3TOJA

Structure of the spry domain of human ash2l
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
201
structure length
196
Chain Sequence
SGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDGSSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Set1/Ash2 histone methyltransferase complex subunit ASH2
publication title Structure of the SPRY domain of human Ash2L and its interactions with RbBP5 and DPY30.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 50
structure length 196
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3tojA01
2YUEA 4P9JA 2LM3A 5F6LB 4P9LA 5C33A 5JI9A 4QT6A 4WVMA 4V1PA 2WL1A 4N7UA 5F6KA 5JI7A 3ZO0B 4KG0A 4XW3A 5JIUA 2YYOA 4N7IA 2IWGB 4B8EA 3TOJA 4B3NA 2VOKA 4X8NA 4P9IA 3KB5A 3UV9A 5JIAA 2FBEA 2E63A 4X8PA 4WVMB
chains in the Genus database with same CATH superfamily
5KHKA 2PAEA 1HQNA 3RGBA 3AP7A 1MEC1 3BTYA 5A6ZA 1GV9A 3AKPA 3W59A 4UOJA 1ASJ3 5ISLA 3VBFA 4KI5M 5T50A 5LA0A 1R081 4FO9A 3OOXA 5IUQA 3VBUA 3AKSA 2HWC3 2YU1A 4XTMA 3BIEA 2D6LX 3U1XA 3U11A 3VKNA 3LIHA 3M4FA 2F17A 2ZHNA 4S2DA 3H8XA 1YQCA 4QM9A 1TME2 1AXYA 5DAWA 4PDWC 4B3NA 4COZA 5IAXA 2HEVF 3BVCA 1KFXL 2R063 5JIAA 2D97A 3O1RA 4AHYA 3OGSA 5C33A 4RGAA 4XDQA 1HKDA 3A23A 3W5NA 3PURA 1UY0A 4OUSA 1ND3B 3C7FA 4ZXEA 4AAPA 4LBQB 4P5YA 3T0BA 3VD7A 5BNPC 3Q8AA 2GZWA 3UNPA 1AYM1 1FPN2 1UXZA 2A3XA 3VD3A 2K2SA 2Y38A 5T52A 3UGFA 1CWPA 4A7ZA 1NA1B 4W6YA 4Z2WA 1UD1A 2QVSB 3KMHA 1UYZA 4XE9A 2PLV2 3ALQA 1VAKA 3B5LB 5FZDA 1W2OA 3MIGA 1W9SA 4CXXA 1AJOA 1RVF2 3AP5A 3U37A 3N4MA 2WC2A 2D6PA 2WT2A 1WMFA 5JR7B 2WZR2 2W1WA 2Q0AA 2J42A 4YLZA 1AR63 1YQ8A 4J25A 1W9WA 4AGGA 4BQ4A 1CGPA 1AR81 5BY5A 2GC0A 1DQ0A 1XNBA 1XPWA 1ENQA 5F6LB 4WVWA 5L36A 2GNDA 3B3QE 1B35A 5EYYA 1V6KA 3CJXA 4KWJA 1NT0A 1RMU3 2VUAA 4Q4V2 2ZX2A 1KXGA 3JCIA 4WM7B 1QF3A 4N43C 3GHMA 2VULA 3U10A 3OB8A 5FBJA 4Y1ZA 1LTEA 3U0ZA 2ZAAA 1NOVA 5EPAA 3H7JA 1NCQA 3ACGA 1PO11 3OGVA 4XFFA 3VBHB 3FFZA 3K46A 1SLLA 2VUCA 4K6BA 1H8VA 4N8MA 4XUNA 4ET7A 4FP3A 1T2XA 1ASJ1 3DKQA 3M3CA 5L19A 3ZYRA 3VKLA 3LEKA 3NQHA 3DL3A 3NNGA 2V09A 1IG0A 4MV2A 1SPPB 5A6XA 4HPKB 4HZFA 1ZX5A 5JMCA 1C8NA 4DFSA 4MADA 2R073 1CIYA 3OBTA 2QCSB 1RHI1 1RJ7A 2ZEXA 2RDNA 4Q4X2 1XSQA 1LAJA 1GP6A 1ULGA 3WP6A 3AFGA 5IVCA 3C3VA 5F37A 4OUEA 1YIPA 1I3HA 2H6CA 2WFF3 4I3GA 5FYCA 4EROA 2ZGPA 3OD4A 2DURA 2BWCA 4AL9A 2QQMA 3JUUA 1O8SA 2XVLA 5BNNB 1O4TA 1YIFA 1DFQA 1AL22 2X5IA 3ZPOA 2VMFA 2I07B 4S2GA 5FO9B 1V9U2 5DAPA 3SHRA 4A3XA 3LIGA 4Y33A 2CGPA 2XL9A 3AMMA 3N35A 4LO4B 4XQ4A 1JMUB 1A78A 2BVBA 1OLME 5IK8A 3V0BA 2C26A 4O61A 5JOXA 1DLLA 4XF3A 4L97A 1CAXB 1SLAA 4KBZA 3CKHA 4QMAA 2F4PA 2JD9A 1WCQA 4D6SA 1AX0A 2ARAA 2DCJA 5JI9A 3ZXJA 4IXLA 4D3WA 1VPHA 4EN7B 1LEMA 2J1AA 3NVCA 2OT7A 5FZMA 3T09A 4NROA 4LBKA 2V72A 5FY7A 5HPOA 1OVSA 1UXXX 3DYMA 4R9DA 3H1WA 3INAA 4ZS3A 3GZTB 4LLFA 1TZOA 3VKOA 4QM8A 1VMHA 3ASIA 4I30A 1CQ9A 4DPNA 4OVEA 5KR7A 4HSLA 2IUWA 1OQ1A 1ST8A 2CHHA 1QHDA 3LZZA 3P5BA 1DG6A 4HK9A 4RHV1 4QB1A 5FCCA 5FYIA 1PGSA 3T0DA 2Q8EA 4CEYC 3D5OA 5FPLA 3ZMOA 3I3EA 3DGTA 4Z92B 1C8M2 4XJAA 3J7NA 2JDHA 4GWNA 2BJSA 4XOGA 3ZYGA 4DZGA 3IM0A 3KV6A 4META 2JDMA 1FXZA 4QPGB 5F5IA 2P17A 4QXHA 4CCKA 4XMIA 1HN1A 2ZAHA 4NHYA 4EJRA 1LHWA 3Q8EA 3USSA 5FZ6A 1NCRB 4DB5A 1WMDA 1JXNA 3IDEA 2R071 4WM8A 2ORZA 2R043 3WINE 3RZHA 2RS33 4OHZA 3TEXA 3MHZA 1K5MA 2WWUA 3POBA 1A6CA 2IVIB 1KD7A 1S0BA 2JE9A 2D5HA 3DPRB 2W52A 4JCKA 2B4KA 2WFF1 2RHPA 3R0RA 2WNVA 4LIVA 4YVSC 5FWEA 1SHWB 5A3WA 2R6QA 3MLLA 5T5JA 2WNUC 2DU0A 4WZFA 3VBOB 2BFUL 2PHWA 3E97A 2WKKA 5FKBA 2FCVA 4JC1A 4XURA 3B93A 3LEMA 4I09A 1CR7A 1DYPA 4LOTA 5CKNA 2VNGA 2P4EA 3VB9A 1JZ8A 3RI8A 1JZ4A 2IWGB 4YPJA 1SMVA 5C9AA 2AYHA 1H2NA 2HWB3 3HBKA 5APAA 1BBT2 1AYN1 2RJ2A 3T0AA 1PM7A 2WZEA 5JSPA 5HBAA 2ET7A 3NNLA 2HWF2 3HMYA 2V4VA 4GIQA 3SCGA 3WQBA 5FRAA 1UYYA 4Z1VA 3OEBA 5KWRA 1U5IA 1Q3EA 1HRI1 2DUPA 4GJYA 5IJRA 2B39A 5D1IA 3K75B 4XYXA 4AI3A 5CAZA 3SMHA 4LHSA 2Y6JA 1SLTA 4QXKA 2C4XA 3BOPA 2JG9C 5DPNA 4C1WA 2DFBA 2FDHA 1Q8OA 3LPFA 3POYA 4XUOA 2IXCA 4P08A 3UKVA 2XBO3 2A75A 3M7AA 5FY5A 4Q1RA 2ADEA 2X05A 1WCUA 1Y9MA 2NQYA 3AXEA 5L73A 4N7IA 1O4ZA 2RR11 1LGBA 3J8F1 5CB7A 4UW6A 3VN4A 3JBG3 2Q1ZB 4AQSA 2EIBA 1ENRA 1W0PA 5A3NA 5CA6A 3WNMA 2P3KA 2ZS6B 3HQRA 1HDKA 5FZ3A 1GBGA 1GNHA 1TE1B 5L7OA 4P5HA 5LBCA 1PHMA 1N1VA 3HWJA 4IGQA 2GC3A 3HN1A 3QH7A 2C24A 3AZYA 3M3EA 1X50A 2RE9A 1G9AA 1ND3A 1XOYA 1US3A 2R32A 1T6BX 4LBQA 1PVC2 5C8CB 2XVGA 3GZAA 4AFCA 1VMFA 4PIYA 3ZKUA 3KV9A 2WS92 2D98A 3TNPB 5K0UC 2Q5TA 1XXNA 4ZZ8A 1NA1A 5IVBA 3RYKA 1UPSA 5LK7B 3ZN4A 1DBNA 1BYHA 4P9IA 5FZ9A 2C6SA 3NJYA 2YC0A 2YY1A 5FYUA 5JZGA 5TSWA 4QQ2A 4HSJA 1ZVFA 4CUCA 1HX6A 2OX0A 5D8AB 1MQTB 2HWB1 3LKJA 1QJU1 4D6RA 2EXHA 1UOGA 5DG1A 4FPJA 4HN1A 4AHWA 3SH5A 2ZJCA 2VECA 3D0SA 2UYAA 2EAAA 1X9PA 2DCKA 4WM7A 2BOJA 4E2SA 1LOEA 5A7PA 3T08A 3ZXEA 2JB8A 4BXFA 1NXMA 4XQWA 1HXS3 1RUG1 4KNCA 3GF6A 5GJ6A 4FP2A 1G86A 4G3YC 3A4UA 1ULPA 2XBO1 3QBQA 5FYSA 3BODA 5I93A 2PYTA 4YM1A 4AEDC 1OOPB 2O8OA 5CIRA 1SPPA 1A8MA 5DUVA 4HPKA 3NWKA 2YPJA 3LWCA 3MYXA 4C90A 2AC1A 1VBB2 4HN0A 5GZEA 1TNFA 1UZZA 4MGSA 1CX1A 3BU7A 1S0IA 