 3CXPA 2L3DA 4YG2F 2Q4VA 5F64A 5LGUA 5BMZA 4HF0A 4LB6B 2ETHA 1V0CA 4HX4A 3BJ8A 4PV6A 3SZTA 1XGSA 4RGXA 1TNTA 4Q48A 2DQRA 1IAWA 1J0RA 1FPQA 4LLNA 4PK2A 3HSEA 2HS5A 1ON0A 3ZPLA 4L89A 1RZ4A 3J80K 1ZRFA 3S6GA 4G6QA 3ECHA 3R0AA 2IA2A 3HHHA 1V4RA 5HOOA 1T0FA 3BJ7A 2W57A 2PFBA 1FSEA 2QBYA 1OPCA 2MH2A 3T8RA 4CGZA 2ADUA 4MNUA 2VC0A 2B0LA 1J5YA 4FD4A 1B4AA 4R1HA 3F8NA 4PSWA 3DQVC 4R3LA 2E1NA 4EM0B 2GWRA 2F5DA 4Y49B 3FX3A 2QMLA 4UA3A 3F5BA 3MGDA 4HYEA 4PZJA 3IWZA 4IF5A 1XB4A 5GCNA 3L09A 2P6GA 5K5OA 2CY2A 4OIPF 5HLIA 1O7FA 2PG4A 1P6RA 1IXCA 1Z6RA 4EGZA 1QPMA 2HKOA 3K2ZA 3GZ6A 5DUIA 3U1DA 1XGMA 2H5MA 1K4JA 4KNYA 1Q2YA 2EFQA 2UXNA 3NE7A 4JWPA 2IL4A 4IXAA 2BYVE 4A6DA 5K5QA 3ML6A 4M9ZA 1ZYRF 2MLGA 1IB1E 4OLLA 5E1WA 5ICGA 2UZKA 4KN7X 2FIAA 2GQQA 3F8CA 4ETSA 2XVCA 1R58A 3KZYA 4I09A 1KQ8A 2PMUA 4F7ZA 3BZ6A 1XMKA 1ZREA 2PC1A 1YX0A 1R5GA 3EXNA 3JVNA 3N7ZA 4L9JA 3EDPA 4LMYA 4BNCA 2EFOA 3K9UA 1NMTA 3G3ZA 3FXQA 4HOBA 2PMHA 2MH9A 3DP7A 4H6ZA 2H94A 1IRFA 2AE6A 2PRBA 5LHHA 4KLVA 4KUBA 3ZN1A 3WGIA 2LSOA 3F6OA 4QWQA 1F4KA 4WCGA 2JRTA 2QLZA 3R0JA 4RAYA 4R3KA 1QZYA 1C0WA 4BXUA 3T90A 1G3WA 2QQ9A 4UVCA 5IT3A 1BOBA 1ZG1A 1SMYF 4I49A 1ZG3A 4CAWA 3LAPA 1O3QA 2CNTA 2ZXJA 4UHTA 1LDDA 5CLSA 4L9NA 1R1UA 1YFHA 2Q4YA 3OWCA 4Q4ZF 1IW7F 3TKYA 1I27A 3PP9A 3S6KA 3SQNA 4EM1A 1BI2A 2OZ6A 2EWNA 4Y15A 1K6OA 4KIBA 1TQIA 1WKMA 4HNYB 4UV8A 2G7UA 2K5TA 2V79A 1QO0D 2XHKA 2F5CA 4KZTA 3U9GA 3R9GA 5CVIA 4UWIA 3CO6C 3RJPA 5D4SA 1CF7A 2A61A 2EFNA 3F8BA 4CO8A 4KICA 5A2QK 2VOPA 4KYWA 1XSDA 4UUVA 1A04A 4UV9A 3GWZA 4AIJA 4RS2A 4RS8A 1YG2A 2G3AA 5EC4A 3TOAA 2LDUA 5DEQA 1HKSA 2M5WA 1J75A 4OU0A 2GE3A 4EM2A 1IXRC 5J6XA 3C26A 3WTZA 1HW5A 1Z05A 3VFZA 2M1BA 4RGSA 3TO7A 2O28A 2MC3A 3KLNA 2BV6A 3DEUA 3RYPA 3LQRA 1CM0A 2VOOA 2PN6A 1WSUA 2CFXA 3FM3A 5E8GA 3MFKA 2EFWA 1UCRA 2WC2A 3TTHA 4QUSA 3KCCA 4A5MA 1JHFA 3GYHX 5D4RA 2NS0A 2Q8KA 2JLMA 2Z11A 3PGPA 1Y9KA 3R96A 3WTWC 2K4BA 3QPHA 4PGGA 3CXSA 3J80Z 1JXSA 4EQQA 1P0HA 4K30A 2QVOA 2ZNYA 1B87A 1ZRCA 2DLLA 1FT9A 4P5OA 3ISPA 3D2MA 4NCZA 2J8NA 3H92A 3WTTC 2J5OA 2Z5UA 3PQKA 3L9FA 1USSA 3KEQA 4LK0F 4B5OA 5BPDA 5K5RA 1LEAA 5KTCA 3HRTA 2VBQA 1I1GA 2HTSA 1ZH5A 4AVCA 4FX0A 2YSRA 1FYMA 1YS7A 4M71A 4L9TA 3SHFA 2GXGA 1B1BA 3KKWA 3P2HA 3UY5A 3BPVA 1O7LA 4LG0B 1KQ0A 4G7OF 2ZKZA 3IRQA 5DCMA 1YYVA 3BDDA 4N9IA 4U0VA 3MZHA 4Z2YA 4X5KA 1TQMA 1B9NA 1FBSA 3HRUA 2MA3A 4L8AA 4HZFA 4L9VA 3P9KA 2G3TA 4EJVA 3F23A 3EO4A 3KP6A 3KETA 1W5TA 5HS7A 5E18F 4KUAA 2JDDA 4OAEA 5H86A 2B4DB 4I0BA 5FGMA 3I9SA 2W84A 1V3FA 2ZW5A 3QP6A 3E6CC 4M72A 2VBZA 1Z91A 3L7WA 1QSTA 5H84A 3V8KA 2RC4A 3LD2A 2P5VA 1LRZA 2STWA 2ZW6A 3TCVA 3JTGA 2R7FA 1IRGA 2OU2A 3VODA 3TDUC 1QSMA 3JSPA 4MI4A 2M8EA 3T5XA 3VB2A 1FYKA 1ODDA 1LVAA 2J8MA 1LEBA 2V1DA 1GXQA 1GXPA 4M3SA 4I2OA 4M9SA 3F3XA 1YW7A 1IF1A 3SXYA 3O6BB 3HYIA 2HR3A 5IT9K 1EH6A 2FE7A 3CUOA 2A07F 3D0SA 1Z7UA 3WTVC 1S7LA 1UHMA 2RNJA 2GANA 3LA2A 2ZFWA 4CXFA 1XSXA 1O57A 2Q44A 2QENA 2L4MA 1WI9A 3R95A 3BLNA 1WWXA 2P0WA 3CUQC 4NSQA 1PU9A 1OYIA 1TTYA 3WGGA 2ZXVA 2STTA 5F46A 3HHGA 1K78A 3GF2A 2GA1A 2JEVA 4KOYA 1Q1HA 3R61A 3ZMSA 5BQTA 1XSVA 4HV6A 4E2AA 2DBBA 4CHUA 1PUAA 5JI6A 3M9AA 2EK5A 1CJWA 4EV0A 3DV8A 3R4KA 3Q9VA 5A2QZ 4GGGA 2XGXA 1H9GA 4UXNA 1MD0A 4YFXF 1KU2A 5H6RA 5DD4A 2B4BA 2PR1A 1KUYA 3EYYA 4PK3A 4IPAA 2AXLA 3FXTA 1EH7A 2D4PA 5JPHA 3HOSA 5BPIA 1P4XA 5TJJA 2LF8A 4HLYA 1Z4EA 2EV0A 1S29A 1FC3A 5DCFA 3QP5A 2AS5F 3HTUA 3GLXA 4L0ZB 1B6AA 4QVTA 1TLHB 3H4QA 4S04A 3FYNA 2G7HA 3QPTA 2O61A 2ARHA 3DXJF 1LDKB 3M1EA 2B3VA 3RDIA 1O3TA 4FT8A 5HS9A 4B5PB 4R8HA 3LWFA 1F1ZA 2I79A 3NQOA 1S3JA 1S7KA 1T38A 1UHWA 1D8KA 1ZARA 3WODF 3W91A 2HZTA 3WE3A 4RB0A 4AD9A 3I54A 2R8VA 1BO4A 1L3LA 5CVVA 3V8IA 3C3WA 1BC8C 3RYRA 1U78A 4Q47A 3SHPA 1SD6A 5HS8A 3F21A 1WRJA 4LB5A 3TO9A 2CSOA 4M85A 1ZN2A 4BQAA 5FFZA 4YFKF 3FMRA 3ROUA 5F47A 3IKVA 2K86A 1XCBA 1R5HA 2BBYA 3K69A 1X3UA 1S6LA 1HBXG 2V6CA 2HUZA 1U6MA 2UXXA 3SXOA 3KP2A 4FD5A 3B8GA 4E0AA 2DO7A 2VBXA 2RQPA 1W4MA 4XSXF 3ZMZA 4ASNA 2Y75A 1SFUA 1D5VA 5AIPA 4R79A 4HKFA 2E7XA 3GFIA 1P4WA 4YFJA 1H0MA 2ZNZA 4U0YA 1N71A 1R22A 1VKCA 4HV5A 5KK1A 3WGHA 4XNHB 2VT3A 2O3FA 2PI0A 1ZGJA 2L02A 4NHJA 4U7BA 2VT2A 4EVYA 1HSJA 3E3VA 1VTNC 2KIUA 3GO5A 3I59B 1L0OC 4QLCU 2JDCA 4A0XA 1R00A 