3TOUA

Crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
b'VMKLIGSHASPYTRKVRVVLAEKKIDYQFVLEDVWNADTQIHQFNPLGKVPCLVMDDGGALFDSRVIAEYADTLSPVARLIPPSGRERVEVRCWEALADGLLDAAVALRVEQTQRTPEQRSESWITRQHHKIDEALKAMSRGLADRTWCNGNHLTLADIAVGCALAYLDFRQPQVDWREQHANLAAFYTRIEKRPSFLETQPQAENLYFQSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione s-transferase protein
publication title Crystal structure of GLUTATHIONE S-TRANSFERASE from Ralstonia solanacearum
rcsb
source organism Ralstonia solanacearum
molecule tags Transferase
total genus 76
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3touA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3touA01
3PINA 4KDXA 4ML6A 4G9HA 3LXTA 2GGTA 5KN2A 3TRPA 2I9HA 2ZUPA 4LLRA 1GLPA 5ID2A 1QQ2A 1PL2A 4TXOA 4PQHA 2GT5A 4XIHA 3TUEA 2P0GA 1EEMA 2VM2A 3PH9A 1YY7A 5CNWA 3ZRDA 4DSRA 1OE8A 4KE3A 3UARA 2NVLA 1DBYA 1NHOA 4OFNA 3UBKA 4EF0A 1V98A 2RUEA 1NSWA 4MZWA 3R2QA 1T4ZA 4YQMA 1PD21 4BA7A 4FQUA 4POBA 5IO0A 5FT3A 1A8YA 1OKDA 1ACVA 2PUKC 3P90A 2MMAA 2C3TA 3UVTA 1GLQA 1KBNA 1OKTA 5ECMB 5IMAA 3UMAA 2IMIA 1AQXA 1XZOA 3ZIVA 1PL1A 1YF0A 1JZDA 2H6XA 2RLIA 3DGQA 1SYRA 1VF4A 1M2AA 1GSFA 3LEFA 1XXUA 5ECOB 2R3XA 1ZYQB 4XHMA 2FUG2 2H30A 5EL8A 2YWIA 1X5DA 2RM6A 2LNTA 2R5GA 3Q6OA 3H8QA 4HQZA 1MDJA 4XRDA 3TJBA 1K3LA 5COHA 2YCDA 2XBIA 3GSSA 1SK0A 3GKKA 3GL3A 1F3BA 2GS3A 4K0GA 1AIUA 3F0IA 3V1WA 2JSZA 5IPHA 2NDOA 3HVVA 5LCZA 1XWBA 3KTBA 2LV3A 1GSYA 5ECLB 4ISDA 5KN0A 4ZL9A 2N5BA 1O8WA 5HFIA 1TP9A 1XWGA 1DUGA 2V6KA 2FWFA 4K6XA 1TRUA 2OKAA 1K0NA 3W6GA 1U87A 4N0ZA 1Q4JA 4KDYA 2VAFA 5J4UA 3HVXA 5CRDA 2MYGA 2BMXA 3CSIA 3ZVJA 4QL9A 4IW9A 1FW1A 3KMNA 1Z6MA 3J7Yb 4ML1A 4OMVA 2QC7A 3F4RA 4DSSB 4OO4A 4JBBA 2HSNB 1C72A 2O8VB 4HDEA 5IOXA 4BVXB 9GSSA 3NOFA 1XW6A 4PNGA 5DCHA 1GUKA 2GSQA 4ZB6A 1S3CA 3EWLA 1Y25A 3TJJA 2IMKA 4IS0A 3C1RA 5DVBA 2L5OA 2HNLA 5A4VA 3GUSA 5KN1A 3WT2A 1OVNA 1TRSA 3UOMA 3C1SA 1MDKA 3GX0A 1JFUA 2CX4A 2GZPA 3CRTA 1E2YA 5L71A 3G7YA 3H79A 1OC3A 5ECKB 1G6WA 1ERUA 2G0FA 2B6MA 5EVOA 1Z6NA 1FVJA 1R5PA 1UN2A 2RUFA 2AJQB 1EOHA 1YF1A 4XCSA 1XVQA 4FH8A 1ERTA 1RK4A 4TR4A 4OD7A 4Q5RA 4BVXA 1X9WB 4G0IA 4PUFC 4IBPA 3TJGA 1YZXA 4K2DA 4KCEA 5CYYA 4E8EA 4Q5NA 3GSTA 2JU5A 2CVKA 1WOUA 2E0QA 2QGVA 2LS5A 3DKSA 5GSTA 3EMXA 2FY6A 3VI5A 1CQHA 2GLRA 3GH6A 1SD9A 2JSYA 3HYPA 5D96A 5HR0A 2GT6A 2VUPA 4F2IA 3GH9A 1GTIA 2L57A 3F4SA 1ERWA 6GSYA 4KUNA 5AIXA 2V32A 1K0DA 3C8EA 2ZCTA 1X5CA 4GSNA 2OBKA 5CREA 4HOJA 5GZZB 4MDCA 1U3AA 4V1Ag 3W8JA 5IMDA 5AIVA 5G5EA 1K0CA 4YQVA 2HRAA 2FLSA 5ECIB 4NV2A 4MJEA 3EU3A 2CA8A 2A2RA 4MZCA 4I97A 4XRAA 1PRXA 4IJ3A 11GSA 3L78A 2HSYA 2I1UA 1FB0A 2DIYA 3Q19A 3D4MA 2FHEA 3LORA 2KP2A 1SJZA 2WCIA 3IC8A 1HD2A 3KM6A 4MLYA 3GL5A 4G0KA 3GKNA 3M0FA 2RIIA 3GFKA 5CRWA 3US3A 2PWJA 4JZQA 1N2AA 1ILOA 3HZ8A 2E7PA 4WBRD 4V2LA 2MMOA 1YEXA 2IIYA 3APQA 1I5GA 2YP6A 3BJ5A 3HJOA 2A2SA 2C3NA 4YH2A 1OAZA 4ZBAA 4IP6A 2EIRA 3KP9A 4POMA 2AB6A 2G2QA 2VLUA 3IR4A 1VF2A 2K8VA 4ECJA 3QOUA 2C8UA 3FW2A 4IVFA 2HRNA 3F6FA 3LQ7A 1R5AA 2EIOA 1PMTA 2H6YA 5IMZA 1F3AA 5HQPA 3S9FA 3ZITA 4HEA2 1T3BA 1GSQA 1GSUA 3L9SA 4GQCA 1XW9A 1XOAA 3PPUA 3IK9A 16GSA 4MF7A 2P5QA 2B7KA 4XS6A 4IP1A 3IA1A 4NPBA 2B5XA 1X9MB 2DSAA 2HT9A 3GRXA 3E9JB 2MBTA 1BQ7A 1ON4A 3FZ9A 1TKDB 2DJ1A 3QFAC 3WD6A 5A5KA 2DJKA 4FYCA 2DBCA 4ZILA 1A2LA 6GSXA 3PGTA 2IFQB 4G10A 4QL7A 4MH2A 5FHIA 2QKEA 1YKCA 2E2GA 3IXRA 5CRGA 3CBUA 1QK8A 4O5RA 5HR3A 1A0RP 4KSOA 3UBLA 2CV4A 3KMOA 5JWOB 5DCGA 2F9SA 2HRFA 