4URAA 4E2GA 4N9IA 5DDJ1 4NE9A 1NE4A 3VBRB 4NUBA 3ZFEB 4AI0A 4Q0SA 4XC9A 5A7QA 4JVAA 1ND2B 5F5QA 1LOFC 3IMMA 3WNOA 4DY5A 1I1EA 3MUZ1 5J7MA 1NLRA 5BNNA 3LCPA 1UIKA 4CDUB 3WDXA 3PTYA 4B4PA 1DP0A 3T30A 4TLGA 1RUE2 1ZM1A 2VZRA 2CY6A 3SITA 2YXSA 3T2TA 4K20A 4MX3A 2BGOA 4NMIA 2V5DA 4YFWA 2QBXA 5CKQA 1QU0A 2OXBA 3KGZA 4RQPC 4XJZA 2Y60A 2YYOA 3GJBA 3AVRA 5DQ0A 1KITA 4RR3B 1NY72 5FZOA 1HB3A 3UESA 5ACA2 1H6XA 1EV12 5SV8A 2FD8A 2ES3A 5F3EA 5A3PA 1VRBA 2VJXA 2QTWB 4K9SA 4AOCA 1W28A 1FATA 1CZTA 2XH6A 1POQA 3L2YA 3FHAA 5FZHA 5A32B 2YUEA 4CDQA 5FP8A 4XFHA 3DKWA 2TUNA 5FO8B 1EUUA 2YPDA 4XUQA 3URFA 5FOJB 2GC1A 1HXS1 3K4AA 4AVCA 3VD5A 1G9DA 3DUIA 1L7LA 3ZYFA 4LKDA 4QPGA 3ON7A 4DEQA 2XKOA 2XG3A 1HJFA 3DECA 4IETA 2VMEA 1COV2 3JB8A 4ZPIA 3ZXLA 4I0AA 4MG2A 2DCZA 4GKXA 4Y3OA 3VDDB 3EQEA 1H30A 1NCRA 4M3CF 2EIGA 2W87A 3ENRA 1PMIA 5CISA 4OI0A 2Y26A 3MLJA 1N3QA 4IW3A 4XFBA 4JGZB 3T3YA 1QJY2 1RGSA 2HWC2 3E6BA 5T5OA 3AMQA 4HLTA 1AR93 5K8SA 4CXWA 4FVVA 5CKMA 3DPRA 1PIV3 2RJKA 3ATGA 3LFMA 2FMDA 3RJRA 1WLWA 1LKNA 2JKBA 5FDBA 1FPN1 3VBOA 4H2AA 1OLRA 3OD0A 3P3PA 5AC93 4UAPA 3S5QA 4AG4A 4HVQA 3RG0A 4C1XA 4Q8LA 4MH0E 1RUC3 2ID4A 2D6MA 4QHBA 5I0RA 2PLV1 5JPMB 4JGYB 1D7PM 3AXDA 1VAVA 2D6NA 3AJYA 4BH9A 4QPIC 1VRH3 1PGW2 2CTVA 3OUHA 4P00B 1OH4A 1TVGA 1UZWA 3H3UA 4FPYA 4AI8A 3WW1A 3RZMA 4K40A 3WZ1A 1EAH3 1LOAA 4FPEA 1XC6A 1UZ0A 3OBZA 4YW6A 2G9FA 4CUGA 2WN3A 4DXTA 1JI6A 1CPNA 1C4RA 4LO7A 5IFTA 1RUI3 1E5HA 2A6WA 2JDPA 4PCRA 3VBUB 3S7EA 3MW3A 1KFUL 2JENA 4Q4V1 1RINA 1OHFA 3JQWA 3R05A 1R1ZA 4BQ5A 1AR62 4COUA 2WLPA 1ONAA 2VG9A 1R092 2R30A 2W1UA 4FFIA 1QOTA 4XCAA 4LHKA 3VZOA 3LA7A 1VBC3 5FY8A 3J26N 3ZMNA 3NAPB 5IVYA 1JS9A 2K9ZA 4BHPA 4C91A 4CDXA 3ELNA 1GZCA 1D4M3 3QOPA 4D94A 2VW2A 3NJZA 2DU1A 3A0KA 5FBZA 2DBNA 1LOGA 1AJKA 2PHFA 3JD73 3MPBA 5GZFA 4BU2A 4LBMA 3H3LA 3WQ1A 3V0AB 5FPUA 4EWEA 2GNMA 2YGLA 1QDOA 1LHUA 4AZZA 1RUOA 2V73A 4PIZA 1HB1A 3PLQA 5EXOA 2E32A 3EYPA 3LGRA 1DQ6A 1YFWA 3CIHA 2ZGQA 4UXAA 2BDRA 4W8JA 3H8OA 5C8CA 4YW2A 2WINB 2RDRA 2WBKA 3NV2A 1US2A 2TNFA 3KF5A 1DZTA 5FZIA 1VE0A 4KWKA 2G9GA 2J1VA 2LROA 5AC91 4FFHA 1UPIA 3FL7A 1DHKB 1UZVA 1RUC1 4P9LA 5IT6A 4XQDA 3GBWA 4PF1A 2ADDA 3AB0A 3GHNA 2RS51 2E6VA 1S2KA 2Z69A 3AYCA 3OUIA 1YNAA 2P3YA 5D8AA 4ES9A 2VU9A 1MQTA 4S2HA 5CU1A 4L11A 2AH2A 4FPFA 2CWSA 1QOSA 1NQJA 1EAH1 3AZWA 4N9HA 3VZLA 3HPNA 4HONA 1BEV1 2YROA 1UYPA 3TYJA 2HWD3 5H9SA 1H1AA 3G7DA 4DMIA 4AE2A 4CP1A 5J37A 4MGYE 4NPMA 1ULCA 5K7PA 2EVXA 4RS5B 1MS3A 2A6YA 2XJPA 3N9QA 2CSGA 5EJ3A 2GN3A 4BYYA 4LIUA 5IYYA 1ZA4A 1LENA 3C7EA 1CAWA 1W8NA 3AKQA 3IZOA 3P1IA 4FQZA 4AI1A 3KQRA 2Z79A 4GH4B 1ALYA 4K3UA 4OULA 5FJKA 4E8DA 3N7LA 3SEPA 1XYPA 1S0EA 3PJYA 1HLCA 1OOPA 3IN9A 3RPQA 3SQOA 5JIUA 5KXDA 5FYHA 4M0NA 3ZXFA 5AVPA 4FTBA 1U5ZA 5KHJA 5E16A 4KH9A 3WW2A 1QJX2 3HEIA 1XU1A 4L9BA 1MS9A 2UWCA 4HXCA 3VBRA 3J7MA 3ZFEA 5E6HA 3G6JB 1ZREA 3LF7A 2X09A 4U2AA 1YFUA 2JEMA 1OD5A 2NN8A 3S30A 2R0HA 4Y22B 1DZRA 1ND2A 2XHKA 4AR2A 4EN9B 1RUH3 1X9TA 5J36A 2NLRA 2R042 2RS32 5FXWA 3CQOA 1AX1A 3KVBA 1MS4A 3ZFFB 3OPTA 4CP2A 1Z78A 3MIHA 4NHXA 3FWEA 4JDNA 2Y8KA 4UW3A 2EXJA 3OGJA 4IERA 3CU7A 3ABZA 2Q8OA 4ARXA 1QQP2 4ISQA 3UKTA 2VNVA 1E5SA 4B29A 2ZTNA 3TNQA 1IPKA 1GQGA 1MEC3 3PUIA 5FPZA 4INDA 5EIYB 5KC6A 3AZVA 1QEXA 1WBLA 5FP4A 4RR3A 2NYYA 3OUJA 4MYEA 4AFDA 1DLCA 4LBQD 1L3JA 4IGOA 1W8ZA 2LM3A 3N3HA 4NIGA 3GM8A 1UN1A 1DIWA 1CN1A 1OF3A 2HWD1 1DDLA 1WLDA 3KV5A 4ATFA 4L92A 1UY3A 1Q8SA 1H1MA 3B02A 2BGCA 3ZSLA 3C7OA 1ZRFA 1JBCA 1R1A2 3RRDA 3LA3A 2HWE2 2XR4A 1X82A 2GAUA 2LRPA 4QGLA 4X6RB 2QDRA 2WNVB 4ZU4A 4FOWA 4K7JA 1IS4A 4A41A 4L2NA 3GDBA 3ITQA 4ES8A 3PJQA 1GOGA 1C5IA 3AP6A 3H50A 1H9WA 1W9YA 2XHNA 4GB32 1WBFA 1OLQA 4HANA 2VBBA 3ETQA 4I01A 3ZSMA 3ZYPA 4LBJA 5C3RA 5CFDC 1O5LA 4YM3A 3BCWA 2XJQA 1QGLA 1O3RA 2CWMA 1H4GA 4H7LA 3ZO0B 4R52A 2OUJA 1OMIA 3N36A 4M3CE 1PVC1 3NO8A 2P6CA 4UW4A 1VBE2 5F3CA 4L99A 1DQ1A 1X8MA 3RZJA 1YFYA 1JODA 3LPGA 1FMD1 1RUD2 1W03A 1BJQA 2PHRA 1QXRA 1RXFA 2QQLA 1F5FA 4LHLA 2CNAA 1UQXA 2ORXA 1CIWA 3THDA 4B1LA 3TEWA 3WP4A 3VV1A 4WVVA 5DZEA 1WMEA 3K3NA 2OW4A 4BJ0A 1BLZA 2P2KA 3J7LA 4JGYA 1G8WA 5AFEA 1JW6A 5ANNA 1GZ9A 3NKTA 5FYMA 4GMP0 1GANA 1PO13 2VZQA 4FTSA 1RUJ2 3NMBA 3FLRA 2Z42A 3K4DA 4YRDA 5F39A 1KS5A 4RD7A 4L0PA 5A1AA 4BQWA 2WYFA 2XB6C 1IQAA 3I2HA 4Q0QA 4OUMA 1I6XA 1BCXA 3OGRA 4QWNA 3O1UA 5ERLA 2BWAA 3TWIA 3FHIB 2WO3A 3ILRA 1RHI3 4GA9A 4QGNA 2SBAA 3AC0A 2BNMA 2RVAA 3DXTA 3H0OA 5L7OB 1AR72 5HCBA 2Y6KA 1J3QA 5ABJA 3K2OA 5G05L 4RFT0 5LA2A 4BMBA 1KGYA 2FDGA 4CDUC 4U36A 4LE3A 3AVSA 5A3TA 2XQXA 3NAPA 3TAYA 3WUCA 4CDWC 4CSWA 1LJ7A 1OC1A 3GGLA 4YW5A 5I0TA 3THTA 1BXHA 1XBFA 2OQ7A 3CJIC 3K77A 2NZ9A 5LEKA 2Q8CA 1H8TB 4E4DX 4QX7A 2W92A 3HAGA 1NLSA 3VHPA 2R16A 2DCTA 4UT5A 1JOJA 3V0AA 2AACA 3I7DA 2BEOA 3MV01 5FZCA 2NMOA 4ZZ5A 2KXLA 4AK3A 1XE0A 4RGKA 5T5LA 3ES4A 4XABA 5E88A 4H14A 4LE4A 1LEDA 4P9GA 4Y5Z0 2XL7A 1D2SA 4CEYA 5JVVA 1ZZ9A 3ZSJA 2J1TA 3D6EA 4COYA 3E6DA 3HBZA 3PMEA 4KQ7A 5LEJA 1J83A 4Y1VA 5FY1A 4OMCA 4GWMA 1H9PA 4FPOB 4IV1A 2RM22 3IIAA 4RHV3 2D6KA 5E89A 2ZEWA 3W20A 2JXAA 1IS5A 4GJZA 4BWOA 1NY71 2B7YA 4FSJA 5GZCA 1VBD2 