5CNPA 3HUGA 1TQPA 1U5TB 1GHEA 5H6QA 2IT0A 4O6JA 1KU9A 2IPQX 2OZUA 2QZ8A 4UNOA 4CYDA 2BUEA 3T1BA 3KE2A 4CICA 2F5IA 4MQ9F 3GFJA 1KYWA 5LGNA 2IA0A 4D0PA 4AB7A 5HMNA 1LDJA 2PQ8A 2Y0MA 1IICA 5LLQA 4IVNA 1XCVA 2XASA 1PDNC 2WV0A 4YRHA 2DPUA 2BEOA 1S7AA 3K1MA 3M8EA 2GXBA 5IT9Z 1I5ZA 2VODA 4GYGA 5D8KB 4KMFA 3F6VA 1G3SA 4XLPF 3B73A 2AJ6A 2KKOA 4P9UA 4DNCA 4GO1A 1UB9A 4KN4X 1SQHA 2ESNA 3ZMTA 2FA5A 1MJAA 4HDVA 1PP8F 5HVQC 4JLYA 3BWGA 4DQ2A 3TQNA 1R1TA 3S2WA 1REPC 2FS5A 1MDMB 3R1KA 3ZMDA 3Q5FA 1RI7A 5ERIA 1G4DA 2L54A 2VBYA 1I6XA 4I01A 4JXQA 1Q2CA 1GHCA 3IRRA 1TBXA 1ZG5A 1FY7A 2K4JA 4A0YA 1BOAA 2L01A 3LFKA 4XPDB 4KLWA 3EQLF 4G7HF 5FLXK 1FBQA 3WTYC 1B9MA 4MEXF 4A2UA 4CZZA 2REEA 3JAMK 1KGSA 3TE4A 3SFZA 2D1HA 3WR7A 4KMUX 4WXHA 2P6SA 2VXZA 3V4GA 2DXQA 3VEPA 2FCKA 1YK3A 5FB2A 4LLGF 3B02A 3SXNA 1U2WA 4KUMA 1W7PB 4OOIA 1AWCA 1IIDA 2VEZA 1CGPA 5F6FA 3E0KA 2A4NA 2IVMA 3GYAA 1YVKA 2KCWA 1FWZA 2K7LA 2FMYA 3GY9A 2JZYA 3TT2A 1BJAA 3P9IA 3IC7A 1FP2A 1YLEA 1TNSA 3GW2A 2XAQA 5ICEA 3RPQA 1XE4A 4ZYHA 2NMTA 2GIVA 3EY5A 5IX3A 2JSCA 2P6EA 1NSLA 2HEOA 2K27A 1SFEA 2NNYA 1S5KA 2FSWA 4U9YA 2V9VA 3WTUC 1FNNA 1YTYA 5F49A 5IV0A 3TGNA
chains in the Genus database with same CATH superfamily
2UV1A 2WAQA 1BR2A 5CJ9A 3GBGA 2R7DA 4LG3A 5FVJA 5L3DA 3TFYA 2QGUA 4B09A 1ONVA 2ZFUA 3FHNA 4UUTA 2R7UA 1U5KA 3GTMJ 4EJWA 1B59A 4Y17A 1FP1D 5DS0A 4ZZLA 1T6SA 2HKXA 5ILVA 3VWBA 4R87A 2ZO4A 4XLNF 2SGPI 1R1VA 1Z5RA 2ZEDA 5LEJA 3RPUD 5HVHA 1DP7P 2XKOA 2HB6A 1Z9CA 2E1OA 1CBXA 2F2EA 2DOAA 1CPXA 2HDCA 1QNTA 3JSOA 3FRMA 3RYOA 5IYCJ 2K9LA 1DUXC 3KHXA 2EJRA 2WA0A 3I71A 2KLOA 3P7NA 3H3VK 5F0FA 1GYTA 2R7HA 1EF4A 1R23A 1ZRDA 4CAXA 5G20A 2ARPF 5CPAA 3D4UA 2EZKA 2YPRA 5KAIC 1FSHA 3QYEA 3QWLA 4OMEA 3J7AO 2R98A 1E2XA 3IWEA 2CG4A 5E20A 4RI1A 3RZAA 5IYBJ 4H89A 1IN7A 3S15J 4L18B 4L9MA 4BHCA 3FBIB 3V38A 2Q0YA 1ZG8A 2QWWA 2PJAA 1U0JA 3LODA 4DW6A 4EGYA 4UEZA 4A0ZA 2RAEA 5EGOA 1RETA 4AIHA 1B8IA 1TGSI 3NRVA 4CGLA 5D5UB 1D5YA 3PO2J 2JA6J 1KU3A 3RSNA 2HNHA 3MEXA 3H1CA 4A94A 2ZJ2A 3FMQA 5AIQA 2OR4A 1HLVA 2KMOA 3BJAA 2LTPA 2EIJH 1IXSB 3FZVA 2LRDA 4U88A 2W25A 3SGQI 3G8WA 2DJNA 5FD5A 2GVIA 2XGCA 4LD5A 2JSPA 3M07A 3LSIA 3PFIA 4G6TB 1FBUA 2OQGA 4LG0A 2CMPA 1WWZA 2FNAA 2CO5A 1O4XA 1ULKA 1FIAA 4GXOA 4RB1A 1A2ZA 3CPAA 4BQOA 3GTJJ 1CX8A 3GUDA 1N78A 1Z6TA 3KYLA 2V8DA 3ZJ0A 2HPIA 3HTSB 2NYQA 4BYYA 2VXDA 5FFXA 3S9NA 1BJZA 1FEXA 1OCCH 2F5VA 3QTLD 2IXSA 1W5SA 1L0CA 2X1DA 3JW4A 4FD6A 1XN7A 4UFWA 3RQIA 3OYLA 2QPOA 5K7HA 2EUIA 2JPBA 2ZOGA 3PFEA 1DPUA 2VZZA 5F1RA 1N25A 2DA3A 2XC7A 2A69F 3KZZA 1QQIA 3S17J 3SDGA 1YREA 2OZHA 3D00A 5KAFC 1K7TA 3W2WA 2ANPA 5LHIA 5J47A 2XSJC 1V5EA 4EJUA 1GV5A 1QBJA 3DLJA 1X1PA 3CUQB 3KQXA 2CFOA 3TC8A 5D6EA 3V8LA 3RPUA 3WU0A 4YU9A 3ZQLA 1S8NA 1RTQA 3SI0A 1LQ1A 1KBFA 5HVFA 4CS0B 3GKRA 1FZPB 4B6DA 2FOWA 1UJ8A 1YOVB 3B6AA 3ABUA 1ZELA 1LR7A 2JJ7A 2KISA 3FEDA 2KIMA 1YO5C 1D1CA 1BMOA 2ZW7A 2KRFA 2HQNA 2B4DA 4B14A 5J8CA 4BMHA 3FF5A 1XDSA 4B3XA 4JJXA 4GS4A 3DPUA 2V1CA 3BTJA 3E2IA 5E3QA 4ZZDA 1VQ4I 1QSRA 3IV5A 2O0YA 2CNMA 5JGFA 1V5GA 3D8PA 1FOYA 2ZEOA 4ESBA 1LUJB 4F93B 1U9NA 2L9RA 4XLFA 3QNVA 2IP2A 1OVOA 1SD5A 1IYLA 4R6TA 3TW6A 3WTSC 4GRIA 1SEUA 4HF1A 4KSAA 4P96A 2XROA 4XOPA 1IOFA 2DA4A 2CJJA 1IGBA 3L2NA 3GX4X 4E70A 4P55A 4AG7A 4ON0A 3K2AA 5J4YA 1XF8A 2ZOFA 2LVSA 2VKHA 3IWFA 1S5LC 4FETA 4RM3A 3H3UA 3DFGA 1ACIA 3GTGJ 2IJZA 3JREA 3LOCA 3I3LA 5JR3A 3F8KA 4X1EA 4NNJA 2HOEA 3BZKA 2PJ6A 5A27A 2BL1A 4Q5SF 1OYWA 1U3EM 4A3MJ 3K4JA 1ZAOA 4PXDA 2NYXA 4ENMA 4JX6A 1Y8FA 3BQZA 3HKZA 1FX7A 1RKWA 4BEHA 4AM3A 3FB3A 2QUFA 3CP8A 1HSTA 1IN6A 2W48A 4MTEA 1KQ9A 3TO6A 2VRWB 4CGMA 2X48A 1J59A 4UUSB 1LJ9A 1ULYA 4WJBA 2L2OA 3ISZA 3IWGA 2H27A 4HLXA 3R9FA 1TZLA 5HH1A 1I3QJ 5LRRA 1WJFA 4DYCA 2E73A 1MH4A 1TBQR 2VJ4A 2ZB9A 1JE8A 2M2EA 2HYJA 2ENNA 4A31A 2YX7A 1R4MB 1S7NA 4LGWA 5L3EA 2PEXA 1OZPA 1TIQA 3R60A 1D0ZA 4IAVA 2BVMA 2KZGA 3M7GA 3UGIA 3S6FA 3S2DJ 1WGTA 4UCMA 3HSFA 4I0AA 2CQXA 3I5UA 2B58A 3F0AA 3DTIA 4F52A 1IRZA 2PJ1A 1Z8WA 2P6FA 2XDVA 4KOXA 2FBKA 3E6DA 3CMAI 5BOXA 3W2AA 2JVGA 2IS2A 2QKLB 3QB8A 3BG3A 1ON1A 3DSBA 5F0CA 5L3BA 3CLOA 5E8IA 3O8HA 3PIOF 3M1CA 1IDZA 4JCVE 1JQGA 5IOYA 5ISVA 3MWMA 2HYGD 2FMLA 2NNNA 3IAM2 4NXYA 1HDQA 1NG7A 2WTEA 3DBLB 2EINH 4JYKA 