3KXOA 3ISOA 2X8GA 4PUAA 1B9YC 3KIJA 1YQ1A 4NXIA 2LEGA 3LJRA 1SJIA 1GTBA 1SD8A 4GSTA 4WF4A 1J9BA 2TRCP 4K7NA 2PVOC 5G1LA 1O7UA 3VURA 1KTEA 4L0UA 3GYKA 3EC3A 2H1BA 5ELAA 2KLXA 1TK8B 4HI7A 2LQQA 2TIRA 1G7OA 1A2JA 2H0IA 3MNGA 3GTUA 4FYUA 1XPVA 4BWQA 2LRCA 2CQ9A 4ZL7A 4LMVA 1GL8A 1AXDA 3EURA 1GRXA 3ERWA 3CSJA 2PU9C 4XS1A 5DAKB 4K1FA 5FWGA 2R6KA 4KW6A 4MJBA 4KSMA 2XBQA 2IL3A 3DXBA 5H5RA 3TKSC 3FKFA 1ABAA 4OCFA 2CAIA 2R2JA 4USSA 1OE7A 2WFCA 3L9UA 2DLXA 2VIMA 2VM1A 1TI1A 2HSHA 1TRWA 2V2GA 1PA3A 1AUCA 1TK0B 2YJ7A 2YWMA 5ECNB 3H93A 1WRYA 3EMPA 3TB2A 4OO5A 1MD4A 2AV4A 2DMMA 3M3MA 4D73B 2JZRA 2JACA 1GP1A 4PGTA 3H4KA 2VCZA 3D6IA 3QR6A 2J23A 1O81A 5DAKA 5DQYA 4EKZA 5IQYA 3F8UA 2HQTA 2N5FA 3WYWA 2AUVA 3D21A 6GSUA 3HD5A 3DYRA 1WP0A 1Z3EA 5CO3A 10GSA 4ECCA 4OFMA 1Z7RA 1XOBA 4N0VA 3O3TA 1UVZA 2DIZA 2O87A 2H0HA 1NW2A 5B6NA 3DD3A 2M72A 3IC4A 1PX6A 1EOGA 1E6BA 1XCCA 5JWRB 4G19A 2HE3A 2L4CA 4MF6A 3IV4A 2ZNMA 1YEPA 4OFTA 2XHFA 4JEDA 3A3TA 3QPMA 3C73A 2OA7A 2HXKA 3QAWA 3ZREA 4F82A 4BVYB 2VOCA 2B1LA 5J3RA 1AW9A 4GXZA 3IK7A 2R4VA 4V1Ap 1DE2A 2H76A 1AQVA 4KF9A 4Q5FA 5DDLA 4POKA 4AGSA 2OACA 4IJIA 3Q18A 4K0NA 3GN3A 3L4NA 5G1KA 3IAM2 2YANA 5J9BA 4HJMA 4F0BA 3FEUA 2FD3A 3DEXA 2KOKA 4E8HA 2H6ZA 2FWEA 1W89A 2HSMB 1LJRA 1SL1B 2L6CA 1R26A 3VWXA 4IHUA 5ECQB 2LTKA 4BL7B 3GNJA 2FA4A 2DMLA 4AJ7A 4PQ1A 3F3RA 1HYUA 4TR0A 1ST9A 3L9VA 3PR8A 2OJLA 4ECIA 3E3EA 4J57E 2WDUA 4BVYA 5EPFA 1TW9A 5G2ZA 3UAPA 3U6VA 3IOSA 6GSWA 5HR1A 5LNKe 3I69A 1FO5A 1MD3A 1EEJA 5ECPB 1XFLA 4NV5A 22GSA 3QD9A 3TOUA 1PQNA 5AISA 1Z9HA 2WULA 3ZLPA 1WPIA 2ES7A 12GSA 2HFDA 1T8EB 3VI7A 4HQSA 2L6DA 1PKWA 4EC0A 1VF3A 4O7HA 2FGXA 3ZVJD 3A5WA 5IO2A 4RQRA 1O73A 1GUMA 3EE2A 2KHPA 2IMDA 3QFBC 4TR1B 4KX4A 4BL7A 1XIYA 1T7PB 3IE3A 2GSTA 5ENUA 2P5RA 4XS4B 1ZGNA 4GCIA 4PX1A 1MTCA 6GSVA 1B48A 2JADA 4ECBA 3GMFA 1V57A 1KNGA 3VWUA 5DQSA 3KTLA 4Z7XA 3BBYA 2M46A 2H74A 1U3IA 1V58A 5HFKA 4GSSA 3A2VA 2I3YA 3SWLA 4L0WA 2HZFA 1XWCA 1OC8A 3ZYWA 4EVMA 2CZ3A 1RW1A 4AF2A 5H5SA 1PSQA 4WBJA 3GHAA 4J2FA 4EDZA 4DSSA 4ZBBA 2VLVA 4FIWA 2H73A 3TKQA 4V2NA 1GWCA 1BEDA 1M2DA 3LYKA 2V6OA 3ME7A 3IAS2 4J56E 2C0DA 1TU8A 1F2EA 2H70A 5DJLA 3D4TA 2H1AA 20GSA 4TR1A 4JE1A 4PTSA 3U5RE 4GRFA 1GNWA 4XS4A 4TRXA 4MF5A 4HUAA 2OE3A 1GULA 4MPGA 1M9AA 1AAZA 4ZIJA 2CVDA 5IIZA 3KCMA 2H1GA 4WR4A 2P31A 5D73A 5J5NA 3F63A 3ERFA 1QXHA 2JZTA 3ME8A 5KN3A 3IBHA 3KEBA 5GAND 1ML6A 3M9KA 3ZMKA 1CQGA 1BAYA 3EINA 2B3SA 4BWSA 5AN1A 2IJYA 3P7XA 4KCAA 3OR5A 1JLVA 3ZFBA 1GSDA 1EP7A 2HZEB 3DWVA 2PERA 2CT6A 2GVPA 3QCPA 5JWQB 4F0CA 3P2AA 3ZZXA 2CAQA 2VL3A 3CTFA 2V41A 4L5LA 3O76A 1OC9B 5F8BA 4WETA 2L5LA 4G0LA 1XWAA 4NWYA 4KGIA 3QAVA 1K3YA 1K3OA 2LNSA 2O89A 4ACSA 1OYJA 2C3QA 1GH2A 2H0GA 3L0HA 1FB6A 4OWYA 1A8LA 2X8HA 3GV1A 5EY6A 3EYTA 5JCGA 1SL2B 2F8FA 4LL1B 1TXXA 3CXGA 4BPYA 1O6JA 3C7MA 3RDWA 2MZCA 2HZEA 4OCEA 5LD0A 1G6YA 3HA9A 3G7IA 3KP8A 2VD1A 1K0AA 3FHKA 4JRRA 6GSSA 1JZRA 3KJYA 4MMMA 2WZ9A 2GZZA 3D22A 4F9ZA 1T4YA 2A4VA 4ILFA 2F51A 2WRTA 4HZ2A 1OC9A 1F6MC 2H71A 3ED3A 4EE0A 1IYHA 4QQ7A 1F37A 1YDKA 2VCVA 1SK2A 2F3MA 3CRUA 4HU9A 2EC4A 4I2TA 5IMFA 1KEBA 4F03A 4JR4A 3MWHA 2REMA 1SL0B 4WR5A 3VFIA 3TKSA 1PGTA 2LRTA 3FR3A 2VCWA 4O92A 3DIEA 1K0BA 2HI7A 6GSTA 2LQOA 2VD0A 2KP1A 4TVEA 2YN1A 4IN0A 4IQ1A 3GA4A 2IMEA 3HXSA 2HRKB 2VL2C 1EP8A 5G5FA 3ZIJA 3APSA 1MEKA 4RUVA 1NHYA 2GQKA 2X64A 1GSEA 2WJUA 1RQMA 3BOAA 3IPZA 1VF1A 3HJPA 1SJ6A 2FNOA 2B7JA 2BTOT 3VWVA 4KNDA 4TN8A 5F06A 3NIVA 1MDIA 1V9WA 