4ZU5A 1VJ2A 4XACA 4ITCA 2E7QA 4CUBA 4Z2AA 3MW4A 4M01A 1LGCA 4OHWA 1W2TA 4IE4A 2P3JA 1XQNA 2PQSA 1QKQA 3FBMA 4XILA 2HYKA 3RZZA 2W3JA 2QQNA 1UZYA 5I8YA 2DTYA 3H1MA 5JXHA 3UYJA 2W46A 5D21A 3MW2A 5C4WA 4RS5A 3ECQA 5LK5A 3N7JA 1RC6A 5BXXA 1QH7A 2WL1A 3LB9A 5FUIA 4XF9A 5KXCA 4IV3B 4XF0A 1WD3A 3B01A 4HKWA 1Y3TA 1HW5A 1TMF1 4GH4A 4LPLA 2A3YA 3I3BA 4LTAA 4LBNA 1COV1 3SNMA 1XB9A 2HEWF 2JECA 3J9SA 4BLIA 1OSGA 4NWWA 4XJUA 1VBA3 5FZ7A 2WYSA 3PVNA 4AFAA 4UFMA 3I49A 1WMXA 3IAPA 5F5AA 3L2HA 3V56A 1E5RA 1UOJA 2IZWA 1ENXA 4LT5A 3LD8A 1K42A 4XAAA 2E31A 2PA7A 4XHBA 2FDJA 3VBFC 1QNYA 2QQVA 4UFHA 4FPHA 3NRUA 4XFGA 3I59B 4XDPA 1PO23 3KM5A 4Y22A 3ZYHA 2PELA 1AYN3 2ZZQA 1S4CA 4JKKA 2CAUA 1K12A 2VQ0A 4IEYA 3RMXA 4CEWB 5B4NA 1W8UA 3BKZA 1SLCA 1OA2A 5FLIA 1ZZ7A 2GU9A 3NNFA 3B7MA 5FZOB 3IKWA 3ZFFA 2VNRA 2MEV2 5FYTA 5FMOL 5A33B 2JDAA 1PIV2 1HRI3 2ZHKA 2VZTA 4A7KA 4C0HA 2OZJA 3WX5A 4ASLA 3GALA 4LO5B 1S2EA 1PGW1 2ZX1A 3ZFGB 2RMU2 2O0OA 4CDQB 3AK0A 4XJ8A 3BUCA 2W1QA 4F8AA 4LO8A 5FIXA 3N7MA 5IK5A 1W9TA 3M2MA 4JTNA 1L7QA 1WLTA 4NOTA 3C7HA 4QU2A 1HRV1 2RR13 2VCMA 3J8F3 1VMJA 1OKOA 2BV4A 2OZ6A 3AYAA 3WF1A 4RYDA 5FZGA 1WA6X 3GBGA 1SFPA 1VRH2 4L8QA 4H7MA 1ZBE2 1YYNA 4KU7A 4KG0A 1Z7S2 3RWKX 1ZRCA 5JZGB 1PZ8A 4FPGA 3MI8A 2BNOA 1BKZA 1OXCA 2WQZC 3AP9A 2E7TA 3LSEA 1FNYA 1IG3A 4FXKB 1RUI2 5LBFA 5FLHA 4AVAA 5BNOB 4PLMA 4XEZA 4Q8KA 3H7YA 3M8LA 4TLFA 4KU8A 2O1QA 1JU4A 3L9JT 1UMIA 3VD9A 2BBAA 2ZCWA 3FN9A 1LODA 1F4HA 2DV9A 5DAQA 1J1TA 2EIEA 3FJSA 1B35C 2JG8A 3POWA 4KGQA 4Q0UA 3WHTA 2C5DA 2G9ZA 1JZ7A 3F95A 1VBA1 3W58A 1TEIA 2YC2A 2KD7A 2JD4A 5FK7A 4BQ1A 4Q4W1 1GWMA 1NCQC 2VZSA 4HKOA 5FZ4A 4AVSA 1UMZA 1D4M2 1J3PA 5DAVA 2WIIB 2ZX3A 2XUEA 2FCTA 3UT0A 4KGGA 5BV6A 1OFSA 1S0JA 1PO21 1UWWA 2UY8A 4H3WA 1QJU3 1S0GA 1GICA 5FZBA 5F32A 4AXOA 2DBIA 1POV0 1S0DA 1QMJA 1EPWA 1SQ4A 1AF9A 2VAUA 3PIGA 4YVWB 4Q26A 4Y24A 4F83A 2ENRA 4I0BA 4IEZA 5A7NA 5JAXA 1Y9GA 1LNSA 4E8CA 3MFAA 4KBBA 5J3UA 2KM2A 1GNYA 3FLPA 5A6QA 3C8XA 1VAMA 2RG4A 3POIA 2ZXQA 4OMDA 4EZ4A 1NYWA 5JI7A 2WUHA 1BQPA 1RUG3 1N3OA 4R9CA 2X8KA 5FR3A 1REFA 2X5IC 1FV3A 1UYXA 1ZZBA 3LOIA 3THPA 2VVFA 1RUF1 2QKDA 3EXUA 4BDVB 4NWVA 2W95A 4QB2A 1HB2A 4N53B 1URXA 2JDNA 1QIQA 2VMCA 1LU2A 3BB6A 5A1FA 2Y33A 1CESA 2W94A 2DYCA 2OIIA 5F5CA 1UF2C 2DVBA 4CDXB 3ZXKA 1A3KA 2IFWA 1DU3D 2OS2A 4QX3A 1UOFA 4TWTA 4GALA 3SC7X 4XJ9A 4EWAA 4QHOA 4LEJA 5DDJ3 1WWYA 4KMQA 3BN6A 4CU7A 4FPCA 2XJSA 4DNYA 2B8MA 3WVJA 5CFCB 3OSDA 4LK7A 4W50A 2HH9A 4XPVA 3OBAA 4Y1UA 1XRUA 1GLHA 1RIRA 2ZGTA 2ZGRA 4BQYA 3MF9A 4IEOA 2DCYA 4QD2A 2VZ3A 1H8TA 1W3XA 3D8CA 4CPBA 2BFUS 1G9CA 4LNVA 2VOWA 3TBDA 1SFYA 3ACIA 3FMGA 4Q4Y2 3KCCA 3WW3A 3KCYA 2NP0A 3ZDVA 1BMV1 2ZZJA 5C3QA 1PGL1 2WZPP 3LA2A 3HVDA 4ISRA 5JSOA 2O8QA 1PMJX 2BPA2 1OA4A 2B9UA 4B7KA 4K1ZA 1GQHA 4LORA 4DRRA 5IK7A 3MF6A 2I45A 4QPYA 4TZDA 1JYCA 3T4HB 4XAEA 2WQ4A 2A6ZA 3WF3A 1ZBA2 2UURA 1BVVA 2GP3A 1OLMA 4WM8C 5DZGA 1UOBA 3WG1A 1RUH2 1QQP1 2DF7A 1L7RA 3GXUA 4CYDA 4DEVA 1K5MC 3CF6E 4ORFA 4XDOA 4A4AA 5AFBA 3B9IA 1B09A 2G1MA 4XIOA 4QDQA 3WG3A 1GP4A 3ETPA 4MGKE 1HV0A 2WNVC 3K48A 3MBWA 3H3ZA 4MZUA 4OHYA 2P37A 2PQQA 4CU8A 1F15A 2F4LA 5FWJA 3WD5A 3SH3A 2D93A 4LXLA 2EICA 5KHHA 1CAWB 1X33A 5F7UA 2ARXA 4X6QB 4AEMA 3TN91 1QXPA 5FY4A 5A3UA 1MEC2 2BZDA 3O1PA 3AZXA 1OUSA 5JOWA 1AXZA 3R4UA 4FOYA 1O3TA 1BK0A 4MOAA 3WUDA 1DF0A 2HYXA 3HT1A 4XUPA 1R082 4A6SA 3CBNA 4D69A 5C9AC 1RXGA 1VIWB 2MPFA 1R1A1 1W8OA 4C0BA 3WDYA 3B9CA 3TEYA 4YNIA 1CZSA 4WV8A 2XLFA 3CNAA 4NPLA 3I3MA 1H0BA 4IV3A 3LFIA 4AW7A 3T2PA 1W6MB 2EIDA 1Q8VA 3X29B 2DVGA 4A3ZA 4XXAA 1FPN3 4GB31 2D5FA 2L9LA 2WSUA 4BCUA 1CJPA 3OTFA 1E5IA 2YFUA 3AX4A 4GULA 3SLIA 2LW8A 4HK8A 2VM9A 3OBRA 5DZFA 1F9KA 5FYZA 1YJLA 2PLV3 4A42A 1H1IA 3QLQA 5DUWA 1FI2A 1G6NA 1DQ2A 1RVF3 1AYM2 2P5BA 2W91A 1JZ6A 3I59A 3ME2A 3WR0A 1GKBA 1FV2A 4CEWA 2I2SA 2QQUA 2RS12 1RUD1 3MPPG 3HD8B 3FUQA 2ZGUA 4JQTA 2BERA 3FFQA 5CVRA 1NG0A 2EF6A 4PDWB 5A7WB 3SKVA 3D3AA 3IDBB 4O65A 4Q4V3 4D0QA 1FT9A 3AKRA 1FOD1 2QZ3A 3Q9OA 4AAXA 3KQ4B 4X8PA 2GMEA 1AR82 3ZFGA 1D2QA 4E9KA 3U07A 3DYOA 2ZGKA 1ND3C 1UCXA 3Q8CA 5BNPB 4QHZA 1QJEA 1OF4A 4R9BA 4XCBA 1K5JA 2H0VA 1XNDA 3T1MA 1FYUA 1V00A 4HT1T 2WZ8A 5A3LA 1O6UA 3BOWA 4NHMA 5H9RA 4M4PA 3WT3A 4CCCA 4DO0A 4NIHA 1W05A 1Y4WA 1NA1C 1S0FA 2QDNA 2YV8A 4BISA 1VALA 3KCXA 4KL1A 1OBNA 1PO12 4LJHA 4Q4X3 1U5YA 4F7ZA 3K4ZA 5C3PA 2PXJA 3MEPA 4FOVA 2C9KA 5C8WA 3QACA 1TME1 1ASJ2 4LK6A 3OGGA 1W8HA 4YZ3A 3POEA 3UK9A 2ZGNA 1CONA 4CVUA 4LKSA 4O7XA 4LITA 1UW8A 2FHRA 2YGMA 5BNOA 5LCWL 1Q8PA 1RHI2 2BNNA 1AL23 1AZDA 1ZYBA 4EN6B 3R4DB 4FCAA 5D2AA 4BA6A 4DUWA 4AVBA 2FDFA 2XWBB 1SCSA 4EYUA 2R062 3MDPA 4RFRB 1C1FA 4WM7C 4N43B 2ZBJA 3NW4A 1NAEA 3OY8B 3RYPA 3ZDSA 3BTAA 3KHCA 3IT8A 1GMMA 1PNFA 3FE5A 1W39A 3AM2A 3OPZA 1PK6A 4CCMA 2VL4A 5LASA 3WCRA 2RJLA 2GN7A 3VBHC 3WQ7A 3A0NA 3C7GA 2WR9A 2E53A 2RS53 1RVF1 2WA4A 1KEXA 4UF0B 4AI9A 1WZXA 4AVTA 5FOBB 4GMP1 4OI1A 3FHQA 5C70A 2WZR1 1OQEA 4IE6A 5A1LA 4YVWA 3LDBA 3SKJE 3B00A 1BEV3 2BYVE 1CAVB 3BI3A 2Y64A 1YRZA 3VBSA 1SZBA 5H9QA 4A45A 1JYNA 2Y6LA 3RSJA 4I2OA 1CJDA 2RM21 2JKXA 4DUXA 5C5TA 1OD3A 2PFWA 4YYOA 4YM2A 3U4XA 