1RO5A 4MFLA 2LP0A 2O6GE 2R1IA 3DEWA 4HQEA 4MCRA 2M87A 1RUNA 2RVCA 1BBYA 3DPTA 4M3FA 4C2TA 4A38A 4MTDA 2KHMA 4MQVA 4XKVA 1B6BA 2FT0A 3ZOBA 3QU3A 5FLXZ 1D3YA 2LC2A 2X0LA 5LHGA 2NRAC 1VHEA 4OIQF 3H5RA 4BJ6C 1RNLA 3PNVA 4HQMA 1FIPA 3JAMZ 5DWMA 1Y0UA 3VYRB 1KUXA 2B8TA 2HI3A 4TV7A 3SJGA 2QM3A 3CP2A 1KUVA 3SEQA 2LKXA 3OYFA 2CWFA 4BINA 4C3JJ 3BJIA 3TBIA 2VXKA 1FT7A 2BE5F 4EMSA 4YFNF 4S0HB 1Y7RA 2Z10A 3ZP5A 3VYUB 1UELB 2DKVA 1H9TA 4LITA 2ACJA 1XX6A 2WB1N 2K9HA 2X7BA 2BY3A 2CU7A 2CV1A 3BI0A 3VPRA 4SGBI 3REOA 1MJBA 1SMTA 2MW8A 3ZQQA 3OYKA 2VPRA 1AOYA 4MY0A 5IPAA 2FNPA 1LCPA 2XRCA 3BZCA 1KU7A 2J8RA 3KP7A 1IUFA 2J87A 3W2VA 1ON2A 3MAJA 2KP6A 3AL0B 4H0EA 1STZA 2EBJA 1I6HJ 1YS6A 4A3JJ 3G2BA 1ETKA 4U0WA 3SZGA 2JA8J 4WK8F 4IHSA 1I1DA 4NJRA 1OMUA 1QPIA 4LOCA 3RBUA 9ANTA 3CTAA 1ZO0A 2FEZA 3S3NA 4EATA 3DU6A 3E6BA 3OYGA 2VJJA 4KA4A 2ZMEB 1IC8A 1DDNA 1PJUA 3MEKA 3AFHA 2RKHA 4D1QA 4IRHA 2BW3A 5L3GA 3K2KA 5AG5A 3P9CA 2GZWA 5ED4A 1RXTA 2XPWA 2EA4A 4BY7J 2Z0ZA 3WU1B 4WXCA 2ECCA 2K9SA 2OD5A 2F4OB 4G8XA 2ELHA 2B63J 1SD7A 3IFEA 4A69C 1BW5A 2B5GB 3HOVJ 3A01A 3HGGA 1T98A 2R5ZB 1SAXA 3ASNH 2PLYA 4JX4A 2Z99A 4B5PA 5HDNA 4G7ZF 1RUOA 5CPRB 1SFOJ 1MBJA 2GLOA 2V8GA 4XPKA 3JTHA 5EJCA 1J7KA 2PJRB 2M45A 1A5JA 4HNXB 2EV5A 4M3GA 2IMOA 4PGHA 3NFZA 2WSAA 2I5UA 4YIFA 2QF7A 4BS9A 1BIAA 4AWXB 4ESJA 1IG7A 2HV2A 3FNCA 3EC4A 1E0EA 1IW4A 3FIXA 3E5QA 4K2EA 4QPOA 2E7WA 2OZGA 1WQ2A 2P7VB 4RM2A 3CF5F 4AVBA 5LGTA 4FUUA 2ZEEA 1HW2A 1OCTC 3D5RC 4FAIA 3BTCA 1RC9A 2W82A 4I98B 4CPAA 4U87A 3M3YJ 2DFIA 1I21A 4PXBA 4LUAA 4Y4RA 1DPRA 3I0TA 1XMAA 3HIFA 4NF1A 2XIGA 5M5XJ 1YW9A 1R7JA 4HNTA 3HOWJ 1WTJA 3TOBA 5D6FA 2HGCA 2GAUA 1UFMA 1LB2A 1CHOI 1G59A 4MHNA 3AG3H 1IJWC 1OKRA 4AVPA 3WTXC 1NE9A 2Z1DA 5DV5A 1SGPI 2V8VA 1R4NB 3KYCB 4D5CA 2IAIA 5FKMA 4A3DJ 3UGLA 3U1KA 4HPQA 2DA1A 2F6CA 2DAOA 5EMIA 4EWTA 4UVBA 1Z9UA 3B7IA 2G0EA 2OB0A 4KOUA 2FOKA 3DTEA 3FVLA 1Q2DA 3M8FA 5JVTA 1P92A 4M6GA 2DI3A 1BR4A 3R5AA 1MIJA 1W1WE 3MN8A 1QSNA 5E17F 1TWFJ 2SGEI 1LKXA 4AUXA 3VDUA 4L5IA 4XNFA 2FXFA 3J7ZI 3BP8A 3V7SA 3C18A 1NH3A 3VWEA 3R6SA 4Y7NJ 1Z21A 2Y9ZA 5E96A 2Y30A 5CYVA 3V7ZA 3PSFA 1AHDP 1WJEA 3BY6A 1ZLHA 4DYOA 4CGNA 3G73A 4F8ZA 4XOTA 3NEUA 2K5CA 2R5YB 1MMDA 2O03A 3D5LA 5EBVA 4R8FA 2HU9A 4M6IA 3GTOJ 2QQCA 1FTZA 4KOTA 2OPTA 2FBHA 3I3GA 3D2PA 4IEJA 1P4AA 2Y31A 2E1CA 4A6EA 2NU2I 5EG0B 1R0RI 1F2OA 3ERMA 4M3EA 4AIKA 3CD6I 1T33A 4AU7A 5J8FA 3L2CA 2YUSA 2C27A 4QB9A 1LR9A 2IRFG 2WZNA 2DOEA 1YE9A 2BHZA 1JI8A 1CGJI 4TNUA 2WAFA 5JHUA 4G6DA 3UEYA 2CYYA 3PUFA 2EB7A 2CUJA 2Q7BA 3DKWA 3CJRB 1FOXA 2GLFA 2REFA 1Y8RB 4MFDA 3CMEI 4E8OA 2DPDA 2QBYB 1WJDA 3FMSA 2IJLA 2R7TA 2A5YB 4D9JA 5CCLA 1YVOA 2XV4S 3CC4I 1NSAA 4ZY0A 2XAJA 4PSXA 4A12A 5HLHA 4AG9A 4E7SA 2HYFA 2Q2EA 2KIQA 4XRFA 4FD7A 3L00A 4HNVA 2OQRA 3KPHA 4LK1F 4MHDA 3K9TA 1DE4C 5FUYA 3RTRA 2BXYA 4BDZA 2LD5A 1F5TA 2C1CA 1S7EA 4M9XA 2ZJPF 4NGQA 2FU4A 3HSRA 3LSJA 1ZGWA 5JFRA 4OMZA 3QRFF 1BPMA 5K8PA 1OCPA 4KOSA 5FO5A 2AFSA 4O23A 1EH8A 2IBDA 2X1EA 3I59A 3IH2A 1VZ0A 1I1SA 4A33A 5JQ4A 2P5KA 1PP7U 2R7OA 3L1PA 3VWDA 1GUUA 5H20A 1PUFA 2WPXA 3HOXJ 2K02A 2I00A 1W4RA 3D7GA 3OYMA 2QSGX 4L0YB 1I12A 1U5TA 1K79A 2DA2A 3O2PE 4OAYA 3B3CA 2A20A 4G1PA 4KVOE 1O3SA 5ILUA 1HKTA 1E17A 4KORA 1ZGAA 4XICA 3J81K 3F22A 4NEXA 4RDUA 1MZBA 2M5XA 3V7CA 3RU0A 2D5VA 4KISA 4M6XA 4XKCA 3FXJA 4OKOA 3OY9A 2OBPA 4MFZA 3RKXA 5G22A 5DUKA 2NU0I 4ZYEA 2BSWA 4M74A 3ISXA 4PQAA 1FOKA 1QA6A 3LA7A 3ZGKA 1O3RA 2HQYA 1Z1DA 4NB5A 2RIJA 3ZZIA 2LMDA 5FD6A 3ZQ7A 1BI3A 1WJCA 2OCCH 3C7JA 4BJ5C 3DDDA 4A3BJ 4XK4A 3DGVA 3RI4A 3VDPA 4XLHA 2VQCA 4RA2A 1OMIA 2JA2A 4KT5C 2H09A 2X52A 5BWAB 3GZ5A 1BI0A 4ZYGA 2CW0F 4XSZF 4HPSA 2R3SA 2G0BA 2LNBA 2GIZA 5EYRA 1RIOH 3VARA 2P8TA 1TW3A 1LFBA 5TRDA 3JR9A 4MIMA 4PDKA 2BY0A 1HDUA 2MBFA 2DK8A 2OJED 3BTIA 2O7OA 3I53A 2K3FA 2NS7A 3ABTA 5FUWA 3G3SA 3FXRA 2F5EA 4RGUA 5CQEA 2DQLA 2M4GA 2XRNA 2WYRA 2PDOA 4C2YA 1HOMA 4ZX9A 3FBUA 2CH0A 3K0LA 4KIGA 3BPXA 3F72A 4A30A 1W7PD 4FKDA 3HGYA 2D1VA 4IHTA 1KZFA 2DK5A 2ID6A 4CCMA 2JW6A 4LJZF 5FKKA 5ILSA 5JVGF 3D67A 3FIWA 2ISYA 3GFMA 3LSHA 2KMPA 1RFHA 3OSFA 3GTPJ 2V1UA 2FSRA 2V1NA 1USTA 2GREA 2O4HA 1BUSA 1WGXA 4RB3C 2RDPA 4A5NA 2EO8A 4CYOA 1SGDI 1MDMA 2UWMA 4H2KA 5BS6A 1IY6A 4U7DA 1YLOA 4CRZB 2KMQA 