3TOMA

Crystal structure of an engineered cytochrome cb562 that forms 2d, zn-mediated sheets
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMRDFRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKTTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-directed, chemically tunable assembly of one-, two- and three-dimensional crystalline protein arrays.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Soluble cytochrome b562
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3tomA00
3TOLA 2CCYA 1APCA 2XL6A 1CGOA 3QVYA 2YLDA 3M15A 3M4CA 4IB4A 1S05A 1MQVA 1BBHA 3DE8A 4L6RA 1YYJA 2J9BA 4CJGA 1A7VA 3C62A 3IQ6A 1JAFA 1E85A 5JT4A 4N4WA 3HNKA 4JEAA 4ER9A 1E86A 5JUAA 3ZTMA 3FOOA 2YLIA 3M4BA 5JSLA 1EKYA 3QW1A 4WGZA 3U8PA 3QW0A 4D4XA 5AGFA 4ULVA 5JRAA 2YLGA 5JVEA 1E83A 4CDVA 1M6TA 3NMKA 2YL1A 2XM0A 3DE9A 5JS5A 4IARA 4N6HA 3HNIA 3C63A 2XL8A 4U9EA 1CPRA 3ZWIA 5JLIA 1YZAA 1YZCA 4JE9A 3L1MA 3M79A 1GQAA 2XLMA 5B3IA 2XLVA 2YL0A 2YKZA 3TOMA 1QQ3A 4CX9A 1NBBA 4CJOA 4WGYA 2J8WA 1RCPA 3HNJA 3FOPA 4CDAA 4U9DA 2XLEA 2XLOA 3ZTZA 1E84A 3HNLA 4IAQA 256BA 4JKVA 1CPQA 3VRCA 4CDYA 3NMJA 3QVZA 4CIPA 1LM3B 2XLHA 1YYXA 2YL3A 4NC3A 2BC5A 3IQ5A 2XLDA 3NMIA 3ZQYA 4EIYA 2YL7A 1CGNA 2QLAA 1QPUA 3ZQVA 2XM4A 2XLWA 4D4NA 4JEBA 5JP7A
chains in the Genus database with same CATH superfamily
2OU6A 3LNRA 2WVQA 2NPUA 2J0WA 1CGOA 2IYLD 1Z23A 4JIOA 4ONSA 3JT1A 2YLDA 4CSAC 2Y3HA 1T6UA 3IPMO 1LI5A 2EPKX 2ZXPA 1LE4A 3NG1A 4J7TA 4QDLA 1ZVZA 1CGME 2CDQA 4XPYA 4YWQA 1KTMA 3L8IA 4L6RA 1YYJA 1UG7A 4RDAA 3S0XA 1NLXA 5BQIA 1E85A 4Q7CA 3UGOA 1VOMA 1KNYA 4BJ5C 4UDVA 4JEAA 4QI0A 2CGEA 3KYJA 1TFOB 2ZD9A 3R7CA 4A4AA 3K1IC 4ER9A 2KQ9A 3G50A 3K33A 3RIPA 4EBBA 2R7UA 1RMVA 3QTHA 3TULA 2R9RB 3ZTMA 4LDRA 1T6QA 2AVKA 2L7AA 4IWBA 2NUTB 5L0JA 1V74B 1F1MA 3JRTA 2RSEB 3NKDA 2NUTA 2JPUA 2YRFA 2M64A 4ULWA 5T3WA 1VLTA 3EG9B 3S28A 1N1CA 3SNHA 4ANJA 3CEXA 3EGXB 3QW0A 2L6FA 3EG9A 2Q9BA 4MVZA 2C03A 4CSAA 3O10A 3PDMP 2EINC 4ULVA 4BEMJ 4I1MA 4Z9IA 1A41A 4YN0B 2EIKC 3AGTA 1V4AA 2GDCA 4I3MA 3DJUB 3KKBA 2DGJA 1M6TA 1GGQA 2OJED 4I44A 3AOUA 4IJJA 3B0VC 1UFBA 5T1DB 2YL1A 2XM0A 3Q6MA 3U3FA 4I1OB 3TD7A 4EHPA 4MVRA 1HMOA 4IARA 2D4UA 3EPVA 2EIMC 3PCVA 4PACA 1G5ZA 1SZIA 4MVMA 1XZPA 2IOQA 2L6GA 3JYHA 4MW8A 1V54C 2H8AA 2OKUA 3C63A 4HEAJ 3UNGC 5AC5A 4CBEA 1T9KA 1R4TA 3OEOA 1HW2A 3EFOA 3AG2C 4XPXA 5JLIA 4Q4ZF 2IXPA 2NSGA 3T6BA 2A0BA 4EWCA 3DWWA 2JD3A 2YHSA 3O6XA 1ZHTA 1BZ4A 3TOMA 1QQ3A 3RH3A 2HS5A 3DM9B 1NZEA 3A9CA 2PX0A 2LD6A 4XEFA 1Y6DA 2ETSA 2DYSC 1SYQA 4G78A 1RCPA 1ZZPA 1U89A 1ZW2A 2CW0F 3GM1A 2G62A 3KMIA 4XEVA 1JMWA 2XLOA 3HKKA 3MFNA 1XZQA 3HNLA 4IAQA 2BL2A 1D1AA 3C18A 4JKVA 3VRCA 1EI7A 1T5OA 1FMWA 2E87A 4H54A 1ORJA 1S7ZA 2AP3A 4U5GA 4U5EE 1SF8A 4G7HF 1J8MF 1RJ9A 3GM3A 3LEOA 3RYLA 2P0NA 1OCCC 1TWAA 2PFDA 3GORA 2KC3A 2G3KA 4MW3A 