1ZRRA 2F6BA 4MLOA 3WCSA 3RWNA 3VGIA 1DGWA 5BNQA 5ABJB 5FMDA 4DUVA 5EQUA 5BNNC 2B5HA 2Q1MA 4HFSA 1XE7A 2JDZA 5GLZA 4YG0A 5IHRA 3RS6A 5FXVA 5LATA 3GYDA 3ZPYA 2ZHMA 3UV9A 1RMU2 5HCAA 4N53A 4IE0A 3M3IA 1KQRA 1WKYA 3LDKA 4ZU7A 5G04L 3UGGA 5JWPA 5KC5A 2WO1A 3W5MA 2ZABA 2QE3A 3D82A 2ZA9A 3EHKA 4Q4X1 1PZ7A 4XJWA 2ZX4A 5I0DA 2W0XA 4UW5A 1GR3A 1ACCA 2FZ2A 4YGCA 2XXZA 5CFCA 1DCSA 2BOIA 1JOBA 4JKLA 1K45A 4MXVA 4G4FA 3VZMA 2R072 2ZEYA 2VCAA 2VVDA 1AL21 1V70A 1GSLA 1ZNPA 2A6VA 4YW3A 2VOKA 4UYBA 1V9U1 3O1MA 2JDUA 4JHZA 2LUWA 3I2GA 2TBVA 2WFF2 2WO7A 2A73B 2VPVA 4CDQC 5IATA 3WHUA 4CEYB 2PAKA 2E63A 2WFPA 3E5UA 2GMPA 4CCJA 4OHVA 3KV4A 1MVEA 2YBKA 3T2QA 4IV1B 4MGQA 5FUNA 3I3QA 4AQ2A 4K1YA 1UAIA 1W2NA 5CZKA 4QPGC 3KS7A 5DXDA 2WAAA 2QNKA 2HWF3 3RJ2X 2D7FA 2VUDA 1AHSA 2JICA 2MEV1 2B46X 1NCRC 3I4IA 3MIFA 1U12A 1YEWA 4NAOA 2AEZA 4BK4A 1AYN2 4OZOA 1XYNA 3TOJA 1YJKA 2ZMNA 1MS5A 4CCNA 4CCLA 4MHUA 1I5PA 1KJRA 2QZ2A 4PI0A 4UFJA 4YVSB 1MZ6A 3DPRC 2Y6HA 5B4XA 2WNUB 1W6NB 1KJLA 3ST7A 5C4WB 2DUOA 4YW7A 4YZ1A 2XLGA 4WVZA 1YHFA 5ANQA 4IEUA 5A3OA 2EXKA 3DEMA 1MR5A 2ATFA 2X29A 4NHKA 1C8M1 3VBOC 3O1OA 5LY1A 1J58A 4Y20B 4R4ZA 1XSRA 4EV0A 1I5ZA 1ZBE1 4RGGA 1Z7S1 4RL7A 2XVKA 4CTEA 3EBRA 3LSDA 4LOSA 1UL9A 1LHOA 3LQCA 5FV3A 2OVUA 3DXUA 2WNOA 1FX5A 5FK8A 1UU4A 2RR12 4IEPA 2ZMLA 3KF3A 2D3SA 3APBA 5CNAA 3VZKA 2YZ4A 2PHDA 2EALA 4D7SA 4AFBA 1ENSA 3J7HA 4PF5A 1NKGA 2AZ5A 1PVC3 4TYSA 1W6MA 4UFLA 1MVQA 2VQAA 3O14A 3V65A 4WVMB 2WS93 1O59A 2E9QA 5J48A 4IL7A 1FMD3 4WBBA 3SISA 1DQ5A 3PHMA 4HBNA 2JG9B 1S55A 1GZTA 5CBLA 2ARBA 4V1PA 5FPXA 4AHZA 1LHNA 4DIQA 4XUTA 1XU2A 1X7NA 3WV6A 4Q2FA 2FDIA 2VXJA 2BQPA 4E4ZA 3VD4A 1LB2A 2AGSA 1IQDC 4DXZA 1M06G 2G19A 1BBT1 5LB6A 1O7FA 1RL3A 2EA7A 5EHDA 4CDXC 2D43A 1ULEA 2MNGA 2HWF1 5A7WA 2UWAA 4PDWA 5BYNA 1W99A 3EJKA 4Y1XA 3ZXGA 3JU9A 4W65A 4I3PA 4XFIA 5FZAA 4MGIE 4Y5SA 1BK1A 1WW6A 2HWB2 5FTTC 4CP9B 3N9MA 5LBEA 4R9AA 2P34A 3WG4A 2B9VA 3DN7A 4O9GA 2NMNA 4HVRA 3WLUA 4BQXA 4IUGA 1XNTA 3ZN6B 3PUAA 5BNPA 1HV1A 3HJRA 2AENA 3A22A 3PUSA 5KHIA 3O0XA 3POSA 3GNEA 1REEA 4GQ7A 2PAMA 4HKLA 2J22A 4JRAA 5C8CC 5JDBA 5K0UB 3LDRA 4TXWA 1V6OA 4CXYA 4SLIA 3PNAA 1UU5A 4OHXA 2W39A 5HV4A 4LULA 4QPWA 4X8NA 3UKNA 1RUG2 3KB5A 1HB4A 4NIDA 2Q1FA 2JG8B 1Y43B 2P6HA 2VZUA 2XWJB 5I91A 1JZ5A 2XBO2 4PBPA 3ZVXA 4CUAA 3T4VA 4QX0A 2W2IA 4HL0A 2W47A 5FYBA 4NIIA 1PX3A 2OKXA 3O0WA 3WSOA 5D8AC 4PT6A 3JBG2 4XIKA 1MQTC 2ZHLA 1A8DA 3WP5A 5FZ8A 3FZ3A 5JCTA 2QQOA 2E51A 3HQXA 2Q8DA 1EY2A 2VQTA 3RVHA 1SDWA 5FAXA 5DDJ2 3NV1A 4FT8A 3U4SA 1QWRA 1YC61 5CADA 1POV1 3HIFA 1YQ6A 1JYTA 4N90A 2WS91 2XOMA 4N43A 3OY8A 3UJQA 4K8FA 2QQWA 1GWLA 2K46A 2Y6GA 3S57A 1QY4A 1YO8A 4QKFA 1Z0HA 4QKBA 2PHLA 3HQUA 5FP7A 3WDUA 1RTVA 1A34A 2VH9A 1UMHA 3I8TA 3P3NA 2HEYF 4UF0A 4LA3A 4AEDB 2WDBA 1P8JA 2ZGLA 5JXJA 3O1VA 1GU3A 2VUJA 5ACA3 1EV13 1OOPC 3MLKA 1QNWA 3AFKA 4XBNA 4AGVA 4AQTA 3MZHA 3KWVA 5HCFA 1ODNA 4CU9A 1U5XA 1CAVA 2H0BA 1OUXA 4LQRA 3ZYBA 2BRTA 4DXSA 1NZCA 1N1SA 3BYWA 3WNNA 4M4RA 1O3QA 4P9YA 4DQAA 3VBRC 5FZ1A 4QDSA 3ZFEC 2XJUA 3VHNA 3LEGA 4EQVA 2TEPA 2UWBA 3MIDA 1ND2C 1J1LA 2Q4SA 2WQ8A 4E27A 1F31A 2IFRA 3IPVB 1RB8G 1LOCA 4JDMA 1VB2A 1VP6A 3VDAA 5I8TA 1TMF3 1SLIA 2WJSA 3SCHA 1COV3 4P14A 2OUHA 4QKNA 3WEZA 2VR4A 3VL9A 1JYIA 3FX3A 1SLBA 1HXS2 5IVEA 4RQPB 4CCDA 4EWDA 1VBB1 1QJY3 2CDOA 3AKTA 3UETA 3VDCA 1Q8QA 5JUVA 1IHMA 5JPNB 4QX1A 1RJ8A 1W6OB 2HLEA 3AMPA 4MXWA 4B8EA 1AX2A 1DZQA 4RR3C 4YWAA 1FNZA 1MZEA 3OYWB 2EXIA 4HOOA 2N7GA 3ZSKA 4Z82A 4AHXA 4ARYA 1F8VA 1ODMA 1AL0G 3ILNA 3IMNA 1W0OA 4NRMA 1EYBA 2PHUA 2RDQA 2ZACA 4LKFA 4CZSA 5C5UA 3CZUA 1DYOA 2GH2A 1RUE1 2KA3A 2W08A 2WT0A 2WA3A 1UKRA 2J1SA 3JXSA 5A80A 1QOOA 1UNBA 1BHGA 2FMYA 3PMSA 2Y34A 4IESA 1JYVA 4AVVA 1O3SA 4AEKA 1OI6A 3WP3A 1XNCA 4RSUA 2RS11 5A7OA 1XYOA 1LECA 4GAZA 4UBGA 3RDIA 4ZKTB 1GP5A 2CYFA 4XTPA 5LWBA 3GJAA 1VR3A 4NIAA 1HRV3 2VMIA 5ACA1 2WNEA 4P9WA 1EV11 3VDDC 5IVFA 5FPBA 1V6NA 2ERFA 2XJVA 1X36A 4CP0A 3PVEA 1OVPA 4XBLA 5A7SA 4JGZC 2VVEA 2ZPXA 3ACHA 4E4HA 3SEEA 5EJ1B 4YZ5A 2YC4A 5IFPA 3NSTA 1R093 4YVSA 3E5XA 1DQ4A 4GZ9A 2WNUA 1PM4A 1W6NA 2Z4FA 4AQ6A 2H6BA 1F35A 3LE0A 3VHOA 4BM8A 4P9XA 4LBLA 3IWZA 5LY2A 1SEFA 2HKXA 5FFOC 3T2OA 4A2UA 3FLTA 2J1UA 4J6GA 4XBQA 4Y20A 5FQ0B 5GLTA 2HBTA 4Z07A 5F1RA 2FCUA 1AVBA 4BZ4A 1O4YA 1UO9A 1G9FA 5L9RA 1U0AA 4JGYC 5EV7A 1O91A 4QPIB 2DTWA 1H2MA 2G4IA 1QJY1 2HWC1 4Q4W3 1SFNA 4XZPA 3PUQA 2A6XA 3VDBA 2A7AA 1WCSA 2D44A 3PVBB 1XJAA 4TN7A 3VUOA 2A71A 3PDQA 3U14A 2YBPA 4OLLA 4WVMA 2GC2A 2R061 4N7UA 5DAXA 3VBUC 1J84A 3ZN5A 3WY6A 3SXWA 4BB3A 5JOZA 5BPXA 3E5QA 1OH3A 1VLNA 3ZXAC 2JG9A 1AR92 4YGEA 4KWUA 2R1DA 3CZJA 3DCQA 3RI9A 2JDKA 5ABJC 1GZWB 3LAGA 4BPZA 5E8AA 5LZ6A 2D3RA 2R7EB 3NV3A 3MV11 1EUTA 1YUDA 4M3CA 3NAPC 3F2ZA 3ZR6A 4GWIA 1LESA 3N7KA 3N9LA 2NM1A 1WGPA 2DVFA 2E26A 5AC92 3AL6A 4M0HA 3CO2A 4YGDA 2VZVA 1RUF3 2ETEA 4YGBA 3QH6A 1RUC2 2VMHA 2JX9A 2XQRA 4V2WA 2BVVA 5F9TA 3KZ4C 1V0AA 2RS52 5JXGA 3NNJA 1WW7A 1KRIA 3ACLA 5H9PA 4CP9A 3UL2A 1NX9A 1XNAA 1AR61 1CVNA 2VTXJ 1EAH2 5FYYA 4COWA 3Q8FA 3ZM8A 3OJBA 1BEV2 1CD3G 2X10A 1R091 4KG8A 3ZN6A 3KVAA 1UU6A 3QCWA 1D0GA 3POJA 