5EEAA 3IGRA 5K1YA 1P4NA 4Y49C 4XRMA 1KWMA 2IS4A 2WADA 5J1YA 3CDXA 2O8XA 4CCNA 2IQ6A 4II9A 2CWGA 4ORFA 2JUGA 2JBKA 4BE1A 2CWEA 4MXUA 3K70C 3ZMVA 2O5RA 4XONA 4XR6A 3S16J 2X6WA 3HB9A 4ZTFA 1MGTA 4A3KJ 4EJTA 4J3GA 4PXCA 1TWAJ 4WF2A 4FCYA 3RIRA 2XF7A 1W36C 3DR6A 4KVME 1SVLA 4ENNA 4XNHC 1UMQA 1CT2I 1CP6A 4YIIA 3JRCA 2LBFA 3S6HA 2JT1A 4FHTA 2R7SA 3CDIA 1VFCA 5E3PA 5HQ8A 4L5JA 4BE2A 1G2HA 1XA6A 3WABA 5J1RA 2P81A 3BLYA 3T0YA 2ESHA 2N8GA 3CXQA 1VIXA 1ZKGA 2DTZA 4ZYAA 1LFWA 3E6MA 4ZDLA 4MY3A 2X6XA 1NG6A 2PMZA 1BC7C 1M1DA 3PNTA 3SZPA 1VQ8I 4C2UA 3PB8X 2QKMB 4BBRJ 3TP0A 4UBRA 2A6TA 2CQKA 2QVPA 3PJRA 3D68A 1AKHA 4IRGA 1BM9A 3K4LA 4A3GJ 2DA7A 1UVGA 5JLWA 4WXDA 3K10A 2EVNA 5GAHJ 3G71I 1U5TC 2EZHA 2B3UA 4IJAA 4ZDOA 3CMYA 2FVGA 1Z8LA 1KA8A 9WGAA 3SI1A 3KZIC 2COMA 2B9SA 1MMNA 3HJEA 4ONUA 1G3TA 3SJEA 4NUBA 3RKWA 3H35A 5J40A 1ZLJA 4OIOF 1Y7EA 4MFPA 1W7PA 3ZXSA 4R9MA 1R5ID 2ZPAA 1IUYA 4NGPA 3CESA 3BHXA 1HXDA 3K1PA 3FXUA 2XEFA 2G9DA 5CBMA 4QBJA 4OC5A 3U21A 4KOWA 4H6UA 1CF7B 3FM5A 1JGSA 2MFZA 3BR3A 2QECA 4LX9A 1X2MA 4ZH4F 4ZYDA 4EJOA 3AAFA 1IOIA 2TDXA 5CQGA 2NVXJ 1D8JA 4NQWA 4XPLA 3RKYA 2Z16A 4MHZA 4MGRA 2A6EF 2VKEA 1HW1A 4U9ZA 5E3MA 2HZDA 3TDZC 2CGPA 1MBGA 2DTRA 2P4WA 3CT9A 3RO0A 2KDOA 7CPAA 4HBLA 2P7CB 5KTDA 2E35A 5ICFA 3OR2C 2D45A 4F0XA 3F8MA 3LQQA 3BOQA 2SGDI 1H8AC 3CCMI 4XRSA 4Y33A 5D5XB 4DJAA 1YJ9I 3IKTA 1ZHFA 1JT0A 3GOXA 5A28A 1QVTA 2WPWA 3O3KA 2NVTJ 1CE3A 2I3CA 4RAZA 1WH5A 3BJ6A 5E79C 5LBQA 1PPFI 2AQEA 2ISZA 1YGHA 2NAZA 3OYCA 1NTCA 2COBA 5J1UA 4ENKA 2F5FA 1WKXA 1UUCA 2ZEGA 4ZBGA 3WG9A 4II3A 2VASA 4DYRA 1MK4A 4CYPA 5CCMA 2F48A 3IO1A 3PB6X 5HDKA 4LFUA 1YJWI 1UAAA 2PJ9A 4OINF 2M30A 3A2KA 1R43A 2SGQI 2OOTA 1M4DA 1Z4RA 1XMBA 3QPSA 3JUWA 3B3SA 3PZJA 3R9EA 4KFCA 4ZY1A 1YW8A 3H3ZA 4FTHA 1MBEA 2JPCA 1YIOA 1F9NA 3ELKA 1IYKA 3OV8A 3UNGC 4I02A 4OMYA 4ZX8A 2VE9A 3I58A 1QZEA 3VSKA 2ME0A 1FYLA 4DUKA 3MZ8A 2LOOA 1JKOC 2FF4A 4NGMA 2MD5A 1XOVA 2Z33A 2CNSA 3OYHA 3UGDA 3JRBA 5EX3A 4JK1X 1VHSA 2QJ8A 1CQTA 2LKPA 4M3BA 3QAHA 1BW6A 4C30A 1X1DA 3ZQIA 1VF9A 1JKQC 3OVOA 4IRIA 2FL4A 5DDGA 2OH1A 3PB7X 2FQ4A 1BN5A 4PFPA 1BIBA 3O8GA 4KVXA 5HLTA 3LAJA 2LY1A 1HC8A 1HQCA 3ZQHA 3BG5A 2EK9A 1IRXA 5DD8A 4RGRA 3FEEA 3E5UA 3ABKH 4XPDC 4XLAA 1WK4A 1N13A 1YX3A 2DA5A 5E1XA 4PPZA 1UFHA 2W85A 4MHGA 3GCMA 4II2A 1LPQA 1MNMC 1Q1VA 4D7MA 2PJ8A 3DTKA 4ZC3A 1M1EB 3H5NA 2HVQA 2HOAA 3OOPA 3N4MA 2E1MC 4IL6C 5M3FJ 1MBHA 1R36A 4BHPA 2YUUA 2J5PA 2Y2ZA 2PBIA 3B3TA 5LRSA 3OS0A 1OYYA 5E1ZB 2CQQA 4P6YA 4R57A 1ZTRA 2IW5A 3BQYA 2PJPA 2YX4A 1IU8A 4FE4A 1VHOA 2GOMA 2AO9A 3WHBA 4B8XA 5AG4A 4OADA 2BEIA 4S05A 4B44A 1QGPA 1S20A 2DMNA 1XDUA 4O5VA 2DMUA 5LRKA 3BC8A 1E3HA 1OCOH 2O53A 3WE2A 4EMEA 1SFXA 4ZY2A 3LSPA 1BR1A 2UZ3A 3ECOA 5I0CA 2E71A 5D8LB 4HX7A 2CTCA 1ETQA 1F43A 2VQGA 5EEGA 2DU9A 5HDGA 1W0UA 1QSOA 3PB9X 3EETA 4BAYA 4GYIA 4ABZA 2FBIA 1EE3P 2RFHA 4JXRA 2PIYA 3FSXA 2VZYA 3PFOA 4YWYA 4OC1A 1TF9A 3OR1C 2ATRA 2H8RA 3QOPA 2H8WA 2L5QA 5AG6A 3H36A 2HXIA 3BJOA 1CG2A 4IF4A 2POKA 1CGII 3P2FA 1MSEC 1LOKA 2AFUA 1OCRH 3VOEA 2A68F 1K6YA 4BGDA 3CUQA 1R49A 1P9ZA 1K7AA 2M7AA 4TWEA 2HQRA 2VC1A 3A0BC 4BACA 2FRHA 3E97A 2QQAA 3CCEI 1YITI 2BOAA 1PYVA 4P44A 5C88A 4OIRF 3KP5A 1P2FA 4IX7A 4A95A 3C1DA 3J81Z 2VQYA 1YRNB 2LG4A 2CTBA 3LFUA 4RUHA 2RB7A 3GEZA 4C7HA 4UXIA 3F8FA 2OUMA 3I64A 2VE8A 4FQGA 2ELJA 4HA8A 2GFQA 1J2XA 4AYBA 2L4AA 3ONQA 3C2BA 2VN2A 1S7FA 1VGYA 4C7IA 5IB0A 1BI1A 1LNWA 2BVLA 2X6YA 4ENJA 3ZQCA 3K4BA 1MMAA 1HKQA 3WC6A 5DCMB 1TW2A 2LLKA 3SJMA 4NGRA 1WHUA 3G6EI 2J9AA 1LVKA 3DF8A 4IHVA 5HLGA 4KDPA 4OC2A 4JX5A 5KTAA 2XAFA 1IN5A 5LEKA 5GTIC 3L2QA 4IQJA 4IHWA 1K4SA 2PJ4A 3B3WA 4G94A 5IP7J 3H8FA 2FE3A 4QSHA 3ERED 2O9LA 1DGWY 3W3CA 7WGAA 5JH9A 2EA2A 1X1AA 2IA1A 2Y48A 3FBNB 1XGOA 1J9IA 2RGVA 4RLFA 2P5LC 3R5DA 3FK7A 4CDGA 2Q04A 3B4VC 3P5JA 2V1XA 3E5XA 5D5WB 1XFOA 4KIFA 2MG4A 2KZVA 3GXOA 3K4NA 3IC1A 1RESA 4BHBA 3R5BA 3MZYA 3GTQJ 3JTKA 2KJBA 1YIJI 4F9VA 3DKXA 2D2WA 3HEFA 4UUSA 5D29A 1Z77A 4IHXA 2X4HA 3KR5A 3PNYA 4X6AJ 3BROA 3KY9A 1IN4A 4N9HA 3D66A 3CF2A 3EYIA 2P6AC 3X2QH 3ZCOA 3IJ3A 1YQEA 2L7ZA 3DPLC 4IKFA 3HH2C 2W1OA 2EFPA 4B12A 4F6AA 2N52A 2XF5A 4BH9A 2XB5A 1UWYA 5F48A 1PUEE 4OC3A 1XGNA 1M4GA 3HRMA 5FKNA 1GVJA 3JRAA 3H9GA 3IU1A 1YQAA 1NHAA 