3TOTA

Crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
212
structure length
212
Chain Sequence
b'VMKLIGSHASPYTRKVRVVLAEKKIDYQFVLEDVWNADTQIHQFNPLGKVPCLVMDDGGALFDSRVIAEYADTLSPVARLIPPSGRERVEVRCWEALADGLLDAAVALRVEQTQRTPEQRSESWITRQHHKIDEALKAMSRGLADRTWCNGNHLTLADIAVGCALAYLDFRQPQVDWREQHANLAAFYTRIEKRPSFLETQPQAENLYFQSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione s-transferase protein
publication title Crystal structure of GLUTATHIONE S-TRANSFERASE from Ralstonia solanacearum
rcsb
source organism Ralstonia solanacearum
molecule tags Transferase
total genus 73
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3totA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3totA01
3EURA 3GL5A 4LLRA 3ED3A 2P31A 3HHVA 2K18A 3FRCA 4WF4A 1YY7A 3ZYWA 4K9ZA 2HSMA 2R6KA 2LRNA 4MZWA 4HJMA 3UMAA 5ELGA 4FYUA 3J7Yb 2BMXA 4IP1A 2AAWA 3DGQA 2MYGA 3IA1A 2PMTA 3F4RA 3A5WA 5ID2B 1PKWA 3WT2A 1G7OA 2LRCA 4POKA 4JBBA 1V57A 3HD5A 3FK8A 1IYIA 1BX9A 5IOWA 5LD0A 5HR3A 4V2LA 2FWHA 2PBJA 1H4OA 3L0HA 1K3YA 2N5FA 2FUG2 22GSA 1YJ6A 4GSSA 4EL1A 4TXOA 3C71A 1G0TA 4KSMA 3GKKA 2PVQA 3O6TA 4OCEA 4DSSA 2VUPA 2B7JA 3TGZA 4XIHA 3DMLA 2RUFA 4YH2A 3FZ9A 3UAPA 1N2AA 1WRYA 3IXRA 3SBCA 3FR9A 1K0OA 3HVSA 3I69A 1O8WA 3DRNA 4DEJA 3QFBC 4F0CA 3KM6A 1DSBA 4ECBA 2ZUPA 1X5DA 1A8YA 5G2ZA 4BWQA 3M9JA 2GZZA 4O7HA 1PMTA 1GUKA 2HZFA 4POBA 2YWIA 2YZHA 5HFGA 2WB9A 2H73A 2YOIA 3F63A 3KMOA 3HJMA 1A0RP 19GSA 2C3QA 4K0GA 2F51A 2GQMA 3NZNA 3ERWA 3ZTLA 4PNGA 3EMPA 3ZZXA 4WKWA 3VK9A 1GTIA 2DJ3A 5KN3A 2B1KA 3FY7A 3GFKA 4HJ2A 5DAKB 2LJAA 1TRWA 2HT9A 1UA5A 2WULA 2HYXA 2GSQA 1OAZA 2LQQA 5ID2A 3IK9A 1WP0A 1UN2A 2H6XA 4D73B 4FYBA 2IN3A 3FZ4A 1ILOA 3J7Yk 5CRDA 2CVDA 1FOVA 1SKSB 2VAFA 4WEYA 1S3AA 4MJEA 4EUYA 4MA9A 1XVQA 2GT6A 3C1RA 1QGVA 1U88A 3GUSA 1WMJA 1SD9A 4JR6A 2ON7A 1ERVA 1M0UA 1GLQA 4Q5RA 5IOXA 2I4AA 4OO5A 1OE8A 3RPPA 1J0FA 4N10A 3DVWA 3GA4A 4XCSA 5D96A 2YWMA 4KH7A 3TKSA 3WD6A 2RUEA 2HSNB 4AJ6A 1JZDA 1CQGA 2ON5A 2CT6A 2GQKA 5IQYA 4PXOA 4TRXA 4V1Ag 3DXBA 2CAQA 3F6DA 1H75A 5DCHA 1AXDA 2LNSA 1Z6NA 5INYA 4Q5NA 1GTAA 3IAM2 3EMXA 4ZL7A 2ZCTA 3UL3A 3Q74A 3WT1A 4KW6A 4IJ3A 6GSUA 2VM2A 5JCGA 5A5KA 2PN8A 5CO3A 4ECJA 1ML6A 4K7NA 1SL2B 4KSOA 3Q6OA 1YEXA 2B5XA 5F07A 2V2GA 3DWVA 2X8CA 3F0IA 3U5RE 1EZKA 3KP9A 1M7TA 3CSJA 2H71A 5DAKA 2K6VA 17GSA 4ZB6A 3HJOA 3VFIA 2H70A 3HDCA 3VWVA 3TJBA 2LUSA 2H66A 5ECQB 1QQ2A 2VCTA 3ZMLA 3TB2A 5JWRB 2H8LA 1GRXA 5IM9A 1YF1A 3D6IA 3TJFA 2N5AA 4BVYB 4KF9A 2P5RA 3GH6A 2DIYA 1A8LA 2FY6A 3CRUA 1F37A 2FNOA 2H1DA 1R5AA 3GKMA 1YEPA 3TKSC 3RPNA 1SL0B 4TR1B 3DIEA 1O81A 2WDUA 4WETA 2VLVA 4IBPA 3PH9A 3M3MA 2B5YA 3WGEA 3IV4A 4KX4A 3FEUA 2WCIA 1YKCA 5ECMB 4PX1A 5J5NA 2OE1A 3GMFA 3W8SA 2OKAA 2C4JA 2IJYA 3H8QA 2YZUA 2C3NA 1XOBA 5DQSA 4FYCA 4V1Ap 2GZYA 2JSZA 1A23A 3GX0A 3L4NA 5JWQB 3ZL5A 1PGTA 2QC7A 3EVIA 1WE0A 3NOFA 2YWNA 2OBIA 2F9SA 4EO3A 3GNJA 2VCQA 3MAKA 5ENUA 2X99A 3GYKA 3KXOA 1X5EA 3M0FA 3H1NA 3HZ4A 4YQMA 1A0FA 2LJKA 3UVTA 4Q5QA 3HCZA 4I5QA 1BQ7A 3CBUA 4E8EA 3IAS2 3FW2A 1KEBA 3JCML 4H86A 3CSIA 1EOHA 4RI6A 2P5QA 2L6DA 4HI7A 4GXZA 5A4WA 2AJQB 2DMMA 3O3TA 3ME8A 1VF3A 5G1LA 1AUCA 4GSNA 4I97A 1TJDA 1FVJA 2DIZA 5IMVA 4OWYA 1MDIA 3V1WA 5D9TA 1GH2A 1T4ZA 3GKNA 2OE0A 6GSVA 1BAYA 2C0EA 3LORA 2WJUA 1LJRA 1GSSA 1DBYA 1EV4A 5J4UA 5J3RA 9GSSA 4EKZA 4BVYA 1F3AA 3FR6A 4KE3A 5D9WA 1W4VA 2F8AA 2VM1A 3VPQA 4K2DA 5G30A 5DVBA 3EYTA 1K3LA 2PPTA 4KDYA 1U3AA 1U3IA 1TOFA 1AIUA 4K7OA 3C7MA 2JADA 2CA8A 2CVKA 3RAZA 1C72A 4L5LA 4ECCA 1SU9A 2RM5A 4KCEA 4DSSB 5ECNB 4N0VA 5B6NA 2WGRA 2H19A 4G19A 2IPAA 3IPZA 2IFQA 3IRAA 1GUMA 1GSFA 3UIWA 3TJKA 1XFLA 5ECPB 1WJKA 3GN3A 1EV9A 4MJCA 4QL7A 1T8EB 4MZCA 5GSTA 1TK8B 4XS4B 4KB3A 4IQ1A 1K0CA 3G7IA 1G6YA 1TU8A 2EIQA 2IWTA 2GT5A 1ON4A 1XXUA 5EPFA 3CTFA 4PQHA 2L4CA 5J41A 1OC9B 1TK0B 2LTKA 2WZ9A 2O8VB 4KUNA 5B8BA 2I81A 2QKEA 1M99A 1FB0A 2NVLA 2DC5A 3FZ5A 2OADA 4MP4A 3HYPA 1NHOA 5B7CA 4NHZA 2H0IA 2FLSA 1RW1A 1WOUA 4BA7A 1GSDA 2E0QA 2EIOA 1B48A 2TRCP 1ZYEA 2LS5A 4TXVA 1IYHA 1VRSD 1F9MA 4YAPA 4XS6A 5AISA 4G9HA 4WXTA 5DBQA 5E59A 3KZQA 4L0UA 5J9CA 3EWLA 4F2IA 2LRTA 1AW9A 2NBSA 1GL8A 4TN8A 2HRKB 4XRDA 2CX3A 3LYKA 1MD3A 2K9FA 4K7IA 2QSIA 3EU4A 3LFLA 2VD0A 1SK2A 1TKDB 4F0BA 1XW5A 1G6WA 1NM3A 2FD3A 5ECKB 2H01A 3G9BA 1SKRB 10GSA 4P3YB 1FB6A 2HRFA 2XPEA 2NDOA 1AQVA 3D22A 3LSZA 1E2YA 3I9V2 4WR5A 2C0GA 4XS4A 1BG5A 1PKZA 1ZMAA 1F2EA 2C8UA 2GS3A 2K8SA 2CX4A 4X43A 4GQFA 4EF0A 2GZPA 3KTLA 1V40A 1XPVA 4EVMA 3TJGA 2H74A 4ID0A 14GSA 5G1KA 1LBKA 1OC9A 3RHBA 1TXXA 4L5OA 1HD2A 2B1LA 4PUFC 4O92A 3ZITA 2BJXA 5B6MA 4XRAA 5KN1A 1AC1A 1S3CA 3IHQA 1B9YC 3HZ8A 1V58A 3BCIA 1T1VA 4I6XA 3W8JA 4GRFA 5D73A 5DJLA 2I9HA 3GKXA 4O5RA 2HRNA 2YV9A 2GDRA 1JZRA 4MCUA 5GZZB 1VF2A 4F82A 3US3A 4HU7A 1Z3EA 1V9WA 5D9VA 4POMA 4GF0A 2F8FA 3L9VA 4GWRA 1KTEA 2R4VA 4NV5A 3ZVJA 2F3MA 4I2TA 1OYJA 2V6OA 3E0UA 2IMEA 1PX6A 2I1UA 2BTOT 2B3SA 2YCDA 1YQ1A 2C1YA 4K8MA 4ZILA 1FO5A 2WFCA 2HRKA 2ES7A 1B8XA 2EIRA 3F6FA 1M2DA 4MJAA 4YQUA 2IMKA 4FH8A 2LJRA 5KN0A 3LQ7A 4NMUA 1M9AA 4O32A 1M2AA 1YDKA 1UC7A 3EE2A 5A4VA 2A2RA 4PTSA 2IMDA 3GURA 1SENA 1O85A 2KP2A 5D9XA 1LU4A 4MJBA 2JZRA 1XZOA 2RLIA 3D5JA 2JU5A 1T3BA 1SJ6A 3C1SA 2L57A 2TIRA 1I9DA 4Z7XA 3H93A 4MMMA 2ZNMA 1MDJA 6GSWA 1ABAA 1XVWA 4NPBA 1GSUA 2R3XA 3F3QA 2HZEB 3GRXA 1GNEA 2LNTA 4EC0A 4LMVA 5G5FA 3C8EA 3APOA 3CYNA 1T7PB 3IR4A 4IQAA 2A4VA 3TKQA 5F8BA 1V2AA 4TKYA 3BD2A 4L8EA 4HDEA 2VOCA 2YPMA 3ZFLA 3LWAA 2OBKA 5CRHA 5IPHA 3ZREA 3I6AA 2G0FA 2MBTA 2DJJA 1TRSA 3ZVJD 3R2QA 3HKRA 1PN9A 2R5GA 4X1UA 2CVBA 2H30A 2RM6A 4PQ1A 5HR2A 2GGTA 8GSSA 3LJRA 2Z9SA 2DJ2A 4IGJA 4IVFA 4ZXGA 3FR3A 1A2LA 13GSA 4OMVA 4N11A 2E2MA 4XHMA 4CW9A 1XWGA 4HOJA 2R2JA 3VWXA 5DCGA 1DE1A 2H1BA 4IW9A 1ZZYA 4YQVA 4MDCA 4WF5A 4NV2A 3GX8A 3PINA 2KP1A 2UZ8A 1FAAA 5CP1A 1K0BA 1JLWA 1Z5YE 1TP9A 2JZSA 2LV3A 1U6TA 2KUCA 5G5EA 1R4WA 4BL7B 3DYRA 3IE3A 3VPTA 5JWOB 3TRXA 5J9BA 4QL9A 2VCVA 2E2GA 2EC4A 2L5OA 2VLTA 5E4WA 1HNAA 3D21A 3L9SA 2FWEA 4F9ZA 2AB6A 3GV1A 1QXHA 2FGXA 5FHIA 2IFQB 5D93A 1PX7A 2LKUA 3KP8A 3IDVA 4JZQA 3SWLA 1Y6EA 2HZEA 4HUAA 1ZL9A 2GLRA 2VCWA 6GSYA 3DKSA 3GHAA 4J56E 2OE3A 1XW9A 5CRGA 2C0FA 2O7KA 5AIXA 4ZB9A 2B7KA 1QUWA 2H6YA 4PURA 1NSWA 2HXKA 3F9UA 1ZYQB 1KNGA 5HR1A 2RIIA 1THXA 1JFUA 3KGKA 3CXGA 3Q19A 5EVOA 3E9JB 4X0XA 1PL2A 2O85A 4BWSA 4BVXB 1OC8A 3KJYA 5IO2A 4KGIA 4FIWA 1R26A 1SJZA 3U6VA 1MD4A 1TRVA 3HY2A 4K0NA 2PERA 1PSQA 3VLNA 5IIZA 5B8AA 4XS1A 3VWWA 2YNXA 1VF1A 5HR0A 1MDKA 4G10A 5H5SA 4LA1A 3OR5A 2DJKA 1PD21 2FA8A 12GSA 2GSSA 4TR4A 2GQLA 1BJXA 3D4MA 2A2SA 3DVXA 4BL7A 2HSHA 5H5QA 2O89A 2MMNA 4HZ4A 3WGXA 1A2MA 1F3BA 5F0GA 4MH3A 1XOAA 3LG6A 3LYPA 2V32A 3RBTA 3CRTA 3DD3A 2M80A 3BJ5A 5ABRA 4IELA 1K0MA 2MMAA 2TRXA 2GTUA 3CSHA 5GAND 1HNBA 4JE1A 1PA3A 2DLXA 2G2QA 4ZL8A 1O7UA 1DUGA 1PRXA 2J23A 5IMCA 3CMIA 2VO4A 3I43A 2C0DA 1Z6MA 4MLYA 2IIYA 4YAVA 1M2BA 2QGVA 2H1GA 1K0DA 1B4PA 2KOKA 1V98A 1X9SB 2XBIA 3C73A 3WYWA 4HQZA 2MMZA 2VL9A 5DQYA 3ZIVA 4KAEA 1XCCA 3IC8A 1TTZA 4HS1A 2HQTA 1Z9HA 1DE2A 3EC3A 3KCMA 3TRPA 1A2JA 1B9XC 2YJHA 3HA9A 2AHEA 1GSEA 1PQNA 4JR4A 3APSA 1SK1A 2HFDA 1QFNA 2DJ0A 1SJIA 4TW5A 4IJIA 1E6BA 3VWUA 1NHYA 3N9JA 4BVXA 2FWFA 4PGTA 2L5LA 2FHEA 1BEDA 1ST9A 3A3TA 3TOTA 4AJ7A 1OKTA 2OACA 4FO5A 1TI3A 1XWAA 2VL2A 1CQHA 2P0GA 2HNLA 3NIVA 1GSQA 1SL1B 2B6MA 3AY8A 2R37A 3TJJA 2XC2A 2I3YA 4KDXA 2K8VA 3IC4A 3L9UA 1OVNA 4GSTA 4OD7A 2GSTA 3UARA 4HEA2 3S9FA 1X5CA 2CZ2A 5ECHB 4N0ZA 3LGCA 4G0LA 3EINA 1EGRA 4ZB8A 2WRTA 3MSZA 3QCPA 1EEMA 4KA0A 5H5RA 4XTSA 2MMOA 4MZBA 5GSSA 1ZOFA 2YN1A 3KH9A 2JACA 6GSTA 3MDKA 3VURA 5AGYA 2CV4A 4NAXA 4CHSA 3FHKA 4OCFA 5AN1A 2N5BA 2V41A 3QFAC 2LEGA 2C3TA 1VF4A 2DBCA 1WWJA 3QPMA 3APQA 5HQPA 2DJ1A 2OA7A 5HFKA 3GSTA 4MF5A 4TOPA 1O8XA 2VD1A 1N8JA 4QQ7A 1X9WB 3KEBA 3UVHA 4ULXA 2IMFA 4MPGA 3LXZA 4AF2A 4LMWA 2LQOA 1TDIA 1K3OA 3TUEA 4DSRA 3PR8A 2VIMA 3ERFA 1R5PA 1S3DA 3H79A 2JZTA 1R7HA 4HU9A 5CREA 2YANA 4PNFA 1KBNA 3HXSA 1ACVA 2VL2C 2OJLA 2M46A 2NTOA 4V2NA 5DALB 4JRRA 2HLSA 5IPGA 3IBHA 2NPBA 4DSQA 1TRUA 5CRWA 1AQWA 3A2WA 2PGTA 2XBQA 5C04A 2X64A 3EU3A 1M9BA 3F3RA 3GSSA 4ML1A 4ZL9A 4FQUA 1A24A 2VLUA 2MBSA 3PPUA 6GSSA 2YJ7A 2V1MA 4J2FA 1AQXA 5ECRB 2REMA 2H0HA 1USBA 4MF6A 4IHUA 5ECLB 2VCXA 2AYTA 1PL1A 3QDNA 3QAWA 4LL4B 1K0NA 2CAIA 7GSSA 5A4UA 1RQMA 1FVKA 1GWCA 1EP8A 1X9MB 11GSA 5BMUA 3D4TA 3TOUA 1F6MC 4MK3A 1GNWA 1O73A 3LEFA 3ME7A 3P7XA 2B5EA 4RQRA 1ZGNA 4N30A 3PGTA 3GTUB 5F05A 3KTBA 3TKSE 2CZ3A 2WS2A 3P8WA 4EDYA 4BPYA 3L78A 2XPDA 3TRQA 1K0AA 3P2AA 3BCKA 2IMIA 4WR4A 2AV4A 4K6XA 1EEJA 5JCUA 2VL3A 1SYXA 5LNKe 1TW9A 4HZ2A 4GQCA 4KCAA 4I2UA 1JZWA 1XWBA 1Q98A 1GULA 2VCZA 3D0ZA 2PUKC 3N5OA 3HVXA 2D2ZA 1XBSA 2HI7A 4IP6A 3W6GA 3IOSA 3UBLA 1W89A 5KN2A 2FWGA 3QR6A 1SYRA 3VI5A 5G31A 4RI7A 2MZCA 3QAVA 4OO4A 4ILFA 2ALBA 3F4SA 1Z7RA 2KHPA 1NW2A 5DALA 1B4QA 3TKRA 2L6CA 5F06A 1U87A 1YKAA 2H76A 1SD8A 1JZOA 2PVOC 1WIKA 4RUVA 4GLTA 2PWJA 4OFTA 1QMVA 1URMA 3ZIJA 1GSYA 1J08A 4KNDA 3MNGA 2L59A 5DDLA 3ZRDA 1YF0A 3DEXA 1OKDA 1YZXA 1GP1A 4USSA 2E7PA 3KH7A 2H75A 3TKPA 4F03A 2PU9C 2X8GA 3BOAA 6GSXA 3TDGA 4IKHA 3LXTA 1GTUA 3RHCA 3ZLPA 4HQSA 18GSA 4D73A 1XWCA 1THOA 1GUHA 2HSYA 4NHWA 5KEJA 1RK4A 3M1GA 1ERWA 3ISOA 20GSA 4POLA 4ZBAA 16GSA 1SK0A 1VGLA 2HRAA 2IL3A 1XIYA 4OFMA 4G0IA 3A2VA 3FZAA 3GTUA 2C80A 1GLPA 5CAXA 1FHEA 4L0WA 3IK7A 3VI7A 1EOGA 4MPFA 5IO0A 2DSAA 1GTBA 1MEKA 2H1AA 1AAZA 2V6KA 3A2XA 3ZMKA 4ZBBA 1WPIA 2H72A 5IMAA 2JL4A 5ELAA 3P90A 4G2EA 4WBRD 3R3EA 3H4KA 3GL3A 3F8UA 5C00A 1J9BA 4ISDA 3ZFBA 2H0GA 2FCHA 3FKFA 5AIVA 4ML6A 3G7YA 1OE7A 1HYUA 5COHA 4MABA 2CQ9A 4V2MA 3KD0A 1JLVA 5JCWA 4NWYA 2YWOA 5EL8A 2GVPA 4ACSA 4E8HA 3GH9A 1EWXA 2FA4A 4ZIJA 1ERUA 1TK5B 1MTCA 2XHFA 4IS0A 4EDZA 4TVEA 1QK8A 4I8BA 2GSRA 4RQXA 5HFIA 4EXJA 1Z7PA 5D8IA 1BYEA 4G0KA 1I5GA 3HVVA 5GAPD 3UBKA 4Q5FA 2HSMB 4MF7A 3Q18A 4KDUA 5FWGA 4WBJA 4AJ8A 1Q4JA 3UOMA 2JSYA 2X8HA 1HQOA 2YV7A 5ECOB 3KMNA 3UEMA 1X0RA 1FG4A 4PQIA 4MH2A 3HJPA 3K8NA 3BBYA 3M9KA 4J57E 3QOUA 2J9HA 4LL1B 3CTGA 5EY6A 3GIXA 4IN0A 2O87A 4TR1A 5IMDA 4GCIA 3QMXA 5L71A 1EP7A 5CYYA 1HNCA 2AUVA 4TXOB 2DMLA 1SKWB 3TCOA 2LSTA 4K1FA 1T4YA 1O6JA 1TI1A 4TR0A 4DVCA 1XWKA 1ZCPA 2H6ZA 3E3EA 4PUAA 4TR3A 4CDOA 4JEDA 5FT3A 3FYGA 3ERGA 4AGSA 3WGDA 4GTUA 3MWHA 4NXIA 3QAGA 1ERTA 2L4QA 5IMFA 4JU5A 1JHBA 1G7EA 5ECIB 1OC3A 3M8NA 3G7JA 3UJ1A 4ECIA 5DJMA 2HE3A 3F4TA 3RDWA 2M72A 1FW1A 5IMZA 1T00A 4OFNA 3O76A 5CNWA 5LCZA 5ECSA 1UVZA 1XW6A 1Y25A 3KIJA 2YP6A 2KLXA 1TU7A 4ZBDA 1EGOA 3QD9A 4EE0A