4FAGA 3GBFA 4FXGB 3RNSA 1RMU1 5GLWA 5FZLA 2J7MA 5K0UA 4XXPA 2AUYA 1MS1A 1IKQA 1WD4A 2AEYA 5FMCA 5GLVA 3I2DA 3USUB 3CL1A 4OI2A 2V4AA 2YBSA 1QJX3 2DFCA 1C1LA 2LS6A 5K9YA 4IV1C 1W8FA 1VBC2 2VOTA 1S2BA 4QT6A 5J1XA 1JU3A 1GFF2 1GOHA 3TRSB 5FZFA 5DMYA 1GUIA 1PK6B 4ZY9A 3H9AA 4BIOA 2ARCA 1UX6A 4AF9A 3MIBA 2VBPA 1D0HA 2JIGA 2I74A 3JD72 3EO6A 3O5SA 4CA9A 2YMZA 5FZKA 3WOGA 2IXKA 5LA1A 2XPJA 1QH6A 3DF0A 1WW4A 5I0UA 5C4WC 4FTEA 2FDKA 4RS5C 1QQP3 3D0JA 4ZONA 3VBSB 5FMOS 5HV0A 5CG9A 1T6GC 3CDZB 2R0FA 3M70A 3OF1A 3ZIXA 1Q5OA 2YB7A 2VTXA 5LRRA 1N1TA 4AFMA 4Y5TA 4GH4C 1SBEA 5F6KA 4AEDA 4D8MA 1IS6A 1C5HA 2IXHA 2VY0A 1LU1A 3AYDA 1OT5A 5T54A 1PZ9A 3HOBA 2A3WA 4AGRA 1CAUA 3EB7A 3TN93 3NL1A 2DDUA 4CCEA 3IDCB 4QGMA 4HETA 4EZHA 2ZKNA 1W2UA 2VQUA 3RMYA 1SBFA 3S5AA 1JHNA 5LRSA 1MACA 1JUHA 4XETA 3C2UA 4KWLA 3ROUA 4YZ4A 1UX7A 2FBEA 5JXIA 1IKPA 1LOFA 5EYXA 1R1A3 4MUVA 2WRAA 2HWE3 1CX4A 1QJFA 2LALA 1LGNA 3I2JA 4P9JA 4MVTA 4B7EA 5IK4A 2PN5A 3IPVA 3RZGA 5KXEA 3U75A 1Y7BA 2HWD2 1G7YA 2V5YA 3ZOIA 2HJIA 3FC0A 3ZFFC 5A6YA 1IPSA 3KT4A 4GB33 1N47A 1D4VB 1LHVA 1PMHX 1STMA 3PTRB 1PNGA 1JZ3A 3E1F1 5K4LA 4RQPA 4NO4A 4QB6A 1QJX1 3KLSA 4QU1A 5L9BA 1X8EA 2E33A 2PHTA 4XF4A 1APNA 1W6OA 2KR2A 3ZX7A 2VXRA 3I2FA 1HIXA 3NJXA 3OYWA 5JSRA 1VBE3 2C0ZA 3NJVA 2VBDA 4PJYA 2R041 1W2AX 3ZLIA 2RS31 1RUD3 4CU6A 1I9RA 2X53S 3O7OA 4ZS2A 1ZRDA 5DABA 2J1RA 1NQDA 3MICA 3O1TA 1CPMA 1W6QB 2XJTA 1IOAA 3WNPA 4B1MA 5B2GB 2BUKA 3GCWA 4IEWA 1LCLA 1FOD3 1V6MA 4UWDA 4QXCA 3WQ0A 4OI4A 1F2NA 4RN5A 1XE8A 5T5PA 2QQPA 1LR5A 1FMD2 1MPXA 4YW1A 4JAAA 3JB4C 1JOPA 1RUJ3 3CMGA 4Q0PA 2IXJA 1JHJA 2QJVA 1H6YA 2JG8C 2VCCA 5CFDB 2VW1A 2JB4A 2D40A 3KD4A 5T3NA 2PHXA 1W8WA 2JJ6A 2W68A 3S0MA 3GCXA 1YQ2A 1LRHA 4H55A 5DG2A 5LBBA 1GNZA 3A7QA 1J59A 1WCDJ 3NNMA 1AR73 1TME3 3PU8A 2Z5WA 4JX0A 1MS0A 1DGRA 3GZEA 4W6WA 2XONA 3S6PA 5CG8A 2BBVA 3UJOA 2VMDA 2A70A 3WNXA 1ZZ8A 4FFFA 3ZKYA 2WT1A 5A33A 4YG3A 2HWE1 5J09A 4OZXA 3BTXA 2VD7A 2YFZA 2GALA 5A70A 5FP9A 4BLJA 3OG2A 4CRQA 1JUIA 5FQ0A 4LR4A 2CU5A 1RITA 3NKGA 1V6IA 3VHRA 3VBHA 4BXSV 4IGPA 4S2FA 1DGLA 3ZYIB 2YU2A 5A3MA 3V64A 2WWJA 2FQPA 3I3DA 1REDA 4NPRA 1IPJA 4K21A 4FFGA 4QPIA 4R4XA 2O14A 4A6OA 5LW9A 4PQQA 2OQ6A 3JBG1 4ONUA 4XVHA 4D6QA 1AUYA 4Y4RA 5C6CA 1QJZA 3K51A 4OYUA 4QQPA 2VTFA 5FZEA 3WDWA 1R64A 1KDMA 2VZPA 3AJZA 4JRLA 3I2OA 5HXVA 5CEHA 5E1RA 5FXZA 4GMP3 2WZR3 1VBE1 5FKCA 3RZLA 4TTGA 1JYXA 2GH8A 1HQLA 2IXIA 2VCBA 5M0TA 2XUMA 5FLJA 5GALA 4MGZE 4RA0A 1NE6A 4AI2A 5L7OC 3BTZA 1GZWA 4PQ9A 4IDZA 4QX8A 5C3OA 1S0CA 2RM23 2WLQA 5FP3A 3WW4A 2RDSA 1HN0A 3AZZA 3NV4A 4OFGA 3EMRA 3ZXDA 5DN2A 4CDWB 2P1BA 1IS3A 1OURA 1MS8A 2Z2SB 3VLBB 2XLAA 4OQ8A 3O1SA 1VBD3 3CJIB 1NUKA 2WAOA 5GM0A 4DOUA 1RUJ1 1CAXA 3ZYJB 4AWDA 2WO2A 3HNMA 4B4RA 1H8TC 1MZ5A 3WF0A 1JTZX 1MZFA 4AYUA 4JZRA 3SH4A 2BU9A 1OQDA 3T1LA 2C1FA 3AMHA 2VOXA 1N1YA 4GD4A 1Y9QA 4J1XA 4NAMA 4PI2A 5AVAA 3ZR5A 4Y1YA 2DWRA 4A44A 5C3SA 3IDAA 4IEXA 1AR71 2JE7A 1YI9A 4JV4A 2UU8A 3I97A 2DUQA 4UI9L 4LHNA 2YG0A 2Y0OA 3LOBA 3LEIA 3WNLA 1SDDB 5HI0A 1JN2P 4M00A 1M4WA 3USUA 4MGTA 1V9U3 3BGAA 5FY9A 3VKMA 5IW0A 4LKEA 4LA2A 4J1WA 1ULOA 2K0GA 1TMF2 1WCKA 3ES1A 2AREA 4W4ZA 5FPVA 5FZ0A 4Y26A 5HCHA 1DGWX 1UIJA 4YM0A 4DY3A 2XJRA 1YLLA 3DV8A 5JOYA 1DGRN 3OCPA 5KBFA 1OPMA 4FOQA 3HN3A 2B42B 1W6PB 3M1HA 2CGOA 1KS4A 2WSVA 2MEV3 5CYYA 1CZVA 1O5UA 5T55A 5C71A 5FXXA 2Y0IA 4QQHA 4NJ4A 4Z8BA 2ZKLA 3JQXA 1O8PA 4BQ3A 4PLOA 4MSVA 3RQ0A 4MHRA 2RMU3 4XW3A 2GP5A 1DYKA 4YW4A 4IV3C 1H4HA 2WABA 2BP6A 4Q27A 2EAKA 4UFIA 2B45X 4F3JA 4BOWA 4QXBA 1SCRA 3CHXA 4JHTA 1E57A 4FAHA 2JWPA 5IAVA 3WF2A 5KHGA 3D4KA 1VBD1 1C8M3 3IBMA 4LBOA 4OCTA 1EP0A 1EPZA 1IGOA 2GDFA 1HJGA 1ZBE3 2JIJA 2AR6A 1Z7S3 5GZGA 2E7AA 2WN2A 5I8SA 2BGPA 4RHV2 3VBFB 2Q30A 2CDPA 1H2KA 4C8DA 1HRV2 5FMBA 1YI7A 2ZGSA 5GZDA 5J96B 2XGXA 3KHBA 4PBOA 4D7YA 1W9FA 3FBYA 5FY0A 4CEWC 1PVXA 2GSYA 2R1BA 4MXWB 4FPKA 4JKMA 2HBUA 4URTA 4HMZA 1ZRIA 1NLQA 4I0WB 3VZNA 1G9BA 1XNKA 2A1XA 3PIJA 1LULA 4QDRA 2W9XA 4LUMA 4DXRA 1YWKA 4GXLA 4UFKA 3ILFA 3KT7A 2PMWB 3FUOA 3E6CC 2SLIA 2DVAA 3ZFGC 1C57A 1J3RA 4PIXA 2QFEA 3WDTA 3DYPA 1AXKA 3BPSA 3ZIWA 2NPIA 4IE7A 1H2LA 3WG2A 1KDKA 3HNBM 3UGHA 4BMEA 3CEWA 1BBT3 1VBA2 4FBFA 1BVP1 1YCIA 2VGDA 1QXJA 4BQ2A 3ORJA 5F2WA 1UY2A 3Q8BA 4Q4W2 4EN0A 3N9NA 5JZGC 2OA2A 1AR91 2R49A 4DRVA 1W6QA 4XFAA 1S1AA 1PIV1 3KSCA 4NHLA 2IC1A 1ULFA 1W8TA 1PO22 5JMOA 4E4SA 2PTMA 2W1SA 1RUNA 2C9AA 3OPWA 2VMGA 4QAWA 3JZVA 1W06A 5BNOC 1GYKA 2BTVC 2RMU1 2VZOA 3PU3A 3IAQA 5C7GA 1N3PA 5DUXA 5FJHA 4MO3M 1B35B 3IIIA 3MGUA 3O12A 4IEVA 3ZSEA 1HRI2 3N9OA 4GKYA 1SBDA 2ZOEB 4GWJA 4BIFA 3KT1A 3PL0A 4NRQA 5FUPA 5CFDA 4FPLA 5DUUA 4QQLA 5FPAA 4HG6B 1VRH1 5F8PA 1WLCA 4XF1A 5EFUA 3WXPA 1NCQB 1SACA 2VW0A 1PK6C 4XZUG 5LA9A 3AL5A 4NVPA 1RUF2 4HVOA 2LTNA 5I0SA 5GLUA 3R4SA 5HXMA 1ZZ6A 3VL8A 4LMFA 4Q29A 1WW5A 1GOFA 3J8F2 3POGA 1RUI1 1OPOA 4QKDA 5F3IA 3W21A 1F5JA 2A5ZA 4XHXA 1OKQA 2OPWA 4YVWC 3WDVA 4V2VA 2VZ1A 4YSFA 2XDVA 2QUOA 2GMMA 3VBSC 3AP4A 1POV3 1K3IA 3SCFA 3AMNA 4NR1A 2UYBA 3HT2A 4Q1PA 4Q4Y3 5IVVA 1SG3A 3B94A 1VBC1 3N9PA 1C28A 1C3HA 3BIWE 1JZ2A 3I2IA 4IQPA 4PLNA 3MUY1 2ZGOA 4P02B 