3NA6A 3NH5A 4LQGA 4PXEA 2YU3A 3CMMA 4WX9A 4DJLA 1V5FA 2EQRA 3BR5A 1XMTA 2HDDA 3K1NA 3W6KB 4BJTA 1R3NA 1ETXA 2PR8A 2NOJB 3SGBI 3HDDA 2V8HA 1ETYA 4O3MA 2HFHA 1M44A 5AONA 5FROA 2VI7A 3COAC 1S7OA 4HX8A 3JRUA 2D4OA 5ICCA 2IS6A 3S1MJ 3GLJA 2K40A 3EUHA 3VYTB 1BAVA 2KIFA 2L9VA 1RPWA 3DKYA 4CRYB 5THWA 3GVAA 1IZ1A 5EEHA 2WV1A 1HA8A 4CAVA 3MKZA 4HDUA 2W24A 2VONA 1GLNA 2SGFI 2ZCWA 3L2RA 1ZLKA 3D7FA 3T8TA 3J7AY 3DLAA 5D5VB 4GFBA 3BXMA 2GU2A 2XSDC 5CVJA 1UVFA 4MJ8A 4B4CA 3EFAA 2M4KA 3FHZA 4JD6A 5G1ZA 1G6NA 1M8CA 3QYFA 4M73A 3S3MA 1K7UA 4HGUA 4WWVA 3U2RA 3HBLA 3KIOA 2ZBKA 1TUSA 2F7VA 1T2KA 2LK2A 2XEIA 3KEOA 2OAZA 2Z3YA 1BL0A 3QOEA 4DZJA 3S14J 2OD1A 4E4HA 1PYTB 2XGDA 1Y9WA 2HWVA 3W6JB 3I4PA 1PTQA 2CWHA 1ARMA 4UB6C 4Y13A 4HNWB 3KFWX 3ZMUA 3KP4A 4AVAA 1K78B 2P6TA 2CQNA 3HRSA 3LSTA 3Q0UA 1SFKA 2RREA 3QAYA 3KEYA 4UWJA 5CVUA 3KR4A 3IAS2 2EV6A 2H6CA 2FXAA 1M4IA 2C6PA 3DNSA 3GTLJ 1Z3YA 4ZYQA 1EV7A 2HC9A 5LYLA 1UHSA 2XAHA 3KLOA 3J7YJ 1FLIA 2FX0A 2Z9OA 2V1CC 3MQ0A 5KVRA 2R92J 1YR0A 5KHDA 5DWNA 2FQ3A 2BGCA 3G1OA 3DWLE 4NC6A 1NK3P 2YNDA 3PQJA 3BCBA 3D3SA 1U6GA 3BR6A 1R9TJ 2JTVA 4UVAA 4LLLA 4BQQA 3GFLA 4JYWA 2LFBA 3E0JB 1S9HA 1OR7A 1IO2A 2Q4ZA 2ZMEA 2ZXWH 3BTLA 1XRYA 2FNFX 3W6VA 1NXUA 1MKMA 2WWYA 4I7HA 4PJ0C 4E7KA 3N97A 3HPHA 1J4JA 1R57A 2YR2A 4C3HJ 2QYOA 4IO9F 2XEJA 3HUVA 4KJZA 2LF7A 2G9WA 1TWGJ 1R6RA 2PSWA 1XIXA 4QC6A 3W6SA 2LH9A 2ZW4A 2B5GA 2MLKA 2K85A 3A1YA 1G3YA 3A0HC 2LREA 2R5ZA 2CUZA 4E7HA 2E2JJ 1DGRM 1QZZA 4N0BA 5FKLA 3S1RJ 4EVIA 5K7FA 1SGNI 4M6HA 4FX4A 1J09A 5LYIA 1SANA 3QU6A 3Q9SA 2XUBA 1EJ9A 1XEBA 4A3LJ 2KDZA 2A3SA 2PCUA 3FWEA 2PJRA 4G9YA 2HVSA 4MBUA 4U5YA 1A35A 2DOFA 2DT6A 5E3NA 4KSFA 4BD9A 4RB2C 4GCVA 2KCXA 5IP9J 3HPGA 4NFRA 5JM6A 1TKHA 2Q0OA 3ZRGA 2DT5A 4AIDA 3CJNA 1XBTA 2PJ2A 4Q36A 2RV8A 5K7ZA 4CGPA 2YGWA 3ABMH 4EFDA 3KP3A 3IHUA 4CUGA 1U8RA 4ESFA 4HNUA 3RQ4A 1JHHA 2Q7SA 3W6XA 2QQBA 3L2WA 4QTRA 3CO7C 1KYZA 1IN8A 3CDHA 2DW4A 3HOTA 5CVRA 4KOVA 1T39A 5FUVA 4IOCF 1E3OC 3FK6A 2VBWA 4M6YA 1JKRC 3ULQB 4IUSA 2E34A 2HTJA 4HF2A 1UHAA 1MBFA 3V7RA 2LUYA 4I6ZA 1OQYA 3HXLA 3V8JA 3T8WA 5DYMA 4D7NA 4P4BA 2XAGA 2H6BA 2C6YA 3ZN0A 5L3CA 3GTKJ 5ELYA 4OAZA 3IL2A 3DR8A 2A6HF 2DMTA 5GP9A 1M8BA 1TXRA 1YLFA 3E1SA 4G12A 1YW6A 3WC5A 4JQFA 1W3SA 2FIWA 6PAXA 1MJ9A 2E60A 3LSRA 4HAMA 2RN7A 4BXXJ 2V77A 2JBJA 4OWRB 2GA2A 2KJCA 2ZSHB 2JXDA 1S3ZA 4PCQA 3QQAA 5L3FA 2OA4A 1AN1I 3T9YA 1GT0C 2IGOA 1JKPC 2XB0X 3LA3A 1FOWA 5F09A 1SD4A 4WWCA 3AG4H 2KMUA 4P9FA 3CCJI 1S60A 3MRUA 4JBAA 5KNLA 2R7RA 2PJ3A 4XBFA 4HW0A 1XD7A 1P7JA 4CCJA 2ODFA 1D1AA 4BBHA 1AU7A 3Q3SA 2XRLA 4GDFA 2QIRA 2XKPA 3MCZA 3VDXA 2CF4A 4NGSA 4F0YA 4MEYF 3CXPA 2L3DA 4YG2F 2VPLA 2L0KA 4XIDA 4E1RA 2Q4VA 2Y9YA 2KL4A 5F64A 4YGOA 5LGUA 5BMZA 4HF0A 4LB6B 2ETHA 1ZQ3P 2V53A 4WP4A 2CXAA 3JRIA 1V0CA 4AC0A 5C4JJ 3H0GJ 1HDPA 4BQNA 2R5YA 1WJBA 4HX4A 4CAEA 4L5EA 2Q1ZB 3BJ8A 4PV6A 3SZTA 2Z3KA 1AUGA 3OYEA 1XGSA 5IOZA 1YJNI 1YHQI 1ULNA 4KSIA 2ME6A 2OC6A 4RGXA 1WH7A 4BL0B 1TNTA 4Q48A 2DQRA 4DGWB 5EG0A 1IAWA 1J0RA 1FPQA 3LSMA 1A36A 5B66C 1XBUA 3FSYA 2VKVA 4LLNA 4PK2A 3HSEA 2HS5A 1ON0A 4ZTJA 1V1HA 3ZPLA 4L89A 1RZ4A 3J80K 1ZRFA 3S6GA 4G6QA 5DAEA 3ECHA 3R0AA 4AMLA 2IA2A 3HHHA 1V4RA 5HOOA 1BLLE 1T0FA 3IEHA 3BJ7A 1VNDA 2IGKA 1OR7C 2DN0A 2PFBA 2W57A 1FSEA 1FTTA 2QBYA 1JUMA 2CV2A 1OPCA 2MH2A 3T8RA 4CGZA 1X4OA 5HNHA 2ADUA 4MNUA 4UB8C 2VC0A 2B0LA 2BHYA 1J5YA 2GOXB 1FNOA 4BKXA 4FD4A 1B4AA 4R1HA 1OLTA 1T08B 1QU3A 1POGA 1ETOA 2AHQA 3F8NA 5E3RA 3KGQA 4PSWA 3DQVC 2AFOA 4R3LA 4J19A 1JTXA 2E1NA 5HNFA 4EM0B 3KZWA 2GWRA 3FYNA 4C2ZA 2RQQA 2ZELA 3VH9A 2F5DA 4Y49B 2VQHA 3CLQA 1U8BA 3FX3A 2QMLA 4A32A 1YX5A 1LFPA 3SI2A 4B11A 4UA3A 5I4MA 3F5BA 3MGDA 2K9QA 4HYEA 4PZJA 3OXGA 3IWZA 1BA5A 1HEVA 4IF5A 1XB4A 1JT6A 3IH4A 4XQFA 5GCNA 3L09A 2P6GA 1MNEA 5K5OA 2CY2A 4OIPF 5B5EC 5HLIA 1O7FA 1JJ6C 2RNGA 2PG4A 1Z2IA 1P6RA 1IXCA 1Z6RA 2JRMA 3I1UA 4EGZA 2VUMJ 1HDDC 2C6GA 2WB1A 1QPMA 2HKOA 2TRTA 3K2ZA 3GZ6A 5E3LA 4OC0A 2M3AA 4PJMA 5DUIA 3U1DA 1XGMA 2H5MA 1K4JA 4KNYA 3OYJA 2ELIA 1Q2YA 4BE0A 2ZENA 2EFQA 2UXNA 2WVJA 4P4EA 2X3TA 2ZJRF 3CCYA 3NE7A 5IP6A 1NUBA 3FKJA 4XLCA 4JWPA 2QA4I 1WI3A 2IL4A 2WAQN 4IXAA 3LACA 4A93J 2BYVE 4A6DA 1DS2I 5K5QA 3ML6A 4M9ZA 1ZYRF 2LKSA 2NU3I 1ZLIA 4OP4A 4E7IA 2MLGA 