3LG6A 2JZSA 4NHZA 1K0OA 2D2ZA 3LFLA 4AJ6A 3DRNA 5F0GA 1Q98A 3HKRA 2Z9SA 2WGRA 2WS2A 1USBA 3M1GA 3F9UA 1FAAA 3CMIA 2XC2A 5DJMA 4Q5QA 5ID2B 2IFQA 2IMFA 2AHEA 4MABA 5HFGA 2FWGA 1BYEA 4WKWA 2NPBA 2EIQA 3M8NA 3AY8A 4MA9A 1HNAA 1A23A 4FYBA 5IM9A 4JU5A 4EXJA 1SU9A 4K8MA 5BMUA 2UZ8A 3G9BA 1XBSA 8GSSA 4L8EA 1G7EA 5D9WA 4MP4A 5A4WA 1GTAA 3HHVA 5D9XA 4TOPA 1IYIA 4MZBA 5C00A 1SKRB 1BX9A 2LJRA 5CRHA 2VO4A 1U88A 5D9TA 3D0ZA 4TW5A 1URMA 1EZKA 2YJHA 1JZWA 1TI3A 2VCQA 1NM3A 2N5AA 2M80A 2H01A 2NTOA 4TXVA 2QSIA 5J41A 1LBKA 1X9SB 4ID0A 2H66A 1TK5B 3FR9A 2YPMA 4ZL8A 2LJKA 4CW9A 3FZAA 2C0GA 1YKAA 3VWWA 4FO5A 5IPGA 4V2MA 1WIKA 1N8JA 2ON7A 4O32A 1FVKA 3I6AA 4N10A 4EO3A 2GTUA 5IOWA 18GSA 1B4QA 3Q74A 1G0TA 1S3AA 5ECHB 3JCML 1GUHA 3RPNA 4KA0A 2B5YA 2GQMA 4WXTA 2YV7A 3IDVA 4NHWA 1ZOFA 4YAPA 3RHCA 4ZB9A 4PNFA 2O85A 3TJFA 2C0FA 2XPEA 2K8SA 5G31A 2PMTA 4D73A 1UC7A 1ZCPA 2LUSA 3VPTA 4KH7A 4DVCA 2OE0A 1T00A 3O6TA 3G7JA 1SKWB 2GZYA 1R7HA 3RAZA 7GSSA 4EDYA 1JLWA 2RM5A 3F3QA 1YJ6A 2YZHA 5DALB 2LSTA 2ALBA 3BD2A 3VLNA 3ZMLA 3N9JA 2H19A 3ERGA 1DSBA 3GX8A 2DJ0A 2K6VA 2L4QA 3F6DA 1H75A 2H1DA 3IHQA 1PKZA 4HS1A 5H5QA 5D8IA 3TKSE 3N5OA 3MAKA 3I43A 4P3YB 1EV4A 3HCZA 4KAEA 1A2MA 1QGVA 2V1MA 1Z7PA 3CSHA 1ZL9A 4DSQA 1TDIA 4CHSA 2CZ2A 17GSA 4WEYA 5B8AA 4RQXA 2I4AA 2B1KA 3KD0A 5ELGA 1EGRA 1U6TA 3WGEA 1K0MA 4ZBDA 2YV9A 5DALA 2DJ3A 3GURA 2E2MA 3GKMA 4PXOA 3KZQA 5E59A 3RHBA 3TRQA 5F05A 1FOVA 1ERVA 2KUCA 5CP1A 4KB3A 2LRNA 5D93A 2HSMA 2PGTA 2I81A 2MMZA 3HJMA 1TTZA 3TGZA 2PBJA 2HLSA 4HU7A 2VLTA 1UA5A 2GSSA 2K9FA 3LGCA 1GTUA 3H1NA 3UVHA 4LL4B 2DJJA 1SENA 2YWNA 4AJ8A 4GF0A 3QAGA 3HVSA 3A2XA 1EGOA 3VPQA 1LU4A 3DVXA 3QMXA 2BJXA 2GSRA 2YNXA 2OBIA 1QMVA 3NZNA 1TJDA 4TKYA 3TJKA 4X0XA 2F8AA 2XPDA 4I5QA 4CDOA 4PQIA 5AGYA 3WT1A 5ECSA 2MMNA 1XWKA 3LYPA 3APOA 1AC1A 3SBCA 3UL3A 4IELA 4YAVA 1SKSB 2VCXA 3TKPA 2YWOA 5B7CA 3ZTLA 1B4PA 1F9MA 4MCUA 1TRVA 2VL9A 1O8XA 2AAWA 4HZ4A 4IQAA 5J9CA 3GKXA 3QDNA 1XW5A 1O85A 3KH9A 4ULXA 4MJCA 13GSA 3FR6A 5F07A 2L59A 2FCHA 2IPAA 3FK8A 3TDGA 5GAPD 1FG4A 2HYXA 4JR6A 4KDUA 3IRAA 2YOIA 2GQLA 4G2EA 1ZZYA 1W4VA 3BCIA 4MH3A 3KGKA 1HNCA 1S3DA 2IWTA 4LA1A 5IMCA 3M9JA 1BG5A 2VL2A 4TR3A 1B9XC 3LXZA 1M9BA 2H72A 2OADA 1WWJA 4H86A 4K9ZA 3R3EA 2TRXA 5INYA 3D5JA 4PURA 1M99A 2C4JA 5JCUA 19GSA 4IGJA 2B5EA 1I9DA 3HZ4A 2IN3A 4L5OA 1PX7A 4LMWA 1JZOA 4DEJA 4N30A 1TU7A 3I9V2 1V2AA 3WGXA 3TOTA 5G30A 3C71A 1H4OA 1ZMAA 3LSZA 2X8CA 4I2UA 2YZUA 5D9VA 4YQUA 3GIXA 2MBSA 1R4WA 3E0UA 3KH7A 3A2WA 4K7OA 3TKRA 2WB9A 3EVIA 4I8BA 4I6XA 2H75A 4POLA 3K8NA 1EWXA 4ZXGA 2PN8A 4MPFA 3LWAA 1SYXA 1X5EA 5B8BA 4WF5A 1SK1A 3HDCA 1DE1A 1T1VA 1WJKA 1TOFA 1ZYEA 4EL1A 3DMLA 4X1UA 2C1YA 2JL4A 3VK9A 2O7KA 4GTUA 4N11A 1AQWA 1XVWA 1THXA 4RI7A 1GNEA 4GWRA 5E4WA 3TCOA 2CVBA 5ECRB 1QUWA 1V40A 3TRXA 2FA8A 2PVQA 1M7TA 5B6MA 2NBSA 1QFNA 4HJ2A 3ZFLA 1PN9A 5DBQA 3RPPA 1GSSA 2PPTA 2X99A 2LKUA 3BCKA 4K7IA 4NAXA 3HY2A 5GSSA 2GDRA 2C0EA 2J9HA 3F4TA 2C80A 3GTUB 4GQFA 5CAXA 2AYTA 3MSZA 4IKHA 1A24A 5C04A 5A4UA 3RBTA 3UJ1A 3UEMA 3W8SA 3WGDA 1J0FA 5ABRA 1VGLA 1M0UA 1FHEA 4X43A 3DVWA 2DC5A 1THOA 2R37A 3MDKA 5IMVA 1VRSD 4EUYA 4NMUA 3P8WA 1X0RA 2HRKA 4TXOB 3UIWA 3FZ5A 5HR2A 2H8LA 1JHBA 2OE1A 1M2BA 4XTSA 2ON5A 2LJAA 2CX3A 4ZB8A 1J08A 1WE0A 1HQOA 1A0FA 1BJXA 3FZ4A 1HNBA 3FY7A 1B8XA 4MJAA 3CYNA 4MK3A 14GSA 1Z5YE 3ZL5A 3FYGA 4GLTA 3J7Yk 4RI6A 2DJ2A 2VCTA 2K18A 1EV9A 1Y6EA 2FWHA 5KEJA 1WMJA 3EU4A 3CTGA 3FRCA 5JCWA
chains in the Genus database with same CATH superfamily