chains in the Genus database with same CATH superfamily
3EURA 3GL5A 4LLRA 3ED3A 2P31A 3HHVA 2K18A 3FRCA 4WF4A 1YY7A 3ZYWA 4PI0C 4K9ZA 2HSMA 2R6KA 2LRNA 5KOWA 4MZWA 4HJMA 3UMAA 5ELGA 4FYUA 2H1LA 3J7Yb 2BMXA 4IP1A 2AAWA 3DGQA 2MYGA 3IA1A 2PMTA 3F4RA 3A5WA 5ID2B 1PKWA 3WT2A 1G7OA 2LRCA 4POKA 4JBBA 1V57A 3HD5A 3FK8A 1IYIA 1BX9A 5IOWA 5LD0A 5HR3A 4V2LA 2FWHA 1S4BP 2PBJA 1H4OA 3L0HA 1K3YA 2N5FA 2FUG2 22GSA 1YJ6A 4GSSA 4EL1A 4TXOA 3C71A 1M3JA 1G0TA 4KSMA 3GKKA 2PVQA 3O6TA 4OCEA 4DSSA 2VUPA 3CQFA 2B7JA 3TGZA 4XIHA 3LW9A 3DMLA 2RUFA 4YH2A 3FZ9A 3UAPA 1N2AA 1WRYA 3IXRA 3SBCA 3FR9A 1K0OA 3HVSA 3I69A 1O8WA 3DRNA 4DEJA 3QFBC 4F0CA 3KM6A 1DSBA 4ECBA 2ZUPA 1X5DA 1A8YA 5G2ZA 4BWQA 3M9JA 2GZZA 4O7HA 2VKZG 1PMTA 1Y1UA 1GUKA 5A1NB 5A34B 2HZFA 4POBA 2YWIA 2YZHA 5HFGA 2WB9A 2H73A 2YOIA 3F63A 3KMOA 3HJMA 1A0RP 19GSA 2C3QA 4K0GA 2F51A 2GQMA 3NZNA 3ERWA 3ZTLA 4PNGA 3EMPA 3ZZXA 4WKWA 3VK9A 1GTIA 2DJ3A 5KN3A 2B1KA 3FY7A 3GFKA 4HJ2A 5DAKB 2LJAA 1TRWA 2HT9A 1FOHA 1UA5A 2WULA 2HYXA 2GSQA 1OAZA 2LQQA 5ID2A 3IK9A 1WP0A 1UN2A 2H6XA 4D73B 4FYBA 4K2XA 2IN3A 3FZ4A 4W66A 1ILOA 1SVLA 3J7Yk 5CRDA 2CVDA 1FOVA 1SKSB 2VAFA 4WEYA 1S3AA 4MJEA 4EUYA 4MA9A 1XVQA 2GT6A 3C1RA 1QGVA 1U88A 3GUSA 1WMJA 1SD9A 4JR6A 2ON7A 1ERVA 1M0UA 1GLQA 4Q5RA 5IOXA 2I4AA 4OO5A 4ICYA 1OE8A 4AI6A 3RPPA 1J0FA 3FMWA 4N10A 3DVWA 3GA4A 4XCSA 5D96A 2YWMA 4KH7A 3TKSA 3WD6A 2RUEA 2HSNB 4AJ6A 1JZDA 1CQGA 2ON5A 2CT6A 2GQKA 5IQYA 4PXOA 2DKIA 4TRXA 4V1Ag 3DXBA 2CAQA 3F6DA 1H75A 5DCHA 1AXDA 2LNSA 1Z6NA 1ZYPA 5INYA 4Q5NA 1GTAA 3IAM2 3EMXA 4ZL7A 2ZCTA 3UL3A 3Q74A 3WT1A 4KW6A 4IJ3A 6GSUA 2VM2A 5JCGA 5A1NA 5A34A 5A5KA 2PN8A 5CO3A 4ECJA 1ML6A 4K7NA 1SL2B 4KSOA 3Q6OA 2O36A 1YEXA 2B5XA 5F07A 2A4HA 2V2GA 3DWVA 2X8CA 3F0IA 3U5RE 1EZKA 3KP9A 1M7TA 3CSJA 2H71A 5DAKA 2K6VA 17GSA 4ZB6A 3HJOA 3VFIA 2H70A 3HDCA 3VWVA 3TJBA 2LUSA 2H66A 5ECQB 1QQ2A 2VCTA 3ZMLA 3TB2A 5JWRB 2H8LA 1GRXA 5IM9A 1YF1A 3D6IA 3TJFA 2N5AA 4BVYB 4KF9A 2EFDA 2P5RA 3GH6A 2DIYA 1A8LA 2FY6A 3CRUA 1F37A 2FNOA 2H1DA 1R5AA 3GKMA 1YEPA 3TKSC 3RPNA 1SL0B 4TR1B 3DIEA 1O81A 2WDUA 4WETA 2VLVA 4IBPA 1YEWC 3PH9A 2R0PA 3M3MA 2B5YA 3WGEA 3IV4A 4KX4A 3FEUA 2WCIA 2WZSA 1YKCA 5ECMB 4PX1A 5J5NA 2OE1A 3GMFA 3W8SA 2OKAA 2C4JA 2IJYA 3H8QA 2YZUA 2C3NA 1XOBA 5DQSA 4FYCA 4V1Ap 2GZYA 2JSZA 1A23A 3GX0A 3L4NA 5JWQB 2R0CA 3ZL5A 1PGTA 2QC7A 4BIKA 3EVIA 1WE0A 3NOFA 2YWNA 2OBIA 2F9SA 4EO3A 3GNJA 2VCQA 4X4JA 3MAKA 4YKFA 5ENUA 2X99A 3GYKA 3KXOA 1X5EA 3M0FA 3H1NA 3HZ4A 4FXYP 4YQMA 1A0FA 2LJKA 3UVTA 4Q5QA 3HCZA 4I5QA 1BQ7A 3CBUA 4E8EA 3IAS2 3FW2A 1KEBA 3JCML 4H86A 3CSIA 1EOHA 4RI6A 2P5QA 2L6DA 4HI7A 4GXZA 5A4WA 2AJQB 2DMMA 3O3TA 3ME8A 1VF3A 5G1LA 1AUCA 4GSNA 4I97A 1TJDA 1FVJA 2DIZA 5IMVA 4OWYA 1MDIA 3V1WA 5D9TA 1GH2A 1T4ZA 3GKNA 2OE0A 6GSVA 1BAYA 2C0EA 4AKIA 3LORA 2WJUA 1LJRA 1GSSA 1DBYA 1EV4A 5J4UA 5J3RA 9GSSA 4EKZA 2QA1A 4BVYA 1F3AA 3FR6A 4KE3A 5D9WA 1W4VA 2F8AA 2VM1A 3VPQA 4K2DA 5G30A 5DVBA 3EYTA 1K3LA 2PPTA 4KDYA 1U3AA 1U3IA 1TOFA 1AIUA 4K7OA 3C7MA 2JADA 2CA8A 4GDFA 2CVKA 3RAZA 1C72A 4L5LA 4ECCA 1SU9A 2RM5A 4KCEA 4DSSB 5ECNB 4N0VA 5B6NA 2WGRA 2H19A 4G19A 2IPAA 3IPZA 2IFQA 3IRAA 1GUMA 1GSFA 3UIWA 3TJKA 1XFLA 5ECPB 1WJKA 3GN3A 1EV9A 4MJCA 1YVLA 4QL7A 1T8EB 4MZCA 5GSTA 1TK8B 4XS4B 4KB3A 4IQ1A 1K0CA 3G7IA 1G6YA 1TU8A 3TU3B 2EIQA 2IWTA 2GT5A 1ON4A 1XXUA 5EPFA 3CTFA 4PQHA 2L4CA 5J41A 1OC9B 1TK0B 2LTKA 2WZ9A 2O8VB 4KUNA 5B8BA 2I81A 2QKEA 1M99A 1FB0A 2NVLA 2DC5A 1XG8A 3FZ5A 2OADA 4MP4A 3HYPA 5J40A 1N25A 4AKGA 1NHOA 5B7CA 4NHZA 2H0IA 2FLSA 1RW1A 1WOUA 4BA7A 1GSDA 2E0QA 2EIOA 1B48A 2TRCP 1ZYEA 2LS5A 4TXVA 1IYHA 1VRSD 1F9MA 4YAPA 4XS6A 5AISA 4G9HA 4WXTA 5DBQA 5E59A 3KZQA 4L0UA 5J9CA 3EWLA 4F2IA 2LRTA 1AW9A 2NBSA 1GL8A 4TN8A 2HRKB 4XRDA 2CX3A 1MD3A 3LYKA 2K9FA 4K7IA 2QSIA 3EU4A 3LFLA 2VD0A 4YKGA 1SK2A 1TKDB 4F0BA 1XW5A 1G6WA 1NM3A 2FD3A 5ECKB 2H01A 3G9BA 1SKRB 10GSA 4P3YB 4PI2C 1FB6A 2HRFA 2XPEA 2NDOA 1AQVA 3D22A 3LSZA 1E2YA 4K5RA 3I9V2 4WR5A 5J47A 2C0GA 4XS4A 1BG5A 1PKZA 1ZMAA 1F2EA 2C8UA 2GS3A 2K8SA 2CX4A 4X43A 4Z2TA 4PHZC 4GQFA 4EF0A 2GZPA 3KTLA 1V40A 1XPVA 4EVMA 3TJGA 2H74A 4ID0A 3MIXA 14GSA 5G1KA 1LBKA 1OC9A 3RHBA 1TXXA 4L5OA 1HD2A 2B1LA 4PUFC 4O92A 3ZITA 2BJXA 5B6MA 2O5VA 4XRAA 5KN1A 1AC1A 1S3CA 3IHQA 1B9YC 3HZ8A 1V58A 3BCIA 1T1VA 4I6XA 3RFRC 3W8JA 4GRFA 5D73A 5DJLA 2I9HA 3GKXA 4O5RA 2HRNA 2YV9A 2GDRA 1JZRA 4MCUA 5GZZB 1VF2A 4F82A 3US3A 4HU7A 1Z3EA 1V9WA 5D9VA 4POMA 4GF0A 2F8FA 3L9VA 4GWRA 1KTEA 2R4VA 4G01A 4NV5A 3ZVJA 4AKHA 2F3MA 4I2TA 1OYJA 2V6OA 3E0UA 2IMEA 1PX6A 2I1UA 2BTOT 2B3SA 2YCDA 1YQ1A 2C1YA 4K8MA 4ZILA 1FO5A 2WFCA 2UV8G 2HRKA 2ES7A 1B8XA 2EIRA 3F6FA 1M2DA 4MJAA 4YQUA 2IMKA 4FH8A 2LJRA 5KN0A 3LQ7A 4NMUA 1M9AA 4O32A 1M2AA 1YDKA 1UC7A 3EE2A 5A4VA 2A2RA 4PTSA 2IMDA 3GURA 1SENA 1O85A 2KP2A 5D9XA 1LU4A 4MJBA 2JZRA 1XZOA 2RLIA 4CY8A 5A5HB 3D5JA 2JU5A 1T3BA 1SJ6A 3C1SA 2L57A 2TIRA 1I9DA 4Z7XA 3H93A 4MMMA 2ZNMA 1MDJA 6GSWA 1ABAA 1XVWA 4NPBA 1GSUA 2R3XA 3F3QA 2HZEB 3GRXA 1GNEA 2LNTA 4EC0A 4LMVA 5G5FA 3C8EA 3APOA 3CYNA 1T7PB 3IR4A 4IQAA 2A4VA 3TKQA 5F8BA 1V2AA 2X4AA 4TKYA 3BD2A 4L8EA 4HDEA 2VOCA 2YPMA 3ZFLA 3LWAA 2OBKA 5CRHA 5IPHA 3ZREA 3I6AA 2G0FA 2MBTA 2DJJA 1TRSA 3ZVJD 3R2QA 3HKRA 1PN9A 2R5GA 4X1UA 4AKXB 2CVBA 2H30A 2RM6A 4PQ1A 5HR2A 2GGTA 8GSSA 3LJRA 2Z9SA 2DJ2A 4IGJA 4IVFA 4ZXGA 3FR3A 1A2LA 13GSA 4OMVA 4N11A 2E2MA 4XHMA 4CW9A 1XWGA 4HOJA 2R2JA 3VWXA 5DCGA 1DE1A 2H1BA 4IW9A 1ZZYA 4YQVA 4MDCA 4WF5A 4NV2A 3GX8A 3PINA 2KP1A 2DKHA 2UZ8A 1FAAA 5CP1A 3CWGA 1K0BA 1JLWA 1Z5YE 1TP9A 2JZSA 2LV3A 1U6TA 2KUCA 1PFOA 4O5UA 5G5EA 1R4WA 4BL7B 3DYRA 3IE3A 3VPTA 5JWOB 3TRXA 5J9BA 2O3EA 4QL9A 2VCVA 2WW3A 2EC4A 2VLTA 2L5OA 2E2GA 5E4WA 1HNAA 3D21A 3L9SA 2FWEA 4F9ZA 2AB6A 3GV1A 1QXHA 2FGXA 5FHIA 5A5HA 2IFQB 5D93A 1PX7A 2LKUA 3KP8A 3IDVA 4JZQA 3SWLA 1Y6EA 2HZEA 4HUAA 1ZL9A 2GLRA 2VCWA 6GSYA 3DKSA 3GHAA 4J56E 2OE3A 1XW9A 5CRGA 2C0FA 2O7KA 5AIXA 4ZB9A 2B7KA 1QUWA 2H6YA 4PURA 1NSWA 2HXKA 3F9UA 2A2PA 1ZYQB 1KNGA 5HR1A 2RIIA 1THXA 1JFUA 3KGKA 3CXGA 3Q19A 5EVOA 3E9JB 4X0XA 1PL2A 1PN0A 2O85A 4BWSA 4BVXB 1OC8A 3KJYA 5IO2A 4KGIA 4FIWA 4K5SA 1R26A 1SJZA 3U6VA 1MD4A 1TRVA 3HY2A 4K0NA 2PERA 1PSQA 3VLNA 5IIZA 5B8AA 4XS1A 3VWWA 2YNXA 1VF1A 5HR0A 1MDKA 4G10A 5H5SA 4EIPA 4LA1A 3OR5A 2DJKA 1PD21 2FA8A 12GSA 2GSSA 4TR4A 2GQLA 1BJXA 3D4MA 2A2SA 3DVXA 4BL7A 2HSHA 5H5QA 2O89A 2MMNA 4HZ4A 1ZYNA 3WGXA 1A2MA 1F3BA 5F0GA 4MH3A 5BRTA 1XOAA 3LG6A 3LYPA 2V32A 3RBTA 3CRTA 3DD3A 2M80A 3BJ5A 5ABRA 4IELA 1K0MA 2MMAA 2TRXA 2GTUA 3CSHA 5GAND 1HNBA 4JE1A 3MYDA 1PA3A 2DLXA 2G2QA 4ZL8A 1O7UA 1DUGA 1PRXA 2J23A 5IMCA 3CMIA 2VO4A 3I43A 2C0DA 1Z6MA 4MLYA 2IIYA 4N3ZA 4YAVA 1M2BA 2QGVA 2H1GA 1K0DA 1B4PA 4E68A 2KOKA 1V98A 1X9SB 2XBIA 3C73A 3WYWA 4HQZA 2MMZA 2VL9A 2WVXB 5DQYA 3ZIVA 4KAEA 1XCCA 3IC8A 1TTZA 4HS1A 2HQTA 1Z9HA 1DE2A 3EC3A 3KCMA 3TRPA 1A2JA 1B9XC 2YJHA 3HA9A 2AHEA 1GSEA 1PQNA 4JR4A 3APSA 1SK1A 2HFDA 1QFNA 2WW1A 5J4YA 2DJ0A 1SJIA 4TW5A 4IJIA 1E6BA 3VWUA 1NHYA 2WW0A 3N9JA 4BVXA 2FWFA 4PGTA 2L5LA 2FHEA 1BEDA 1ST9A 3A3TA 3TOTA 4AJ7A 1OKTA 2OACA 4FO5A 1TI3A 1XWAA 2VL2A 1CQHA 2P0GA 2HNLA 3NIVA 4CY6A 1GSQA 1SL1B 2B6MA 3AY8A 2R37A 3TJJA 2XC2A 2I3YA 4KDXA 2K8VA 3IC4A 3L9UA 1OVNA 2OT3A 4GSTA 4OD7A 2GSTA 3UARA 4HEA2 3S9FA 1X5CA 2CZ2A 5ECHB 4N0ZA 4Z2RA 3LGCA 4G0LA 3EINA 1EGRA 4ZB8A 2WRTA 3MSZA 5BMUB 3QCPA 1EEMA 4KA0A 5H5RA 4XTSA 2MMOA 4MZBA 5GSSA 1ZOFA 2YN1A 3KH9A 2JACA 6GSTA 3MDKA 3VURA 5AGYA 2CV4A 4NAXA 4CHSA 3FHKA 2QA2A 4OCFA 5AN1A 2N5BA 2V41A 3QFAC 2LEGA 2C3TA 1VF4A 2DBCA 1WWJA 3QPMA 3APQA 5HQPA 2DJ1A 2OA7A 5HFKA 3GSTA 4MF5A 4TOPA 1O8XA 2VD1A 1N8JA 4QQ7A 1X9WB 3KEBA 3UVHA 4ULXA 2IMFA 4MPGA 3LXZA 4AF2A 4LMWA 2LQOA 1TDIA 1K3OA 3TUEA 2WVXA 4DSRA 3PR8A 2VIMA 3ERFA 1R5PA 1S3DA 3H79A 2JZTA 1R7HA 4HU9A 5CREA 2YANA 4PNFA 1KBNA 3HXSA 1ACVA 2VL2C 2OJLA 2M46A 2NTOA 4V2NA 5DALB 4JRRA 2HLSA 5IPGA 3IBHA 2NPBA 4DSQA 1TRUA 1BG1A 5CRWA 4O5QA 1AQWA 3A2WA 2PGTA 2XBQA 5C04A 2X64A 3EU3A 1M9BA 3F3RA 3GSSA 4ML1A 4ZL9A 4FQUA 1A24A 2VLUA 2MBSA 3PPUA 6GSSA 2YJ7A 2V1MA 4J2FA 1AQXA 5ECRB 2REMA 2H0HA 1USBA 4MF6A 4IHUA 5ECLB 2VCXA 2AYTA 1PL1A 3QDNA 3QAWA 4LL4B 1K0NA 2CAIA 7GSSA 5A4UA 1RQMA 1FVKA 1GWCA 1EP8A 1X9MB 11GSA 5BMUA 3D4TA 3TOUA 1F6MC 4MK3A 1GNWA 1O73A 3LEFA 3ME7A 3P7XA 2B5EA 4RQRA 1ZGNA 4N30A 3PGTA 3GTUB 5F05A 3KTBA 3TKSE 2CZ3A 2WS2A 3P8WA 4EDYA 4BPYA 3L78A 2XPDA 3RGBC 3TRQA 1K0AA 3P2AA 3BCKA 2IMIA 4WR4A 2AV4A 4K6XA 1EEJA 5JCUA 2VL3A 1SYXA 5LNKe 1TW9A 2WVYA 4HZ2A 4GQCA 4KCAA 4I2UA 1JZWA 3IHGA 1XWBA 1Q98A 1GULA 2VCZA 3D0ZA 2PUKC 3N5OA 3HVXA 2D2ZA 1XBSA 2HI7A 4IP6A 3W6GA 3IOSA 3A5IA 3UBLA 1W89A 5KN2A 2FWGA 3QR6A 1SYRA 3VI5A 5G31A 4RI7A 2MZCA 3QAVA 4OO4A 1S3RA 4ILFA 2ALBA 3F4SA 1Z7RA 2KHPA 1NW2A 5DALA 1B4QA 3TKRA 2L6CA 2WW2A 5F06A 1U87A 1YKAA 2H76A 1SD8A 1JZOA 2PVOC 1WIKA 3HVNA 4RUVA 4GLTA 2PWJA 4OFTA 1QMVA 1URMA 3ZIJA 1GSYA 1J08A 4KNDA 3MNGA 2L59A 