1IB1E 2KT0A 2PJ7A 5F04A 4OLLA 3JCUC 5E1WA 1AA7A 5ICGA 4CYCB 2UZKA 3OIPA 3UEJA 3CZ6A 3HUGB 4KN7X 4CA0A 2DCEA 2GQQA 3F8CA 2FIAA 3OL4A 4ETSA 2XVCA 4F3QA 1R58A 2B7EA 3KZYA 4I09A 4MLOA 4EEFG 1K4TA 1DU6A 1KQ8A 4IHMA 2PMUA 4F7ZA 3H8GA 3BZ6A 2XGEA 2AFWA 1XMKA 3H9JA 1IV8A 1ZREA 2PC1A 2PVVA 3SEZA 4ONWA 4RN7A 2ZJQF 1YX0A 4B48A 1R5GA 4MCPA 4P45A 1Z7LA 5C3EJ 5K8NA 3FH4A 3EXNA 3ASOH 3JVNA 5HODA 3N7ZA 4OIWA 5FLMJ 4L9JA 1OCZH 3EDPA 4LMYA 4BNCA 1YI2I 1LAPA 2EFOA 1V1IA 3K9UA 1SGQI 1NMTA 4A2ZA 1EA3A 2F4MB 1I3AA 3CCQI 2L7XA 2CUFA 1WFXA 1PVEA 1Y8QB 3OYAA 1VQ9I 3G3ZA 3FXQA 4R7MA 4HOBA 4XN3A 2PMHA 2MH9A 3DP7A 3SFIA 4H6ZA 2H94A 3KQZA 3NWTA 3IUOA 1IRFA 2AE6A 2PRBA 5LHHA 4KLVA 4KUBA 1T0FC 3ZN1A 4MFJA 3WGIA 5GADJ 4I76A 1EKEA 2LSOA 3F6OA 3VE5A 4QWQA 1F4KA 1Z8XA 4WCGA 2VJ5A 2JA5J 1KONA 2E19A 2JRTA 2QLZA 3R0JA 4RAYA 4MFKA 1QZYA 3RZDJ 4R3KA 5GAEJ 1C0WA 4V19K 4W9YA 3PIPF 4BXUA 3T90A 1G3WA 2QQ9A 4UVCA 4IOAF 3OOUA 1K61A 5IT3A 1GDTA 5FJ8J 1BOBA 1ZG1A 1VQ7I 1SMYF 1Y0YA 4I49A 2KRHA 5LYFA 1ZG3A 2Z2SB 3LAPA 4GXHA 4CAWA 1O3QA 1SVMA 1XG1A 3K4CA 2CNTA 6CPAA 2ZXJA 4KT6A 4P4DA 3BG6A 1MT1A 4UHTA 1LDDA 3D7DA 3KX2A 2A5WA 5CLSA 4L9NA 4BY1J 1R1UA 1GV2A 3G1LA 1YFHA 1XPXA 2Q4YA 3OWCA 5LD2C 4Q4ZF 1IW7F 5AGEA 3E59A 5BNGA 3TKYA 1Z3XA 1I27A 4HSRA 1T8IA 3PP9A 2MABA 3N05A 2EPFA 3SQNA 3TP3A 1H88C 1HEEA 3S6KA 4M3DA 2PJBA 3IH3A 4EM1A 1BI2A 2OZ6A 2EWNA 4Y15A 1K6OA 4KIBA 1TQIA 3AKZA 2Z3PA 3B2YA 5B3SH 1WKMA 4HNYB 2PRQA 4UV8A 2G7UA 2K5TA 2V79A 4B10A 1V55H 1QO0D 2XHKA 4F55A 2GLJA 1LE8B 3FJUA 1CT0I 2F5CA 4KZTA 3TEDA 3U9GA 1X4SA 5CVIA 1R71A 4UWIA 3R9GA 3CO6C 3RJPA 5D4SA 1CF7A 2A61A 2EFNA 3F8BA 4CO8A 2R7ZJ 1MMGA 5DM7F 3KL9A 3A03A 4B1RA 2HOSA 4FE7A 2HDWA 2K3PA 4KICA 1XX5A 5A2QK 3EPZA 2VOPA 3S32A 5H2FC 4NJQA 4KYWA 3BG9A 1XSDA 4UUVA 1A04A 1ZK8A 1IGNA 3NE8A 4UV9A 3GWZA 4AIJA 4RS2A 5HXDA 2E5NA 3LL7A 3ZR8X 4RS8A 1YG2A 1MNDA 2R7VA 2BZTA 2VL8A 1D1BA 2G3AA 1B72B 1DS3I 3MD2A 5EC4A 2ABZA 1KBEA 1WGCA 1TL8A 1WVRA 3TOAA 2LDUA 5DEQA 3I4MJ 2QQDA 1HKSA 2M5WA 2E5RA 4MO7A 1J75A 2DEAA 4A3IJ 2I10A 3ZQGA 2ZEHA 2PE3A 4OU0A 2NVYJ 2DIPA 2OCEA 4EM2A 3S93A 2F3CI 1ELMP 2GE3A 5J4VA 1IXRC 3M8JA 5J6XA 3C26A 3WTZA 1HW5A 1Z05A 3VFZA 2M1BA 2V26A 2QQ8A 4RGSA 1HJAI 3TO7A 5K8OA 2HQ5A 2TCTA 2O28A 2MC3A 3KLNA 2BV6A 3MKYB 3S9MA 3DEUA 3C2HA 2B0UC 2VIXA 3RYPA 4E7ZA 3LQRA 1SGRI 1CM0A 2ELKA 2PN6A 1WSUA 2VOOA 2CFXA 4UEEA 2OVOA 2Q43A 5TISC 1A6IA 2MYSA 5JLXA 1FAQA 5GAGJ 2E2IJ 3FM3A 5E8GA 3FF3A 3IU2A 4HEA2 3MFKA 4BBSJ 4P10A 2M0MA 2EFWA 1UCRA 2WC2A 1JTYA 3TTHA 1DP3A 4QUSA 3KCCA 4A5MA 4MMOA 3M4OJ 1JHFA 4ANJA 2ID3A 2R0QC 3GYHX 3HOUJ 5D4RA 2NS0A 2Q8KA 2JLMA 2Z11A 3PGPA 1Y9KA 3R96A 3OYNA 3TL4X 4XM3A 2L8EA 4UF4A 3EUAA 3WTWC 2Q51A 2XPUA 4ITVA 2K4BA 3QPHA 4B47A 4PGGA 4KITB 2GXAA 3OL0A 1QMUA 3IIBA 4MRIA 4P1WA 3CXSA 3S1NJ 2MC4A 4W1UA 3J80Z 1VQNI 1JXSA 4EQQA 1P0HA 1ETVA 4K30A 2QVOA 3GB0A 4MCQA 2ZNYA 1B87A 1TBOA 1ZRCA 5G21A 2DLLA 1FT9A 4Q7AA 4P5OA 5GPAA 2DYSH 3ISPA 2QEXI 3D2MA 1FARA 1G8XA 4NCZA 2ORWA 5EF6A 5JHFA 3FMCA 2J8NA 3Q0VA 3H92A 2X51A 2ZEMA 3WTTC 2J5OA 2Z5UA 3PQKA 3L9FA 3CCVI 1PTRA 2ENZA 1Q9BA 4GI3C 3CZXA 5K8MA 1USSA 3KEQA 4LK0F 4QIWN 1F2PA 5BPDA 1X1CA 5K5RA 4B5OA 3HC7A 2YNCA 1LEAA 3BR1A 3BR2A 4OVOA 5KTCA 2PIZA 3HRTA 3SJFA 5EGOB 1D0XA 4HSTA 1B8IB 2VBQA 1I1GA 2HTSA 1ZH5A 4AVCA 4FX0A 4DOZA 2LR8A 2YSRA 1FYMA 1YS7A 3DLLF 4M71A 2EWBA 1TBNA 4E7LA 2DODA 4L9TA 4UIBA 2GXGA 3SHFA 3SJXA 1F57A 1B1BA 1OJLA 1HF0A 2YU9J 3D1NI 3KKWA 3PRTA 4CCKA 3P2HA 3UY5A 4MCSA 5F0HA 3BPVA 1YRNA 4M6VA 4B43A 1O7LA 2JN6A 2K9NA 1S72I 2DA6A 4LG0B 1XTAA 1KQ0A 2NVQJ 3PBBA 3FDYA 5LFAA 4G7OF 1TURA 2QSHX 3OYDA 2ZKZA 5CKTA 3WU2C 3IRQA 4JZ0A 2JA1A 3ZQFA 1SGEI 3RKQA 2N71A 5DCMA 1YYVA 3PL8A 3BDDA 2DMPA 5LRGA 4N9IA 4U0VA 4AVZA 3MZHA 4RBOA 2DXIA 3OS1A 3TW7A 1ARLA 1FMWA 4Y3OA 4UIAA 5D8NA 2JZMA 4Z2YA 2OV7A 4CGOA 3HM5A 4X5KA 1TQMA 5F08A 2W00A 1B9NA 3UR3C 4V2GA 3TMOA 1FBSA 4YEJA 2VB6A 1Y1WJ 1P9GA 3PUBA 3HRUA 2MA3A 4L8AA 4HZFA 1ETWA 2BO9A 3QPLA 4L9VA 4A39A 3P9KA 2L7MP 1APLC 1ELLP 3G4SI 2G3TA 4RLQA 2WY8Q 4EJVA 3F23A 1ZG7A 3EO4A 3KP6A 3KETA 1W5TA 5HS7A 5E18F 1A31A 4KUAA 2PX9A 3DU5A 2JDDA 4PFOA 4OAEA 5H86A 2B4DB 5IB9A 1TWCJ 5AG7A 1Z67A 2ZEFA 5B1AH 2BCOA 4I0BA 5FGMA 3I9SA 2F8HA 1TBRR 2W84A 4P4JA 2AXTC 1V3FA 1Q7LA 2ZW5A 