3PINA 4KDXA 4ML6A 4G9HA 3LXTA 2GGTA 5KN2A 4YKGA 3TRPA 2I9HA 2ZUPA 4LLRA 1GLPA 5ID2A 1QQ2A 1PL2A 4TXOA 4PQHA 2GT5A 4XIHA 3TUEA 2P0GA 4CY6A 1EEMA 2VM2A 3PH9A 1YY7A 5CNWA 3ZRDA 2X4AA 4DSRA 1OE8A 4KE3A 3UARA 2NVLA 1DBYA 1NHOA 4OFNA 3UBKA 4EF0A 1V98A 2RUEA 1NSWA 4MZWA 3R2QA 1T4ZA 4YQMA 1PD21 4BA7A 4FQUA 4POBA 5IO0A 5FT3A 1A8YA 1TXUA 1OKDA 1ACVA 2PUKC 3P90A 2MMAA 2C3TA 3UVTA 1GLQA 1KBNA 1OKTA 5ECMB 5IMAA 3UMAA 1YEWC 1AQXA 2IMIA 1XZOA 3ZIVA 1PL1A 1YF0A 1JZDA 1M3JA 2H6XA 2RLIA 3DGQA 4PI2C 1SYRA 1VF4A 1M2AA 1GSFA 3LEFA 1XXUA 5ECOB 2R3XA 1ZYQB 4XHMA 2FUG2 2H30A 5EL8A 2YWIA 1X5DA 2RM6A 2LNTA 2R5GA 3Q6OA 3H8QA 4HQZA 1MDJA 4XRDA 1Y1UA 3TJBA 1K3LA 5COHA 2YCDA 2XBIA 3GSSA 1SK0A 3GKKA 4E68A 3GL3A 1F3BA 2GS3A 4K0GA 1AIUA 3F0IA 3V1WA 2JSZA 2R0GA 5IPHA 2NDOA 3HVVA 5LCZA 4AKHA 1XWBA 3KTBA 2LV3A 1GSYA 5ECLB 4ISDA 5KN0A 4ZL9A 2N5BA 1O8WA 5HFIA 1TP9A 1XWGA 1PN0A 1DUGA 2V6KA 2FWFA 4K6XA 1TRUA 2OKAA 1K0NA 3W6GA 1U87A 4N0ZA 1Q4JA 4KDYA 2VAFA 5J4UA 3HVXA 5CRDA 2MYGA 2BMXA 3CSIA 3ZVJA 4QL9A 4MNNA 2R0CA 4IW9A 1FW1A 4K5SA 3KMNA 1Z6MA 3J7Yb 4ML1A 4OMVA 2QC7A 3F4RA 4DSSB 4OO4A 4JBBA 2HSNB 1C72A 2O8VB 4HDEA 5IOXA 4BVXB 9GSSA 3NOFA 1XW6A 4PNGA 5DCHA 1GUKA 2GSQA 4ZB6A 1S3CA 3EWLA 1Y25A 3TJJA 2IMKA 4IS0A 3C1RA 5DVBA 2L5OA 2HNLA 5A4VA 3GUSA 5KN1A 4K5RA 2EFDA 3WT2A 1OVNA 1TRSA 3UOMA 3C1SA 1MDKA 3GX0A 1JFUA 2CX4A 2GZPA 3CRTA 1E2YA 5L71A 3G7YA 3H79A 1OC3A 5ECKB 1G6WA 1ERUA 2G0FA 2B6MA 2X49A 5EVOA 4BIKA 1Z6NA 1FVJA 1R5PA 1UN2A 2RUFA 2AJQB 1EOHA 1YF1A 4XCSA 1XVQA 2HSNA 4FH8A 1ERTA 1RK4A 4TR4A 4OD7A 4Q5RA 4BVXA 1X9WB 4G0IA 4PUFC 4IBPA 3TJGA 1YZXA 4K2DA 2EFEA 4KCEA 5CYYA 4E8EA 3FMWA 4Q5NA 3GSTA 2JU5A 2CVKA 1WOUA 2E0QA 2QA2A 2QGVA 2LS5A 3DKSA 5GSTA 3EMXA 2FY6A 3VI5A 1CQHA 2GLRA 3GH6A 3LW9A 1SD9A 2JSYA 3HYPA 5D96A 5HR0A 2GT6A 2VUPA 4F2IA 3GH9A 1GTIA 2L57A 4O5UA 3F4SA 1ERWA 6GSYA 4KUNA 5AIXA 2V32A 1K0DA 3C8EA 2O36A 2ZCTA 1X5CA 4GSNA 2OBKA 5CREA 4HOJA 5GZZB 4MDCA 1U3AA 4V1Ag 3W8JA 5IMDA 5AIVA 5G5EA 1K0CA 4YQVA 2HRAA 2FLSA 4AKGA 5ECIB 4NV2A 4MJEA 4QMKA 3EU3A 2CA8A 2A2RA 4MZCA 4I97A 4XRAA 1PRXA 4IJ3A 11GSA 3L78A 2HSYA 2I1UA 1FB0A 2DIYA 3Q19A 3D4MA 2FHEA 3LORA 2KP2A 1SJZA 2WCIA 3IC8A 1HD2A 4CY8A 3KM6A 4MLYA 3GL5A 4G0KA 3GKNA 3M0FA 2RIIA 3GFKA 5CRWA 3US3A 2PWJA 4JZQA 1N2AA 1ILOA 3HZ8A 2E7PA 4WBRD 4V2LA 2MMOA 1YEXA 2IIYA 3APQA 1I5GA 2YP6A 3BJ5A 3HJOA 2A2SA 2C3NA 4YH2A 1OAZA 4ZBAA 4IP6A 2EIRA 3KP9A 2WVYA 4POMA 2AB6A 2G2QA 2VLUA 3IR4A 1VF2A 2K8VA 4ECJA 3QOUA 2C8UA 3FW2A 4IVFA 2HRNA 3F6FA 3LQ7A 1R5AA 2EIOA 1PMTA 2H6YA 5IMZA 1F3AA 5HQPA 3S9FA 3ZITA 4HEA2 1T3BA 1GSQA 1GSUA 3L9SA 4GQCA 1XW9A 3RGBC 1XOAA 3PPUA 3IK9A 16GSA 4MF7A 2P5QA 2B7KA 4XS6A 4IP1A 3IA1A 4NPBA 2B5XA 1X9MB 2DSAA 2HT9A 3GRXA 3E9JB 2MBTA 1BQ7A 1ON4A 3FZ9A 1TKDB 2DJ1A 3QFAC 3WD6A 5A5KA 2DJKA 3A5IA 4FYCA 2DBCA 4ZILA 1A2LA 6GSXA 3PGTA 2IFQB 4G10A 4QL7A 1S3RA 4MH2A 5FHIA 4PHZC 2QKEA 1YKCA 2E2GA 3IXRA 5CRGA 3CBUA 1QK8A 4O5RA 5HR3A 1A0RP 4KSOA 3UBLA 2CV4A 3KMOA 5JWOB 5DCGA 2F9SA 2HRFA 3KXOA 5BRTA 3ISOA 2X8GA 4PUAA 1SVOA 4W66A 1B9YC 3KIJA 1YQ1A 4NXIA 2LEGA 3LJRA 1SJIA 1GTBA 1SD8A 4GSTA 4WF4A 1J9BA 2TRCP 1I1IP 4K7NA 2PVOC 5G1LA 1O7UA 3VURA 1KTEA 4L0UA 3GYKA 3EC3A 2H1BA 5ELAA 2KLXA 1TK8B 4HI7A 2LQQA 2TIRA 1G7OA 1A2JA 2H0IA 3MNGA 3GTUA 4FYUA 1XPVA 2QA1A 4BWQA 2LRCA 2CQ9A 4ZL7A 4LMVA 1GL8A 1AXDA 3EURA 1GRXA 3ERWA 3CSJA 2PU9C 4XS1A 5DAKB 4K1FA 5FWGA 2R6KA 4KW6A 4MJBA 4KSMA 2XBQA 3IHGA 2IL3A 3DXBA 5H5RA 3TKSC 