1YYXA 3C8GB 3JSZA 3TK0A 3WG7C 3EZHA 2R7SA 5A6AA 2HSBA 2Y3DA 1K04A 1FFTC 3NMIA 5IY5C 2AWCA 4N6CA 3S29A 3UR3C 4EIYA 4E0IA 5EK0A 1PCXA 2YL7A 3DJNB 2J7PA 2QLAA 2I8BA 2R7OA 3IQCA 3SYNA 2MYSA 2EPLX 5GPGB 2J46A 4JZAA 2ZXRA 3HLZA 4P9TA 2XLWA 1A7DA 2OQMA 2HMZA 3CSKA 4G0HA 5CIVA 5K0IA 1M57C 3TOLA 1BDJB 2CCYA 2AWYA 4AL1A 2J9VA 5A6BA 2MWQA 2WZFA 3ITFA 1APCA 1M2VB 3NYJA 1NFOA 3ZC4A 1YA7O 4LDKA 4O6MA 5F5HA 2ZPAA 2HSQA 5COFA 3E9VA 4O79A 2J45A 1MQVA 1BBHA 2AU5A 1NFNA 5D91A 2OEVA 2A6HF 3KH2A 4OIQF 1BR2A 2HJ3A 3NKEA 1WATA 3GANA 1G4WR 3C62A 3CAXA 4NQFA 3DKAA 2KYHA 5FZTA 1AVOB 2HJMA 3JRMO 2P7VA 3WHNA 5EGYA 5L0DA 2Y3BA 1W2WA 2P1AA 3HNKA 4MTGA 3SXKA 5E3AA 2FFHA 4KBLA 3DXJF 4E0HA 1E86A 4OIRF 1OXBA 2OOCA 5L0CA 2R7WA 1YDIA 3BRJA 3FOOA 3DM5A 3Q6NA 5DQZA 2EPOA 1U6HA 3SXYA 1FAPB 1HE9A 3JTLO 1Q0FA 3GEIA 3JSEO 4FAPB 3U8PA 1ST6A 1EQ1A 3AGUA 1FR0A 3ZVRA 4D4XA 4HFFB 4J30B 4HE8D 4P9FA 5AGFA 1JPNA 1RJ9B 5JRAA 5KYYB 2EIJC 4R32A 3UMIA 3F47A 2YLGA 3W4YA 3UMHA 3B71A 5COMA 1YJGA 2MHRA 2UUHA 1TFKB 3F46A 3LLIA 4YT5A 5BUOA 4AE4B 1TWCA 1WWPA 2QUPA 3LS0A 3RW0A 3SXMA 1FNTc 1AUEA 2LFDA 2R7VA 1HW1A 1ZHWA 2CNWA 2IXNA 1Y4CA 2PP4A 3B9QA 4O7GA 1JPJA 1VLSA 2ZXWC 4IAOA 2HKVA 1LKXA 1H9TA 2KGOA 1H7IA 1WN0A 3GWLA 3JCUQ 1Z6AA 3LUTB 3N24A 4G7ZF 2LP4A 5KYYA 1QKRA 1GQAA 1NSGB 1FMVA 1VYKA 2A69F 2PX3A 2PBEA 2XLMA 2VCAA 2J9WA 1WASA 2XLVA 3O55A 4YT4A 5DS4A 2R7RA 3DAGA 3I5PA 3C8GA 3VYWA 5DS6A 1MMAA 1PD1A 2B0HA 4C7OB 1NBBA 2DYRC 1RXQA 3DAFA 3DD7A 2HMQA 1PD0A 3HNJA 5L3VA 3FAJA 1Q0DA 3K7DA 3HJCA 2H7BA 3GWNA 5E3CA 2LSEA 2OEXA 3OWTA 4NTAA 2Z15A 2L6HA 2W9YA 2Q9AA 3ABKC 5B1AC 4BJ1A 4DBQA 3W2WA 2EILC 1M56C 3U2LA 5A6JA 1MMNA 3K66A 4CDYA 1ZHYA 3AQCA 3DZAA 3EHMA 4MVUA 1EA8A 4NTBA 1MMGA 4H4KC 3FAPB 2QE9A 4GEHA 1OR2A 3EZIA 4C3EA 4CIPA 4NTFA 1V55C 4K0DA 5L0IA 3UMKA 1A7EA 1TWGA 5COGA 5B1BC 1ZHXA 3W8IA 3FVYA 3X1OA 3SEOA 1LVKA 4XWJA 2NG1A 3HTKC 4U5HA 2YL3A 3MYFA 4NC3A 1HE1A 5BQGA 2R7QA 4Z9JA 1OCOC 2XLDA 3V7OA 2I15A 2WB7A 4U5FE 1FFHA 5D92A 4MNDA 2H7OA 4ZLDA 5F28E 3ZIBA 1QLEC 3LLKA 4KNVA 2NUPB 1Z3IX 1BR4A 2O9XA 3ZQVA 2XM4A 4EKWA 4QI2A 3EFOB 4KNWA 2TMVP 1OKKD 2FGYA 2L9JA 1Z7Qc 1VB5A 3KL4A 4DRHB 4D4NA 1ZHZA 2C04A 1JR8A 1VK5A 4JJFA 5L0FA 1L7CA 3BEHA 1QSPA 4K1OA 1T6IA 2ASRA 3KPHA 3C8GD 4C3BA 3EJNA 1OR3A 3CZ6A 4BJTA 1KU2A 2W4MA 3M15A 3M4CA 4K7BA 2LIGA 4JRZA 1WGWA 2LQGA 3S90A 4OIPF 3EGDA 4J32B 3NYLA 2R7TA 2HV6A 1LS1A 3V5YA 2A1DD 1WOLA 1I4YA 2GWWA 3GEHA 5E2QA 1I4ZA 3DE8A 4JW1A 2BE5F 4U5DE 4W8PA 5T3TA 4CJGA 2J0XA 4E17A 1A7VA 3IQ6A 4G7OF 1JAFA 2X0CA 3FMSA 1D1BA 5DLJA 2L81A 4O6YA 4BJ6A 4N4WA 3EGXA 3UGPA 3US6A 3U0CA 3SXZA 3K6BA 2VCCA 3DMDA 3L0IA 2D5RB 1G8XA 1TQGA 1I5NA 3AG1C 3JYYA 3K1HA 1U0BB 4DVZA 2FAPB 1XWJA 1OQCA 3LAYA 2H7VC 5JUAA 1TKNA 4MTFA 4KC9A 3EGDB 2CNWD 2EPNA 5DVWA 4LLCA 2IBFA 4MVSA 4ZLCA 3WAQA 5CI8A 3C8ZA 5JSLA 2R7XA 4U5BE 2CYDA 2R02A 2NSFA 