4I99C 4UFVA 4N4NB 3DBHB 2Z3LA 3I55I 3PDNA 3H8EA 2MGQA 3QP6A 3E6CC 4M72A 2NU1I 2VBZA 2EBIA 2YNEA 4P4IA 3FXLA 3BR0A 1Z91A 3L7WA 1RR8C 3QYBA 1QSTA 5H84A 3V8KA 2RC4A 3LD2A 2P5VA 3TGNA 1LRZA 3B3VA 3NAUA 2STWA 3CCSI 3PFYA 2ZW6A 2W7NA 3PEIA 1MH3A 3TCVA 2NXNB 2R7FA 1E3PA 3JTGA 1IRGA 4E1PA 2OU2A 5DS9A 4MHPA 3VODA 2M9HA 4CCOA 2HQAA 2DFEA 3TDUC 2HVRA 3JRFA 3JSPA 1QSMA 2AFZA 4MI4A 3RZOJ 4ZI6A 2M8EA 1OISA 3T5XA 3VB2A 1FYKA 3CXLA 1ODDA 3L2VA 4W97A 1LVAA 1P9QC 2CS3A 1LEBA 3OXLA 4BU2A 2J8MA 1FJLA 2V1DA 4CH7A 5GTHC 1IV6A 4BEHB 5IY5H 1GXQA 1GXPA 4MPIA 3KYDB 4I2OA 4M9SA 1WPKA 4FASD 4M3SA 1Y1BA 4B3AA 3B35A 4IZZA 4OIDA 1UG2A 3F3XA 3LWUA 4MFQA 1Y0RA 1YW7A 2JMWA 1IF1A 3SXYA 4PJLA 3O6BB 3HYIA 4A24A 2HR3A 4UCPA 5IT9K 1EH6A 4RAGA 1RRJA 2FE7A 3CUOA 3SEKC 2YNCC 2A07F 4B13A 4PUSA 4N4OB 3D0SA 1Z7UA 2JK3A 4DYQA 1U9OA 3WTVC 1S7LA 5JHWC 1UHMA 3S3OA 3CPXA 4NGNA 2RNJA 2GANA 3LA2A 4LQ6A 2ZFWA 4CXFA 1XSXA 5LRJA 1O57A 2Q44A 2DYRH 2QENA 1ITYA 2L4MA 1WI9A 1YMEA 3OMYA 3R95A 2KPMA 2E5ZA 4YELA 3BLNA 1WWXA 2P0WA 3CUQC 3UKGA 4FWUA 4NC7A 5EZGA 1PU9A 4NSQA 1OYIA 2X85A 3PO3J 3IP4B 1TTYA 2HXOA 4Q38A 3WGGA 1N75A 5FRMA 2EZLA 2STTA 2ZXVA 2DDBA 1I39A 3RCOA 2XF6A 3HHGA 1OBRA 5F46A 1XC5A 2BY2A 1K78A 1QHHD 3GF2A 4X3RA 4MFEA 2GA1A 2JEVA 4KOYA 5J1QA 5C4XJ 1WJAA 1Q1HA 2GBYA 3R61A 3OSGA 1ENHA 3ZMSA 5BQTA 1XSVA 3H9QA 3BG7A 2R93J 3VATA 2FJ1A 4HV6A 1Y0NA 3OXFA 2DMQA 3C2GA 1PCAA 2DBBA 4B6ZA 4E2AA 4BXFA 4CHUA 1PUAA 3MKWB 5JI6A 3D5SC 2EH3A 3M9AA 4C3IJ 2EK5A 3AG2H 3LSKA 4CAFA 1CJWA 4EV0A 3DV8A 3R4KA 3Q9VA 4XLEA 2UUZA 3E7LA 5A2QZ 4GGGA 4UXHA 2XGXA 3CC7I 3S1QJ 1P7IA 1H9GA 2Y69H 4UXNA 4Z6YA 2W0TA 1MD0A 3ESWB 3MN2A 4YFXF 1KU2A 1X19A 5DD4A 5H6RA 4JP0A 5DTDA 2CQ7A 4E7JA 2B4BA 2Z3NA 2PR1A 1KUYA 4ZJZA 3EYYA 4PK3A 4IPAA 2JWTA 2AXLA 3H5ZA 3A4CA 2VI6A 2LY9A 2OTJI 1JJ8C 2ECBA 2IGMA 3MKLA 1EH7A 2PJ0A 3FXTA 2D4PA 2E36A 1VQLI 3HOSA 5JPHA 2PVWA 3EUKL 5BPIA 3LSGA 1Z2LA 1P4XA 4CCLA 1WZ2A 5TJJA 2QSFX 2LF8A 3H0DA 4HLYA 2R7QA 3H5AA 2E2HJ 3CCUI 2EV0A 2DT7B 1Z4EA 1S29A 1FC3A 2W4SA 5DCFA 3QP5A 2V4JC 3CDLA 3PBEA 1Y56A 2X1CA 4NBQA 1LFUP 2X6OA 2AS5F 3F0CA 3HTUA 3NARA 3GLXA 4L0ZB 2F4IA 3CJTB 2L9SA 3OWTA 2N1AB 1ZG9A 4UFXA 2IEKA 2BW3B 3K4KA 4C68A 1YTPA 2R7XA 2PJCA 1B6AA 4QVTA 1TLHB 3H4QA 2DDAA 4S04A 2EILH 3HOYJ 1CPSA 2BOLA 2G7HA 3OIOA 1VI0A 3QPTA 3L2UA 2O61A 1Z7KB 2CJSC 2ARHA 4MHYA 3DXJF 1LDKB 4FISA 2N17A 4UEFA 3M1EA 2B3VA 2LEOA 1Y39A 3CCLI 2WBMA 3K7AJ 5B1BH 3RDIA 1O3TA 3A01B 4FT8A 3EUHC 2LY2A 5HS9A 4B5PB 2OTLI 4R8HA 4UCNA 3LWFA 1VQKI 2GKVA 1F1ZA 2M34A 2I79A 1TC3C 3SDBA 1X10A 1OMTA 4Y52J 4X2TA 3ABLH 4JOMA 3F9KA 3K70D 2CV0A 2CRGA 3NQOA 2AFXA 3K6GA 1S3JA 1M4LA 3WHCA 3UFFA 1OYVI 1S7KA 3HOZJ 1DU0A 1W36D 1UHWA 2DFFA 1T38A 2DB6A 1D8KA 1ZARA 3WODF 3W91A 2FUG2 3AG1H 2ICWG 1QVUA 2HZTA 4H4KC 3WE3A 4RB0A 5DM6F 3VYSB 4AD9A 4CZCA 2FD5A 3I54A 2R8VA 1NK2P 3N5FA 1BO4A 2WY7Q 3K4MA 3BCAA 1L3LA 4PJNA 5CVVA 4CYNA 3V8IA 3C3WA 1BC8C 3QODA 3RYRA 3JRGA 2I8DA 1U78A 4PJJA 4Q47A 4ZGYB 3SHPA 3GLLA 2EK8A 1SD6A 5HS8A 5KCMA 1IDYA 2GKRI 3F21A 2KQRA 4XRSG 1CP7A 1X3ZB 1WRJA 4LB5A 2DPSA 1GVDA 1VQ5I 3HG9A 3I4NJ 4P4FA 3TO9A 1ZR2A 2CSOA 3AL0C 1CSOI 2PMZN 1OFCX 2XEGA 4M85A 2JQ7A 1ZN2A 4BQAA 5FFZA 4YFKF 3FMRA 3ROUA 4IK2A 1BPNA 2DFHA 5F47A 3IKVA 4NDLA 3FC3A 2K86A 2X9DA 2VL1A 4QPQA 2ROWA 1XCBA 2ZMEC 1XMXA 1R5HA 2BBYA 2WCYA 4X0GA 3K69A 4RMNA 5E3OA 3NWSA 1X3UA 3CCRI 1DQUA 1S6LA 2ORVA 4DBQA 4AXVA 1HBXG 5GPCA 2CW7A 2V6CA 1XS9A 1U6MA 2HUZA 4CSWA 2UXXA 2Z3OA 3SXOA 3KP2A 4F9UA 4UY8I 4BDYA 3WC7A 1Z0XA 2AFMA 3S9LA 1I50J 4GM5A 4FD5A 2CW8A 2YS9A 2BUSA 1Y1CA 3B8GA 4E0AA 2DO7A 5FRNA 1X3WB 2VBXA 2LB7A 1TF8A 2RQPA 1W4MA 4XSXF 3ZMZA 4ASNA 2Y75A 1LR8A 1SFUA 1D5VA 5AIPA 4X8IA 4IQ4A 3BI1A 3NH4A 1MMSA 1DTDA 3DBRB 2C6CA 4K3NA 1ORKA 1T95A 2MD0A 2R4GA 2JEWA 3LMSA 4R79A 4HKFA 1YU6C 2E7XA 3GFIA 1P4WA 3HLPA 4YFJA 1H0MA 2ZNZA 4U0YA 1V54H 1N71A 4D5FA 1R22A 1VKCA 2DJIA 4HV5A 5KK1A 1AMPA 4NC8A 2Y0SN 3WGHA 4XNHB 3KI9A 2VT3A 4A37A 2O3FA 2M7BA 4HRIA 3CC2I 2DF5A 2Q2EB 1JUSA 2XPVA 1ZGJA 2PI0A 4A3EJ 2OF7A 4XORA 3FXOA 2L02A 4NHJA 4U7BA 2VT2A 1A6QA 3R5CA 4EVYA 1JUPA 1K83J 2VQLA 1HSJA 3E3VA 3KASA 1VTNC 3IWWA 1ULMA 2KIUA 3GO5A 2WGCA 1TT0A 2NVUB 4XKWA 1TKFA 3I59B 1L0OC 2YQPA 4DBRA 4CYQA 4QLCU 2NSMA 2JDCA 4PK4A 2L9NA 