3FKFA 1ABAA 4OCFA 2CAIA 2R2JA 4USSA 1OE7A 2WFCA 3L9UA 2DLXA 2VIMA 5J4YA 2VM1A 1TI1A 2HSHA 1TRWA 2V2GA 1PA3A 1AUCA 1TK0B 2YJ7A 2YWMA 5ECNB 3H93A 1WRYA 3EMPA 3TB2A 4OO5A 1MD4A 2AV4A 2DMMA 3M3MA 4D73B 2JZRA 2JACA 1GP1A 4PGTA 3H4KA 2VCZA 3D6IA 3QR6A 2J23A 1O81A 5DAKA 5DQYA 4EKZA 4O5QA 5IQYA 3F8UA 1PFOA 2HQTA 2N5FA 3WYWA 2AUVA 3D21A 6GSUA 3HD5A 3DYRA 1WP0A 1Z3EA 5CO3A 10GSA 4ECCA 4OFMA 2O5VA 1Z7RA 1XOBA 4N0VA 3O3TA 1UVZA 2DIZA 2O87A 2H0HA 1NW2A 5B6NA 3DD3A 2M72A 3IC4A 2O3EA 1PX6A 1EOGA 1E6BA 1XCCA 5JWRB 4G19A 2HE3A 2L4CA 4MF6A 3IV4A 2ZNMA 1YEPA 4OFTA 2XHFA 4JEDA 3A3TA 3QPMA 3C73A 2OA7A 2HXKA 3QAWA 3ZREA 4F82A 4BVYB 2VOCA 2B1LA 5J3RA 1AW9A 4GXZA 3IK7A 2R4VA 4V1Ap 1DE2A 2H76A 1AQVA 4KF9A 4Q5FA 5DDLA 4POKA 2WW2A 4AGSA 2OACA 4IJIA 3Q18A 4K0NA 3GN3A 3L4NA 5G1KA 3IAM2 2YANA 5J9BA 4HJMA 4F0BA 3FEUA 2FD3A 3DEXA 2KOKA 4E8HA 2H6ZA 2FWEA 1W89A 2HSMB 1LJRA 1SL1B 2L6CA 1R26A 3VWXA 4IHUA 4HSCX 5ECQB 2LTKA 4BL7B 3GNJA 2FA4A 2DMLA 4AJ7A 2EFHA 4PQ1A 3F3RA 1HYUA 4TR0A 1ST9A 3L9VA 3PR8A 2OJLA 4ECIA 3E3EA 4J57E 5A34B 2WDUA 4BVYA 5EPFA 1TW9A 5G2ZA 3UAPA 3U6VA 3IOSA 6GSWA 5HR1A 5LNKe 3I69A 1FO5A 1MD3A 1EEJA 5ECPB 1XFLA 4Z2TA 4NV5A 2H1LA 22GSA 3QD9A 3TOUA 1PQNA 5AISA 1Z9HA 2WULA 3ZLPA 1WPIA 1XG8A 2ES7A 12GSA 2HFDA 1T8EB 4X4JA 3VI7A 4HQSA 2L6DA 1PKWA 4EC0A 1VF3A 4O7HA 2FGXA 3ZVJD 3A5WA 5IO2A 4RQRA 1O73A 1GUMA 3EE2A 2KHPA 2IMDA 3QFBC 4TR1B 4KX4A 4BL7A 1XIYA 1T7PB 3IE3A 2GSTA 5ENUA 2P5RA 4XS4B 1ZGNA 4GCIA 4PX1A 1MTCA 6GSVA 2A2PA 1B48A 1ZYNA 2JADA 4ECBA 3GMFA 1V57A 1KNGA 3VWUA 5DQSA 3KTLA 4Z7XA 3BBYA 2M46A 2H74A 1U3IA 1V58A 5HFKA 4GSSA 3A2VA 2I3YA 3SWLA 4L0WA 2HZFA 1XWCA 1OC8A 3ZYWA 4EVMA 2CZ3A 1RW1A 4AF2A 5H5SA 1PSQA 4WBJA 3GHAA 4J2FA 4EDZA 4DSSA 4ZBBA 2UV8G 2VLVA 4FIWA 2H73A 3TKQA 4V2NA 4FXYP 1GWCA 1BEDA 1M2DA 3LYKA 2V6OA 3ME7A 3IAS2 4J56E 2C0DA 1TU8A 1F2EA 2H70A 5DJLA 3D4TA 2H1AA 3MYDA 20GSA 4TR1A 4JE1A 4PTSA 3U5RE 4GRFA 1SVMA 1GNWA 4XS4A 4TRXA 4MF5A 4HUAA 2OE3A 1GULA 4MPGA 1M9AA 2EFCA 1AAZA 4ZIJA 2CVDA 5IIZA 3KCMA 2H1GA 3CWGA 4WR4A 2P31A 5D73A 5J5NA 3F63A 3ERFA 1QXHA 2JZTA 3ME8A 5KN3A 3IBHA 3KEBA 5GAND 1ML6A 3M9KA 3ZMKA 1CQGA 1BAYA 3EINA 2B3SA 4BWSA 5AN1A 2IJYA 3P7XA 4KCAA 3OR5A 1JLVA 3ZFBA 1GSDA 1EP7A 2HZEB 3DWVA 2PERA 2CT6A 2GVPA 3QCPA 5JWQB 4F0CA 3P2AA 3ZZXA 1BG1A 3MIXA 2CAQA 2VL3A 3CTFA 2V41A 4L5LA 3O76A 1OC9B 5F8BA 4WETA 2L5LA 4G0LA 1XWAA 4NWYA 4KGIA 3QAVA 1K3YA 1K3OA 2LNSA 2O89A 4ACSA 1OYJA 2C3QA 1GH2A 2H0GA 3L0HA 1FB6A 4OWYA 1A8LA 2X8HA 3GV1A 5EY6A 3EYTA 5JCGA 5KOXA 1SL2B 2F8FA 4LL1B 1TXXA 3CXGA 4BPYA 1O6JA 3C7MA 3RDWA 2MZCA 2HZEA 4OCEA 5LD0A 1G6YA 3HA9A 1BF5A 3G7IA 3KP8A 2VD1A 1K0AA 3FHKA 4JRRA 6GSSA 1JZRA 3KJYA 4A5PA 4MMMA 5A1NB 2WZ9A 2GZZA 3D22A 4F9ZA 1T4YA 2A4VA 4ILFA 2F51A 2WRTA 4HZ2A 1OC9A 2WW1A 1F6MC 1N25A 2H71A 3HMJG 3ED3A 3TU3B 4EE0A 4K2XA 1IYHA 4QQ7A 1F37A 1YDKA 2VCVA 1SK2A 2F3MA 3CRUA 4HU9A 2EC4A 4I2TA 5IMFA 1KEBA 4F03A 4JR4A 3MWHA 2REMA 1SL0B 4WR5A 2R0PA 3VFIA 3TKSA 1PGTA 2LRTA 3FR3A 2VCWA 4O92A 3DIEA 1K0BA 2HI7A 6GSTA 2LQOA 2VD0A 2KP1A 4TVEA 2YN1A 4IN0A 4IQ1A 3GA4A 2IMEA 3HXSA 5A1NA 2HRKB 2VL2C 1EP8A 5G5FA 3ZIJA 3APSA 1ZYPA 1MEKA 4RUVA 1NHYA 2GQKA 2X64A 1GSEA 2WJUA 2WVXB 1RQMA 2WW3A 3BOAA 3IPZA 1VF1A 3HJPA 1SJ6A 2FNOA 2B7JA 2BTOT 3VWVA 4KNDA 5BMUB 4AI6A 4TN8A 5F06A 3NIVA 1YVLA 1MDIA 1V9WA 3LG6A 2JZSA 4NHZA 1K0OA 2D2ZA 3LFLA 4AJ6A 3DRNA 5F0GA 1Q98A 3HKRA 2Z9SA 2WGRA 2WS2A 1USBA 3M1GA 3F9UA 1FAAA 3CMIA 2XC2A 5DJMA 4Q5QA 5ID2B 2IFQA 2IMFA 