5DDLA 3ZRDA 1YF0A 3DEXA 1OKDA 4HSCX 1YZXA 1GP1A 4USSA 2E7PA 3KH7A 2H75A 3TKPA 4F03A 2PU9C 2X8GA 3BOAA 6GSXA 3TDGA 4IKHA 3LXTA 1GTUA 3RHCA 3ZLPA 4HQSA 18GSA 4D73A 1XWCA 1THOA 1GUHA 2HSYA 4NHWA 5KEJA 1RK4A 3M1GA 5KOXA 1ERWA 3ISOA 20GSA 4POLA 2EFCA 16GSA 4ZBAA 1SK0A 1VGLA 2EFEA 2HRAA 2IL3A 1XIYA 4OFMA 4G0IA 3A2VA 3FZAA 3GTUA 2C80A 1GLPA 5CAXA 1FHEA 4L0WA 3IK7A 3VI7A 1EOGA 4MPFA 5IO0A 4QMKA 2DSAA 1GTBA 1MEKA 2H1AA 1AAZA 2V6KA 3A2XA 3ZMKA 4ZBBA 1WPIA 1I1IP 2H72A 5IMAA 2X49A 2JL4A 5ELAA 3P90A 4G2EA 2HSNA 4WBRD 3R3EA 3H4KA 4MNNA 3HMJG 3GL3A 3F8UA 5C00A 1J9BA 1SVOA 4ISDA 3ZFBA 2H0GA 2FCHA 3FKFA 5AIVA 4ML6A 3G7YA 1OE7A 1HYUA 5COHA 4MABA 2CQ9A 4V2MA 3KD0A 1JLVA 5JCWA 4NWYA 2YWOA 5EL8A 2GVPA 4ACSA 4E8HA 3GH9A 1EWXA 2FA4A 4ZIJA 1ERUA 1TK5B 1MTCA 2XHFA 4IS0A 4A5PA 4EDZA 4TVEA 1TXUA 1QK8A 4I8BA 2GSRA 3CHXC 4RQXA 5HFIA 4EXJA 1Z7PA 4Z2UA 5D8IA 1BYEA 4G0KA 1I5GA 3HVVA 5GAPD 3UBKA 4Q5FA 2HSMB 4MF7A 3Q18A 4KDUA 5J4VA 5FWGA 4WBJA 4AJ8A 2R0GA 1Q4JA 3UOMA 2JSYA 2X8HA 1HQOA 2YV7A 5ECOB 3KMNA 2WVZA 3UEMA 1X0RA 1FG4A 1SVMA 4PQIA 4MH2A 3HJPA 3K8NA 3BBYA 2EFHA 3M9KA 1M3IA 4J57E 3QOUA 2J9HA 4LL1B 3CTGA 5EY6A 3GIXA 4IN0A 2O87A 4TR1A 5IMDA 4GCIA 3QMXA 5L71A 1EP7A 5CYYA 1HNCA 2AUVA 4TXOB 2DMLA 1SKWB 3EPTA 3TCOA 2LSTA 4K1FA 1T4YA 4EIQA 1O6JA 1TI1A 4TR0A 4DVCA 1XWKA 3E3EA 1ZCPA 2H6ZA 4PUAA 4TR3A 4CDOA 4JEDA 5FT3A 3FYGA 3ERGA 4AGSA 3WGDA 4GTUA 3MWHA 4NXIA 3QAGA 1ERTA 2L4QA 5IMFA 4JU5A 1JHBA 1G7EA 5ECIB 1OC3A 3M8NA 3G7JA 3UJ1A 4ECIA 4ZB7A 5DJMA 2HE3A 3F4TA 3RDWA 2M72A 1FW1A 5IMZA 1T00A 4OFNA 3O76A 5CNWA 5LCZA 5ECSA 1UVZA 1XW6A 1Y25A 3KIJA 2YP6A 2KLXA 1TU7A 4ZBDA 1BF5A 1EGOA 3QD9A 4EE0A
chains in the Genus database with same CATH topology
3EURA 3GL5A 4LLRA 3ED3A 2P31A 3HHVA 2K18A 3FRCA 4WF4A 1YY7A 3ZYWA 4K9ZA 2HSMA 2R6KA 2LRNA 5KOWA 4MZWA 4HJMA 3UMAA 5ELGA 4FYUA 2H1LA 3J7Yb 2BMXA 4IP1A 2AAWA 3DGQA 2MYGA 3IA1A 2PMTA 3F4RA 3A5WA 5ID2B 1PKWA 3WT2A 1G7OA 2LRCA 4POKA 4JBBA 1V57A 3HD5A 3FK8A 1IYIA 1BX9A 5IOWA 5LD0A 5HR3A 4V2LA 2FWHA 2PBJA 1H4OA 3L0HA 1K3YA 2N5FA 2FUG2 22GSA 1YJ6A 4GSSA 4EL1A 4TXOA 3C71A 1G0TA 4KSMA 3GKKA 2PVQA 3O6TA 4OCEA 4DSSA 2VUPA 2B7JA 3TGZA 4XIHA 3LW9A 3DMLA 2RUFA 4YH2A 3FZ9A 3UAPA 1N2AA 1WRYA 3IXRA 3SBCA 3FR9A 1K0OA 3HVSA 3I69A 1O8WA 3DRNA 4DEJA 3QFBC 4F0CA 3KM6A 1DSBA 4ECBA 2ZUPA 1X5DA 1A8YA 5G2ZA 4BWQA 3M9JA 2GZZA 4O7HA 2VKZG 1PMTA 1Y1UA 1GUKA 5A1NB 5A34B 2HZFA 4POBA 2YWIA 2YZHA 5HFGA 2WB9A 2H73A 2YOIA 3F63A 3KMOA 3HJMA 1A0RP 19GSA 2C3QA 4K0GA 2F51A 2GQMA 3NZNA 3ERWA 3ZTLA 4PNGA 3EMPA 3ZZXA 4WKWA 3VK9A 1GTIA 2DJ3A 5KN3A 2B1KA 3FY7A 3GFKA 4HJ2A 5DAKB 2LJAA 1TRWA 2HT9A 1FOHA 1UA5A 2WULA 2HYXA 2GSQA 1OAZA 2LQQA 5ID2A 3IK9A 1WP0A 1UN2A 2H6XA 4D73B 4FYBA 4K2XA 2IN3A 3FZ4A 4W66A 1ILOA 1SVLA 3J7Yk 5CRDA 2CVDA 1FOVA 1SKSB 2VAFA 4WEYA 1S3AA 4MJEA 4EUYA 4MA9A 1XVQA 2GT6A 3C1RA 1QGVA 1U88A 3GUSA 1WMJA 1SD9A 4JR6A 2ON7A 1ERVA 1M0UA 1GLQA 4Q5RA 5IOXA 2I4AA 4OO5A 4ICYA 1OE8A 4AI6A 3RPPA 1J0FA 3FMWA 4N10A 3DVWA 3GA4A 4XCSA 5D96A 2YWMA 4KH7A 3TKSA 3WD6A 2RUEA 2HSNB 4AJ6A 1JZDA 1CQGA 2ON5A 2CT6A 2GQKA 5IQYA 4PXOA 2DKIA 4TRXA 4V1Ag 3DXBA 2CAQA 3F6DA 1H75A 5DCHA 1AXDA 2LNSA 1Z6NA 1ZYPA 5INYA 4Q5NA 1GTAA 3IAM2 3EMXA 4ZL7A 2ZCTA 3UL3A 3Q74A 3WT1A 4KW6A 4IJ3A 6GSUA 2VM2A 5JCGA 5A1NA 5A34A 5A5KA 2PN8A 5CO3A 4ECJA 1ML6A 4K7NA 1SL2B 4KSOA 3Q6OA 1YEXA 2B5XA 5F07A 2A4HA 2V2GA 3DWVA 2X8CA 3F0IA 3U5RE 1EZKA 3KP9A 1M7TA 3CSJA 2H71A 5DAKA 2K6VA 17GSA 4ZB6A 3HJOA 3VFIA 2H70A 3HDCA 3VWVA 3TJBA 2LUSA 2H66A 5ECQB 1QQ2A 2VCTA 3ZMLA 3TB2A 5JWRB 2H8LA 1GRXA 5IM9A 1YF1A 3D6IA 3TJFA 2N5AA 4BVYB 4KF9A 2EFDA 2P5RA 3GH6A 2DIYA 1A8LA 2FY6A 3CRUA 1F37A 2FNOA 2H1DA 1R5AA 3GKMA 1YEPA 3TKSC 3RPNA 1SL0B 4TR1B 3DIEA 1O81A 2WDUA 4WETA 2VLVA 4IBPA 3PH9A 2R0PA 3M3MA 2B5YA 3WGEA 3IV4A 4KX4A 3FEUA 2WCIA 1YKCA 5ECMB 4PX1A 5J5NA 2OE1A 3GMFA 3W8SA 2OKAA 2C4JA 2IJYA 3H8QA 2YZUA 2C3NA 1XOBA 5DQSA 4FYCA 4V1Ap 2GZYA 2JSZA 1A23A 3GX0A 3L4NA 5JWQB 2R0CA 3ZL5A 1PGTA 2QC7A 3EVIA 1WE0A 3NOFA 2YWNA 2OBIA 2F9SA 4EO3A 3GNJA 2VCQA 4X4JA 3MAKA 4YKFA 5ENUA 2X99A 3GYKA 3KXOA 1X5EA 3M0FA 3H1NA 3HZ4A 4YQMA 1A0FA 2LJKA 3UVTA 4Q5QA 3HCZA 4I5QA 1BQ7A 3CBUA 4E8EA 3IAS2 3FW2A 1KEBA 3JCML 4H86A 3CSIA 1EOHA 4RI6A 2P5QA 2L6DA 4HI7A 4GXZA 5A4WA 2AJQB 2DMMA 3O3TA 3ME8A 1VF3A 5G1LA 1AUCA 4GSNA 4I97A 1TJDA 1FVJA 2DIZA 5IMVA 4OWYA 1MDIA 3V1WA 5D9TA 1GH2A 1T4ZA 3GKNA 2OE0A 6GSVA 1BAYA 2C0EA 4AKIA 3LORA 2WJUA 1LJRA 1GSSA 1DBYA 1EV4A 5J4UA 5J3RA 9GSSA 4EKZA 2QA1A 4BVYA 1F3AA 3FR6A 4KE3A 5D9WA 1W4VA 2F8AA 2VM1A 3VPQA 4K2DA 5G30A 5DVBA 3EYTA 1K3LA 2PPTA 4KDYA 1U3AA 1U3IA 1TOFA 1AIUA 4K7OA 3C7MA 2JADA 2CA8A 4GDFA 2CVKA 3RAZA 1C72A 4L5LA 4ECCA 1SU9A 2RM5A 4KCEA 4DSSB 5ECNB 4N0VA 5B6NA 2WGRA 2H19A 4G19A 2IPAA 3IPZA 2IFQA 3IRAA 1GUMA 1GSFA 3UIWA 3TJKA 1XFLA 5ECPB 1WJKA 3GN3A 1EV9A 4MJCA 1YVLA 4QL7A 1T8EB 4MZCA 5GSTA 1TK8B 4XS4B 4KB3A 4IQ1A 1K0CA 3G7IA 1G6YA 1TU8A 3TU3B 2EIQA 2IWTA 2GT5A 1ON4A 1XXUA 5EPFA 3CTFA 4PQHA 2L4CA 5J41A 1OC9B 1TK0B 2LTKA 2WZ9A 2O8VB 4KUNA 5B8BA 2I81A 2QKEA 1M99A 1FB0A 2NVLA 2DC5A 3FZ5A 2OADA 4MP4A 3HYPA 5J40A 1N25A 4AKGA 1NHOA 5B7CA 4NHZA 2H0IA 2FLSA 1RW1A 1WOUA 4BA7A 1GSDA 2E0QA 2EIOA 1B48A 2TRCP 1ZYEA 2LS5A 4TXVA 1IYHA 1VRSD 1F9MA 4YAPA 4XS6A 5AISA 4G9HA 4WXTA 5DBQA 5E59A 3KZQA 4L0UA 5J9CA 3EWLA 4F2IA 2LRTA 1AW9A 2NBSA 1GL8A 4TN8A 2HRKB 4XRDA 2CX3A 3LYKA 1MD3A 2K9FA 4K7IA 2QSIA 3EU4A 3LFLA 2VD0A 4YKGA 1SK2A 1TKDB 4F0BA 1XW5A 1G6WA 1NM3A 2FD3A 5ECKB 2H01A 3G9BA 1SKRB 10GSA 4P3YB 1FB6A 2HRFA 2XPEA 2NDOA 1AQVA 3D22A 3LSZA 1E2YA 4K5RA 3I9V2 4WR5A 5J47A 2C0GA 4XS4A 1BG5A 1PKZA 1ZMAA 1F2EA 2C8UA 2GS3A 2K8SA 2CX4A 4X43A 4Z2TA 4GQFA 4EF0A 2GZPA 3KTLA 1V40A 1XPVA 4EVMA 3TJGA 2H74A 4ID0A 3MIXA 14GSA 5G1KA 1LBKA 1OC9A 3RHBA 1TXXA 4L5OA 1HD2A 2B1LA 4PUFC 4O92A 3ZITA 2BJXA 5B6MA 2O5VA 4XRAA 5KN1A 1AC1A 1S3CA 3IHQA 1B9YC 3HZ8A 1V58A 3BCIA 1T1VA 4I6XA 3W8JA 4GRFA 5D73A 5DJLA 2I9HA 3GKXA 4O5RA 2HRNA 2YV9A 2GDRA 1JZRA 4MCUA 5GZZB 1VF2A 4F82A 3US3A 4HU7A 1Z3EA 1V9WA 5D9VA 4POMA 4GF0A 2F8FA 3L9VA 4GWRA 1KTEA 2R4VA 4G01A 4NV5A 3ZVJA 4AKHA 2F3MA 4I2TA 1OYJA 2V6OA 3E0UA 2IMEA 1PX6A 2I1UA 2BTOT 2B3SA 2YCDA 1YQ1A 2C1YA 4K8MA 4ZILA 1FO5A 2WFCA 2UV8G 2HRKA 2ES7A 1B8XA 2EIRA 3F6FA 1M2DA 4MJAA 4YQUA 2IMKA 4FH8A 2LJRA 5KN0A 3LQ7A 4NMUA 1M9AA 4O32A 1M2AA 1YDKA 1UC7A 3EE2A 5A4VA 2A2RA 4PTSA 2IMDA 3GURA 1SENA 1O85A 2KP2A 5D9XA 1LU4A 4MJBA 2JZRA 1XZOA 2RLIA 4CY8A 5A5HB 3D5JA 2JU5A 1T3BA 1SJ6A 3C1SA 2L57A 2TIRA 1I9DA 4Z7XA 3H93A 4MMMA 2ZNMA 1MDJA 6GSWA 1ABAA 1XVWA 4NPBA 1GSUA 2R3XA 3F3QA 2HZEB 3GRXA 1GNEA 2LNTA 4EC0A 4LMVA 5G5FA 3C8EA 3APOA 3CYNA 1T7PB 3IR4A 4IQAA 2A4VA 3TKQA 5F8BA 1V2AA 2X4AA 4TKYA 3BD2A 4L8EA 4HDEA 2VOCA 2YPMA 3ZFLA 3LWAA 2OBKA 5CRHA 5IPHA 3ZREA 3I6AA 2G0FA 2MBTA 2DJJA 1TRSA 3ZVJD 3R2QA 3HKRA 1PN9A 2R5GA 4X1UA 4AKXB 2CVBA 2H30A 2RM6A 4PQ1A 5HR2A 2GGTA 8GSSA 3LJRA 2Z9SA 2DJ2A 4IGJA 4IVFA 4ZXGA 3FR3A 1A2LA 13GSA 4OMVA 4N11A 2E2MA 4XHMA 4CW9A 1XWGA 4HOJA 2R2JA 3VWXA 5DCGA 1DE1A 2H1BA 4IW9A 1ZZYA 4YQVA 4MDCA 4WF5A 4NV2A 3GX8A 3PINA 2KP1A 2DKHA 2UZ8A 1FAAA 5CP1A 3CWGA 1K0BA 1JLWA 1Z5YE 1TP9A 2JZSA 2LV3A 1U6TA 2KUCA 4O5UA 5G5EA 1R4WA 4BL7B 3DYRA 3IE3A 3VPTA 5JWOB 3TRXA 5J9BA 4QL9A 2VCVA 2E2GA 2EC4A 2VLTA 2L5OA 5E4WA 1HNAA 3D21A 3L9SA 2FWEA 4F9ZA 2AB6A 3GV1A 1QXHA 2FGXA 5FHIA 5A5HA 2IFQB 5D93A 1PX7A 2LKUA 3KP8A 3IDVA 4JZQA 3SWLA 1Y6EA 2HZEA 4HUAA 1ZL9A 2GLRA 2VCWA 6GSYA 3DKSA 3GHAA 4J56E 2OE3A 1XW9A 5CRGA 2C0FA 2O7KA 5AIXA 4ZB9A 2B7KA 1QUWA 2H6YA 4PURA 1NSWA 2HXKA 3F9UA 2A2PA 1ZYQB 1KNGA 5HR1A 2RIIA 1THXA 1JFUA 3KGKA 3CXGA 3Q19A 5EVOA 3E9JB 4X0XA 1PL2A 1PN0A 2O85A 4BWSA 4BVXB 1OC8A 3KJYA 5IO2A 4KGIA 4FIWA 4K5SA 1R26A 1SJZA 3U6VA 1MD4A 1TRVA 3HY2A 4K0NA 2PERA 1PSQA 3VLNA 5IIZA 5B8AA 4XS1A 3VWWA 2YNXA 1VF1A 5HR0A 1MDKA 4G10A 5H5SA 4EIPA 4LA1A 3OR5A 2DJKA 1PD21 2FA8A 12GSA 2GSSA 4TR4A 2GQLA 1BJXA 3D4MA 2A2SA 3DVXA 4BL7A 2HSHA 5H5QA 2O89A 2MMNA 4HZ4A 1ZYNA 3WGXA 1A2MA 1F3BA 5F0GA 4MH3A 5BRTA 1XOAA 3LG6A 3LYPA 2V32A 3RBTA 3CRTA 3DD3A 2M80A 3BJ5A 5ABRA 4IELA 1K0MA 2MMAA 2TRXA 2GTUA 3CSHA 5GAND 1HNBA 4JE1A 3MYDA 1PA3A 2DLXA 2G2QA 4ZL8A 1O7UA 1DUGA 1PRXA 2J23A 5IMCA 3CMIA 2VO4A 3I43A 2C0DA 1Z6MA 4MLYA 2IIYA 4N3ZA 4YAVA 1M2BA 2QGVA 2H1GA 1K0DA 1B4PA 4E68A 2KOKA 1V98A 1X9SB 2XBIA 3C73A 3WYWA 4HQZA 2MMZA 2VL9A 5DQYA 3ZIVA 4KAEA 1XCCA 3IC8A 1TTZA 4HS1A 2HQTA 1Z9HA 1DE2A 3EC3A 3KCMA 3TRPA 1A2JA 1B9XC 2YJHA 3HA9A 2AHEA 1GSEA 1PQNA 4JR4A 3APSA 1SK1A 2HFDA 1QFNA 5J4YA 2DJ0A 1SJIA 4TW5A 4IJIA 1E6BA 3VWUA 1NHYA 3N9JA 4BVXA 2FWFA 4PGTA 2L5LA 2FHEA 1BEDA 1ST9A 3A3TA 3TOTA 4AJ7A 1OKTA 2OACA 4FO5A 1TI3A 1XWAA 2VL2A 1CQHA 2P0GA 2HNLA 3NIVA 4CY6A 1GSQA 1SL1B 2B6MA 3AY8A 2R37A 3TJJA 2XC2A 2I3YA 4KDXA 2K8VA 3IC4A 3L9UA 1OVNA 2OT3A 4GSTA 4OD7A 2GSTA 3UARA 4HEA2 3S9FA 1X5CA 2CZ2A 5ECHB 4N0ZA 4Z2RA 3LGCA 4G0LA 3EINA 1EGRA 4ZB8A 2WRTA 3MSZA 5BMUB 3QCPA 1EEMA 4KA0A 5H5RA 4XTSA 2MMOA 4MZBA 5GSSA 1ZOFA 2YN1A 3KH9A 2JACA 6GSTA 3MDKA 3VURA 5AGYA 2CV4A 4NAXA 4CHSA 3FHKA 2QA2A 4OCFA 5AN1A 2N5BA 2V41A 3QFAC 2LEGA 2C3TA 1VF4A 2DBCA 1WWJA 3QPMA 3APQA 5HQPA 2DJ1A 2OA7A 5HFKA 3GSTA 4MF5A 4TOPA 1O8XA 2VD1A 1N8JA 4QQ7A 1X9WB 3KEBA 3UVHA 4ULXA 2IMFA 4MPGA 3LXZA 4AF2A 4LMWA 2LQOA 1TDIA 1K3OA 3TUEA 4DSRA 3PR8A 2VIMA 3ERFA 1R5PA 1S3DA 3H79A 2JZTA 1R7HA 4HU9A 5CREA 2YANA 4PNFA 1KBNA 3HXSA 1ACVA 2VL2C 2OJLA 2M46A 2NTOA 4V2NA 5DALB 4JRRA 2HLSA 5IPGA 3IBHA 2NPBA 4DSQA 1TRUA 1BG1A 5CRWA 4O5QA 1AQWA 3A2WA 2PGTA 2XBQA 5C04A 2X64A 3EU3A 1M9BA 3F3RA 3GSSA 4ML1A 4ZL9A 4FQUA 1A24A 2VLUA 2MBSA 3PPUA 6GSSA 2YJ7A 2V1MA 4J2FA 1AQXA 5ECRB 2REMA 2H0HA 1USBA 4MF6A 4IHUA 5ECLB 2VCXA 2AYTA 1PL1A 3QDNA 3QAWA 4LL4B 1K0NA 