2VASA 2WZLA 4A2NB 4YT2A 1Z5ZA 1H6GA 1Q0GA 2X51A 2QTVA 2WVOA 3QMKA 4DJ9A 3ZSUA 2IXMA 2G3VA 2UUIA 1O3UA 4IGGA 2A68F 2HZ8A 4DVYP 3B0UX 2YQYA 4OD5A 4XLPF 4XTKA 4PFOA 5JVEA 4C7OA 4CDVA 4FESA 4MVQA 4RD9A 3DE9A 2V3CC 3C7JA 3S9OA 3ZG1A 5JS5A 4Q5SF 5HV9A 3HNIA 4JCZA 3PHF2 2WL8A 3ASNC 2M4EA 1D1CA 3E70C 2XL8A 4PJMA 2OJQA 1H9GA 1CPRA 2IXOA 3ABLC 1D0XA 4JCHA 4AK9A 3H2UA 2Y69C 3ZWIA 1YZAA 5E33A 1YZCA 3WODF 3L1MA 5KYNA 1O87A 3I4UA 3JZ0A 3M79A 4NCQA 4PJNA 4XQ1A 4DRIB 3L8JA 4RBNA 3AG3C 1OCZC 1SMYF 3N2ZB 4PFPA 4CS7A 4J7YA 2YZSA 1RKEB 3LS1A 5F5FA 4CX9A 1IZMA 2P61A 4CJOA 3VF0A 5EHHA 3H2VA 4N06A 1IW7F 4W8KA 3TQOA 4BJ5A 1LPEA 3GODA 4M63A 1T01A 4F4BA 2R05A 3FOPA 4E18A 3X2QC 4JVSA 4U9DA 4EBJA 1YLMA 3K1IA 1MMDA 2QNLA 2P6VA 4JTAB 4LERA 1RKCA 1C17M 3ZTZA 256BA 2KW3C 1OW7A 2WZGA 2XXAA 3NMJA 3QVZA 1NG1A 1DOVA 1WTYA 2KNHA 2Y39A 1FTSA 3T9OA 1ZW3A 2PNOA 2YVKA 3W8HA 1LM3B 4EBKA 1QZXA 2XSEA 1BR1A 2WVNA 4WABA 2VH3A 3NRHA 3ZQYA 3RFYA 2DI3A 1E2XA 1ZU5A 3PMRA 3B0PA 5BQHA 1OW8A 2Q7RA 3L34A 5TJ5E 3LJBA 3RQGA 1DOWA 3U5SA 4MTOA 1QVXA 2XS8A 4MVOA 1TR2A 3DI5A 4Z9HA 3U9MA 5JP7A 4OINF 3U8VA 1M2VA 4JURI 3VM6A 4CS8C 4DRJB 1ZU4A 2XL6A 2XRHA 1O5HA 2R03A 2YWAA 3QVYA 3QZCA 3RQEA 4U5CE 2OG2A 4DXWA 3LNMB 2Q00A 4CS9C 4IB4A 3U2MA 2OCCC 3U9JA 1J8YF 2KJGA 1JOGA 4CS9A 1YVIA 2Q9CA 5A69A 1M2OA 1S05A 2Q4FA 4BPMA 5KYWB 2J9BA 4YL3A 4FWVA 5JT4A 4JJGA 4JTCB 3S27A 3U3BA 2EPMX 2XL4A 4PJLA 1Z63A 4LDQA 2J7PD 1VYIA 1RKEA 3OA1A 3NDBB 2PF4E 4XLNF 2GAQA 1HY5A 1L3PA 2VCBA 1G4US 4DBRA 2KSFA 2YLIA 3M4BA 4BEJA 4X0RA 4WJ0A 3O39A 2DB4A 2VC9A 2JX0A 3LESA 4CS8A 2J9UA 4PJJA 4JTDB 5KYWA 5HSWA 3QW1A 1EKYA 3FXHA 3N0TA 1D0YA 3Q7GA 4WGZA 2NUPA 3T6GB 1B68A 1OCRC 3NYMA 3I5QA 2HFIA 3KYIA 4BJ6C 2LFFA 2QY9A 2HV7A 4MQ9F 3ASOC 4EUKB 3GM2A 5L3QA 1E83A 5AC4A 3NMKA 3ECSA 2GA0A 3SP1A 2XXAB 1LS4A 2A6EF 3RVZA 2GFHA 2YEVA 4YJWA 3T6JA 4P6IC 4AE4A 4E7ZA 3GEEA 1ORYA 4C3DA 4LACB 3POVA 3Q7LA 4BG0A 4N6HA 4O6NA 4YT8A 3SZRA 1OXKA 3B29A 5A6KA 3RF3A 4AX2A 4GQHA 4U9EA 2Y3GA 3IQTA 3VAYA 3EHNA 4PK4A 1VTMP 4XPWA 1MNDA 1K05A 1HMDA 1NU9C 4JE9A 3MBGA 3RQFA 4YK5A 3LEVA 5DQTA 1D0ZA 2F22A 1LI7A 2YL0A 4B6IA 5B3IA 2YKZA 5B3SC 3ZDLA 3R2PA 3RKOF 1C03A 4E7SA 1VMAA 2W4BA 3EH1A 1JRAA 3IHUA 3TJ6A 5KYXB 2B0JA 2A0UA 4WGYA 2J8WA 3G4ZA 3ABMC 3H65A 1OW6A 3J06A 4MS2A 3MX3A 4YL1A 3MYIA 1PV3A 3G4XA 4CDAA 5KYUB 3S84A 2IM8A 2XLEA 4YL0A 3M1CB 1E84A 1TWHA 2HUJA 3ATPA 5CI9A 3EQLF 2ZXOA 3TJ5A 1LE2A 1CPQA 2XS1A 3AQBA 1GS9A 1Q0MA 5L0GA 1OKKA 3RVYA 4PR9A 4JC7A 2V26A 1SR2A 3FHDA 2VB6A 4XEKA 1Q0KA 1ORSC 1AEPA 1YARO 3T4RA 3V5XA 5KYXA 2R25A 2LK4A 4IRUA 1GM5A 3W2VA 4KI2A 2XLHA 1K40A 3EH2A 1R5ID 3AJMA 5A6BD 2RD9A 3FDQA 5KYUA 1C02A 2W45A 4NY3A 1ZYRF 2BC5A 3IQ5A 3V5ZA 1YAUO 4OD4A 4LLEA 3AG4C 1NU7D 4HFKB 4DOZA 2LCHA 3CQZA 1MNEA 2KK1A 4CIHA 5DS5A 4AL0A 3MLGA 5L0HA 1CGNA 4FX5A 3IEEA 1QPUA 2ICWG 1LIHA 4GYTA 5FCLA 2Q3TA 1YA9A 4JEBA 4OIOF 3A11A 1A0BA