2AHEA 4MABA 5HFGA 2FWGA 2DKHA 1BYEA 4WKWA 2NPBA 2EIQA 3M8NA 2WVXA 3AY8A 4MA9A 1HNAA 1A23A 4FYBA 5IM9A 4JU5A 4EXJA 1SU9A 4K8MA 5BMUA 2UZ8A 3G9BA 1XBSA 8GSSA 4L8EA 4N3ZA 1G7EA 5D9WA 4MP4A 5A4WA 1GTAA 3HHVA 5D9XA 4TOPA 1IYIA 4MZBA 3CQFA 5C00A 1SKRB 1BX9A 2LJRA 5CRHA 2A4HA 2VO4A 1U88A 5D9TA 3D0ZA 4TW5A 1URMA 1EZKA 2YJHA 2VKZG 1JZWA 1TI3A 3HVNA 2VCQA 1NM3A 2N5AA 4AKIA 2M80A 2H01A 2NTOA 4TXVA 2QSIA 5J41A 1LBKA 1X9SB 4ID0A 2H66A 1TK5B 3FR9A 2YPMA 4ZL8A 2LJKA 4CW9A 3FZAA 4AKXB 2C0GA 1YKAA 3VWWA 4FO5A 5IPGA 4V2MA 1WIKA 1N8JA 2ON7A 4O32A 1FVKA 3I6AA 4N10A 4EO3A 2GTUA 5IOWA 18GSA 1B4QA 3Q74A 1G0TA 1S3AA 5ECHB 3JCML 1GUHA 3RPNA 4KA0A 2B5YA 2GQMA 4WXTA 2YV7A 3IDVA 4NHWA 1ZOFA 5J40A 4YAPA 4Z2RA 3RHCA 4ZB9A 4PNFA 2O85A 3TJFA 2C0FA 2XPEA 2K8SA 5G31A 2PMTA 4D73A 1UC7A 1ZCPA 2LUSA 3VPTA 5J47A 4KH7A 4DVCA 4EIPA 4ZB7A 2OE0A 1T00A 3O6TA 1M3IA 3G7JA 2WW0A 1SKWB 2GZYA 1R7HA 3RAZA 7GSSA 4EDYA 1JLWA 2RM5A 3F3QA 1YJ6A 2YZHA 5DALB 2LSTA 2ALBA 3BD2A 3VLNA 3ZMLA 3N9JA 2H19A 3ERGA 1DSBA 3GX8A 2DJ0A 2K6VA 2L4QA 3F6DA 1H75A 2H1DA 3IHQA 1PKZA 4HS1A 5H5QA 5D8IA 3TKSE 2WVZA 3N5OA 3MAKA 4GDFA 3I43A 4P3YB 1EV4A 3HCZA 4KAEA 1A2MA 1QGVA 2V1MA 1Z7PA 3CSHA 1ZL9A 4DSQA 1TDIA 4CHSA 2CZ2A 17GSA 4WEYA 5B8AA 4RQXA 2I4AA 2B1KA 3KD0A 5ELGA 1EGRA 1U6TA 3WGEA 1K0MA 4ZBDA 2YV9A 5DALA 2DJ3A 3GURA 2E2MA 3GKMA 4PXOA 3KZQA 5E59A 3RHBA 3TRQA 5F05A 1FOVA 1ERVA 2KUCA 5CP1A 4KB3A 2LRNA 5D93A 2HSMA 2PGTA 2I81A 2MMZA 3HJMA 1TTZA 3TGZA 2PBJA 2HLSA 4HU7A 2VLTA 1UA5A 2GSSA 2K9FA 3LGCA 5A34A 1GTUA 3H1NA 3UVHA 4LL4B 2DJJA 1SENA 2YWNA 4AJ8A 4GF0A 3QAGA 3HVSA 3A2XA 1EGOA 3VPQA 1LU4A 3DVXA 3QMXA 2BJXA 2GSRA 5A5HB 2YNXA 2OBIA 1QMVA 3NZNA 1TJDA 4TKYA 3TJKA 4X0XA 2F8AA 2XPDA 4I5QA 4CDOA 4PQIA 5AGYA 3WT1A 5ECSA 2MMNA 1XWKA 3LYPA 3APOA 1AC1A 3SBCA 3UL3A 4IELA 4YAVA 1SKSB 2VCXA 3TKPA 2YWOA 5B7CA 3ZTLA 4Z2UA 1B4PA 1F9MA 4MCUA 1TRVA 2VL9A 1O8XA 2AAWA 4HZ4A 4IQAA 5J9CA 3GKXA 3QDNA 5J4VA 1XW5A 1O85A 3KH9A 4ULXA 4MJCA 13GSA 3FR6A 5F07A 2L59A 2FCHA 2IPAA 3FK8A 3TDGA 5GAPD 5A5HA 1FG4A 2HYXA 4JR6A 4KDUA 1FOHA 3IRAA 2YOIA 2GQLA 4G2EA 1ZZYA 1W4VA 3BCIA 4MH3A 3KGKA 1HNCA 1S3DA 2IWTA 4LA1A 5IMCA 3M9JA 1BG5A 2VL2A 4TR3A 1B9XC 3LXZA 1M9BA 2H72A 2OADA 1WWJA 4H86A 4K9ZA 3R3EA 2TRXA 5INYA 3D5JA 4PURA 1M99A 2C4JA 5JCUA 19GSA 4IGJA 2B5EA 1I9DA 3HZ4A 2IN3A 4L5OA 1PX7A 4LMWA 1JZOA 4DEJA 4N30A 1TU7A 3I9V2 1V2AA 3WGXA 3TOTA 5G30A 3C71A 1H4OA 1ZMAA 3LSZA 2X8CA 4I2UA 2YZUA 5D9VA 4YQUA 4EIQA 3GIXA 2MBSA 1R4WA 3E0UA 3KH7A 3A2WA 4K7OA 3TKRA 2WB9A 3EVIA 4I8BA 4I6XA 2H75A 3RFRC 4POLA 4PI0C 3K8NA 1EWXA 4ZXGA 2PN8A 4MPFA 3LWAA 1SYXA 1X5EA 5B8BA 4WF5A 1SK1A 3HDCA 1DE1A 1T1VA 1WJKA 1TOFA 1ZYEA 4EL1A 3DMLA 4X1UA 2C1YA 2JL4A 3VK9A 2O7KA 4GTUA 4N11A 1AQWA 1XVWA 1THXA 4RI7A 1GNEA 4GWRA 5E4WA 3TCOA 2CVBA 5ECRB 1QUWA 4G01A 1V40A 3TRXA 2FA8A 2PVQA 2DKIA 1M7TA 5B6MA 4YKFA 2NBSA 1QFNA 4HJ2A 3ZFLA 1PN9A 5DBQA 2OT3A 3RPPA 1GSSA 2PPTA 2X99A 2LKUA 3BCKA 3CHXC 4K7IA 4NAXA 4ICYA 3HY2A 5GSSA 2GDRA 2C0EA 2J9HA 3F4TA 2C80A 3GTUB 4GQFA 5CAXA 2AYTA 3MSZA 4IKHA 1A24A 5C04A 5A4UA 3RBTA 3UJ1A 3UEMA 3W8SA 3WGDA 1J0FA 5ABRA 1VGLA 1M0UA 1FHEA 4X43A 3DVWA 2DC5A 1THOA 2R37A 3MDKA 5IMVA 1VRSD 4EUYA 4NMUA 3P8WA 1X0RA 2HRKA 4TXOB 3UIWA 3FZ5A 5HR2A 2H8LA 1JHBA 2OE1A 1M2BA 4XTSA 1S4BP 2ON5A 2LJAA 2CX3A 4ZB8A 1J08A 1WE0A 2WZSA 1HQOA 1A0FA 1BJXA 3FZ4A 1HNBA 3EPTA 3FY7A 1B8XA 4MJAA 1SVLA 3CYNA 4MK3A 14GSA 1Z5YE 3ZL5A 3FYGA 4GLTA 3J7Yk 4RI6A 2DJ2A 2VCTA 5KOWA 2K18A 1EV9A 1Y6EA 2FWHA 5KEJA 1WMJA 3EU4A 3CTGA 3FRCA 5JCWA