2CAIA 7GSSA 5A4UA 1RQMA 1FVKA 1GWCA 1EP8A 1X9MB 11GSA 5BMUA 3D4TA 3TOUA 1F6MC 4MK3A 1GNWA 1O73A 3LEFA 3ME7A 3P7XA 2B5EA 4RQRA 1ZGNA 4N30A 3PGTA 3GTUB 5F05A 3KTBA 3TKSE 2CZ3A 2WS2A 3P8WA 4EDYA 4BPYA 3L78A 2XPDA 3TRQA 1K0AA 3P2AA 3BCKA 2IMIA 4WR4A 2AV4A 4K6XA 1EEJA 5JCUA 2VL3A 1SYXA 5LNKe 1TW9A 4HZ2A 4GQCA 4KCAA 4I2UA 1JZWA 3IHGA 1XWBA 1Q98A 1GULA 2VCZA 3D0ZA 2PUKC 3N5OA 3HVXA 2D2ZA 1XBSA 2HI7A 4IP6A 3W6GA 3IOSA 3A5IA 3UBLA 1W89A 5KN2A 2FWGA 3QR6A 1SYRA 3VI5A 5G31A 4RI7A 2MZCA 3QAVA 4OO4A 4ILFA 2ALBA 3F4SA 1Z7RA 2KHPA 1NW2A 5DALA 1B4QA 3TKRA 2L6CA 5F06A 1U87A 1YKAA 2H76A 1SD8A 1JZOA 2PVOC 1WIKA 4RUVA 4GLTA 2PWJA 4OFTA 1QMVA 1URMA 3ZIJA 1GSYA 1J08A 4KNDA 3MNGA 2L59A 5DDLA 3ZRDA 1YF0A 3DEXA 1OKDA 1YZXA 1GP1A 4USSA 2E7PA 3KH7A 2H75A 3TKPA 4F03A 2PU9C 2X8GA 3BOAA 6GSXA 3TDGA 4IKHA 3LXTA 1GTUA 3RHCA 3ZLPA 4HQSA 18GSA 4D73A 1XWCA 1THOA 1GUHA 2HSYA 4NHWA 5KEJA 1RK4A 3M1GA 5KOXA 1ERWA 3ISOA 20GSA 4POLA 2EFCA 16GSA 4ZBAA 1SK0A 1VGLA 2EFEA 2HRAA 2IL3A 1XIYA 4OFMA 4G0IA 3A2VA 3FZAA 3GTUA 2C80A 1GLPA 5CAXA 1FHEA 4L0WA 3IK7A 3VI7A 1EOGA 4MPFA 5IO0A 4QMKA 2DSAA 1GTBA 1MEKA 2H1AA 1AAZA 2V6KA 3A2XA 3ZMKA 4ZBBA 1WPIA 2H72A 5IMAA 2X49A 2JL4A 5ELAA 3P90A 4G2EA 2HSNA 4WBRD 3R3EA 3H4KA 4MNNA 3HMJG 3GL3A 3F8UA 5C00A 1J9BA 1SVOA 4ISDA 3ZFBA 2H0GA 2FCHA 3FKFA 5AIVA 4ML6A 3G7YA 1OE7A 1HYUA 5COHA 4MABA 2CQ9A 4V2MA 3KD0A 1JLVA 5JCWA 4NWYA 2YWOA 5EL8A 2GVPA 4ACSA 4E8HA 3GH9A 1EWXA 2FA4A 4ZIJA 1ERUA 1TK5B 1MTCA 2XHFA 4IS0A 4A5PA 4EDZA 4TVEA 1TXUA 1QK8A 4I8BA 2GSRA 4RQXA 5HFIA 4EXJA 1Z7PA 4Z2UA 5D8IA 1BYEA 4G0KA 1I5GA 3HVVA 5GAPD 3UBKA 4Q5FA 2HSMB 4MF7A 3Q18A 4KDUA 5J4VA 5FWGA 4WBJA 4AJ8A 2R0GA 1Q4JA 3UOMA 2JSYA 2X8HA 1HQOA 2YV7A 5ECOB 3KMNA 3UEMA 1X0RA 1FG4A 1SVMA 4PQIA 4MH2A 3HJPA 3K8NA 3BBYA 2EFHA 3M9KA 4J57E 3QOUA 2J9HA 4LL1B 3CTGA 5EY6A 3GIXA 4IN0A 2O87A 4TR1A 5IMDA 4GCIA 3QMXA 5L71A 1EP7A 5CYYA 1HNCA 2AUVA 4TXOB 2DMLA 1SKWB 3EPTA 3TCOA 2LSTA 4K1FA 1T4YA 4EIQA 1O6JA 1TI1A 4TR0A 4DVCA 1XWKA 3E3EA 1ZCPA 2H6ZA 4PUAA 4TR3A 4CDOA 4JEDA 5FT3A 3FYGA 3ERGA 4AGSA 3WGDA 4GTUA 3MWHA 4NXIA 3QAGA 1ERTA 2L4QA 5IMFA 4JU5A 1JHBA 1G7EA 5ECIB 1OC3A 3M8NA 3G7JA 3UJ1A 4ECIA 4ZB7A 5DJMA 2HE3A 3F4TA 3RDWA 2M72A 1FW1A 5IMZA 1T00A 4OFNA 3O76A 5CNWA 5LCZA 5ECSA 1UVZA 1XW6A 1Y25A 3KIJA 2YP6A 2KLXA 1TU7A 4ZBDA 1BF5A 1EGOA 3QD9A 4EE0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EUR A;  3GL5 A;  4LLR A;  3ED3 A;  2P31 A;  3HHV A;  2K18 A;  3FRC A;  4WF4 A;  1YY7 A;  3ZYW A;  4K9Z A;  2HSM A;  2R6K A;  2LRN A;  4MZW A;  4HJM A;  3UMA A;  5ELG A;  4FYU A;  3J7Y b;  2BMX A;  4IP1 A;  2AAW A;  3DGQ A;  2MYG A;  3IA1 A;  2PMT A;  3F4R A;  3A5W A;  5ID2 B;  1PKW A;  3WT2 A;  1G7O A;  2LRC A;  4POK A;  4JBB A;  1V57 A;  3HD5 A;  3FK8 A;  1IYI A;  1BX9 A;  5IOW A;  5LD0 A;  5HR3 A;  4V2L A;  2FWH A;  2PBJ A;  1H4O A;  3L0H A;  1K3Y A;  2N5F A;  2FUG 2;  22GS A;  1YJ6 A;  4GSS A;  4EL1 A;  4TXO A;  3C71 A;  1G0T A;  4KSM A;  3GKK A;  2PVQ A;  3O6T A;  4OCE A;  4DSS A;  2VUP A;  2B7J A;  3TGZ A;  4XIH A;  3DML A;  2RUF A;  4YH2 A;  3FZ9 A;  3UAP A;  1N2A A;  1WRY A;  3IXR A;  3SBC A;  3FR9 A;  1K0O A;  3HVS A;  3I69 A;  1O8W A;  3DRN A;  4DEJ A;  3QFB C;  4F0C A;  3KM6 A;  1DSB A;  4ECB A;  2ZUP A;  1X5D A;  1A8Y A;  5G2Z A;  4BWQ A;  3M9J A;  2GZZ A;  4O7H A;  1PMT A;  1GUK A;  2HZF A;  4POB A;  2YWI A;  2YZH A;  5HFG A;  2WB9 A;  2H73 A;  2YOI A;  3F63 A;  3KMO A;  3HJM A;  1A0R P;  19GS A;  2C3Q A;  4K0G A;  2F51 A;  2GQM A;  3NZN A;  3ERW A;  3ZTL A;  4PNG A;  3EMP A;  3ZZX A;  4WKW A;  3VK9 A;  1GTI A;  2DJ3 A;  5KN3 A;  2B1K A;  3FY7 A;  3GFK A;  4HJ2 A;  5DAK B;  2LJA A;  1TRW A;  2HT9 A;  1UA5 A;  2WUL A;  2HYX A;  2GSQ A;  1OAZ A;  2LQQ A;  5ID2 A;  3IK9 A;  1WP0 A;  1UN2 A;  2H6X A;  4D73 B;  4FYB A;  2IN3 A;  3FZ4 A;  1ILO A;  3J7Y k;  5CRD A;  2CVD A;  1FOV A;  1SKS B;  2VAF A;  4WEY A;  1S3A A;  4MJE A;  4EUY A;  4MA9 A;  1XVQ A;  2GT6 A;  3C1R A;  1QGV A;  1U88 A;  3GUS A;  1WMJ A;  1SD9 A;  4JR6 A;  2ON7 A;  1ERV A;  1M0U A;  1GLQ A;  4Q5R A;  5IOX A;  2I4A A;  4OO5 A;  1OE8 A;  3RPP A;  1J0F A;  4N10 A;  3DVW A;  3GA4 A;  4XCS A;  5D96 A;  2YWM A;  4KH7 A;  3TKS A;  3WD6 A;  2RUE A;  2HSN B;  4AJ6 A;  1JZD A;  1CQG A;  2ON5 A;  2CT6 A;  2GQK A;  5IQY A;  4PXO A;  4TRX A;  4V1A g;  3DXB A;  2CAQ A;  3F6D A;  1H75 A;  5DCH A;  1AXD A;  2LNS A;  1Z6N A;  5INY A;  4Q5N A;  1GTA A;  3IAM 2;  3EMX A;  4ZL7 A;  2ZCT A;  3UL3 A;  3Q74 A;  3WT1 A;  4KW6 A;  4IJ3 A;  6GSU A;  2VM2 A;  5JCG A;  5A5K A;  2PN8 A;  5CO3 A;  4ECJ A;  1ML6 A;  4K7N A;  1SL2 B;  4KSO A;  3Q6O A;  1YEX A;  2B5X A;  5F07 A;  2V2G A;  3DWV A;  2X8C A;  3F0I A;  3U5R E;  1EZK A;  3KP9 A;  1M7T A;  3CSJ A;  2H71 A;  5DAK A;  2K6V A;  17GS A;  4ZB6 A;  3HJO A;  3VFI A;  2H70 A;  3HDC A;  3VWV A;  3TJB A;  2LUS A;  2H66 A;  5ECQ B;  1QQ2 A;  2VCT A;  3ZML A;  3TB2 A;  5JWR B;  2H8L A;  1GRX A;  5IM9 A;  1YF1 A;  3D6I A;  3TJF A;  2N5A A;  4BVY B;  4KF9 A;  2P5R A;  3GH6 A;  2DIY A;  1A8L A;  2FY6 A;  3CRU A;  1F37 A;  2FNO A;  2H1D A;  1R5A A;  3GKM A;  1YEP A;  3TKS C;  3RPN A;  1SL0 B;  4TR1 B;  3DIE A;  1O81 A;  2WDU A;  4WET A;  2VLV A;  4IBP A;  3PH9 A;  3M3M A;  2B5Y A;  3WGE A;  3IV4 A;  4KX4 A;  3FEU A;  2WCI A;  1YKC A;  5ECM B;  4PX1 A;  5J5N A;  2OE1 A;  3GMF A;  3W8S A;  2OKA A;  2C4J A;  2IJY A;  3H8Q A;  2YZU A;  2C3N A;  1XOB A;  5DQS A;  4FYC A;  4V1A p;  2GZY A;  2JSZ A;  1A23 A;  3GX0 A;  3L4N A;  5JWQ B;  3ZL5 A;  1PGT A;  2QC7 A;  3EVI A;  1WE0 A;  3NOF A;  2YWN A;  2OBI A;  2F9S A;  4EO3 A;  3GNJ A;  2VCQ A;  3MAK A;  5ENU A;  2X99 A;  3GYK A;  3KXO A;  1X5E A;  3M0F A;  3H1N A;  3HZ4 A;  4YQM A;  1A0F A;  2LJK A;  3UVT A;  4Q5Q A;  3HCZ A;  4I5Q A;  1BQ7 A;  3CBU A;  4E8E A;  3IAS 2;  3FW2 A;  1KEB A;  3JCM L;  4H86 A;  3CSI A;  1EOH A;  4RI6 A;  2P5Q A;  2L6D A;  4HI7 A;  4GXZ A;  5A4W A;  2AJQ B;  2DMM A;  3O3T A;  3ME8 A;  1VF3 A;  5G1L A;  1AUC A;  4GSN A;  4I97 A;  1TJD A;  1FVJ A;  2DIZ A;  5IMV A;  4OWY A;  1MDI A;  3V1W A;  5D9T A;  1GH2 A;  1T4Z A;  3GKN A;  2OE0 A;  6GSV A;  1BAY A;  2C0E A;  3LOR A;  2WJU A;  1LJR A;  1GSS A;  1DBY A;  1EV4 A;  5J4U A;  5J3R A;  9GSS A;  4EKZ A;  4BVY A;  1F3A A;  3FR6 A;  4KE3 A;  5D9W A;  1W4V A;  2F8A A;  2VM1 A;  3VPQ A;  4K2D A;  5G30 A;  5DVB A;  3EYT A;  1K3L A;  2PPT A;  4KDY A;  1U3A A;  1U3I A;  1TOF A;  1AIU A;  4K7O A;  3C7M A;  2JAD A;  2CA8 A;  2CVK A;  3RAZ A;  1C72 A;  4L5L A;  4ECC A;  1SU9 A;  2RM5 A;  4KCE A;  4DSS B;  5ECN B;  4N0V A;  5B6N A;  2WGR A;  2H19 A;  4G19 A;  2IPA A;  3IPZ A;  2IFQ A;  3IRA A;  1GUM A;  1GSF A;  3UIW A;  3TJK A;  1XFL A;  5ECP B;  1WJK A;  3GN3 A;  1EV9 A;  4MJC A;  4QL7 A;  1T8E B;  4MZC A;  5GST A;  1TK8 B;  4XS4 B;  4KB3 A;  4IQ1 A;  1K0C A;  3G7I A;  1G6Y A;  1TU8 A;  2EIQ A;  2IWT A;  2GT5 A;  1ON4 A;  1XXU A;  5EPF A;  3CTF A;  4PQH A;  2L4C A;  5J41 A;  1OC9 B;  1TK0 B;  2LTK A;  2WZ9 A;  2O8V B;  4KUN A;  5B8B A;  2I81 A;  2QKE A;  1M99 A;  1FB0 A;  2NVL A;  2DC5 A;  3FZ5 A;  2OAD A;  4MP4 A;  3HYP A;  1NHO A;  5B7C A;  4NHZ A;  2H0I A;  2FLS A;  1RW1 A;  1WOU A;  4BA7 A;  1GSD A;  2E0Q A;  2EIO A;  1B48 A;  2TRC P;  1ZYE A;  2LS5 A;  4TXV A;  1IYH A;  1VRS D;  1F9M A;  4YAP A;  4XS6 A;  5AIS A;  4G9H A;  4WXT A;  5DBQ A;  5E59 A;  3KZQ A;  4L0U A;  5J9C A;  3EWL A;  4F2I A;  2LRT A;  1AW9 A;  2NBS A;  1GL8 A;  4TN8 A;  2HRK B;  4XRD A;  2CX3 A;  3LYK A;  1MD3 A;  2K9F A;  4K7I A;  2QSI A;  3EU4 A;  3LFL A;  2VD0 A;  1SK2 A;  1TKD B;  4F0B A;  1XW5 A;  1G6W A;  1NM3 A;  2FD3 A;  5ECK B;  2H01 A;  3G9B A;  1SKR B;  10GS A;  4P3Y B;  1FB6 A;  2HRF A;  2XPE A;  2NDO A;  1AQV A;  3D22 A;  3LSZ A;  1E2Y A;  3I9V 2;  4WR5 A;  2C0G A;  4XS4 A;  1BG5 A;  1PKZ A;  1ZMA A;  1F2E A;  2C8U A;  2GS3 A;  2K8S A;  2CX4 A;  4X43 A;  4GQF A;  4EF0 A;  2GZP A;  3KTL A;  1V40 A;  1XPV A;  4EVM A;  3TJG A;  2H74 A;  4ID0 A;  14GS A;  5G1K A;  1LBK A;  1OC9 A;  3RHB A;  1TXX A;  4L5O A;  1HD2 A;  2B1L A;  4PUF C;  4O92 A;  3ZIT A;  2BJX A;  5B6M A;  4XRA A;  5KN1 A;  1AC1 A;  1S3C A;  3IHQ A;  1B9Y C;  3HZ8 A;  1V58 A;  3BCI A;  1T1V A;  4I6X A;  3W8J A;  4GRF A;  5D73 A;  5DJL A;  2I9H A;  3GKX A;  4O5R A;  2HRN A;  2YV9 A;  2GDR A;  1JZR A;  4MCU A;  5GZZ B;  1VF2 A;  4F82 A;  3US3 A;  4HU7 A;  1Z3E A;  1V9W A;  5D9V A;  4POM A;  4GF0 A;  2F8F A;  3L9V A;  4GWR A;  1KTE A;  2R4V A;  4NV5 A;  3ZVJ A;  2F3M A;  4I2T A;  1OYJ A;  2V6O A;  3E0U A;  2IME A;  1PX6 A;  2I1U A;  2BTO T;  2B3S A;  2YCD A;  1YQ1 A;  2C1Y A;  4K8M A;  4ZIL A;  1FO5 A;  2WFC A;  2HRK A;  2ES7 A;  1B8X A;  2EIR A;  3F6F A;  1M2D A;  4MJA A;  4YQU A;  2IMK A;  4FH8 A;  2LJR A;  5KN0 A;  3LQ7 A;  4NMU A;  1M9A A;  4O32 A;  1M2A A;  1YDK A;  1UC7 A;  3EE2 A;  5A4V A;  2A2R A;  4PTS A;  2IMD A;  3GUR A;  1SEN A;  1O85 A;  2KP2 A;  5D9X A;  1LU4 A;  4MJB A;  2JZR A;  1XZO A;  2RLI A;  3D5J A;  2JU5 A;  1T3B A;  1SJ6 A;  3C1S A;  2L57 A;  2TIR A;  1I9D A;  4Z7X A;  3H93 A;  4MMM A;  2ZNM A;  1MDJ A;  6GSW A;  1ABA A;  1XVW A;  4NPB A;  1GSU A;  2R3X A;  3F3Q A;  2HZE B;  3GRX A;  1GNE A;  2LNT A;  4EC0 A;  4LMV A;  5G5F A;  3C8E A;  3APO A;  3CYN A;  1T7P B;  3IR4 A;  4IQA A;  2A4V A;  3TKQ A;  5F8B A;  1V2A A;  4TKY A;  3BD2 A;  4L8E A;  4HDE A;  2VOC A;  2YPM A;  3ZFL A;  3LWA A;  2OBK A;  5CRH A;  5IPH A;  3ZRE A;  3I6A A;  2G0F A;  2MBT A;  2DJJ A;  1TRS A;  3ZVJ D;  3R2Q A;  3HKR A;  1PN9 A;  2R5G A;  4X1U A;  2CVB A;  2H30 A;  2RM6 A;  4PQ1 A;  5HR2 A;  