chains in the Genus database with same CATH topology
3TOLA 2CCYA 1APCA 2XL6A 1CGOA 3QVYA 2YLDA 3M15A 3M4CA 4IB4A 1S05A 1MQVA 1BBHA 3DE8A 4L6RA 1YYJA 2J9BA 4CJGA 1A7VA 3C62A 3IQ6A 1JAFA 1E85A 5JT4A 4N4WA 3HNKA 4JEAA 4ER9A 1E86A 5JUAA 3ZTMA 3FOOA 2YLIA 3M4BA 5JSLA 1EKYA 3QW1A 4WGZA 3U8PA 3QW0A 4D4XA 5AGFA 4ULVA 5JRAA 2YLGA 5JVEA 1E83A 4CDVA 1M6TA 3NMKA 2YL1A 2XM0A 3DE9A 5JS5A 4IARA 4N6HA 3HNIA 3C63A 2XL8A 4U9EA 1CPRA 3ZWIA 5JLIA 1YZAA 1YZCA 4JE9A 3L1MA 3M79A 1GQAA 2XLMA 5B3IA 2XLVA 2YL0A 2YKZA 3TOMA 1QQ3A 4CX9A 1NBBA 4CJOA 4WGYA 2J8WA 1RCPA 3HNJA 3FOPA 4CDAA 4U9DA 2XLEA 2XLOA 3ZTZA 1E84A 3HNLA 4IAQA 256BA 4JKVA 1CPQA 3VRCA 4CDYA 3NMJA 3QVZA 4CIPA 1LM3B 2XLHA 1YYXA 2YL3A 4NC3A 2BC5A 3IQ5A 2XLDA 3NMIA 3ZQYA 4EIYA 2YL7A 1CGNA 2QLAA 1QPUA 3ZQVA 2XM4A 2XLWA 4D4NA 4JEBA 5JP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TOL A;  2CCY A;  1APC A;  2XL6 A;  1CGO A;  3QVY A;  2YLD A;  3M15 A;  3M4C A;  4IB4 A;  1S05 A;  1MQV A;  1BBH A;  3DE8 A;  4L6R A;  1YYJ A;  2J9B A;  4CJG A;  1A7V A;  3C62 A;  3IQ6 A;  1JAF A;  1E85 A;  5JT4 A;  4N4W A;  3HNK A;  4JEA A;  4ER9 A;  1E86 A;  5JUA A;  3ZTM A;  3FOO A;  2YLI A;  3M4B A;  5JSL A;  1EKY A;  3QW1 A;  4WGZ A;  3U8P A;  3QW0 A;  4D4X A;  5AGF A;  4ULV A;  5JRA A;  2YLG A;  5JVE A;  1E83 A;  4CDV A;  1M6T A;  3NMK A;  2YL1 A;  2XM0 A;  3DE9 A;  5JS5 A;  4IAR A;  4N6H A;  3HNI A;  3C63 A;  2XL8 A;  4U9E A;  1CPR A;  3ZWI A;  5JLI A;  1YZA A;  1YZC A;  4JE9 A;  3L1M A;  3M79 A;  1GQA A;  2XLM A;  5B3I A;  2XLV A;  2YL0 A;  2YKZ A;  3TOM A;  1QQ3 A;  4CX9 A;  1NBB A;  4CJO A;  4WGY A;  2J8W A;  1RCP A;  3HNJ A;  3FOP A;  4CDA A;  4U9D A;  2XLE A;  2XLO A;  3ZTZ A;  1E84 A;  3HNL A;  4IAQ A;  256B A;  4JKV A;  1CPQ A;  3VRC A;  4CDY A;  3NMJ A;  3QVZ A;  4CIP A;  1LM3 B;  2XLH A;  1YYX A;  2YL3 A;  4NC3 A;  2BC5 A;  3IQ5 A;  2XLD A;  3NMI A;  3ZQY A;  4EIY A;  2YL7 A;  1CGN A;  2QLA A;  1QPU A;  3ZQV A;  2XM4 A;  2XLW A;  4D4N A;  4JEB A;  5JP7 A; 
#chains in the Genus database with same CATH topology
 2OU6 A;  3LNR A;  2WVQ A;  2NPU A;  2J0W A;  1CGO A;  2IYL D;  1Z23 A;  4JIO A;  4ONS A;  3JT1 A;  2YLD A;  4CSA C;  2Y3H A;  1T6U A;  3IPM O;  1LI5 A;  2EPK X;  2ZXP A;  1LE4 A;  3NG1 A;  4J7T A;  4QDL A;  1ZVZ A;  1CGM E;  2CDQ A;  4XPY A;  4YWQ A;  1KTM A;  3L8I A;  4L6R A;  1YYJ A;  1UG7 A;  4RDA A;  3S0X A;  1NLX A;  5BQI A;  1E85 A;  4Q7C A;  3UGO A;  1VOM A;  1KNY A;  4BJ5 C;  4UDV A;  4JEA A;  4QI0 A;  2CGE A;  3KYJ A;  1TFO B;  2ZD9 A;  3R7C A;  4A4A A;  3K1I C;  4ER9 A;  2KQ9 A;  3G50 A;  3K33 A;  3RIP A;  4EBB A;  2R7U A;  1RMV A;  3QTH A;  3TUL A;  2R9R B;  3ZTM A;  4LDR A;  1T6Q A;  2AVK A;  2L7A A;  4IWB A;  2NUT B;  5L0J A;  1V74 B;  1F1M A;  3JRT A;  2RSE B;  