chains in the Genus database with same CATH topology
3PINA 4KDXA 4ML6A 4G9HA 3LXTA 2GGTA 5KN2A 4YKGA 3TRPA 2I9HA 2ZUPA 4LLRA 1GLPA 5ID2A 1QQ2A 1PL2A 4TXOA 4PQHA 2GT5A 4XIHA 3TUEA 2P0GA 4CY6A 1EEMA 2VM2A 3PH9A 1YY7A 5CNWA 3ZRDA 2X4AA 4DSRA 1OE8A 4KE3A 3UARA 2NVLA 1DBYA 1NHOA 4OFNA 3UBKA 4EF0A 1V98A 2RUEA 1NSWA 4MZWA 3R2QA 1T4ZA 4YQMA 1PD21 4BA7A 4FQUA 4POBA 5IO0A 5FT3A 1A8YA 1TXUA 1OKDA 1ACVA 2PUKC 3P90A 2MMAA 2C3TA 3UVTA 1GLQA 1KBNA 1OKTA 5ECMB 5IMAA 3UMAA 2IMIA 1AQXA 1XZOA 3ZIVA 1PL1A 1YF0A 1JZDA 2H6XA 2RLIA 3DGQA 1SYRA 1VF4A 1M2AA 1GSFA 3LEFA 1XXUA 5ECOB 2R3XA 1ZYQB 4XHMA 2FUG2 2H30A 5EL8A 2YWIA 1X5DA 2RM6A 2LNTA 2R5GA 3Q6OA 3H8QA 4HQZA 1MDJA 4XRDA 1Y1UA 3TJBA 1K3LA 5COHA 2YCDA 2XBIA 3GSSA 1SK0A 3GKKA 4E68A 3GL3A 1F3BA 2GS3A 4K0GA 1AIUA 3F0IA 3V1WA 2JSZA 2R0GA 5IPHA 2NDOA 3HVVA 5LCZA 4AKHA 1XWBA 3KTBA 2LV3A 1GSYA 5ECLB 4ISDA 5KN0A 4ZL9A 2N5BA 1O8WA 5HFIA 1TP9A 1XWGA 1PN0A 1DUGA 2V6KA 2FWFA 4K6XA 1TRUA 2OKAA 1K0NA 3W6GA 1U87A 4N0ZA 1Q4JA 4KDYA 2VAFA 5J4UA 3HVXA 5CRDA 2MYGA 2BMXA 3CSIA 3ZVJA 4QL9A 4MNNA 2R0CA 4IW9A 1FW1A 4K5SA 3KMNA 1Z6MA 3J7Yb 4ML1A 4OMVA 2QC7A 3F4RA 4DSSB 4OO4A 4JBBA 2HSNB 1C72A 2O8VB 4HDEA 5IOXA 4BVXB 9GSSA 3NOFA 1XW6A 4PNGA 5DCHA 1GUKA 2GSQA 4ZB6A 1S3CA 3EWLA 1Y25A 3TJJA 2IMKA 4IS0A 3C1RA 5DVBA 2L5OA 2HNLA 5A4VA 3GUSA 5KN1A 4K5RA 2EFDA 3WT2A 1OVNA 1TRSA 3UOMA 3C1SA 1MDKA 3GX0A 1JFUA 2CX4A 2GZPA 3CRTA 1E2YA 5L71A 3G7YA 3H79A 1OC3A 5ECKB 1G6WA 1ERUA 2G0FA 2B6MA 2X49A 5EVOA 1Z6NA 1FVJA 1R5PA 1UN2A 2RUFA 2AJQB 1EOHA 1YF1A 4XCSA 1XVQA 2HSNA 4FH8A 1ERTA 1RK4A 4TR4A 4OD7A 4Q5RA 4BVXA 1X9WB 4G0IA 4PUFC 4IBPA 3TJGA 1YZXA 4K2DA 2EFEA 4KCEA 5CYYA 4E8EA 3FMWA 4Q5NA 3GSTA 2JU5A 2CVKA 1WOUA 2E0QA 2QA2A 2QGVA 2LS5A 3DKSA 5GSTA 3EMXA 2FY6A 3VI5A 1CQHA 2GLRA 3GH6A 3LW9A 1SD9A 2JSYA 3HYPA 5D96A 5HR0A 2GT6A 2VUPA 4F2IA 3GH9A 1GTIA 2L57A 4O5UA 3F4SA 1ERWA 6GSYA 4KUNA 5AIXA 2V32A 1K0DA 3C8EA 2ZCTA 1X5CA 4GSNA 2OBKA 5CREA 4HOJA 5GZZB 4MDCA 1U3AA 4V1Ag 3W8JA 5IMDA 5AIVA 5G5EA 1K0CA 4YQVA 2HRAA 2FLSA 4AKGA 5ECIB 4NV2A 4MJEA 4QMKA 3EU3A 2CA8A 2A2RA 4MZCA 4I97A 4XRAA 1PRXA 4IJ3A 11GSA 3L78A 2HSYA 2I1UA 1FB0A 2DIYA 3Q19A 3D4MA 2FHEA 3LORA 2KP2A 1SJZA 2WCIA 3IC8A 1HD2A 4CY8A 3KM6A 4MLYA 3GL5A 4G0KA 3GKNA 3M0FA 2RIIA 3GFKA 5CRWA 3US3A 2PWJA 4JZQA 1N2AA 1ILOA 3HZ8A 2E7PA 4WBRD 4V2LA 2MMOA 1YEXA 2IIYA 3APQA 1I5GA 2YP6A 3BJ5A 3HJOA 2A2SA 2C3NA 4YH2A 1OAZA 4ZBAA 4IP6A 2EIRA 3KP9A 4POMA 2AB6A 2G2QA 2VLUA 3IR4A 1VF2A 2K8VA 4ECJA 3QOUA 2C8UA 3FW2A 4IVFA 2HRNA 3F6FA 3LQ7A 1R5AA 2EIOA 1PMTA 2H6YA 5IMZA 1F3AA 5HQPA 3S9FA 3ZITA 4HEA2 1T3BA 1GSQA 1GSUA 3L9SA 4GQCA 1XW9A 1XOAA 3PPUA 3IK9A 16GSA 4MF7A 2P5QA 2B7KA 4XS6A 4IP1A 3IA1A 4NPBA 2B5XA 1X9MB 2DSAA 2HT9A 3GRXA 3E9JB 2MBTA 1BQ7A 1ON4A 3FZ9A 1TKDB 2DJ1A 3QFAC 3WD6A 5A5KA 2DJKA 3A5IA 4FYCA 2DBCA 4ZILA 1A2LA 6GSXA 3PGTA 2IFQB 4G10A 4QL7A 4MH2A 5FHIA 2QKEA 1YKCA 2E2GA 3IXRA 5CRGA 3CBUA 1QK8A 4O5RA 5HR3A 1A0RP 4KSOA 3UBLA 2CV4A 3KMOA 5JWOB 5DCGA 2F9SA 2HRFA 3KXOA 5BRTA 3ISOA 2X8GA 4PUAA 1SVOA 4W66A 1B9YC 3KIJA 1YQ1A 4NXIA 2LEGA 3LJRA 1SJIA 1GTBA 1SD8A 4GSTA 4WF4A 1J9BA 2TRCP 4K7NA 2PVOC 5G1LA 1O7UA 3VURA 1KTEA 4L0UA 3GYKA 3EC3A 2H1BA 5ELAA 2KLXA 1TK8B 4HI7A 2LQQA 2TIRA 1G7OA 1A2JA 2H0IA 3MNGA 3GTUA 4FYUA 1XPVA 2QA1A 4BWQA 2LRCA 2CQ9A 4ZL7A 4LMVA 1GL8A 1AXDA 3EURA 1GRXA 3ERWA 3CSJA 2PU9C 4XS1A 5DAKB 4K1FA 5FWGA 2R6KA 4KW6A 4MJBA 4KSMA 2XBQA 3IHGA 2IL3A 3DXBA 