2X5IB 4AEJA 2OPKA 3K3OA 2OYZA 4CE8A 3BALA 1D4M1 5IWFA 1YFXA 2GNTA 3A21A 4M3CB 3RZKA 4LO6B 3JD71 3W9AA 3OEAA 4CCOA 4Y4YA 4YFZA 4N53C 3V0BB 1PGL2 4OQ9A 4R8HA 2VOVA 3POFA 1BMV2 1ZBA3 4JDOA 1BZWA 5EJZB 4ASKA 5EWSA 4W6XA 1OFNA 1LOBA 3TEZA 3MFCA 5JR2A 3B69A 3H42B 1IZ3A 2QQJA 1VB4A 3M3OA 4Q0VA 4Q5OA 4CDUA 2MHFA 4DS0A 5SV5A 4TSVA 4WZCA 4CPBD 5CFCC 1YXWA 1QJU2 3I2KA 4CDWA 1PX4A 1W90A 2CAVA 2J1EA 1TNRA 4LLOA 2GNBA 3CJIA 1V6JA 2ZGMA 1HQWA 2WWSA 4FQ4A 5FYVA 5EZWA 1WUVA 2IXLA 2VE1A 2Y6FA 3MO4A 3O0VA 1TQ5A 2YDEA 4JTOA 4PHZA 3WF4A 5KXBA 3QD6A 1JH5A 3THCA 2CV6A 3H1YA 1R083 2VC9A 2VO5A 3M3QA 4EE2A 1VBB3 1UKGA 1GQPA 2ZMKA 1NZIA 4NRPA 4G9SB 2ZEZA 3TN92 3R6SA 2ILMA 1V6LA 1W04A 4SBVA 4BE3A 2CGNA 3ACFA 4IEQA 5A32A 4WM8B 4D7TA 2QQKA 4EN8B 5FO7B 3KGLA 4O9EA 4BK5A 1ZA7A 4FI9A 3VKFC 1ULDA 1K5MB 2DVDA 5F3GA 3H8RA 3BPZA 4YARA 1F4AA 3CLPA 3TB0A 1RUE3 3MIEA 2BW8A 5BUVA 4Q4Y1 4B4QA 2RV9A 4ASMB 2QQIA 1AYM3 2CL2A 4IE5A 4LUKA 5GKAC 4ZXKA 3VDDA 3I54A 3WNKA 1WA4A 4QX2A 2JDYA 2ZX0A 4XFCA 4E2QA 4COVA 1ZZCA 2RS13 5J98B 4JGZA 5IVJA 2IVJA 1Q43A 4QQOA 1W6PA 3HR9A 1RYYA 2JE8A 4I02A 5L9VA 1W0NA 2D3PA 3H8UA 2D6OX 4UBHA 2XMLA 3VZJA 4ATEA 4DINB 1CAUB 1ZBA1 4QX5A 5C9AB 4K8RB 2YHJA 1Q56A 1W3VA 1RUH1 5F2SA 3RFRA 1FAYA 3PUHA 5FREA 1AR83 5EP9A 5JLVA 4XMAA 1UY4A 1NXD1 2ET1A 1YQ5A 3U78A 3P6BA 1GWKA 3GZUC 2FZ1A 1OA3A 3AYEA 3IB3A 2UY9A 3S7IA 2XKPA 3PVOA 4NN0A 2P3IA 3J4UH 4ZHNA 1TG7A 1UY1A 2VNOA 1FOD2 4YG6A 3HNYM 4A7YA 4YZ2A 3RYRA 1JYWA 3BU0A 2W5FA 1QDCA 4JQRA
chains in the Genus database with same CATH topology
5KHKA 2PAEA 1HQNA 3AP7A 1MEC1 1GV9A 3AKPA 3W59A 1ASJ3 3VBFA 5T50A 1R081 4FO9A 5IUQA 3VBUA 3AKSA 2HWC3 4XTMA 2D6LX 3U11A 3VKNA 3M4FA 2ZHNA 4S2DA 4QM9A 4COZA 1TME2 1AXYA 4B3NA 4PDWC 2HEVF 1KFXL 2R063 5JIAA 2D97A 4AHYA 4RGAA 4XDQA 1HKDA 4OUSA 1ND3B 4LBQB 5BNPC 2GZWA 1AYM1 1FPN2 2A3XA 2K2SA 2Y38A 5T52A 4A7ZA 1NA1B 4W6YA 4Z2WA 1UD1A 2QVSB 3KMHA 4XE9A 2PLV2 3ALQA 1VAKA 3B5LB 3MIGA 1AJOA 1RVF2 3AP5A 3N4MA 2WC2A 2D6PA 2WT2A 1WMFA 5JR7B 2WZR2 2Q0AA 4YLZA 1AR63 4AGGA 1CGPA 1AR81 5BY5A 2GC0A 1DQ0A 1XNBA 5F6LB 1ENQA 4WVWA 5L36A 2GNDA 3B3QE 1B35A 5EYYA 1V6KA 3CJXA 4KWJA 1RMU3 2VUAA 4Q4V2 4WM7B 2ZX2A 1KXGA 3JCIA 5A33B 1QF3A 4N43C 3GHMA 2VULA 3U10A 4Y1ZA 1LTEA 3U0ZA 2ZAAA 1NOVA 3H7JA 1NCQA 3VBHB 1PO11 4XFFA 3FFZA 1SLLA 4K6BA 1H8VA 5L19A 4FP3A 1ASJ1 3M3CA 3ZYRA 3VKLA 3DL3A 2V09A 4MV2A 4HPKB 4HZFA 1ZX5A 5JMCA 1C8NA 4DFSA 2R073 3OBTA 2QCSB 1RHI1 1RJ7A 4Q4X2 1ULGA 3WP6A 3AFGA 3C3VA 1YIPA 1I3HA 2H6CA 2WFF3 4I3GA 4EROA 2ZGPA 3OD4A 2DURA 2BWCA 3JUUA 2XVLA 5BNNB 1O4TA 1YIFA 1DFQA 1AL22 2X5IA 2I07B 4S2GA 5FO9B 1V9U2 3SHRA 4A3XA 2CGPA 2XL9A 3AMMA 3N35A 4LO4B 4XQ4A 1A78A 2BVBA 3V0BA 5IK8A 5JOXA 1DLLA 4XF3A 4L97A 1CAXB 1SLAA 4QMAA 2F4PA 1AX0A 2DCJA 5JI9A 3ZXJA 4IXLA 4D3WA 4EN7B 1LEMA 3NVCA 4LBKA 4R9DA 3H1WA 3INAA 3GZTB 4LLFA 3VKOA 4QM8A 3ASIA 4I30A 1CQ9A 4DPNA 4OVEA 4HSLA 4KU7A 1OQ1A 3LZZA 1QHDA 4HK9A 4RHV1 1DG6A 5FCCA 1PGSA 4CEYC 3D5OA 3ZMOA 4Z92B 3DGTA 1C8M2 4XJAA 4GWNA 4XOGA 3ZYGA 4DZGA 3IM0A 4META 1FXZA 4QPGB 2P17A 4XMIA 2ZAHA 4EJRA 1LHWA 3USSA 1NCRB 4DB5A 1WMDA 1JXNA 3IDEA 2R071 4WM8A 2R043 3WINE 2RS33 4OHZA 1K5MA 1A6CA 1KD7A 1S0BA 2JE9A 2D5HA 3DPRB 2W52A 4JCKA 4ATFA 2WFF1 2RHPA 3R0RA 2WNVA 4YVSC 2R6QA 3MLLA 5T5JA 2WNUC 2DU0A 4WZFA 3VBOB 2BFUL 2PHWA 3E97A 2WKKA 4JC1A 3B93A 4I09A 1CR7A 1DYPA 2VNGA 3RI8A 2IWGB 1SMVA 5C9AA 2AYHA 1H2NA 2HWB3 1BBT2 1AYN1 1PM7A 5JSPA 5HBAA 2ET7A 2HWF2 3HMYA 4GIQA 3SCGA 5FRAA 4Z1VA 5KWRA 1U5IA 1Q3EA 1HRI1 2DUPA 5CAZA 2B39A 5D1IA 4XYXA 4AI3A 3SMHA 4QXKA 1SLTA 3BOPA 2JG9C 4C1WA 2DFBA 1Q8OA 3POYA 2IXCA 3UKVA 2XBO3 2A75A 3M7AA 4Q1RA 2NQYA 3AXEA 5L73A 4N7IA 1O4ZA 2RR11 1LGBA 3J8F1 5CB7A 4UW6A 3VN4A 3JBG3 2Q1ZB 4AQSA 1ENRA 1W0PA 5CA6A 2P3KA 2ZS6B 1HDKA 1GBGA 1GNHA 1TE1B 5L7OA 4P5HA 1PHMA 1N1VA 3HWJA 2GC3A 3HN1A 3QH7A 3AZYA 3M3EA 1X50A 2RE9A 1G9AA 1ND3A 2R32A 4LBQA 1PVC2 5C8CB 2XVGA 3GZAA 4AFCA 4PIYA 2WS92 2D98A 3TNPB 5K0UC 2Q5TA 1XXNA 1NA1A 3RYKA 1UPSA 5LK7B 3ZN4A 1DBNA 1BYHA 4P9IA 2YC0A 2YY1A 5TSWA 4QQ2A 4HSJA 1ZVFA 1HX6A 5D8AB 1MQTB 2HWB1 3LKJA 1QJU1 2EXHA 5DG1A 4FPJA 4HN1A 4AHWA 3SH5A 2ZJCA 2VECA 3D0SA 2UYAA 2EAAA 2DCKA 4WM7A 4E2SA 1LOEA 3ZXEA 1NXMA 4XQWA 1HXS3 1RUG1 4KNCA 3GF6A 5GJ6A 4FP2A 1G86A 4G3YC 3A4UA 2XBO1 3QBQA 3BODA 5I93A 2PYTA 4YM1A 4AEDC 1OOPB 2O8OA 5CIRA 1A8MA 5DUVA 4HPKA 3NWKA 2YPJA 3LWCA 3MYXA 4C90A 1VBB2 4HN0A 5GZEA 1TNFA 1UZZA 3BU7A 1S0IA 4E2GA 4N9IA 5DDJ1 3VBRB 1NE4A 3ZFEB 4AI0A 4Q0SA 4JVAA 1ND2B 5F5QA 1LOFC 4DY5A 1I1EA 5J7MA 1NLRA 5BNNA 3LCPA 1UIKA 4CDUB 3WDXA 3PTYA 4B4PA 1RUE2 1ZM1A 2CY6A 3SITA 2YXSA 3T2TA 4K20A 4MX3A 4YFWA 1QU0A 3KGZA 4RQPC 4XJZA 2YYOA 1KITA 4RR3B 1NY72 5ACA2 1EV12 5SV8A 2ES3A 4K9SA 1FATA 2XH6A 3L2YA 5A32B 2YUEA 4CDQA 4XFHA 3DKWA 2TUNA 5FO8B 3URFA 5FOJB 2GC1A 1HXS1 4AVCA 1G9DA 3DUIA 4QPGA 2XKOA 2XG3A 4IETA 1COV2 3JB8A 3ZXLA 4I0AA 2DCZA 4GKXA 3VDDB 3EQEA 1H30A 1NCRA 4M3CF 2EIGA 3ENRA 1PMIA 4OI0A 2Y26A 3MLJA 1N3QA 4XFBA 4JGZB 1QJY2 1RGSA 2HWC2 3E6BA 5T5OA 3AMQA 4HLTA 1AR93 5K8SA 4FVVA 3DPRA 1PIV3 2RJKA 3ATGA 2FMDA 3RJRA 1WLWA 1LKNA 2JKBA 5FDBA 1FPN1 3VBOA 1OLRA 