2GGT A;  8GSS A;  3LJR A;  2Z9S A;  2DJ2 A;  4IGJ A;  4IVF A;  4ZXG A;  3FR3 A;  1A2L A;  13GS A;  4OMV A;  4N11 A;  2E2M A;  4XHM A;  4CW9 A;  1XWG A;  4HOJ A;  2R2J A;  3VWX A;  5DCG A;  1DE1 A;  2H1B A;  4IW9 A;  1ZZY A;  4YQV A;  4MDC A;  4WF5 A;  4NV2 A;  3GX8 A;  3PIN A;  2KP1 A;  2UZ8 A;  1FAA A;  5CP1 A;  1K0B A;  1JLW A;  1Z5Y E;  1TP9 A;  2JZS A;  2LV3 A;  1U6T A;  2KUC A;  5G5E A;  1R4W A;  4BL7 B;  3DYR A;  3IE3 A;  3VPT A;  5JWO B;  3TRX A;  5J9B A;  4QL9 A;  2VCV A;  2E2G A;  2EC4 A;  2L5O A;  2VLT A;  5E4W A;  1HNA A;  3D21 A;  3L9S A;  2FWE A;  4F9Z A;  2AB6 A;  3GV1 A;  1QXH A;  2FGX A;  5FHI A;  2IFQ B;  5D93 A;  1PX7 A;  2LKU A;  3KP8 A;  3IDV A;  4JZQ A;  3SWL A;  1Y6E A;  2HZE A;  4HUA A;  1ZL9 A;  2GLR A;  2VCW A;  6GSY A;  3DKS A;  3GHA A;  4J56 E;  2OE3 A;  1XW9 A;  5CRG A;  2C0F A;  2O7K A;  5AIX A;  4ZB9 A;  2B7K A;  1QUW A;  2H6Y A;  4PUR A;  1NSW A;  2HXK A;  3F9U A;  1ZYQ B;  1KNG A;  5HR1 A;  2RII A;  1THX A;  1JFU A;  3KGK A;  3CXG A;  3Q19 A;  5EVO A;  3E9J B;  4X0X A;  1PL2 A;  2O85 A;  4BWS A;  4BVX B;  1OC8 A;  3KJY A;  5IO2 A;  4KGI A;  4FIW A;  1R26 A;  1SJZ A;  3U6V A;  1MD4 A;  1TRV A;  3HY2 A;  4K0N A;  2PER A;  1PSQ A;  3VLN A;  5IIZ A;  5B8A A;  4XS1 A;  3VWW A;  2YNX A;  1VF1 A;  5HR0 A;  1MDK A;  4G10 A;  5H5S A;  4LA1 A;  3OR5 A;  2DJK A;  1PD2 1;  2FA8 A;  12GS A;  2GSS A;  4TR4 A;  2GQL A;  1BJX A;  3D4M A;  2A2S A;  3DVX A;  4BL7 A;  2HSH A;  5H5Q A;  2O89 A;  2MMN A;  4HZ4 A;  3WGX A;  1A2M A;  1F3B A;  5F0G A;  4MH3 A;  1XOA A;  3LG6 A;  3LYP A;  2V32 A;  3RBT A;  3CRT A;  3DD3 A;  2M80 A;  3BJ5 A;  5ABR A;  4IEL A;  1K0M A;  2MMA A;  2TRX A;  2GTU A;  3CSH A;  5GAN D;  1HNB A;  4JE1 A;  1PA3 A;  2DLX A;  2G2Q A;  4ZL8 A;  1O7U A;  1DUG A;  1PRX A;  2J23 A;  5IMC A;  3CMI A;  2VO4 A;  3I43 A;  2C0D A;  1Z6M A;  4MLY A;  2IIY A;  4YAV A;  1M2B A;  2QGV A;  2H1G A;  1K0D A;  1B4P A;  2KOK A;  1V98 A;  1X9S B;  2XBI A;  3C73 A;  3WYW A;  4HQZ A;  2MMZ A;  2VL9 A;  5DQY A;  3ZIV A;  4KAE A;  1XCC A;  3IC8 A;  1TTZ A;  4HS1 A;  2HQT A;  1Z9H A;  1DE2 A;  3EC3 A;  3KCM A;  3TRP A;  1A2J A;  1B9X C;  2YJH A;  3HA9 A;  2AHE A;  1GSE A;  1PQN A;  4JR4 A;  3APS A;  1SK1 A;  2HFD A;  1QFN A;  2DJ0 A;  1SJI A;  4TW5 A;  4IJI A;  1E6B A;  3VWU A;  1NHY A;  3N9J A;  4BVX A;  2FWF A;  4PGT A;  2L5L A;  2FHE A;  1BED A;  1ST9 A;  3A3T A;  3TOT A;  4AJ7 A;  1OKT A;  2OAC A;  4FO5 A;  1TI3 A;  1XWA A;  2VL2 A;  1CQH A;  2P0G A;  2HNL A;  3NIV A;  1GSQ A;  1SL1 B;  2B6M A;  3AY8 A;  2R37 A;  3TJJ A;  2XC2 A;  2I3Y A;  4KDX A;  2K8V A;  3IC4 A;  3L9U A;  1OVN A;  4GST A;  4OD7 A;  2GST A;  3UAR A;  4HEA 2;  3S9F A;  1X5C A;  2CZ2 A;  5ECH B;  4N0Z A;  3LGC A;  4G0L A;  3EIN A;  1EGR A;  4ZB8 A;  2WRT A;  3MSZ A;  3QCP A;  1EEM A;  4KA0 A;  5H5R A;  4XTS A;  2MMO A;  4MZB A;  5GSS A;  1ZOF A;  2YN1 A;  3KH9 A;  2JAC A;  6GST A;  3MDK A;  3VUR A;  5AGY A;  2CV4 A;  4NAX A;  4CHS A;  3FHK A;  4OCF A;  5AN1 A;  2N5B A;  2V41 A;  3QFA C;  2LEG A;  2C3T A;  1VF4 A;  2DBC A;  1WWJ A;  3QPM A;  3APQ A;  5HQP A;  2DJ1 A;  2OA7 A;  5HFK A;  3GST A;  4MF5 A;  4TOP A;  1O8X A;  2VD1 A;  1N8J A;  4QQ7 A;  1X9W B;  3KEB A;  3UVH A;  4ULX A;  2IMF A;  4MPG A;  3LXZ A;  4AF2 A;  4LMW A;  2LQO A;  1TDI A;  1K3O A;  3TUE A;  4DSR A;  3PR8 A;  2VIM A;  3ERF A;  1R5P A;  1S3D A;  3H79 A;  2JZT A;  1R7H A;  4HU9 A;  5CRE A;  2YAN A;  4PNF A;  1KBN A;  3HXS A;  1ACV A;  2VL2 C;  2OJL A;  2M46 A;  2NTO A;  4V2N A;  5DAL B;  4JRR A;  2HLS A;  5IPG A;  3IBH A;  2NPB A;  4DSQ A;  1TRU A;  5CRW A;  1AQW A;  3A2W A;  2PGT A;  2XBQ A;  5C04 A;  2X64 A;  3EU3 A;  1M9B A;  3F3R A;  3GSS A;  4ML1 A;  4ZL9 A;  4FQU A;  1A24 A;  2VLU A;  2MBS A;  3PPU A;  6GSS A;  2YJ7 A;  2V1M A;  4J2F A;  1AQX A;  5ECR B;  2REM A;  2H0H A;  1USB A;  4MF6 A;  4IHU A;  5ECL B;  2VCX A;  2AYT A;  1PL1 A;  3QDN A;  3QAW A;  4LL4 B;  1K0N A;  2CAI A;  7GSS A;  5A4U A;  1RQM A;  1FVK A;  1GWC A;  1EP8 A;  1X9M B;  11GS A;  5BMU A;  3D4T A;  3TOU A;  1F6M C;  4MK3 A;  1GNW A;  1O73 A;  3LEF A;  3ME7 A;  3P7X A;  2B5E A;  4RQR A;  1ZGN A;  4N30 A;  3PGT A;  3GTU B;  5F05 A;  3KTB A;  3TKS E;  2CZ3 A;  2WS2 A;  3P8W A;  4EDY A;  4BPY A;  3L78 A;  2XPD A;  3TRQ A;  1K0A A;  3P2A A;  3BCK A;  2IMI A;  4WR4 A;  2AV4 A;  4K6X A;  1EEJ A;  5JCU A;  2VL3 A;  1SYX A;  5LNK e;  1TW9 A;  4HZ2 A;  4GQC A;  4KCA A;  4I2U A;  1JZW A;  1XWB A;  1Q98 A;  1GUL A;  2VCZ A;  3D0Z A;  2PUK C;  3N5O A;  3HVX A;  2D2Z A;  1XBS A;  2HI7 A;  4IP6 A;  3W6G A;  3IOS A;  3UBL A;  1W89 A;  5KN2 A;  2FWG A;  3QR6 A;  1SYR A;  3VI5 A;  5G31 A;  4RI7 A;  2MZC A;  3QAV A;  4OO4 A;  4ILF A;  2ALB A;  3F4S A;  1Z7R A;  2KHP A;  1NW2 A;  5DAL A;  1B4Q A;  3TKR A;  2L6C A;  5F06 A;  1U87 A;  1YKA A;  2H76 A;  1SD8 A;  1JZO A;  2PVO C;  1WIK A;  4RUV A;  4GLT A;  2PWJ A;  4OFT A;  1QMV A;  1URM A;  3ZIJ A;  1GSY A;  1J08 A;  4KND A;  3MNG A;  2L59 A;  5DDL A;  3ZRD A;  1YF0 A;  3DEX A;  1OKD A;  1YZX A;  1GP1 A;  4USS A;  2E7P A;  3KH7 A;  2H75 A;  3TKP A;  4F03 A;  2PU9 C;  2X8G A;  3BOA A;  6GSX A;  3TDG A;  4IKH A;  3LXT A;  1GTU A;  3RHC A;  3ZLP A;  4HQS A;  18GS A;  4D73 A;  1XWC A;  1THO A;  1GUH A;  2HSY A;  4NHW A;  5KEJ A;  1RK4 A;  3M1G A;  1ERW A;  3ISO A;  20GS A;  4POL A;  4ZBA A;  16GS A;  1SK0 A;  1VGL A;  2HRA A;  2IL3 A;  1XIY A;  4OFM A;  4G0I A;  3A2V A;  3FZA A;  3GTU A;  2C80 A;  1GLP A;  5CAX A;  1FHE A;  4L0W A;  3IK7 A;  3VI7 A;  1EOG A;  4MPF A;  5IO0 A;  2DSA A;  1GTB A;  1MEK A;  2H1A A;  1AAZ A;  2V6K A;  3A2X A;  3ZMK A;  4ZBB A;  1WPI A;  2H72 A;  5IMA A;  2JL4 A;  5ELA A;  3P90 A;  4G2E A;  4WBR D;  3R3E A;  3H4K A;  3GL3 A;  3F8U A;  5C00 A;  1J9B A;  4ISD A;  3ZFB A;  2H0G A;  2FCH A;  3FKF A;  5AIV A;  4ML6 A;  3G7Y A;  1OE7 A;  1HYU A;  5COH A;  4MAB A;  2CQ9 A;  4V2M A;  3KD0 A;  1JLV A;  5JCW A;  4NWY A;  2YWO A;  5EL8 A;  2GVP A;  4ACS A;  4E8H A;  3GH9 A;  1EWX A;  2FA4 A;  4ZIJ A;  1ERU A;  1TK5 B;  1MTC A;  2XHF A;  4IS0 A;  4EDZ A;  4TVE A;  1QK8 A;  4I8B A;  2GSR A;  4RQX A;  5HFI A;  4EXJ A;  1Z7P A;  5D8I A;  1BYE A;  4G0K A;  1I5G A;  3HVV A;  5GAP D;  3UBK A;  4Q5F A;  2HSM B;  4MF7 A;  3Q18 A;  4KDU A;  5FWG A;  4WBJ A;  4AJ8 A;  1Q4J A;  3UOM A;  2JSY A;  2X8H A;  1HQO A;  2YV7 A;  5ECO B;  3KMN A;  3UEM A;  1X0R A;  1FG4 A;  4PQI A;  4MH2 A;  3HJP A;  3K8N A;  3BBY A;  3M9K A;  4J57 E;  3QOU A;  2J9H A;  4LL1 B;  3CTG A;  5EY6 A;  3GIX A;  4IN0 A;  2O87 A;  4TR1 A;  5IMD A;  4GCI A;  3QMX A;  5L71 A;  1EP7 A;  5CYY A;  1HNC A;  2AUV A;  4TXO B;  2DML A;  1SKW B;  3TCO A;  2LST A;  4K1F A;  1T4Y A;  1O6J A;  1TI1 A;  4TR0 A;  4DVC A;  1XWK A;  1ZCP A;  2H6Z A;  3E3E A;  4PUA A;  4TR3 A;  4CDO A;  4JED A;  5FT3 A;  3FYG A;  3ERG A;  4AGS A;  3WGD A;  4GTU A;  3MWH A;  4NXI A;  3QAG A;  1ERT A;  2L4Q A;  5IMF A;  4JU5 A;  1JHB A;  1G7E A;  5ECI B;  1OC3 A;  3M8N A;  3G7J A;  3UJ1 A;  4ECI A;  5DJM A;  2HE3 A;  3F4T A;  3RDW A;  2M72 A;  1FW1 A;  5IMZ A;  1T00 A;  4OFN A;  3O76 A;  5CNW A;  5LCZ A;  5ECS A;  1UVZ A;  1XW6 A;  1Y25 A;  3KIJ A;  2YP6 A;  2KLX A;  1TU7 A;  4ZBD A;  1EGO A;  3QD9 A;  4EE0 A; 
#chains in the Genus database with same CATH topology
 3EUR A;  3GL5 A;  4LLR A;  3ED3 A;  2P31 A;  3HHV A;  2K18 A;  3FRC A;  4WF4 A;  1YY7 A;  3ZYW A;  4PI0 C;  4K9Z A;  2HSM A;  2R6K A;  2LRN A;  5KOW A;  4MZW A;  4HJM A;  3UMA A;  5ELG A;  4FYU A;  2H1L A;  3J7Y b;  2BMX A;  4IP1 A;  2AAW A;  3DGQ A;  2MYG A;  3IA1 A;  2PMT A;  3F4R A;  3A5W A;  5ID2 B;  1PKW A;  3WT2 A;  1G7O A;  2LRC A;  4POK A;  4JBB A;  1V57 A;  3HD5 A;  3FK8 A;  1IYI A;  1BX9 A;  5IOW A;  5LD0 A;  5HR3 A;  4V2L A;  2FWH A;  1S4B P;  2PBJ A;  1H4O A;  3L0H A;  1K3Y A;  2N5F A;  2FUG 2;  22GS A;  1YJ6 A;  4GSS A;  4EL1 A;  4TXO A;  3C71 A;  1M3J A;  1G0T A;  4KSM A;  3GKK A;  2PVQ A;  3O6T A;  4OCE A;  4DSS A;  2VUP A;  3CQF A;  2B7J A;  3TGZ A;  4XIH A;  3LW9 A;  3DML A;  2RUF A;  4YH2 A;  3FZ9 A;  3UAP A;  1N2A A;  1WRY A;  3IXR A;  3SBC A;  3FR9 A;  1K0O A;  3HVS A;  3I69 A;  1O8W A;  3DRN A;  4DEJ A;  3QFB C;  4F0C A;  3KM6 A;  1DSB A;  4ECB A;  2ZUP A;  1X5D A;  1A8Y A;  5G2Z A;  4BWQ A;  3M9J A;  2GZZ A;  4O7H A;  2VKZ G;  1PMT A;  1Y1U A;  1GUK A;  5A1N B;  5A34 B;  2HZF A;  4POB A;  2YWI A;  2YZH A;  5HFG A;  2WB9 A;  2H73 A;  2YOI A;  3F63 A;  3KMO A;  3HJM A;  1A0R P;  19GS A;  2C3Q A;  4K0G A;  2F51 A;  2GQM A;  3NZN A;  3ERW A;  3ZTL A;  4PNG A;  3EMP A;  3ZZX A;  4WKW A;  3VK9 A;  1GTI A;  2DJ3 A;  5KN3 A;  2B1K A;  3FY7 A;  3GFK A;  4HJ2 A;  5DAK B;  2LJA A;  1TRW A;  2HT9 A;  1FOH A;  1UA5 A;  2WUL A;  2HYX A;  2GSQ A;  1OAZ A;  2LQQ A;  5ID2 A;  3IK9 A;  1WP0 A;  1UN2 A;  2H6X A;  4D73 B;  4FYB A;  4K2X A;  2IN3 A;  3FZ4 A;  4W66 A;  1ILO A;  1SVL A;  3J7Y k;  5CRD A;  2CVD A;  1FOV A;  1SKS B;  2VAF A;  4WEY A;  1S3A A;  4MJE A;  4EUY A;  4MA9 A;  1XVQ A;  2GT6 A;  3C1R A;  1QGV A;  1U88 A;  3GUS A;  1WMJ A;  1SD9 A;  4JR6 A;  2ON7 A;  1ERV A;  1M0U A;  1GLQ A;  4Q5R A;  5IOX A;  2I4A A;  4OO5 A;  4ICY A;  1OE8 A;  4AI6 A;  3RPP A;  1J0F A;  3FMW A;  4N10 A;  3DVW A;  3GA4 A;  4XCS A;  5D96 A;  2YWM A;  4KH7 A;  3TKS A;  3WD6 A;  2RUE A;  2HSN B;  4AJ6 A;  1JZD A;  1CQG A;  2ON5 A;  2CT6 A;  2GQK A;  5IQY A;  4PXO A;  2DKI A;  4TRX A;  4V1A g;  3DXB A;  2CAQ A;  3F6D A;  1H75 A;  5DCH A;  1AXD A;  2LNS A;  1Z6N A;  1ZYP A;  5INY A;  4Q5N A;  1GTA A;  3IAM 2;  3EMX A;  