3NKD A;  2NUT A;  2JPU A;  2YRF A;  2M64 A;  4ULW A;  5T3W A;  1VLT A;  3EG9 B;  3S28 A;  1N1C A;  3SNH A;  4ANJ A;  3CEX A;  3EGX B;  3QW0 A;  2L6F A;  3EG9 A;  2Q9B A;  4MVZ A;  2C03 A;  4CSA A;  3O10 A;  3PDM P;  2EIN C;  4ULV A;  4BEM J;  4I1M A;  4Z9I A;  1A41 A;  4YN0 B;  2EIK C;  3AGT A;  1V4A A;  2GDC A;  4I3M A;  3DJU B;  3KKB A;  2DGJ A;  1M6T A;  1GGQ A;  2OJE D;  4I44 A;  3AOU A;  4IJJ A;  3B0V C;  1UFB A;  5T1D B;  2YL1 A;  2XM0 A;  3Q6M A;  3U3F A;  4I1O B;  3TD7 A;  4EHP A;  4MVR A;  1HMO A;  4IAR A;  2D4U A;  3EPV A;  2EIM C;  3PCV A;  4PAC A;  1G5Z A;  1SZI A;  4MVM A;  1XZP A;  2IOQ A;  2L6G A;  3JYH A;  4MW8 A;  1V54 C;  2H8A A;  2OKU A;  3C63 A;  4HEA J;  3UNG C;  5AC5 A;  4CBE A;  1T9K A;  1R4T A;  3OEO A;  1HW2 A;  3EFO A;  3AG2 C;  4XPX A;  5JLI A;  4Q4Z F;  2IXP A;  2NSG A;  3T6B A;  2A0B A;  4EWC A;  3DWW A;  2JD3 A;  2YHS A;  3O6X A;  1ZHT A;  1BZ4 A;  3TOM A;  1QQ3 A;  3RH3 A;  2HS5 A;  3DM9 B;  1NZE A;  3A9C A;  2PX0 A;  2LD6 A;  4XEF A;  1Y6D A;  2ETS A;  2DYS C;  1SYQ A;  4G78 A;  1RCP A;  1ZZP A;  1U89 A;  1ZW2 A;  2CW0 F;  3GM1 A;  2G62 A;  3KMI A;  4XEV A;  1JMW A;  2XLO A;  3HKK A;  3MFN A;  1XZQ A;  3HNL A;  4IAQ A;  2BL2 A;  1D1A A;  3C18 A;  4JKV A;  3VRC A;  1EI7 A;  1T5O A;  1FMW A;  2E87 A;  4H54 A;  1ORJ A;  1S7Z A;  2AP3 A;  4U5G A;  4U5E E;  1SF8 A;  4G7H F;  1J8M F;  1RJ9 A;  3GM3 A;  3LEO A;  3RYL A;  2P0N A;  1OCC C;  1TWA A;  2PFD A;  3GOR A;  2KC3 A;  2G3K A;  4MW3 A;  1YYX A;  3C8G B;  3JSZ A;  3TK0 A;  3WG7 C;  3EZH A;  2R7S A;  5A6A A;  2HSB A;  2Y3D A;  1K04 A;  1FFT C;  3NMI A;  5IY5 C;  2AWC A;  4N6C A;  3S29 A;  3UR3 C;  4EIY A;  4E0I A;  5EK0 A;  1PCX A;  2YL7 A;  3DJN B;  2J7P A;  2QLA A;  2I8B A;  2R7O A;  3IQC A;  3SYN A;  2MYS A;  2EPL X;  5GPG B;  2J46 A;  4JZA A;  2ZXR A;  3HLZ A;  4P9T A;  2XLW A;  1A7D A;  2OQM A;  2HMZ A;  3CSK A;  4G0H A;  5CIV A;  5K0I A;  1M57 C;  3TOL A;  1BDJ B;  2CCY A;  2AWY A;  4AL1 A;  2J9V A;  5A6B A;  2MWQ A;  2WZF A;  3ITF A;  1APC A;  1M2V B;  3NYJ A;  1NFO A;  3ZC4 A;  1YA7 O;  4LDK A;  4O6M A;  5F5H A;  2ZPA A;  2HSQ A;  5COF A;  3E9V A;  4O79 A;  2J45 A;  1MQV A;  1BBH A;  2AU5 A;  1NFN A;  5D91 A;  2OEV A;  2A6H F;  3KH2 A;  4OIQ F;  1BR2 A;  2HJ3 A;  3NKE A;  1WAT A;  3GAN A;  1G4W R;  3C62 A;  3CAX A;  4NQF A;  3DKA A;  2KYH A;  5FZT A;  1AVO B;  2HJM A;  3JRM O;  2P7V A;  3WHN A;  5EGY A;  5L0D A;  2Y3B A;  1W2W A;  2P1A A;  3HNK A;  4MTG A;  3SXK A;  5E3A A;  2FFH A;  4KBL A;  3DXJ F;  4E0H A;  1E86 A;  4OIR F;  1OXB A;  2OOC A;  5L0C A;  2R7W A;  1YDI A;  3BRJ A;  3FOO A;  3DM5 A;  3Q6N A;  5DQZ A;  2EPO A;  1U6H A;  3SXY A;  1FAP B;  1HE9 A;  3JTL O;  1Q0F A;  3GEI A;  3JSE O;  4FAP B;  3U8P A;  1ST6 A;  1EQ1 A;  3AGU A;  1FR0 A;  3ZVR A;  4D4X A;  4HFF