3OD0A 3P3PA 5AC93 4AG4A 4HVQA 3RG0A 4C1XA 4Q8LA 4MH0E 1RUC3 2D6MA 4QHBA 5I0RA 2PLV1 5JPMB 4JGYB 3AXDA 1VAVA 2D6NA 3AJYA 4BH9A 4QPIC 1VRH3 1PGW2 2CTVA 4AI8A 3H3UA 4FPYA 3WW1A 4K40A 3WZ1A 1EAH3 1LOAA 4FPEA 2G9FA 1CPNA 1C4RA 4LO7A 1RUI3 2A6WA 3VBUB 4PCRA 3S7EA 3MW3A 1KFUL 2JENA 4Q4V1 1RINA 1OHFA 3JQWA 3R05A 1R1ZA 1AR62 4COUA 2WLPA 1ONAA 2VG9A 1R092 2R30A 1QOTA 4LHKA 3VZOA 3LA7A 1VBC3 3ZMNA 3J26N 3NAPB 2K9ZA 4BHPA 4C91A 4CDXA 3ELNA 1GZCA 1D4M3 3QOPA 4D94A 2VW2A 3NJZA 2DU1A 3A0KA 5FBZA 2PHFA 1LOGA 1AJKA 3JD73 3MPBA 5GZFA 4LBMA 3WQ1A 3V0AB 4EWEA 2GNMA 2YGLA 1QDOA 1LHUA 1RUOA 2V73A 4PIZA 3PLQA 5EXOA 3LGRA 1DQ6A 1YFWA 2ZGQA 4UXAA 5C8CA 4YW2A 2WINB 3NV2A 2TNFA 1DZTA 4KWKA 2G9GA 5AC91 1UPIA 1DHKB 5IT6A 1RUC1 4P9LA 4XQDA 3GBWA 3AB0A 3GHNA 2RS51 2E6VA 1S2KA 2Z69A 3AYCA 1YNAA 5D8AA 4ES9A 2VU9A 1MQTA 4S2HA 5CU1A 4L11A 2AH2A 4FPFA 2CWSA 1QOSA 1NQJA 1EAH1 3AZWA 4N9HA 3VZLA 1BEV1 2YROA 3TYJA 2HWD3 5H9SA 1H1AA 3G7DA 4DMIA 4AE2A 4CP1A 5J37A 4MGYE 1ULCA 5K7PA 2EVXA 4RS5B 1MS3A 2A6YA 2XJPA 5EJ3A 2GN3A 4BYYA 1ZA4A 1LENA 1CAWA 3AKQA 4AI1A 4FQZA 3KQRA 2Z79A 4GH4B 1ALYA 4K3UA 4OULA 3N7LA 1XYPA 1S0EA 3PJYA 1HLCA 1OOPA 3IN9A 3RPQA 5JIUA 5KXDA 4M0NA 3ZXFA 5AVPA 4FTBA 1U5ZA 5KHJA 5E16A 4KH9A 3WW2A 1QJX2 1XU1A 4L9BA 1MS9A 2UWCA 3VBRA 3ZFEA 3G6JB 1ZREA 4U2AA 1YFUA 2JEMA 1OD5A 2NN8A 3S30A 2R0HA 4Y22B 1DZRA 1ND2A 2XHKA 4EN9B 1RUH3 5J36A 2NLRA 2R042 2RS32 1AX1A 1MS4A 3ZFFB 4CP2A 1Z78A 3MIHA 3FWEA 4JDNA 4UW3A 2EXJA 3OGJA 4IERA 3CU7A 2Q8OA 1QQP2 4ISQA 3UKTA 4B29A 2ZTNA 3TNQA 1IPKA 1GQGA 1MEC3 5FPZA 4INDA 5KC6A 3AZVA 1WBLA 4RR3A 2NYYA 4MYEA 4AFDA 4LBQD 1L3JA 2LM3A 3N3HA 1UN1A 1DIWA 1CN1A 2HWD1 1DDLA 1WLDA 4L92A 1Q8SA 1H1MA 3B02A 2BGCA 3ZSLA 1ZRFA 1JBCA 1R1A2 3RRDA 3LA3A 2HWE2 1X82A 2GAUA 4QGLA 4X6RB 2QDRA 2WNVB 4ZU4A 4FOWA 4K7JA 1IS4A 4L2NA 4ES8A 3PJQA 1C5IA 3AP6A 3H50A 1H9WA 4GB32 1WBFA 1OLQA 4HANA 4I01A 3ETQA 3ZSMA 3ZYPA 5CFDC 4LBJA 1O5LA 4YM3A 3BCWA 2XJQA 1QGLA 1O3RA 2CWMA 1H4GA 4H7LA 3ZO0B 4R52A 2OUJA 1OMIA 3N36A 4M3CE 1PVC1 3NO8A 4UW4A 1VBE2 4L99A 1DQ1A 1X8MA 1YFYA 1FMD1 1RUD2 1BJQA 2PHRA 1QXRA 1F5FA 4LHLA 2CNAA 1CIWA 3WP4A 3VV1A 4WVVA 5DZEA 1WMEA 5AFEA 2OW4A 2P2KA 4JGYA 1G8WA 1JW6A 1GZ9A 3NKTA 4GMP0 1GANA 1PO13 4FTSA 1RUJ2 3FLRA 2Z42A 4YRDA 1KS5A 4RD7A 2XB6C 1IQAA 4Q0QA 4OUMA 1I6XA 1BCXA 2BWAA 3TWIA 3FHIB 3ILRA 4GA9A 1RHI3 4QGNA 2SBAA 2BNMA 3H0OA 5L7OB 1AR72 5HCBA 5ABJA 1J3QA 4RFT0 4BMBA 4CDUC 4U36A 4LE3A 3NAPA 3TAYA 3WUCA 4CDWC 1LJ7A 4YW5A 5I0TA 3THTA 1BXHA 3CJIC 5LEKA 2NZ9A 1H8TB 4E4DX 3HAGA 1NLSA 3VHPA 2R16A 2DCTA 1JOJA 3V0AA 3I7DA 2BEOA 2NMOA 2KXLA 4AK3A 5T5LA 3ES4A 5E88A 4H14A 4LE4A 1LEDA 4P9GA 4Y5Z0 2XL7A 1D2SA 4CEYA 5JVVA 1ZZ9A 3ZSJA 3D6EA 4COYA 3E6DA 3HBZA 3PMEA 4KQ7A 5LEJA 4Y1VA 4GWMA 1H9PA 4FPOB 4IV1A 2RM22 3IIAA 4RHV3 2D6KA 5E89A 2JXAA 1IS5A 4BWOA 1NY71 2B7YA 4FSJA 5GZCA 1VBD2 4ZU5A 1VJ2A 4ITCA 2E7QA 3MW4A 4M01A 1LGCA 4OHWA 2P3JA 1XQNA 3FBMA 1QKQA 4XILA 5I8YA 2HYKA 3RZZA 1UZYA 2DTYA 3H1MA 3MW2A 5C4WA 4RS5A 3ECQA 5LK5A 3N7JA 1RC6A 5BXXA 1QH7A 2WL1A 3LB9A 4XF9A 5KXCA 4IV3B 4XF0A 1WD3A 3B01A 4HKWA 1Y3TA 1HW5A 1TMF1 4GH4A 2A3YA 4LTAA 3SNMA 4LBNA 1COV1 2HEWF 2JECA 4BLIA 3J9SA 1OSGA 4NWWA 4XJUA 1VBA3 3PVNA 4AFAA 3L2HA 3V56A 2IZWA 1ENXA 4LT5A 2PA7A 4XHBA 3VBFC 1QNYA 4FPHA 4XFGA 3I59B 4Y22A 1PO23 3KM5A 2PELA 1AYN3 2ZZQA 4CEWB 2CAUA 2VQ0A 4IEYA 3RMXA 1SLCA 1OA2A 5FLIA 1ZZ7A 2GU9A 3B7MA 3IKWA 3ZFFA 2VNRA 2MEV2 5FMOL 1PIV2 1HRI3 2ZHKA 4A7KA 4C0HA 2OZJA 3WX5A 4ASLA 3GALA 4LO5B 1PGW1 2ZX1A 3ZFGB 2RMU2 2O0OA 4CDQB 3AK0A 4XJ8A 4F8AA 4LO8A 5IK5A 3N7MA 3M2MA 4JTNA 1WLTA 4NOTA 4QU2A 1HRV1 2RR13 3J8F3 2OZ6A 3AYAA 3GBGA 1VRH2 4L8QA 4H7MA 1ZBE2 1YYNA 4KG0A 1Z7S2 1ZRCA 5JZGB 1PZ8A 4FPGA 3MI8A 2BNOA 1BKZA 2WQZC 3AP9A 2E7TA 3LSEA 1FNYA 4FXKB 1RUI2 5FLHA 4AVAA 5BNOB 4PLMA 4XEZA 4Q8KA 3H7YA 3M8LA 4TLFA 4KU8A 2O1QA 3L9JT 2ZCWA 1LODA 2DV9A 1J1TA 3FJSA 1B35C 2JG8A 3POWA 4KGQA 4Q0UA 3WHTA 2C5DA 1VBA1 3W58A 1TEIA 2JD4A 4BQ1A 4Q4W1 1NCQC 4HKOA 4AVSA 1UMZA 1D4M2 1J3PA 2WIIB 2ZX3A 4KGGA 5BV6A 1OFSA 1S0JA 1PO21 2UY8A 4H3WA 1QJU3 1S0GA 1GICA 4AXOA 1POV0 1S0DA 1QMJA 4YVWB 1EPWA 1SQ4A 1AF9A 4Q26A 4Y24A 4F83A 2ENRA 4I0BA 4IEZA 5JAXA 3MFAA 4KBBA 5J3UA 2KM2A 3FLPA 1VAMA 1NYWA 5JI7A 1BQPA 1RUG3 1N3OA 4R9CA 2X8KA 1REFA 2X5IC 1FV3A 1ZZBA 3LOIA 3THPA 2VVFA 1RUF1 2QKDA 3EXUA 4NWVA 4N53B 1URXA 3BB6A 1LU2A 1CESA 2DYCA 2OIIA 1UF2C 2DVBA 4CDXB 3ZXKA 1A3KA 2IFWA 1DU3D 4TWTA 4GALA 4XJ9A 4EWAA 4LEJA 5DDJ3 4FPCA 2XJSA 4DNYA 2B8MA 3WVJA 5CFCB 4XPVA 4Y1UA 1XRUA 1GLHA 1RIRA 2ZGTA 2ZGRA 3MF9A 4IEOA 2DCYA 4QD2A 3D8CA 1H8TA 2BFUS 1G9CA 4LNVA 2VOWA 3TBDA 1SFYA 3FMGA 4Q4Y2 3WW3A 3KCCA 2NP0A 3KCYA 1PGL1 1BMV1 2ZZJA 2WZPP 3LA2A 4ISRA 5JSOA 2O8QA 2BPA2 1OA4A 2B9UA 4B7KA 4K1ZA 1GQHA 4DRRA 5IK7A 3MF6A 2I45A 4QPYA 4TZDA 1JYCA 2WQ4A 2A6ZA 1ZBA2 2UURA 1BVVA 4WM8C 5DZGA 3WG1A 1RUH2 1QQP1 2DF7A 4CYDA 5AFBA 1K5MC 3CF6E 4ORFA 3B9IA 1B09A 3WG3A 4XIOA 4MGKE 4MZUA 1HV0A 2WNVC 3K48A 3H3ZA 4OHYA 2P37A 2PQQA 3WD5A 3SH3A 2D93A 5KHHA 1CAWB 1X33A 2ARXA 4X6QB 4AEMA 3TN91 1QXPA 1MEC2 3AZXA 5JOWA 1O3TA 1AXZA 3R4UA 4FOYA 3WUDA 1DF0A 3HT1A 1R082 4D69A 