4ZL7 A;  2ZCT A;  3UL3 A;  3Q74 A;  3WT1 A;  4KW6 A;  4IJ3 A;  6GSU A;  2VM2 A;  5JCG A;  5A1N A;  5A34 A;  5A5K A;  2PN8 A;  5CO3 A;  4ECJ A;  1ML6 A;  4K7N A;  1SL2 B;  4KSO A;  3Q6O A;  2O36 A;  1YEX A;  2B5X A;  5F07 A;  2A4H A;  2V2G A;  3DWV A;  2X8C A;  3F0I A;  3U5R E;  1EZK A;  3KP9 A;  1M7T A;  3CSJ A;  2H71 A;  5DAK A;  2K6V A;  17GS A;  4ZB6 A;  3HJO A;  3VFI A;  2H70 A;  3HDC A;  3VWV A;  3TJB A;  2LUS A;  2H66 A;  5ECQ B;  1QQ2 A;  2VCT A;  3ZML A;  3TB2 A;  5JWR B;  2H8L A;  1GRX A;  5IM9 A;  1YF1 A;  3D6I A;  3TJF A;  2N5A A;  4BVY B;  4KF9 A;  2EFD A;  2P5R A;  3GH6 A;  2DIY A;  1A8L A;  2FY6 A;  3CRU A;  1F37 A;  2FNO A;  2H1D A;  1R5A A;  3GKM A;  1YEP A;  3TKS C;  3RPN A;  1SL0 B;  4TR1 B;  3DIE A;  1O81 A;  2WDU A;  4WET A;  2VLV A;  4IBP A;  1YEW C;  3PH9 A;  2R0P A;  3M3M A;  2B5Y A;  3WGE A;  3IV4 A;  4KX4 A;  3FEU A;  2WCI A;  2WZS A;  1YKC A;  5ECM B;  4PX1 A;  5J5N A;  2OE1 A;  3GMF A;  3W8S A;  2OKA A;  2C4J A;  2IJY A;  3H8Q A;  2YZU A;  2C3N A;  1XOB A;  5DQS A;  4FYC A;  4V1A p;  2GZY A;  2JSZ A;  1A23 A;  3GX0 A;  3L4N A;  5JWQ B;  2R0C A;  3ZL5 A;  1PGT A;  2QC7 A;  4BIK A;  3EVI A;  1WE0 A;  3NOF A;  2YWN A;  2OBI A;  2F9S A;  4EO3 A;  3GNJ A;  2VCQ A;  4X4J A;  3MAK A;  4YKF A;  5ENU A;  2X99 A;  3GYK A;  3KXO A;  1X5E A;  3M0F A;  3H1N A;  3HZ4 A;  4FXY P;  4YQM A;  1A0F A;  2LJK A;  3UVT A;  4Q5Q A;  3HCZ A;  4I5Q A;  1BQ7 A;  3CBU A;  4E8E A;  3IAS 2;  3FW2 A;  1KEB A;  3JCM L;  4H86 A;  3CSI A;  1EOH A;  4RI6 A;  2P5Q A;  2L6D A;  4HI7 A;  4GXZ A;  5A4W A;  2AJQ B;  2DMM A;  3O3T A;  3ME8 A;  1VF3 A;  5G1L A;  1AUC A;  4GSN A;  4I97 A;  1TJD A;  1FVJ A;  2DIZ A;  5IMV A;  4OWY A;  1MDI A;  3V1W A;  5D9T A;  1GH2 A;  1T4Z A;  3GKN A;  2OE0 A;  6GSV A;  1BAY A;  2C0E A;  4AKI A;  3LOR A;  2WJU A;  1LJR A;  1GSS A;  1DBY A;  1EV4 A;  5J4U A;  5J3R A;  9GSS A;  4EKZ A;  2QA1 A;  4BVY A;  1F3A A;  3FR6 A;  4KE3 A;  5D9W A;  1W4V A;  2F8A A;  2VM1 A;  3VPQ A;  4K2D A;  5G30 A;  5DVB A;  3EYT A;  1K3L A;  2PPT A;  4KDY A;  1U3A A;  1U3I A;  1TOF A;  1AIU A;  4K7O A;  3C7M A;  2JAD A;  2CA8 A;  4GDF A;  2CVK A;  3RAZ A;  1C72 A;  4L5L A;  4ECC A;  1SU9 A;  2RM5 A;  4KCE A;  4DSS B;  5ECN B;  4N0V A;  5B6N A;  2WGR A;  2H19 A;  4G19 A;  2IPA A;  3IPZ A;  2IFQ A;  3IRA A;  1GUM A;  1GSF A;  3UIW A;  3TJK A;  1XFL A;  5ECP B;  1WJK A;  3GN3 A;  1EV9 A;  4MJC A;  1YVL A;  4QL7 A;  1T8E B;  4MZC A;  5GST A;  1TK8 B;  4XS4 B;  4KB3 A;  4IQ1 A;  1K0C A;  3G7I A;  1G6Y A;  1TU8 A;  3TU3 B;  2EIQ A;  2IWT A;  2GT5 A;  1ON4 A;  1XXU A;  5EPF A;  3CTF A;  4PQH A;  2L4C A;  5J41 A;  1OC9 B;  1TK0 B;  2LTK A;  2WZ9 A;  2O8V B;  4KUN A;  5B8B A;  2I81 A;  2QKE A;  1M99 A;  1FB0 A;  2NVL A;  2DC5 A;  1XG8 A;  3FZ5 A;  2OAD A;  4MP4 A;  3HYP A;  5J40 A;  1N25 A;  4AKG A;  1NHO A;  5B7C A;  4NHZ A;  2H0I A;  2FLS A;  1RW1 A;  1WOU A;  4BA7 A;  1GSD A;  2E0Q A;  2EIO A;  1B48 A;  2TRC P;  1ZYE A;  2LS5 A;  4TXV A;  1IYH A;  1VRS D;  1F9M A;  4YAP A;  4XS6 A;  5AIS A;  4G9H A;  4WXT A;  5DBQ A;  5E59 A;  3KZQ A;  4L0U A;  5J9C A;  3EWL A;  4F2I A;  2LRT A;  1AW9 A;  2NBS A;  1GL8 A;  4TN8 A;  2HRK B;  4XRD A;  2CX3 A;  1MD3 A;  3LYK A;  2K9F A;  4K7I A;  2QSI A;  3EU4 A;  3LFL A;  2VD0 A;  4YKG A;  1SK2 A;  1TKD B;  4F0B A;  1XW5 A;  1G6W A;  1NM3 A;  2FD3 A;  5ECK B;  2H01 A;  3G9B A;  1SKR B;  10GS A;  4P3Y B;  4PI2 C;  1FB6 A;  2HRF A;  2XPE A;  2NDO A;  1AQV A;  3D22 A;  3LSZ A;  1E2Y A;  4K5R A;  3I9V 2;  4WR5 A;  5J47 A;  2C0G A;  4XS4 A;  1BG5 A;  1PKZ A;  1ZMA A;  1F2E A;  2C8U A;  2GS3 A;  2K8S A;  2CX4 A;  4X43 A;  4Z2T A;  4PHZ C;  4GQF A;  4EF0 A;  2GZP A;  3KTL A;  1V40 A;  1XPV A;  4EVM A;  3TJG A;  2H74 A;  4ID0 A;  3MIX A;  14GS A;  5G1K A;  1LBK A;  1OC9 A;  3RHB A;  1TXX A;  4L5O A;  1HD2 A;  2B1L A;  4PUF C;  4O92 A;  3ZIT A;  2BJX A;  5B6M A;  2O5V A;  4XRA A;  5KN1 A;  1AC1 A;  1S3C A;  3IHQ A;  1B9Y C;  3HZ8 A;  1V58 A;  3BCI A;  1T1V A;  4I6X A;  3RFR C;  3W8J A;  4GRF A;  5D73 A;  5DJL A;  2I9H A;  3GKX A;  4O5R A;  2HRN A;  2YV9 A;  2GDR A;  1JZR A;  4MCU A;  5GZZ B;  1VF2 A;  4F82 A;  3US3 A;  4HU7 A;  1Z3E A;  1V9W A;  5D9V A;  4POM A;  4GF0 A;  2F8F A;  3L9V A;  4GWR A;  1KTE A;  2R4V A;  4G01 A;  4NV5 A;  3ZVJ A;  4AKH A;  2F3M A;  4I2T A;  1OYJ A;  2V6O A;  3E0U A;  2IME A;  1PX6 A;  2I1U A;  2BTO T;  2B3S A;  2YCD A;  1YQ1 A;  2C1Y A;  4K8M A;  4ZIL A;  1FO5 A;  2WFC A;  2UV8 G;  2HRK A;  2ES7 A;  1B8X A;  2EIR A;  3F6F A;  1M2D A;  4MJA A;  4YQU A;  2IMK A;  4FH8 A;  2LJR A;  5KN0 A;  3LQ7 A;  4NMU A;  1M9A A;  4O32 A;  1M2A A;  1YDK A;  1UC7 A;  3EE2 A;  5A4V A;  2A2R A;  4PTS A;  2IMD A;  3GUR A;  1SEN A;  1O85 A;  2KP2 A;  5D9X A;  1LU4 A;  4MJB A;  2JZR A;  1XZO A;  2RLI A;  4CY8 A;  5A5H B;  3D5J A;  2JU5 A;  1T3B A;  1SJ6 A;  3C1S A;  2L57 A;  2TIR A;  1I9D A;  4Z7X A;  3H93 A;  4MMM A;  2ZNM A;  1MDJ A;  6GSW A;  1ABA A;  1XVW A;  4NPB A;  1GSU A;  2R3X A;  3F3Q A;  2HZE B;  3GRX A;  1GNE A;  2LNT A;  4EC0 A;  4LMV A;  5G5F A;  3C8E A;  3APO A;  3CYN A;  1T7P B;  3IR4 A;  4IQA A;  2A4V A;  3TKQ A;  5F8B A;  1V2A A;  2X4A A;  4TKY A;  3BD2 A;  4L8E A;  4HDE A;  2VOC A;  2YPM A;  3ZFL A;  3LWA A;  2OBK A;  5CRH A;  5IPH A;  3ZRE A;  3I6A A;  2G0F A;  2MBT A;  2DJJ A;  1TRS A;  3ZVJ D;  3R2Q A;  3HKR A;  1PN9 A;  2R5G A;  4X1U A;  4AKX B;  2CVB A;  2H30 A;  2RM6 A;  4PQ1 A;  5HR2 A;  2GGT A;  8GSS A;  3LJR A;  2Z9S A;  2DJ2 A;  4IGJ A;  4IVF A;  4ZXG A;  3FR3 A;  1A2L A;  13GS A;  4OMV A;  4N11 A;  2E2M A;  4XHM A;  4CW9 A;  1XWG A;  4HOJ A;  2R2J A;  3VWX A;  5DCG A;  1DE1 A;  2H1B A;  4IW9 A;  1ZZY A;  4YQV A;  4MDC A;  4WF5 A;  4NV2 A;  3GX8 A;  3PIN A;  2KP1 A;  2DKH A;  2UZ8 A;  1FAA A;  5CP1 A;  3CWG A;  1K0B A;  1JLW A;  1Z5Y E;  1TP9 A;  2JZS A;  2LV3 A;  1U6T A;  2KUC A;  1PFO A;  4O5U A;  5G5E A;  1R4W A;  4BL7 B;  3DYR A;  3IE3 A;  3VPT A;  5JWO B;  3TRX A;  5J9B A;  2O3E A;  4QL9 A;  2VCV A;  2WW3 A;  2EC4 A;  2VLT A;  2L5O A;  2E2G A;  5E4W A;  1HNA A;  3D21 A;  3L9S A;  2FWE A;  4F9Z A;  2AB6 A;  3GV1 A;  1QXH A;  2FGX A;  5FHI A;  5A5H A;  2IFQ B;  5D93 A;  1PX7 A;  2LKU A;  3KP8 A;  3IDV A;  4JZQ A;  3SWL A;  1Y6E A;  2HZE A;  4HUA A;  1ZL9 A;  2GLR A;  2VCW A;  6GSY A;  3DKS A;  3GHA A;  4J56 E;  2OE3 A;  1XW9 A;  5CRG A;  2C0F A;  2O7K A;  5AIX A;  4ZB9 A;  2B7K A;  1QUW A;  2H6Y A;  4PUR A;  1NSW A;  2HXK A;  3F9U A;  2A2P A;  1ZYQ B;  1KNG A;  5HR1 A;  2RII A;  1THX A;  1JFU A;  3KGK A;  3CXG A;  3Q19 A;  5EVO A;  3E9J B;  4X0X A;  1PL2 A;  1PN0 A;  2O85 A;  4BWS A;  4BVX B;  1OC8 A;  3KJY A;  5IO2 A;  4KGI A;  4FIW A;  4K5S A;  1R26 A;  1SJZ A;  3U6V A;  1MD4 A;  1TRV A;  3HY2 A;  4K0N A;  2PER A;  1PSQ A;  3VLN A;  5IIZ A;  5B8A A;  4XS1 A;  3VWW A;  2YNX A;  1VF1 A;  5HR0 A;  1MDK A;  4G10 A;  5H5S A;  4EIP A;  4LA1 A;  3OR5 A;  2DJK A;  1PD2 1;  2FA8 A;  12GS A;  2GSS A;  4TR4 A;  2GQL A;  1BJX A;  3D4M A;  2A2S A;  3DVX A;  4BL7 A;  2HSH A;  5H5Q A;  2O89 A;  2MMN A;  4HZ4 A;  1ZYN A;  3WGX A;  1A2M A;  1F3B A;  5F0G A;  4MH3 A;  5BRT A;  1XOA A;  3LG6 A;  3LYP A;  2V32 A;  3RBT A;  3CRT A;  3DD3 A;  2M80 A;  3BJ5 A;  5ABR A;  4IEL A;  1K0M A;  2MMA A;  2TRX A;  2GTU A;  3CSH A;  5GAN D;  1HNB A;  4JE1 A;  3MYD A;  1PA3 A;  2DLX A;  2G2Q A;  4ZL8 A;  1O7U A;  1DUG A;  1PRX A;  2J23 A;  5IMC A;  3CMI A;  2VO4 A;  3I43 A;  2C0D A;  1Z6M A;  4MLY A;  2IIY A;  4N3Z A;  4YAV A;  1M2B A;  2QGV A;  2H1G A;  1K0D A;  1B4P A;  4E68 A;  2KOK A;  1V98 A;  1X9S B;  2XBI A;  3C73 A;  3WYW A;  4HQZ A;  2MMZ A;  2VL9 A;  2WVX B;  5DQY A;  3ZIV A;  4KAE A;  1XCC A;  3IC8 A;  1TTZ A;  4HS1 A;  2HQT A;  1Z9H A;  1DE2 A;  3EC3 A;  3KCM A;  3TRP A;  1A2J A;  1B9X C;  2YJH A;  3HA9 A;  2AHE A;  1GSE A;  1PQN A;  4JR4 A;  3APS A;  1SK1 A;  2HFD A;  1QFN A;  2WW1 A;  5J4Y A;  2DJ0 A;  1SJI A;  4TW5 A;  4IJI A;  1E6B A;  3VWU A;  1NHY A;  2WW0 A;  3N9J A;  4BVX A;  2FWF A;  4PGT A;  2L5L A;  2FHE A;  1BED A;  1ST9 A;  3A3T A;  3TOT A;  4AJ7 A;  1OKT A;  2OAC A;  4FO5 A;  1TI3 A;  1XWA A;  2VL2 A;  1CQH A;  2P0G A;  2HNL A;  3NIV A;  4CY6 A;  1GSQ A;  1SL1 B;  2B6M A;  3AY8 A;  2R37 A;  3TJJ A;  2XC2 A;  2I3Y A;  4KDX A;  2K8V A;  3IC4 A;  3L9U A;  1OVN A;  2OT3 A;  4GST A;  4OD7 A;  2GST A;  3UAR A;  4HEA 2;  3S9F A;  1X5C A;  2CZ2 A;  5ECH B;  4N0Z A;  4Z2R A;  3LGC A;  4G0L A;  3EIN A;  1EGR A;  4ZB8 A;  2WRT A;  3MSZ A;  5BMU B;  3QCP A;  1EEM A;  4KA0 A;  5H5R A;  4XTS A;  2MMO A;  4MZB A;  5GSS A;  1ZOF A;  2YN1 A;  3KH9 A;  2JAC A;  6GST A;  3MDK A;  3VUR A;  5AGY A;  2CV4 A;  4NAX A;  4CHS A;  3FHK A;  2QA2 A;  4OCF A;  5AN1 A;  2N5B A;  2V41 A;  3QFA C;  2LEG A;  2C3T A;  1VF4 A;  2DBC A;  1WWJ A;  3QPM A;  3APQ A;  5HQP A;  2DJ1 A;  2OA7 A;  5HFK A;  3GST A;  4MF5 A;  4TOP A;  1O8X A;  2VD1 A;  1N8J A;  4QQ7 A;  1X9W B;  3KEB A;  3UVH A;  4ULX A;  2IMF A;  4MPG A;  3LXZ A;  4AF2 A;  4LMW A;  2LQO A;  1TDI A;  1K3O A;  3TUE A;  2WVX A;  4DSR A;  3PR8 A;  2VIM A;  3ERF A;  1R5P A;  1S3D A;  3H79 A;  2JZT A;  1R7H A;  4HU9 A;  5CRE A;  2YAN A;  4PNF A;  1KBN A;  3HXS A;  1ACV A;  2VL2 C;  2OJL A;  2M46 A;  2NTO A;  4V2N A;  5DAL B;  4JRR A;  2HLS A;  5IPG A;  3IBH A;  2NPB A;  4DSQ A;  1TRU A;  1BG1 A;  5CRW A;  4O5Q A;  1AQW A;  3A2W A;  2PGT A;  2XBQ A;  5C04 A;  2X64 A;  3EU3 A;  1M9B A;  3F3R A;  3GSS A;  4ML1 A;  4ZL9 A;  4FQU A;  1A24 A;  2VLU A;  2MBS A;  3PPU A;  6GSS A;  2YJ7 A;  2V1M