B;  4J30 B;  4HE8 D;  4P9F A;  5AGF A;  1JPN A;  1RJ9 B;  5JRA A;  5KYY B;  2EIJ C;  4R32 A;  3UMI A;  3F47 A;  2YLG A;  3W4Y A;  3UMH A;  3B71 A;  5COM A;  1YJG A;  2MHR A;  2UUH A;  1TFK B;  3F46 A;  3LLI A;  4YT5 A;  5BUO A;  4AE4 B;  1TWC A;  1WWP A;  2QUP A;  3LS0 A;  3RW0 A;  3SXM A;  1FNT c;  1AUE A;  2LFD A;  2R7V A;  1HW1 A;  1ZHW A;  2CNW A;  2IXN A;  1Y4C A;  2PP4 A;  3B9Q A;  4O7G A;  1JPJ A;  1VLS A;  2ZXW C;  4IAO A;  2HKV A;  1LKX A;  1H9T A;  2KGO A;  1H7I A;  1WN0 A;  3GWL A;  3JCU Q;  1Z6A A;  3LUT B;  3N24 A;  4G7Z F;  2LP4 A;  5KYY A;  1QKR A;  1GQA A;  1NSG B;  1FMV A;  1VYK A;  2A69 F;  2PX3 A;  2PBE A;  2XLM A;  2VCA A;  2J9W A;  1WAS A;  2XLV A;  3O55 A;  4YT4 A;  5DS4 A;  2R7R A;  3DAG A;  3I5P A;  3C8G A;  3VYW A;  5DS6 A;  1MMA A;  1PD1 A;  2B0H A;  4C7O B;  1NBB A;  2DYR C;  1RXQ A;  3DAF A;  3DD7 A;  2HMQ A;  1PD0 A;  3HNJ A;  5L3V A;  3FAJ A;  1Q0D A;  3K7D A;  3HJC A;  2H7B A;  3GWN A;  5E3C A;  2LSE A;  2OEX A;  3OWT A;  4NTA A;  2Z15 A;  2L6H A;  2W9Y A;  2Q9A A;  3ABK C;  5B1A C;  4BJ1 A;  4DBQ A;  3W2W A;  2EIL C;  1M56 C;  3U2L A;  5A6J A;  1MMN A;  3K66 A;  4CDY A;  1ZHY A;  3AQC A;  3DZA A;  3EHM A;  4MVU A;  1EA8 A;  4NTB A;  1MMG A;  4H4K C;  3FAP B;  2QE9 A;  4GEH A;  1OR2 A;  3EZI A;  4C3E A;  4CIP A;  4NTF A;  1V55 C;  4K0D A;  5L0I A;  3UMK A;  1A7E A;  1TWG A;  5COG A;  5B1B C;  1ZHX A;  3W8I A;  3FVY A;  3X1O A;  3SEO A;  1LVK A;  4XWJ A;  2NG1 A;  3HTK C;  4U5H A;  2YL3 A;  3MYF A;  4NC3 A;  1HE1 A;  5BQG A;  2R7Q A;  4Z9J A;  1OCO C;  2XLD A;  3V7O A;  2I15 A;  2WB7 A;  4U5F E;  1FFH A;  5D92 A;  4MND A;  2H7O A;  4ZLD A;  5F28 E;  3ZIB A;  1QLE C;  3LLK A;  4KNV A;  2NUP B;  1Z3I X;  1BR4 A;  2O9X A;  3ZQV A;  2XM4 A;  4EKW A;  4QI2 A;  3EFO B;  4KNW A;  2TMV P;  1OKK D;  2FGY A;  2L9J A;  1Z7Q c;  1VB5 A;  3KL4 A;  4DRH B;  4D4N A;  1ZHZ A;  2C04 A;  1JR8 A;  1VK5 A;  4JJF A;  5L0F A;  1L7C A;  3BEH A;  1QSP A;  4K1O A;  1T6I A;  2ASR A;  3KPH A;  3C8G D;  4C3B A;  3EJN A;  1OR3 A;  3CZ6 A;  4BJT A;  1KU2 A;  2W4M A;  3M15 A;  3M4C A;  4K7B A;  2LIG A;  4JRZ A;  1WGW A;  2LQG A;  3S90 A;  4OIP F;  3EGD A;  4J32 B;  3NYL A;  2R7T A;  2HV6 A;  1LS1 A;  3V5Y A;  2A1D D;  1WOL A;  1I4Y A;  2GWW A;  3GEH A;  5E2Q A;  1I4Z A;  3DE8 A;  4JW1 A;  2BE5 F;  4U5D E;  4W8P A;  5T3T A;  4CJG A;  2J0X A;  4E17 A;  1A7V A;  3IQ6 A;  4G7O F;  1JAF A;  2X0C A;  3FMS A;  1D1B A;  5DLJ A;  2L81 A;  4O6Y A;  4BJ6 A;  4N4W A;  3EGX A;  3UGP A;  3US6 A;  3U0C A;  3SXZ A;  3K6B A;  2VCC A;  3DMD A;  3L0I A;  2D5R B;  1G8X A;  1TQG A;  1I5N A;  3AG1 C;  3JYY A;  3K1H A;  1U0B B;  4DVZ A;  2FAP B;  1XWJ A;  1OQC A;  3LAY A;  2H7V C;  5JUA A;  1TKN A;  4MTF A;  4KC9 A;  3EGD B;  2CNW D;  2EPN A;  5DVW A;  4LLC A;  2IBF A;  4MVS