5C9AC 1VIWB 2MPFA 1R1A1 4C0BA 3WDYA 3B9CA 4YNIA 4WV8A 2XLFA 3CNAA 1H0BA 4IV3A 4AW7A 1W6MB 1Q8VA 3X29B 2DVGA 4XXAA 1FPN3 4GB31 2D5FA 2WSUA 4BCUA 1CJPA 3OTFA 3AX4A 4GULA 3SLIA 4HK8A 3OBRA 5DZFA 1F9KA 1YJLA 2PLV3 1H1IA 3QLQA 5DUWA 1FI2A 1G6NA 1DQ2A 1RVF3 1AYM2 3I59A 3ME2A 3WR0A 1GKBA 1FV2A 4CEWA 2I2SA 2RS12 1RUD1 3MPPG 3HD8B 3FUQA 2ZGUA 3FFQA 5CVRA 1NG0A 2EF6A 4PDWB 3IDBB 4Q4V3 1FT9A 3AKRA 1FOD1 2QZ3A 3Q9OA 4X8PA 2GMEA 1AR82 3ZFGA 1D2QA 4E9KA 3U07A 2ZGKA 1ND3C 1UCXA 5BNPB 4R9BA 2H0VA 1XNDA 3T1MA 1FYUA 1V00A 4HT1T 5A3LA 3BOWA 5H9RA 4NHMA 3WT3A 1NA1C 1S0FA 2QDNA 2YV8A 1VALA 3KCXA 4KL1A 1PO12 4Q4X3 4F7ZA 5JZGA 1U5YA 3MEPA 4FOVA 5C8WA 3QACA 1TME1 1ASJ2 3OGGA 4YZ3A 3UK9A 2ZGNA 1CONA 1UW8A 2FHRA 2YGMA 5BNOA 1Q8PA 1RHI2 2BNNA 1AL23 1AZDA 1ZYBA 4EN6B 3R4DB 4FCAA 4BA6A 4AVBA 2XWBB 1SCSA 2R062 3MDPA 1C1FA 4WM7C 4N43B 2ZBJA 3NW4A 3OY8B 3RYPA 3ZDSA 3BTAA 3IT8A 1PNFA 3FE5A 3OPZA 1W39A 3AM2A 1PK6A 3WCRA 2RJLA 2GN7A 3VBHC 3WQ7A 3A0NA 2E53A 2RS53 1RVF1 2WA4A 4AVTA 5FOBB 4GMP1 4OI1A 2WZR1 1OQEA 4YVWA 3B00A 1BEV3 2BYVE 1CAVB 1YRZA 3VBSA 5H9QA 3RSJA 4I2OA 1CJDA 2RM21 2PFWA 4YYOA 4YM2A 3U4XA 1ZRRA 2F6BA 4MLOA 3WCSA 3RWNA 3VGIA 1DGWA 5BNQA 5ABJB 5BNNC 2B5HA 2Q1MA 4HFSA 1XE7A 2JDZA 5GLZA 4YG0A 3RS6A 3GYDA 3ZPYA 2ZHMA 3UV9A 1RMU2 5HCAA 4N53A 4ZU7A 3M3IA 1KQRA 5JWPA 5KC5A 2ZABA 2QE3A 3D82A 2ZA9A 3EHKA 4Q4X1 1PZ7A 4XJWA 2ZX4A 2W0XA 4UW5A 1GR3A 2FZ2A 4YGCA 5CFCA 4MXVA 4G4FA 3VZMA 2R072 2VVDA 1AL21 1V70A 1GSLA 1ZNPA 2A6VA 4YW3A 2VOKA 1V9U1 2LUWA 2TBVA 2WFF2 2A73B 2VPVA 4CDQC 3WHUA 4CEYB 2PAKA 2E63A 2WFPA 3E5UA 2GMPA 4OHVA 1MVEA 4IV1B 4AQ2A 4K1YA 1UAIA 4QPGC 3KS7A 5DXDA 2QNKA 2HWF3 3RJ2X 2D7FA 1AHSA 2JICA 2MEV1 2B46X 1NCRC 3I4IA 3MIFA 1U12A 1AYN2 1XYNA 3TOJA 1YJKA 2ZMNA 1MS5A 1KJRA 2QZ2A 4YVSB 1MZ6A 3DPRC 2WNUB 1W6NB 1KJLA 3ST7A 5C4WB 2DUOA 4YZ1A 2XLGA 4WVZA 1YHFA 4IEUA 2EXKA 1MR5A 2ATFA 2X29A 4NHKA 1C8M1 3VBOC 1J58A 4Y20B 4R4ZA 4EV0A 1I5ZA 1ZBE1 4RGGA 1Z7S1 4RL7A 2XVKA 4CTEA 3EBRA 3LSDA 1UL9A 1LHOA 2OVUA 1FX5A 1UU4A 2RR12 4IEPA 2ZMLA 2D3SA 3APBA 5CNAA 3VZKA 2YZ4A 2PHDA 2EALA 4D7SA 4AFBA 1ENSA 4PF5A 2AZ5A 1PVC3 4TYSA 1W6MA 1MVQA 2VQAA 3O14A 3V65A 4WVMB 2WS93 2E9QA 5J48A 4IL7A 1FMD3 4WBBA 3SISA 1DQ5A 3PHMA 4HBNA 2JG9B 1S55A 5CBLA 2ARBA 4V1PA 5FPXA 4AHZA 1LHNA 1XU2A 1X7NA 3WV6A 4Q2FA 4E4ZA 2BQPA 1LB2A 2AGSA 4DXZA 1M06G 1BBT1 1O7FA 1RL3A 2EA7A 4CDXC 2D43A 1ULEA 2MNGA 2HWF1 2UWAA 4PDWA 5BYNA 3EJKA 4Y1XA 3ZXGA 3JU9A 4W65A 4I3PA 4XFIA 4MGIE 1BK1A 1WW6A 2HWB2 5FTTC 4R9AA 2P34A 3WG4A 3DN7A 4O9GA 2NMNA 4HVRA 3WLUA 3ZN6B 5BNPA 1HV1A 2AENA 5KHIA 3O0XA 3POSA 3GNEA 1REEA 4GQ7A 2PAMA 4HKLA 4JRAA 5C8CC 5JDBA 5K0UB 1V6OA 4SLIA 3PNAA 1UU5A 4OHXA 2W39A 4LULA 4X8NA 3UKNA 1RUG2 3KB5A 2XWJB 2JG8B 1Y43B 5I91A 2XBO2 4PBPA 3ZVXA 4HL0A 3O0WA 5D8AC 4XIKA 3JBG2 1MQTC 2ZHLA 1A8DA 3WP5A 3FZ3A 5JCTA 2E51A 3HQXA 1EY2A 1SDWA 5FAXA 5DDJ2 3NV1A 4FT8A 5CADA 1QWRA 1POV1 3HIFA 4N90A 2WS91 4N43A 3OY8A 3UJQA 4K8FA 1QY4A 1YO8A 1Z0HA 2PHLA 3WDUA 1RTVA 2VH9A 3I8TA 4DINB 3P3NA 2HEYF 4AEDB 4LA3A 2ZGLA 2VUJA 5ACA3 1EV13 1OOPC 3MLKA 1QNWA 3AFKA 4XBNA 4AGVA 4AQTA 3MZHA 5HCFA 1U5XA 1CAVA 2H0BA 1NZCA 1N1SA 1O3QA 4P9YA 4DQAA 3VBRC 3ZFEC 2XJUA 3VHNA 2TEPA 2UWBA 3MIDA 1ND2C 1J1LA 2Q4SA 4E27A 1F31A 2IFRA 3IPVB 1RB8G 1LOCA 4JDMA 1VB2A 1VP6A 5I8TA 1TMF3 1SLIA 2WJSA 3SCHA 1COV3 4P14A 2OUHA 3VL9A 1JYIA 3FX3A 1SLBA 1HXS2 4RQPB 4EWDA 1VBB1 1QJY3 3AKTA 1Q8QA 1IHMA 5JPNB 1RJ8A 1W6OB 3AMPA 4MXWA 4B8EA 1AX2A 1DZQA 4RR3C 1FNZA 1MZEA 3OYWB 2EXIA 2N7GA 3ZSKA 4Z82A 4AHXA 1F8VA 1AL0G 3ILNA 3IMNA 1W0OA 4CZSA 1EYBA 2PHUA 2ZACA 2GH2A 2KA3A 1RUE1 2W08A 2WT0A 2WA3A 1UKRA 1QOOA 2FMYA 3PMSA 4IESA 4AVVA 1O3SA 4AEKA 1OI6A 3WP3A 1XNCA 4RSUA 2RS11 1XYOA 1LECA 4UBGA 3RDIA 4ZKTB 2CYFA 4XTPA 1VR3A 1HRV3 2VMIA 5ACA1 2WNEA 4P9WA 1EV11 3VDDC 1V6NA 2ERFA 2XJVA 1X36A 4CP0A 3PVEA 4XBLA 4JGZC 2VVEA 2ZPXA 4YZ5A 3NSTA 1R093 4YVSA 3E5XA 1DQ4A 4AQ6A 2WNUA 1W6NA 5C33A 2H6BA 3VHOA 4BM8A 4P9XA 4LBLA 3IWZA 1SEFA 2HKXA 5FFOC 4A2UA 3FLTA 4XBQA 4J6GA 4Y20A 5FQ0B 5GLTA 4Z07A 5F1RA 1AVBA 4BZ4A 1O4YA 1G9FA 1U0AA 4JGYC 5EV7A 1O91A 4QPIB 2DTWA 1H2MA 2G4IA 1QJY1 2HWC1 4Q4W3 1SFNA 4XZPA 2A6XA 2A7AA 1WCSA 2D44A 3PVBB 3VUOA 2A71A 4OLLA 4WVMA 2GC2A 2R061 4N7UA 3VBUC 3ZN5A 5JOZA 3WY6A 3SXWA 5BPXA 3E5QA 1VLNA 3ZXAC 2JG9A 1AR92 4YGEA 2R1DA 3RI9A 5ABJC 1GZWB 3LAGA 4BPZA 5E8AA 2D3RA 3NV3A 1YUDA 4M3CA 3NAPC 1LESA 3N7KA 2NM1A 1WGPA 2DVFA 5AC92 4M0HA 3CO2A 4YGDA 1RUF3 2ETEA 4YGBA 3QH6A 1RUC2 2VMHA 2JX9A 2BVVA 5F9TA 3KZ4C 2RS52 1WW7A 1KRIA 3ACLA 5H9PA 3UL2A 1AR61 1CVNA 4COWA 1EAH2 3OJBA 1BEV2 1CD3G 4KG8A 1R091 3ZN6A 1UU6A 3QCWA 1D0GA 4FAGA 3GBFA 4FXGB 3RNSA 1RMU1 5GLWA 5K0UA 4XXPA 2AUYA 1MS1A 1IKQA 1WD4A 5GLVA 3I2DA 3USUB 3CL1A 4OI2A 1QJX3 2DFCA 1C1LA 5K9YA 4IV1C 1VBC2 4QT6A 1S2BA 1GFF2 3TRSB 1PK6B 3H9AA 4BIOA 1UX6A 4AF9A 3MIBA 1D0HA 2I74A 3JD72 3EO6A 3O5SA 2YMZA 3WOGA 2IXKA 2XPJA 1QH6A 3DF0A 1WW4A 5I0UA 5C4WC 4FTEA 4RS5C 1QQP3 3D0JA 3VBSB 5FMOS 5CG9A 1T6GC 3OF1A 2R0FA 3M70A 3ZIXA 1Q5OA 5LRRA 1N1TA 4AFMA 4GH4C 1SBEA 5F6KA 4AEDA 1IS6A 1C5HA 2IXHA 2VY0A 1LU1A 3AYDA 5T54A 1PZ9A 2A3WA 4AGRA 1CAUA 3TN9<