A;  4J2F A;  1AQX A;  5ECR B;  2REM A;  2H0H A;  1USB A;  4MF6 A;  4IHU A;  5ECL B;  2VCX A;  2AYT A;  1PL1 A;  3QDN A;  3QAW A;  4LL4 B;  1K0N A;  2CAI A;  7GSS A;  5A4U A;  1RQM A;  1FVK A;  1GWC A;  1EP8 A;  1X9M B;  11GS A;  5BMU A;  3D4T A;  3TOU A;  1F6M C;  4MK3 A;  1GNW A;  1O73 A;  3LEF A;  3ME7 A;  3P7X A;  2B5E A;  4RQR A;  1ZGN A;  4N30 A;  3PGT A;  3GTU B;  5F05 A;  3KTB A;  3TKS E;  2CZ3 A;  2WS2 A;  3P8W A;  4EDY A;  4BPY A;  3L78 A;  2XPD A;  3RGB C;  3TRQ A;  1K0A A;  3P2A A;  3BCK A;  2IMI A;  4WR4 A;  2AV4 A;  4K6X A;  1EEJ A;  5JCU A;  2VL3 A;  1SYX A;  5LNK e;  1TW9 A;  2WVY A;  4HZ2 A;  4GQC A;  4KCA A;  4I2U A;  1JZW A;  3IHG A;  1XWB A;  1Q98 A;  1GUL A;  2VCZ A;  3D0Z A;  2PUK C;  3N5O A;  3HVX A;  2D2Z A;  1XBS A;  2HI7 A;  4IP6 A;  3W6G A;  3IOS A;  3A5I A;  3UBL A;  1W89 A;  5KN2 A;  2FWG A;  3QR6 A;  1SYR A;  3VI5 A;  5G31 A;  4RI7 A;  2MZC A;  3QAV A;  4OO4 A;  1S3R A;  4ILF A;  2ALB A;  3F4S A;  1Z7R A;  2KHP A;  1NW2 A;  5DAL A;  1B4Q A;  3TKR A;  2L6C A;  2WW2 A;  5F06 A;  1U87 A;  1YKA A;  2H76 A;  1SD8 A;  1JZO A;  2PVO C;  1WIK A;  3HVN A;  4RUV A;  4GLT A;  2PWJ A;  4OFT A;  1QMV A;  1URM A;  3ZIJ A;  1GSY A;  1J08 A;  4KND A;  3MNG A;  2L59 A;  5DDL A;  3ZRD A;  1YF0 A;  3DEX A;  1OKD A;  4HSC X;  1YZX A;  1GP1 A;  4USS A;  2E7P A;  3KH7 A;  2H75 A;  3TKP A;  4F03 A;  2PU9 C;  2X8G A;  3BOA A;  6GSX A;  3TDG A;  4IKH A;  3LXT A;  1GTU A;  3RHC A;  3ZLP A;  4HQS A;  18GS A;  4D73 A;  1XWC A;  1THO A;  1GUH A;  2HSY A;  4NHW A;  5KEJ A;  1RK4 A;  3M1G A;  5KOX A;  1ERW A;  3ISO A;  20GS A;  4POL A;  2EFC A;  16GS A;  4ZBA A;  1SK0 A;  1VGL A;  2EFE A;  2HRA A;  2IL3 A;  1XIY A;  4OFM A;  4G0I A;  3A2V A;  3FZA A;  3GTU A;  2C80 A;  1GLP A;  5CAX A;  1FHE A;  4L0W A;  3IK7 A;  3VI7 A;  1EOG A;  4MPF A;  5IO0 A;  4QMK A;  2DSA A;  1GTB A;  1MEK A;  2H1A A;  1AAZ A;  2V6K A;  3A2X A;  3ZMK A;  4ZBB A;  1WPI A;  1I1I P;  2H72 A;  5IMA A;  2X49 A;  2JL4 A;  5ELA A;  3P90 A;  4G2E A;  2HSN A;  4WBR D;  3R3E A;  3H4K A;  4MNN A;  3HMJ G;  3GL3 A;  3F8U A;  5C00 A;  1J9B A;  1SVO A;  4ISD A;  3ZFB A;  2H0G A;  2FCH A;  3FKF A;  5AIV A;  4ML6 A;  3G7Y A;  1OE7 A;  1HYU A;  5COH A;  4MAB A;  2CQ9 A;  4V2M A;  3KD0 A;  1JLV A;  5JCW A;  4NWY A;  2YWO A;  5EL8 A;  2GVP A;  4ACS A;  4E8H A;  3GH9 A;  1EWX A;  2FA4 A;  4ZIJ A;  1ERU A;  1TK5 B;  1MTC A;  2XHF A;  4IS0 A;  4A5P A;  4EDZ A;  4TVE A;  1TXU A;  1QK8 A;  4I8B A;  2GSR A;  3CHX C;  4RQX A;  5HFI A;  4EXJ A;  1Z7P A;  4Z2U A;  5D8I A;  1BYE A;  4G0K A;  1I5G A;  3HVV A;  5GAP D;  3UBK A;  4Q5F A;  2HSM B;  4MF7 A;  3Q18 A;  4KDU A;  5J4V A;  5FWG A;  4WBJ A;  4AJ8 A;  2R0G A;  1Q4J A;  3UOM A;  2JSY A;  2X8H A;  1HQO A;  2YV7 A;  5ECO B;  3KMN A;  2WVZ A;  3UEM A;  1X0R A;  1FG4 A;  1SVM A;  4PQI A;  4MH2 A;  3HJP A;  3K8N A;  3BBY A;  2EFH A;  3M9K A;  1M3I A;  4J57 E;  3QOU A;  2J9H A;  4LL1 B;  3CTG A;  5EY6 A;  3GIX A;  4IN0 A;  2O87 A;  4TR1 A;  5IMD A;  4GCI A;  3QMX A;  5L71 A;  1EP7 A;  5CYY A;  1HNC A;  2AUV A;  4TXO B;  2DML A;  1SKW B;  3EPT A;  3TCO A;  2LST A;  4K1F A;  1T4Y A;  4EIQ A;  1O6J A;  1TI1 A;  4TR0 A;  4DVC A;  1XWK A;  3E3E A;  1ZCP A;  2H6Z A;  4PUA A;  4TR3 A;  4CDO A;  4JED A;  5FT3 A;  3FYG A;  3ERG A;  4AGS A;  3WGD A;  4GTU A;  3MWH A;  4NXI A;  3QAG A;  1ERT A;  2L4Q A;  5IMF A;  4JU5 A;  1JHB A;  1G7E A;  5ECI B;  1OC3 A;  3M8N A;  3G7J A;  3UJ1 A;  4ECI A;  4ZB7 A;  5DJM A;  2HE3 A;  3F4T A;  3RDW A;  2M72 A;  1FW1 A;  5IMZ A;  1T00 A;  4OFN A;  3O76 A;  5CNW A;  5LCZ A;  5ECS A;  1UVZ A;  1XW6 A;  1Y25 A;  3KIJ A;  2YP6 A;  2KLX A;  1TU7 A;  4ZBD A;  1BF5 A;  1EGO A;  3QD9 A;  4EE0 A; 
#chains in the Genus database with same CATH homology
 3EUR A;  3GL5 A;  4LLR A;  3ED3 A;  2P31 A;  3HHV A;  2K18 A;  3FRC A;  4WF4 A;  1YY7 A;  3ZYW A;  4K9Z A;  2HSM A;  2R6K A;  2LRN A;  5KOW A;  4MZW A;  4HJM A;  3UMA A;  5ELG A;  4FYU A;  2H1L A;  3J7Y b;  2BMX A;  4IP1 A;  2AAW A;  3DGQ A;  2MYG A;  3IA1 A;  2PMT A;  3F4R A;  3A5W A;  5ID2 B;  1PKW A;  3WT2 A;  1G7O A;  2LRC A;  4POK A;  4JBB A;  1V57 A;  3HD5 A;  3FK8 A;  1IYI A;  1BX9 A;  5IOW A;  5LD0 A;  5HR3 A;  4V2L A;  2FWH A;  2PBJ A;  1H4O A;  3L0H A;  1K3Y A;  2N5F A;  2FUG 2;  22GS A;  1YJ6 A;  4GSS A;  4EL1 A;  4TXO A;  3C71 A;  1G0T A;  4KSM A;  3GKK A;  2PVQ A;  3O6T A;  4OCE A;  4DSS A;  2VUP A;  2B7J A;  3TGZ A;  4XIH A;  3LW9 A;  3DML A;  2RUF A;  4YH2 A;  3FZ9 A;  3UAP A;  1N2A A;  1WRY A;  3IXR A;  3SBC A;  3FR9 A;  1K0O A;  3HVS A;  3I69 A;  1O8W A;  3DRN A;  4DEJ A;  3QFB C;  4F0C A;  3KM6 A;  1DSB A;  4ECB A;  2ZUP A;  1X5D A;  1A8Y A;  5G2Z A;  4BWQ A;  3M9J A;  2GZZ A;  4O7H A;  2VKZ G;  1PMT A;  1Y1U A;  1GUK A;  5A1N B;  5A34 B;  2HZF A;  4POB A;  2YWI A;  2YZH A;  5HFG A;  2WB9 A;  2H73 A;  2YOI A;  3F63 A;  3KMO A;  3HJM A;  1A0R P;  19GS A;  2C3Q A;  4K0G A;  2F51 A;  2GQM A;  3NZN A;  3ERW A;  3ZTL A;  4PNG A;  3EMP A;  3ZZX A;  4WKW A;  3VK9 A;  1GTI A;  2DJ3 A;  5KN3 A;  2B1K A;  3FY7 A;  3GFK A;  4HJ2 A;  5DAK B;  2LJA A;  1TRW A;  2HT9 A;  1FOH A;  1UA5 A;  2WUL A;  2HYX A;  2GSQ A;  1OAZ A;  2LQQ A;  5ID2 A;  3IK9 A;  1WP0 A;  1UN2 A;  2H6X A;  4D73 B;  4FYB A;  4K2X A;  2IN3 A;  3FZ4 A;  4W66 A;  1ILO A;  1SVL A;  3J7Y k;  5CRD A;  2CVD A;  1FOV A;  1SKS B;  2VAF A;  4WEY A;  1S3A A;  4MJE A;  4EUY A;  4MA9 A;  1XVQ A;  2GT6 A;  3C1R A;  1QGV A;  1U88 A;  3GUS A;  1WMJ A;  1SD9 A;  4JR6 A;  2ON7 A;  1ERV A;  1M0U A;  1GLQ A;  4Q5R A;  5IOX A;  2I4A A;  4OO5 A;  4ICY A;  1OE8 A;  4AI6 A;  3RPP A;  1J0F A;  3FMW A;  4N10 A;  3DVW A;  3GA4 A;  4XCS A;  5D96 A;  2YWM A;  4KH7 A;  3TKS A;  3WD6 A;  2RUE A;  2HSN B;  4AJ6 A;  1JZD A;  1CQG A;  2ON5 A;  2CT6 A;  2GQK A;  5IQY A;  4PXO A;  2DKI A;  4TRX A;  4V1A g;  3DXB A;  2CAQ A;  3F6D A;  1H75 A;  5DCH A;  1AXD A;  2LNS A;  1Z6N A;  1ZYP A;  5INY A;  4Q5N A;  1GTA A;  3IAM 2;  3EMX A;  4ZL7 A;  2ZCT A;  3UL3 A;  3Q74 A;  3WT1 A;  4KW6 A;  4IJ3 A;  6GSU A;  2VM2 A;  5JCG A;  5A1N A;  5A34 A;  5A5K A;  2PN8 A;  5CO3 A;  4ECJ A;  1ML6 A;  4K7N A;  1SL2 B;  4KSO A;  3Q6O A;  1YEX A;  2B5X A;  5F07 A;  2A4H A;  2V2G A;  3DWV A;  2X8C A;  3F0I A;  3U5R E;  1EZK A;  3KP9 A;  1M7T A;  3CSJ A;  2H71 A;  5DAK A;  2K6V A;  17GS A;  4ZB6 A;  3HJO A;  3VFI A;  2H70 A;  3HDC A;  3VWV A;  3TJB A;  2LUS A;  2H66 A;  5ECQ B;  1QQ2 A;  2VCT A;  3ZML A;  3TB2 A;  5JWR B;  2H8L A;  1GRX A;  5IM9 A;  1YF1 A;  3D6I A;  3TJF A;  2N5A A;  4BVY B;  4KF9 A;  2EFD A;  2P5R A;  3GH6 A;  2DIY A;  1A8L A;  2FY6 A;  3CRU A;  1F37 A;  2FNO A;  2H1D A;  1R5A A;  3GKM A;  1YEP A;  3TKS C;  3RPN A;  1SL0 B;  4TR1 B;  3DIE A;  1O81 A;  2WDU A;  4WET A;  2VLV A;  4IBP A;  3PH9 A;  2R0P A;  3M3M A;  2B5Y A;  3WGE A;  3IV4 A;  4KX4 A;  3FEU A;  2WCI A;  1YKC A;  5ECM B;  4PX1 A;  5J5N A;  2OE1 A;  3GMF A;  3W8S A;  2OKA A;  2C4J A;  2IJY A;  3H8Q A;  2YZU A;  2C3N A;  1XOB A;  5DQS A;  4FYC A;  4V1A p;  2GZY A;  2JSZ A;  1A23 A;  3GX0 A;  3L4N A;  5JWQ B;  2R0C A;  3ZL5 A;  1PGT A;  2QC7 A;  3EVI A;  1WE0 A;  3NOF A;  2YWN A;  2OBI A;  2F9S A;  4EO3 A;  3GNJ A;  2VCQ A;  4X4J A;  3MAK A;  4YKF A;  5ENU A;  2X99 A;  3GYK A;  3KXO A;  1X5E A;  3M0F A;  3H1N A;  3HZ4 A;  4YQM A;  1A0F A;  2LJK A;  3UVT A;  4Q5Q A;  3HCZ A;  4I5Q A;  1BQ7 A;  3CBU A;  4E8E A;  3IAS 2;  3FW2 A;  1KEB A;  3JCM L;  4H86 A;  3CSI A;  1EOH A;  4RI6 A;  2P5Q A;  2L6D A;  4HI7 A;  4GXZ A;  5A4W A;  2AJQ B;  2DMM A;  3O3T A;  3ME8 A;  1VF3 A;  5G1L A;  1AUC A;  4GSN A;  4I97 A;  1TJD A;  1FVJ A;  2DIZ A;  5IMV A;  4OWY A;  1MDI A;  3V1W A;  5D9T A;  1GH2 A;  1T4Z A;  3GKN A;  2OE0 A;  6GSV A;  1BAY A;  2C0E A;  4AKI A;  3LOR A;  2WJU A;  1LJR A;  1GSS A;  1DBY A;  1EV4 A;  5J4U A;  5J3R A;  9GSS A;  4EKZ A;  2QA1 A;  4BVY A;  1F3A A;  3FR6 A;  4KE3 A;  5D9W A;  1W4V A;  2F8A A;  2VM1 A;  3VPQ A;  4K2D A;  5G30 A;  5DVB A;  3EYT A;  1K3L A;  2PPT A;  4KDY A;  1U3A A;  1U3I A;  1TOF A;  1AIU A;  4K7O A;  3C7M A;  2JAD A;  2CA8 A;  4GDF A;  2CVK A;  3RAZ A;  1C72 A;  4L5L A;  4ECC A;  1SU9 A;  2RM5 A;  4KCE A;  4DSS B;  5ECN B;  4N0V A;  5B6N A;  2WGR A;  2H19 A;  4G19 A;  2IPA A;  3IPZ A;  2IFQ A;  3IRA A;  1GUM A;  1GSF A;  3UIW A;  3TJK A;  1XFL A;  5ECP B;  1WJK A;  3GN3 A;  1EV9 A;  4MJC A;  1YVL A;  4QL7 A;  1T8E B;  4MZC A;  5GST A;  1TK8 B;  4XS4 B;  4KB3 A;  4IQ1 A;  1K0C A;  3G7I A;  1G6Y A;  1TU8 A;  3TU3 B;  2EIQ A;  2IWT A;  2GT5 A;  1ON4 A;  1XXU A;  5EPF A;  3CTF A;  4PQH A;  2L4C A;  5J41 A;  1OC9 B;  1TK0 B;  2LTK A;  2WZ9 A;  2O8V B;  4KUN A;  5B8B A;  2I81 A;  2QKE A;  1M99 A;  1FB0 A;  2NVL A;  2DC5 A;  3FZ5 A;  2OAD A;  4MP4 A;  3HYP A;  5J40 A;  1N25 A;  4AKG A;  1NHO A;  5B7C A;  4NHZ A;  2H0I A;  2FLS A;  1RW1 A;  1WOU A;  4BA7 A;  1GSD A;  2E0Q A;  2EIO A;  1B48 A;  2TRC P;  1ZYE A;  2LS5 A;  4TXV A;  1IYH A;  1VRS D;  1F9M A;  4YAP A;  4XS6 A;  5AIS A;  4G9H A;  4WXT A;  5DBQ A;  5E59 A;  3KZQ A;  4L0U A;  5J9C A;  3EWL A;  4F2I A;  2LRT A;  1AW9 A;  2NBS A;  1GL8 A;  4TN8 A;  2HRK B;  4XRD A;  2CX3 A;  3LYK A;  1MD3 A;  2K9F A;  4K7I A;  2QSI A;  3EU4 A;  3LFL A;  2VD0 A;  4YKG A;  1SK2 A;  1TKD B;  4F0B A;  1XW5 A;  1G6W A;  1NM3 A;  2FD3 A;  5ECK B;  2H01 A;  3G9B A;  1SKR B;  10GS A;  4P3Y B;  1FB6 A;  2HRF A;  2XPE A;  2NDO A;  1AQV A;  3D22 A;  3LSZ A;  1E2Y A;  4K5R A;  3I9V 2;  4WR5 A;  5J47 A;  2C0G A;  4XS4 A;  1BG5 A;  1PKZ A;  1ZMA A;  1F2E A;  2C8U A;  2GS3 A;  2K8S A;  2CX4 A;  4X43 A;  4Z2T A;  4GQF A;  4EF0 A;  2GZP A;  3KTL A;  1V40 A;  1XPV A;  4EVM A;  3TJG A;  2H74 A;  4ID0 A;  3MIX A;  14GS A;  5G1K A;  1LBK A;  1OC9 A;  3RHB A;  1TXX A;  4L5O A;  1HD2 A;  2B1L A;  4PUF C;  4O92 A;  3ZIT A;  2BJX A;  5B6M A;  2O5V A;  4XRA A;  5KN1 A;  1AC1 A;  1S3C A;  3IHQ A;  1B9Y C;  3HZ8 A;  1V58 A;  3BCI A;  1T1V A;  4I6X A;  3W8J A;  4GRF A;  5D73 A;  5DJL A;  2I9H A;  3GKX A;  4O5R A;  2HRN A;  2YV9 A;  2GDR A;  1JZR A;  4MCU A;  5GZZ B;  1VF2 A;  4F82 A;  3US3 A;  4HU7 A;  1Z3E A;  1V9W A;  5D9V A;  4POM A;  4GF0 A;  2F8F A;  3L9V A;  4GWR A;  1KTE A;  2R4V A;  4G01 A;  4NV5 A;  3ZVJ A;  4AKH A;  2F3M A;  4I2T A;  1OYJ A;  2V6O A;  3E0U A;  2IME A;  1PX6 A;  2I1U A;  2BTO T;  2B3S A;  2YCD A;  1YQ1 A;  2C1Y A;  4K8M A;  4ZIL A;  1FO5 A;  2WFC A;  2UV8 G;  2HRK A;  2ES7 A;  1B8X A;  2EIR A;  3F6F A;  1M2D A;  4MJA A;  4YQU A;  2IMK A;  4FH8 A;  2LJR A;  5KN0 A;  3LQ7 A;  4NMU A;  1M9A A;  4O32 A;  1M2A A;  1YDK A;  1UC7 A;  3EE2 A;  5A4V A;  2A2R A;  4PTS A;  2IMD A;  3GUR A;  1SEN A;  1O85 A;  2KP2 A;  5D9X A;  1LU4 A;  4MJB A;  2JZR A;  1XZO A;  2RLI A;  4CY8 A;  5A5H B;  3D5J A;  2JU5 A;  1T3B A;  1SJ6 A;  3C1S A;  2L57 A;  2TIR A;  1I9D A;  4Z7X A;  3H93 A;  4MMM A;  2ZNM A;  1MDJ A;  6GSW A;  1ABA A;  1XVW A;  4NPB A;  1GSU A;  2R3X A;  3F3Q A;  2HZE B;  3GRX A;  1GNE A;  2LNT A;  4EC0 A;  4LMV A;  5G5F A;  3C8E A;  3APO A;  3CYN A;  1T7P B;  3IR4 A;  4IQA A;  2A4V A;  3TKQ A;  5F8B A;  1V2A A;  2X4A A;  4TKY A;  3BD2 A;  4L8E A;  4HDE A;  2VOC A;  2YPM A;  3ZFL A;  3LWA A;  2OBK A;  5CRH A;  5IPH A;  3ZRE A;  3I6A A;  2G0F A;  2MBT A;  2DJJ A;  1TRS A;  3ZVJ D;  3R2Q A;  3HKR A;  1PN9 A;  2R5G A;  4X1U A;  4AKX B;  2CVB A;  2H30 A;  2RM6 A;  4PQ1 A;  5HR2 A;  2GGT A;  8GSS A;  3LJR A;  2Z9S A;  2DJ2 A;  4IGJ A;  4IVF A;  4ZXG A;  3FR3 A;  1A2L A;  13GS A;  4OMV A;  4N11 A;  2E2M A;  4XHM A;  4CW9 A;  1XWG A;  4HOJ A;  2R2J A;  3VWX A;  5DCG A;  1DE1 A;  2H1B A;  4IW9 A;  1ZZY A;  4YQV A;  4MDC A;  4WF5 A;  4NV2 A;  3GX8 A;  3PIN A;  2KP1 A;  2DKH A;  2UZ8 A;  1FAA A;  5CP1 A;  3CWG A;  1K0B A;  1JLW A;  1Z5Y E;  1TP9 A;  2JZS A;  2LV3 A;  1U6T A;  2KUC A;  4O5U A;  5G5E A;  1R4W A;  4BL7 B;  3DYR A;  3IE3 A;  3VPT A;  5JWO B;  3TRX A;  5J9B A;  4QL9 A;  2VCV A;  2E2G A;  2EC4 A;  2VLT A;  2L5O A;  5E4W A;  1HNA A;  3D21 A;  3L9S A;  2FWE A;  4F9Z A;  2AB6 A;  3GV1 A;  1QXH A;  2FGX A;  5FHI A;  5A5H A;  2IFQ B;  5D93 A;  1PX7 A;  2LKU A;  3KP8 A;  3IDV A;  4JZQ A;  3SWL A;  1Y6E A;  2HZE A;  4HUA A;  1ZL9 A;  2GLR A;  2VCW A;  6GSY A;  3DKS A;  3GHA A;  4J56 E;  2OE3 A;  1XW9 A;  5CRG A;  2C0F A;  2O7K A;  5AIX A;  4ZB9 A;  2B7K A;  1QUW A;  2H6Y A;  4PUR A;  1NSW A;  2HXK A;  3F9U A;  2A2P A;  1ZYQ B;  1KNG A;  5HR1 A;  2RII A;  1THX A;  1JFU A;  3KGK A;  3CXG A;  3Q19 A;  5EVO A;  3E9J B;  4X0X A;  1PL2 A;  1PN0 A;  2O85 A;  4BWS A;  4BVX B;  1OC8 A;  3KJY A;  5IO2 A;  4KGI A;  4FIW A;  4K5S A;  1R26 A;  1SJZ A;  3U6V A;  1MD4 A;  1TRV A;  3HY2 A;  4K0N A;  2PER A;  1PSQ A;  3VLN A;  5IIZ A;  5B8A A;  4XS1 A;  3VWW A;  2YNX A;  1VF1 A;  5HR0 A;  1MDK A;  4G10 A;  5H5S A;  4EIP A;  4LA1 A;  3OR5 A;  2DJK A;  1PD2 1;  2FA8 A;  12GS A;  2GSS A;  4TR4 A;  2GQL A;  1BJX A;  3D4M A;  2A2S A;  3DVX A;  4BL7 A;  2HSH A;  5H5Q A;  2O89 A;  2MMN A;  4HZ4 A;  1ZYN A;  3WGX A;  1A2M A;  1F3B A;  5F0G A;  4MH3 A;  5BRT A;  1XOA A;  3LG6 A;  3LYP A;  2V32 A;  3RBT A;  3CRT A;  3DD3 A;  2M80 A;  3BJ5 A;  5ABR A;  4IEL A;  1K0M A;  2MMA A;  2TRX A;  2GTU A;  3CSH A;  5GAN D;  1HNB A;  4JE1 A;  3MYD A;  1PA3 A;  2DLX A;  2G2Q A;  4ZL8 A;  1O7U A;  1DUG A;  1PRX A;  2J23 A;  5IMC A;  3CMI A;  2VO4 A;  3I43 A;  2C0D A;  1Z6M A;  4MLY A;  2IIY A;  4N3Z A;  4YAV A;  1M2B A;  2QGV A;  2H1G A;  1K0D A;  1B4P A;  4E68 A;  2KOK A;  1V98 A;  1X9S B;  2XBI A;  3C73 A;  3WYW A;  4HQZ A;  2MMZ A;  2VL9 A;  5DQY A;  3ZIV A;  4KAE A;  1XCC A;  3IC8 A;  1TTZ A;  4HS1 A;  2HQT A;  1Z9H A;  1DE2 A;  3EC3 A;  3KCM A;  3TRP A;  1A2J A;  1B9X C;  2YJH A;  3HA9 A;  2AHE A;  1GSE A;  1PQN A;  4JR4 A;  3APS A;  1SK1 A;  2HFD A;  1QFN A;  5J4Y A;  2DJ0 A;  1SJI A;  4TW5 A;  4IJI A;  1E6B A;  3VWU A;  1NHY A;  3N9J A;  4BVX A;  2FWF A;  4PGT A;  2L5L A;  2FHE A;  1BED A;  1ST9 A;  3A3T A;  3TOT A;  4AJ7 A;  1OKT A;  2OAC A;  4FO5 A;  1TI3 A;  1XWA A;  2VL2 A;  1CQH A;  2P0G A;  2HNL A;  3NIV A;  4CY6 A;  1GSQ A;  1SL1 B;  2B6M A;  3AY8 A;  2R37 A;  3TJJ A;  2XC2 A;  2I3Y A;  4KDX A;  2K8V A;  3IC4 A;  3L9U A;  1OVN A;  2OT3 A;  4GST A;  4OD7 A;  2GST A;  3UAR A;  4HEA 2;  3S9F A;  1X5C A;  2CZ2 A;  5ECH B;  4N0Z A;  4Z2R A;  3LGC A;  4G0L A;  3EIN A;  1EGR A;  4ZB8 A;  2WRT A;  3MSZ A;  5BMU B;  3QCP A;  1EEM A;  4KA0 A;  5H5R A;  4XTS A;  2MMO A;  4MZB A;  5GSS A;  1ZOF A;  2YN1 A;  3KH9 A;  2JAC A;  6GST A;  3MDK A;  3VUR A;  5AGY A;  2CV4 A;  4NAX A;  4CHS A;  3FHK A;  2QA2 A;  4OCF A;  5AN1 A;  2N5B A;  2V41 A;  3QFA C;  2LEG A;  2C3T A;  1VF4 A;  2DBC A;  1WWJ A;  3QPM A;  3APQ A;  5HQP A;  2DJ1 A;  2OA7 A;  5HFK A;  3GST A;  4MF5 A;  4TOP A;  1O8X A;  2VD1 A;  1N8J A;  4QQ7 A;  1X9W B;  3KEB A;  3UVH A;  4ULX A;  2IMF A;  4MPG A;  3LXZ A;  4AF2 A;  4LMW A;  2LQO A;  1TDI A;  1K3O A;  3TUE A;  4DSR A;  3PR8 A;  2VIM A;  3ERF A;  1R5P A;  1S3D A;  3H79 A;  2JZT A;  1R7H A;  4HU9 A;  5CRE A;  2YAN A;  4PNF A;  1KBN A;  3HXS A;  1ACV A;  2VL2 C;  2OJL A;  2M46 A;  2NTO A;  4V2N A;  5DAL B;  4JRR A;  2HLS A;  5IPG A;  3IBH A;  2NPB A;  4DSQ A;  1TRU A;  1BG1 A;  5CRW A;  4O5Q A;  1AQW A;  3A2W A;  2PGT A;  2XBQ A;  5C04 A;  2X64 A;  3EU3 A;  1M9B A;  3F3R A;  3GSS A;  4ML1 A;  4ZL9 A;  4FQU A;  1A24 A;  2VLU A;  2MBS A;  3PPU A;  6GSS A;  2YJ7 A;  2V1M A;  4J2F A;  1AQX A;  5ECR B;  2REM A;  2H0H A;  1USB A;  4MF6 A;  4IHU A;  5ECL B;  2VCX A;  2AYT A;  1PL1 A;  3QDN A;  3QAW A;  4LL4 B;  1K0N A;  2CAI A;  7GSS A;  5A4U A;  1RQM A;  1FVK A;  1GWC A;  1EP8 A;  1X9M B;  11GS A;  5BMU A;  3D4T A;  3TOU A;  1F6M C;  4MK3 A;  1GNW A;  1O73 A;  3LEF A;  3ME7 A;  3P7X A;  2B5E A;  4RQR A;  1ZGN A;  4N30 A;  3PGT A;  3GTU B;  5F05 A;  3KTB A;  3TKS E;  2CZ3 A;  2WS2 A;  3P8W A;  4EDY A;  4BPY A;  3L78 A;  2XPD A;  3TRQ A;  1K0A A;  3P2A A;  3BCK A;  2IMI A;  4WR4 A;  2AV4 A;  4K6X A;  1EEJ A;  5JCU A;  2VL3 A;  1SYX A;  5LNK e;  1TW9 A;  4HZ2 A;  4GQC A;  4KCA A;  4I2U A;  1JZW A;  3IHG A;  1XWB A;  1Q98 A;  1GUL A;  2VCZ A;  3D0Z A;  2PUK C;  3N5O A;  3HVX A;  2D2Z A;  1XBS A;  2HI7 A;  4IP6 A;  3W6G A;  3IOS A;  3A5I A;  3UBL A;  1W89 A;  5KN2 A;  2FWG A;  3QR6 A;  1SYR A;  3VI5 A;  5G31 A;  4RI7 A;  2MZC A;  3QAV A;  4OO4 A;  4ILF A;  2ALB A;  3F4S A;  1Z7R A;  2KHP A;  1NW2 A;  5DAL A;  1B4Q A;  3TKR A;  2L6C A;  5F06 A;  1U87 A;  1YKA A;  2H76 A;  1SD8 A;  1JZO A;  2PVO C;  1WIK A;  4RUV A;  4GLT A;  2PWJ A;  4OFT A;  1QMV A;  1URM A;  3ZIJ A;  1GSY A;  1J08 A;  4KND A;  3MNG A;  2L59 A;  5DDL A;  3ZRD A;  1YF0 A;  3DEX A;  1OKD A;  1YZX A;  1GP1 A;  4USS A;  2E7P A;  3KH7 A;  2H75 A;  3TKP A;  4F03 A;  2PU9 C;  2X8G A;  3BOA A;  6GSX A;  3TDG A;  4IKH A;  3LXT A;  1GTU A;  3RHC A;  3ZLP A;  4HQS A;  18GS A;  4D73 A;  1XWC A;  1THO A;  1GUH A;  2HSY A;  4NHW A;  5KEJ A;  1RK4 A;  3M1G A;  5KOX A;  1ERW A;  3ISO A;  20GS A;  4POL A;  2EFC A;  16GS A;  4ZBA A;  1SK0 A;  1VGL A;  2EFE A;  2HRA A;  2IL3 A;  1XIY A;  4OFM A;  4G0I A;  3A2V A;  3FZA A;  3GTU A;  2C80 A;  1GLP A;  5CAX A;  1FHE A;  4L0W A;  3IK7 A;  3VI7 A;  1EOG A;  4MPF A;  5IO0 A;  4QMK A;  2DSA A;  1GTB A;  1MEK A;  2H1A A;  1AAZ A;  2V6K A;  3A2X A;  3ZMK A;  4ZBB A;  1WPI A;  2H72 A;  5IMA A;  2X49 A;  2JL4 A;  5ELA A;  3P90 A;  4G2E A;  2HSN A;  4WBR D;  3R3E A;  3H4K A;  4MNN A;  3HMJ G;  3GL3 A;  3F8U A;  5C00 A;  1J9B A;  1SVO A;  4ISD A;  3ZFB A;  2H0G A;  2FCH A;  3FKF A;  5AIV A;  4ML6 A;  3G7Y A;  1OE7 A;  1HYU A;  5COH A;  4MAB A;  2CQ9 A;  4V2M A;  3KD0 A;  1JLV A;  5JCW A;  4NWY A;  2YWO A;  5EL8 A;  2GVP A;  4ACS A;  4E8H A;  3GH9 A;  1EWX A;  2FA4 A;  4ZIJ A;  1ERU A;  1TK5 B;  1MTC A;  2XHF A;  4IS0 A;  4A5P A;  4EDZ A;  4TVE A;  1TXU A;  1QK8 A;  4I8B A;  2GSR A;  4RQX A;  5HFI A;  4EXJ A;  1Z7P A;  4Z2U A;  5D8I A;  1BYE A;  4G0K A;  1I5G A;  3HVV A;  5GAP D;  3UBK A;  4Q5F A;  2HSM B;  4MF7 A;  3Q18 A;  4KDU A;  5J4V A;  5FWG A;  4WBJ A;  4AJ8 A;  2R0G A;  1Q4J A;  3UOM A;  2JSY A;  2X8H A;  1HQO A;  2YV7 A;  5ECO B;  3KMN A;  3UEM A;  1X0R A;  1FG4 A;  1SVM A;  4PQI A;  4MH2 A;  3HJP A;  3K8N A;  3BBY A;  2EFH A;  3M9K A;  4J57 E;  3QOU A;  2J9H A;  4LL1 B;  3CTG A;  5EY6 A;  3GIX A;  4IN0 A;  2O87 A;  4TR1 A;  5IMD A;  4GCI A;  3QMX A;  5L71 A;  1EP7 A;  5CYY A;  1HNC A;  2AUV A;  4TXO B;  2DML A;  1SKW B;  3EPT A;  3TCO A;  2LST A;  4K1F A;  1T4Y A;  4EIQ A;  1O6J A;  1TI1 A;  4TR0 A;  4DVC A;  1XWK A;  3E3E A;  1ZCP A;  2H6Z A;  4PUA A;  4TR3 A;  4CDO A;  4JED A;  5FT3 A;  3FYG A;  3ERG A;  4AGS A;  3WGD A;  4GTU A;  3MWH A;  4NXI A;  3QAG A;  1ERT A;  2L4Q A;  5IMF A;  4JU5 A;  1JHB A;  1G7E A;  5ECI B;  1OC3 A;  3M8N A;  3G7J A;  3UJ1 A;  4ECI A;  4ZB7 A;  5DJM A;  2HE3 A;  3F4T A;  3RDW A;  2M72 A;  1FW1 A;  5IMZ A;  1T00 A;  4OFN A;  3O76 A;  5CNW A;  5LCZ A;  5ECS A;  1UVZ A;  1XW6 A;  1Y25 A;  3KIJ A;  2YP6 A;  2KLX A;  1TU7 A;  4ZBD A;  1BF5 A;  1EGO A;  3QD9 A;  4EE0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...