1PUFB 4A3CJ 4CYCA 4A0XA 2WUUA 1R00A 5CNPA 2CIJA 3HUGA 3OL3A 1TQPA 1U5TB 2GM4A 5EX0A 2PJ5A 1Z8TA 3I56I 2J9RA 1GHEA 1MW7A 2EIKH 2NU4I 5H6QA 2IT0A 1X74A 4O6JA 1KU9A 2V7FA 2JUCA 4J01A 2IPQX 2QQEA 2OZUA 2QZ8A 3FKIJ 1H89C 4CYDA 3BT9A 4UNOA 4XKBA 5IYDJ 3T1BA 3KE2A 4CICA 1IY5A 2BUEA 2F5IA 5C82A 4MQ9F 3JRHA 3GFJA 3NH8A 1KYWA 5LGNA 1VQOI 1VQPI 2AQFA 2V6EA 3VSLA 3CQZJ 4DZPA 2IA0A 3WG7H 4D0PA 2NS8A 2IS1A 4AB7A 1TT5B 5HMNA 1LDJA 1RR7A 2PQ8A 3SYTA 1UZCA 2Y0MA 4E6KG 2JVHA 1MSFC 4V2FA 5LLQA 1KMAA 1W0TA 1IICA 3RAMA 4IVNA 1XCVA 2XASA 1PDNC 2WV0A 3CJQB 1HPTA 1X2NA 4YRHA 2DPUA 2BXZA 5F1JA 1X4PA 2BEOA 1R79A 1S7AA 1H0ZA 1T56A 3UOEA 3K1MA 3M8EA 4YIRX 2GXBA 5IT9Z 1I5ZA 2VODA 4GYGA 2HOTA 2ZEPA 5D8KB 4KMFA 1XJOA 2V9PA 1AYEA 3F6VA 1D0YA 1G3SA 2R7WA 4XLPF 3A02A 3B73A 2AJ6A 2KKOA 4P9UA 4DNCA 4GO1A 1UB9A 4KN4X 1PJRA 2KFDA 4FBEA 1K7VA 1SQHA 4RAFA 1H8LA 4KS9A 4C9YA 1F36A 2HPMA 5FUXA 1X58A 2ESNA 3ZMTA 3GZNB 4NGTA 4ZDPA 2FA5A 1MJAA 4HDVA 1X1BA 4C2XA 2QQ0A 1CT4I 2LYCA 2NOGA 1PP8F 1TKJA 5HVQC 4JLYA 1N77A 3BWGA 5F27A 2JA7J 4DQ2A 2ODDA 3TQNA 1R1TA 3S2WA 1REPC 2VLAA 3I9V2 2L7FP 3TJQA 3G1MA 1MDMB 2FS5A 1JGGA 3R1KA 3FISA 2ZC2A 1QQ9A 2BY1A 2WAEA 3ZMDA 2XAUA 3B6CA 3S8PA 3Q5FA 4F91B 2KMRA 1RI7A 5ERIA 1SGYI 1HDLA 4R76A 1G4DA 2L54A 2VBYA 4LIVA 1I6XA 4C2MJ 2EIMH 3OS2A 1ERDA 1ZR4A 4I01A 3WT4A 3OIQA 4JXQA 1SVOA 1LANA 3GIUA 1PCEA 1Q2CA 5M5WJ 2IGNA 2VKDA 2JYYA 2CUEA 3HL2A 1GHCA 3IRRA 2QYVA 1TBXA 1ZG5A 3OYBA 1FY7A 3PM1A 2K4JA 4F92B 1LE8A 1VDDA 2LBFB 4A0YA 1BOAA 2L01A 3D7HA 3LFKA 1LAMA 4AYBN 4KLWA 4XPDB 3FXMA 3EQLF 4G7HF 4A3FJ 3PB4X 2L7KA 5FLXK 3FECA 1FBQA 1TP4A 3Q0WA 3WTYC 1B9MA 4BUPA 1QHGA 2E1MB 4A2UA 4MEXF 4CZZA 2REEA 4XMYA 3RNZA 3JAMK 1KGSA 4IHYA 1SAUA 3TE4A 2GKTI 1AKHB 3SFZA 2ERWA 2EZIA 2UVOA 1YW4A 1MBKA 3PSIA 5EZHA 1TIHA 1FYBA 2D1HA 4UXJA 3WR7A 4KMUX 4WXHA 1X12A 1JWQA 2P6SA 2VXZA 3V4GA 1TWHJ 2A05A 2KRCA 4YRVA 1B72A 3S2HJ 1IY7A 2DXQA 3VEPA 5EDNA 2FCKA 1YK3A 1YSJA 5FB2A 3FX6A 3V42A 5M3MJ 5LYDA 4LLGF 1VQMI 3B02A 1QRYA 1U2WA 3SXNA 4KUMA 1W7PB 5FKOA 3MVPA 1TOTA 4HG2A 4OOIA 3GMEA 1AWCA 2MSYA 2K9MA 3DEEA 1IIDA 2VEZA 2M0CA 1CGPA 4LIUA 3A9LA 1RKTA 5F6FA 3E0KA 2A4NA 2IVMA 3GYAA 1Y1VJ 3HKZN 4DIQA 3TX8A 1YVKA 2KCWA 2QCOA 4Z65A 5HVGA 1FWZA 1W5CC 5C44J 2K7LA 2FMYA 5TGTA 2JZYA 3FXKA 1SC7A 3GY9A 4NQWB 3TT2A 1BJAA 5J3LA 1WCMJ 3P9IA 3IC7A 1FP2A 2Y0SA 3DCFA 2V9KA 1YLEA 1TNSA 2VJIA 3GW2A 2ZSIB 2DPTA 3KHZA 2XAQA 1HCRA 5ICEA 3RPQA 3OYIA 3HZJA 3LMMA 5HI7A 4ZYHA 1XE4A 2ZXHA 2H1KA 2H1LA 2GIVA 2NMTA 1KZHA 2Z3MA 3QWPA 3EY5A 4OC4A 2O8KA 3MMYB 5FLVA 1UG0A 5M5YJ 2JSCA 5IX3A 2P6EA 3JRDA 1NSLA 8CPAA 2HEOA 4J00A 2K27A 1SFEA 4XL9A 2NNYA 2FSWA 3LNQA 1VQ6I 1S5KA 4XN0A 3GUXA 4U9YA 2V9VA 3WTUC 1FNNA 1YTYA 5F49A 5IV0A 2M8GX 1FMVA 2ZXIA 1WJ5A 1Y6IA
chains in the Genus database with same CATH topology
5CJ9A 2R7DA 5FVJA 5L3DA 3TFYA 4B09A 1ONVA 4EJWA 1B59A 4Y17A 1FP1D 4ZZLA 1T6SA 2HKXA 5ILVA 4R87A 2ZO4A 4XLNF 1R1VA 5LEJA 1DP7P 2XKOA 1Z9CA 2F2EA 2HDCA 1QNTA 3JSOA 3FRMA 3RYOA 1DUXC 2EJRA 3P7NA 3I71A 2R7HA 4CAXA 1R23A 1ZRDA 5G20A 2YPRA 1FSHA 3J7AO 2R98A 1E2XA 3IWEA 2CG4A 5E20A 4RI1A 4H89A 1IN7A 4L18B 4BHCA 2Q0YA 2QWWA 3LODA 4EGYA 4A0ZA 4AIHA 3NRVA 5D5UB 1KU3A 3MEXA 2ZJ2A 3FMQA 5AIQA 3BJAA 3FZVA 1IXSB 4U88A 2W25A 3G8WA 5FD5A 4LD5A 3PFIA 4LG0A 1FBUA 2OQGA 1WWZA 5C82A 2FNAA 2CO5A 4RB1A 4GXOA 3GUDA 1Z6TA 3ZJ0A 3HTSB 4BYYA 5FFXA 1L0CA 1W5SA 3JW4A 4FD6A 1XN7A 4UFWA 2EUIA 2JPBA 1DPUA 2VZZA 5F1RA 2A69F 3KZZA 1QQIA 1YREA 2OZHA 5LHIA 4EJUA 1QBJA 3CUQB 5D6EA 3V8LA 3RPUA 3WU0A 1S8NA 1LQ1A 4CS0B 3GKRA 1FZPB 3ABUA 2KIMA 1YO5C 2ZW7A 2KRFA 2HQNA 2B4DA 4B14A 5J8CA 4BMHA 3FF5A 1XDSA 4JJXA 4GS4A 4ZZDA 1QSRA 2O0YA 2CNMA 3D8PA 4ESBA 2IP2A 1SD5A 1IYLA 3WTSC 4HF1A 4KSAA 4P96A 2XROA 3GX4X 4E70A 4P55A 4AG7A 4ON0A 1XF8A 3IWFA 3H3UA 3DFGA 5JR3A 3F8KA 2HOEA 5A27A 2BL1A 4Q5SF 1OYWA 1U3EM 1ZAOA 2NYXA 4ENMA 1FX7A 3FB3A 2QUFA 3TO6A 1HSTA 1IN6A 4MTEA 4CGMA 1KQ9A 1J59A 1LJ9A 1ULYA 3IWGA 2H27A 4HLXA 3R9FA 5HH1A 5LRRA 1JE8A 4A31A 2YX7A 1S7NA 4LGWA 5L3EA 2PEXA 1OZPA 1TIQA 3R60A 3M7GA 3S6FA 4UCMA 3HSFA 4I0AA 3I5UA 2B58A 3F0AA 2P6FA 4KOXA 2FBKA 3E6DA 5BOXA 3QB8A 1ON1A 3DSBA 5L3BA 3CLOA 5E8IA 5ISVA 3MWMA 2HYGD 2FMLA 2NNNA 4NXYA 2WTEA 1RO5A 4MFLA 2O6GE 2R1IA 4HQEA 2M87A 1RUNA