A;  4ZLC A;  3WAQ A;  5CI8 A;  3C8Z A;  5JSL A;  2R7X A;  4U5B E;  2CYD A;  2R02 A;  2NSF A;  2VAS A;  2WZL A;  4A2N B;  4YT2 A;  1Z5Z A;  1H6G A;  1Q0G A;  2X51 A;  2QTV A;  2WVO A;  3QMK A;  4DJ9 A;  3ZSU A;  2IXM A;  2G3V A;  2UUI A;  1O3U A;  4IGG A;  2A68 F;  2HZ8 A;  4DVY P;  3B0U X;  2YQY A;  4OD5 A;  4XLP F;  4XTK A;  4PFO A;  5JVE A;  4C7O A;  4CDV A;  4FES A;  4MVQ A;  4RD9 A;  3DE9 A;  2V3C C;  3C7J A;  3S9O A;  3ZG1 A;  5JS5 A;  4Q5S F;  5HV9 A;  3HNI A;  4JCZ A;  3PHF 2;  2WL8 A;  3ASN C;  2M4E A;  1D1C A;  3E70 C;  2XL8 A;  4PJM A;  2OJQ A;  1H9G A;  1CPR A;  2IXO A;  3ABL C;  1D0X A;  4JCH A;  4AK9 A;  3H2U A;  2Y69 C;  3ZWI A;  1YZA A;  5E33 A;  1YZC A;  3WOD F;  3L1M A;  5KYN A;  1O87 A;  3I4U A;  3JZ0 A;  3M79 A;  4NCQ A;  4PJN A;  4XQ1 A;  4DRI B;  3L8J A;  4RBN A;  3AG3 C;  1OCZ C;  1SMY F;  3N2Z B;  4PFP A;  4CS7 A;  4J7Y A;  2YZS A;  1RKE B;  3LS1 A;  5F5F A;  4CX9 A;  1IZM A;  2P61 A;  4CJO A;  3VF0 A;  5EHH A;  3H2V A;  4N06 A;  1IW7 F;  4W8K A;  3TQO A;  4BJ5 A;  1LPE A;  3GOD A;  4M63 A;  1T01 A;  4F4B A;  2R05 A;  3FOP A;  4E18 A;  3X2Q C;  4JVS A;  4U9D A;  4EBJ A;  1YLM A;  3K1I A;  1MMD A;  2QNL A;  2P6V A;  4JTA B;  4LER A;  1RKC A;  1C17 M;  3ZTZ A;  256B A;  2KW3 C;  1OW7 A;  2WZG A;  2XXA A;  3NMJ A;  3QVZ A;  1NG1 A;  1DOV A;  1WTY A;  2KNH A;  2Y39 A;  1FTS A;  3T9O A;  1ZW3 A;  2PNO A;  2YVK A;  3W8H A;  1LM3 B;  4EBK A;  1QZX A;  2XSE A;  1BR1 A;  2WVN A;  4WAB A;  2VH3 A;  3NRH A;  3ZQY A;  3RFY A;  2DI3 A;  1E2X A;  1ZU5 A;  3PMR A;  3B0P A;  5BQH A;  1OW8 A;  2Q7R A;  3L34 A;  5TJ5 E;  3LJB A;  3RQG A;  1DOW A;  3U5S A;  4MTO A;  1QVX A;  2XS8 A;  4MVO A;  1TR2 A;  3DI5 A;  4Z9H A;  3U9M A;  5JP7 A;  4OIN F;  3U8V A;  1M2V A;  4JUR I;  3VM6 A;  4CS8 C;  4DRJ B;  1ZU4 A;  2XL6 A;  2XRH A;  1O5H A;  2R03 A;  2YWA A;  3QVY A;  3QZC A;  3RQE A;  4U5C E;  2OG2 A;  4DXW A;  3LNM B;  2Q00 A;  4CS9 C;  4IB4 A;  3U2M A;  2OCC C;  3U9J A;  1J8Y F;  2KJG A;  1JOG A;  4CS9 A;  1YVI A;  2Q9C A;  5A69 A;  1M2O A;  1S05 A;  2Q4F A;  4BPM A;  5KYW B;  2J9B A;  4YL3 A;  4FWV A;  5JT4 A;  4JJG A;  4JTC B;  3S27 A;  3U3B A;  2EPM X;  2XL4 A;  4PJL A;  1Z63 A;  4LDQ A;  2J7P D;  1VYI A;  1RKE A;  3OA1 A;  3NDB B;  2PF4 E;  4XLN F;  2GAQ A;  1HY5 A;  1L3P A;  2VCB A;  1G4U S;  4DBR A;  2KSF A;  2YLI A;  3M4B A;  4BEJ A;  4X0R A;  4WJ0 A;  3O39 A;  2DB4 A;  2VC9 A;  2JX0 A;  3LES A;  4CS8 A;  2J9U A;  4PJJ A;  4JTD B;  5KYW A;  5HSW A;  3QW1 A;  1EKY A;  3FXH A;  3N0T A;  1D0Y A;  3Q7G A;  4WGZ A;  2NUP A;  3T6G B;  1B68 A;  1OCR C;  3NYM A;  3I5Q A;  2HFI A;  3KYI A;  4BJ6 C;  2LFF A;  2QY9 A;  2HV7 A;  4MQ9 F;  3ASO C;  4EUK B;  3GM2 A;  5L3Q A;  1E83 A;  5AC4 A;  3NMK A;  3ECS A;  2GA0 A;  3SP1 A;  2XXA B;  1LS4 A;  2A6E F;  3RVZ A;  2GFH A;  2YEV A;  4YJW A;  3T6J A;  4P6I C;  4AE4 A;  4E7Z A;  3GEE A;  1ORY A;  4C3D A;  4LAC B;  3POV A;  3Q7L A;  4BG0 A;  4N6H A;  4O6N A;  4YT8 A;  3SZR A;  1OXK A;  3B29 A;  5A6K A;  3RF3 A;  4AX2 A;  4GQH A;  4U9E A;  2Y3G A;  3IQT A;  3VAY A;  3EHN A;  4PK4 A;  1VTM P;  4XPW A;  1MND A;  1K05 A;  1HMD A;  1NU9 C;  4JE9 A;  3MBG A;  3RQF A;  4YK5 A;  3LEV A;  5DQT A;  1D0Z A;  2F22 A;  1LI7 A;  2YL0 A;  4B6I A;  5B3I A;  2YKZ A;  5B3S C;  3ZDL A;  3R2P A;  3RKO F;  1C03 A;  4E7S A;  1VMA A;  2W4B A;  3EH1 A;  1JRA A;  3IHU A;  3TJ6 A;  5KYX B;  2B0J A;  2A0U A;  4WGY A;  2J8W A;  3G4Z A;  3ABM C;  3H65 A;  1OW6 A;  3J06 A;  4MS2 A;  3MX3 A;  4YL1 A;  3MYI A;  1PV3 A;  3G4X A;  4CDA A;  5KYU B;  3S84 A;  2IM8 A;  2XLE A;  4YL0 A;  3M1C B;  1E84 A;  1TWH A;  2HUJ A;  3ATP A;  5CI9 A;  3EQL F;  2ZXO A;  3TJ5 A;  1LE2 A;  1CPQ A;  2XS1 A;  3AQB A;  1GS9 A;  1Q0M A;  5L0G A;  1OKK A;  3RVY A;  4PR9 A;  4JC7 A;  2V26 A;  1SR2 A;  3FHD A;  2VB6 A;  4XEK A;  1Q0K A;  1ORS C;  1AEP A;  1YAR O;  3T4R A;  3V5X A;  5KYX A;  2R25 A;  2LK4 A;  4IRU A;  1GM5 A;  3W2V A;  4KI2 A;  2XLH A;  1K40 A;  3EH2 A;  1R5I D;  3AJM A;  5A6B D;  2RD9 A;  3FDQ A;  5KYU A;  1C02 A;  2W45 A;  4NY3 A;  1ZYR F;  2BC5 A;  3IQ5 A;  3V5Z A;  1YAU O;  4OD4 A;  4LLE A;  3AG4 C;  1NU7 D;  4HFK B;  4DOZ A;  2LCH A;  3CQZ A;  1MNE A;  2KK1 A;  4CIH A;  5DS5 A;  4AL0 A;  3MLG A;  5L0H A;  1CGN A;  4FX5 A;  3IEE A;  1QPU A;  2ICW G;  1LIH A;  4GYT A;  5FCL A;  2Q3T A;  1YA9 A;  4JEB A;  4OIO F;  3A11 A;  1A0B A; 
#chains in the Genus database with same CATH homology
 3TOL A;  2CCY A;  1APC A;  2XL6 A;  1CGO A;  3QVY A;  2YLD A;  3M15 A;  3M4C A;  4IB4 A;  1S05 A;  1MQV A;  1BBH A;  3DE8 A;  4L6R A;  1YYJ A;  2J9B A;  4CJG A;  1A7V A;  3C62 A;  3IQ6 A;  1JAF A;  1E85 A;  5JT4 A;  4N4W A;  3HNK A;  4JEA A;  4ER9 A;  1E86 A;  5JUA A;  3ZTM A;  3FOO A;  2YLI A;  3M4B A;  5JSL A;  1EKY A;  3QW1 A;  4WGZ A;  3U8P A;  3QW0 A;  4D4X A;  5AGF A;  4ULV A;  5JRA A;  2YLG A;  5JVE A;  1E83 A;  4CDV A;  1M6T A;  3NMK A;  2YL1 A;  2XM0 A;  3DE9 A;  5JS5 A;  4IAR A;  4N6H A;  3HNI A;  3C63 A;  2XL8 A;  4U9E A;  1CPR A;  3ZWI A;  5JLI A;  1YZA A;  1YZC A;  4JE9 A;  3L1M A;  3M79 A;  1GQA A;  2XLM A;  5B3I A;  2XLV A;  2YL0 A;  2YKZ A;  3TOM A;  1QQ3 A;  4CX9 A;  1NBB A;  4CJO A;  4WGY A;  2J8W A;  1RCP A;  3HNJ A;  3FOP A;  4CDA A;  4U9D A;  2XLE A;  2XLO A;  3ZTZ A;  1E84 A;  3HNL A;  4IAQ A;  256B A;  4JKV A;  1CPQ A;  3VRC A;  4CDY A;  3NMJ A;  3QVZ A;  4CIP A;  1LM3 B;  2XLH A;  1YYX A;  2YL3 A;  4NC3 A;  2BC5 A;  3IQ5 A;  2XLD A;  3NMI A;  3ZQY A;  4EIY A;  2YL7 A;  1CGN A;  2QLA A;  1QPU A;  3ZQV A;  2XM4 A;  2XLW A;  4D4N A;  4JEB A;  5JP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...