5H5RA 3TKSC 3FKFA 1ABAA 4OCFA 2CAIA 2R2JA 4USSA 1OE7A 2WFCA 3L9UA 2DLXA 2VIMA 5J4YA 2VM1A 1TI1A 2HSHA 1TRWA 2V2GA 1PA3A 1AUCA 1TK0B 2YJ7A 2YWMA 5ECNB 3H93A 1WRYA 3EMPA 3TB2A 4OO5A 1MD4A 2AV4A 2DMMA 3M3MA 4D73B 2JZRA 2JACA 1GP1A 4PGTA 3H4KA 2VCZA 3D6IA 3QR6A 2J23A 1O81A 5DAKA 5DQYA 4EKZA 4O5QA 5IQYA 3F8UA 2HQTA 2N5FA 3WYWA 2AUVA 3D21A 6GSUA 3HD5A 3DYRA 1WP0A 1Z3EA 5CO3A 10GSA 4ECCA 4OFMA 2O5VA 1Z7RA 1XOBA 4N0VA 3O3TA 1UVZA 2DIZA 2O87A 2H0HA 1NW2A 5B6NA 3DD3A 2M72A 3IC4A 1PX6A 1EOGA 1E6BA 1XCCA 5JWRB 4G19A 2HE3A 2L4CA 4MF6A 3IV4A 2ZNMA 1YEPA 4OFTA 2XHFA 4JEDA 3A3TA 3QPMA 3C73A 2OA7A 2HXKA 3QAWA 3ZREA 4F82A 4BVYB 2VOCA 2B1LA 5J3RA 1AW9A 4GXZA 3IK7A 2R4VA 4V1Ap 1DE2A 2H76A 1AQVA 4KF9A 4Q5FA 5DDLA 4POKA 4AGSA 2OACA 4IJIA 3Q18A 4K0NA 3GN3A 3L4NA 5G1KA 3IAM2 2YANA 5J9BA 4HJMA 4F0BA 3FEUA 2FD3A 3DEXA 2KOKA 4E8HA 2H6ZA 2FWEA 1W89A 2HSMB 1LJRA 1SL1B 2L6CA 1R26A 3VWXA 4IHUA 5ECQB 2LTKA 4BL7B 3GNJA 2FA4A 2DMLA 4AJ7A 2EFHA 4PQ1A 3F3RA 1HYUA 4TR0A 1ST9A 3L9VA 3PR8A 2OJLA 4ECIA 3E3EA 4J57E 5A34B 2WDUA 4BVYA 5EPFA 1TW9A 5G2ZA 3UAPA 3U6VA 3IOSA 6GSWA 5HR1A 5LNKe 3I69A 1FO5A 1MD3A 1EEJA 5ECPB 1XFLA 4Z2TA 4NV5A 2H1LA 22GSA 3QD9A 3TOUA 1PQNA 5AISA 1Z9HA 2WULA 3ZLPA 1WPIA 2ES7A 12GSA 2HFDA 1T8EB 4X4JA 3VI7A 4HQSA 2L6DA 1PKWA 4EC0A 1VF3A 4O7HA 2FGXA 3ZVJD 3A5WA 5IO2A 4RQRA 1O73A 1GUMA 3EE2A 2KHPA 2IMDA 3QFBC 4TR1B 4KX4A 4BL7A 1XIYA 1T7PB 3IE3A 2GSTA 5ENUA 2P5RA 4XS4B 1ZGNA 4GCIA 4PX1A 1MTCA 6GSVA 2A2PA 1B48A 1ZYNA 2JADA 4ECBA 3GMFA 1V57A 1KNGA 3VWUA 5DQSA 3KTLA 4Z7XA 3BBYA 2M46A 2H74A 1U3IA 1V58A 5HFKA 4GSSA 3A2VA 2I3YA 3SWLA 4L0WA 2HZFA 1XWCA 1OC8A 3ZYWA 4EVMA 2CZ3A 1RW1A 4AF2A 5H5SA 1PSQA 4WBJA 3GHAA 4J2FA 4EDZA 4DSSA 4ZBBA 2UV8G 2VLVA 4FIWA 2H73A 3TKQA 4V2NA 1GWCA 1BEDA 1M2DA 3LYKA 2V6OA 3ME7A 3IAS2 4J56E 2C0DA 1TU8A 1F2EA 2H70A 5DJLA 3D4TA 2H1AA 3MYDA 20GSA 4TR1A 4JE1A 4PTSA 3U5RE 4GRFA 1SVMA 1GNWA 4XS4A 4TRXA 4MF5A 4HUAA 2OE3A 1GULA 4MPGA 1M9AA 2EFCA 1AAZA 4ZIJA 2CVDA 5IIZA 3KCMA 2H1GA 3CWGA 4WR4A 2P31A 5D73A 5J5NA 3F63A 3ERFA 1QXHA 2JZTA 3ME8A 5KN3A 3IBHA 3KEBA 5GAND 1ML6A 3M9KA 3ZMKA 1CQGA 1BAYA 3EINA 2B3SA 4BWSA 5AN1A 2IJYA 3P7XA 4KCAA 3OR5A 1JLVA 3ZFBA 1GSDA 1EP7A 2HZEB 3DWVA 2PERA 2CT6A 2GVPA 3QCPA 5JWQB 4F0CA 3P2AA 3ZZXA 1BG1A 3MIXA 2CAQA 2VL3A 3CTFA 2V41A 4L5LA 3O76A 1OC9B 5F8BA 4WETA 2L5LA 4G0LA 1XWAA 4NWYA 4KGIA 3QAVA 1K3YA 1K3OA 2LNSA 2O89A 4ACSA 1OYJA 2C3QA 1GH2A 2H0GA 3L0HA 1FB6A 4OWYA 1A8LA 2X8HA 3GV1A 5EY6A 3EYTA 5JCGA 5KOXA 1SL2B 2F8FA 4LL1B 1TXXA 3CXGA 4BPYA 1O6JA 3C7MA 3RDWA 2MZCA 2HZEA 4OCEA 5LD0A 1G6YA 3HA9A 1BF5A 3G7IA 3KP8A 2VD1A 1K0AA 3FHKA 4JRRA 6GSSA 1JZRA 3KJYA 4A5PA 4MMMA 5A1NB 2WZ9A 2GZZA 3D22A 4F9ZA 1T4YA 2A4VA 4ILFA 2F51A 2WRTA 4HZ2A 1OC9A 1F6MC 1N25A 2H71A 3HMJG 3ED3A 3TU3B 4EE0A 4K2XA 1IYHA 4QQ7A 1F37A 1YDKA 2VCVA 1SK2A 2F3MA 3CRUA 4HU9A 2EC4A 4I2TA 5IMFA 1KEBA 4F03A 4JR4A 3MWHA 2REMA 1SL0B 4WR5A 2R0PA 3VFIA 3TKSA 1PGTA 2LRTA 3FR3A 2VCWA 4O92A 3DIEA 1K0BA 2HI7A 6GSTA 2LQOA 2VD0A 2KP1A 4TVEA 2YN1A 4IN0A 4IQ1A 3GA4A 2IMEA 3HXSA 5A1NA 2HRKB 2VL2C 1EP8A 5G5FA 3ZIJA 3APSA 1ZYPA 1MEKA 4RUVA 1NHYA 2GQKA 2X64A 1GSEA 2WJUA 1RQMA 3BOAA 3IPZA 1VF1A 3HJPA 1SJ6A 2FNOA 2B7JA 2BTOT 3VWVA 4KNDA 5BMUB 4AI6A 4TN8A 5F06A 3NIVA 1YVLA 1MDIA 1V9WA 3LG6A 2JZSA 4NHZA 1K0OA 2D2ZA 3LFLA 4AJ6A 3DRNA 5F0GA 1Q98A 3HKRA 2Z9SA 2WGRA 2WS2A 1USBA 3M1GA 3F9UA 1FAAA 3CMIA 2XC2A 5DJMA 4Q5QA 5ID2B 2IFQA 2IMFA 2AHEA 4MABA 5HFGA 2FWGA 2DKHA 1BYEA 4WKWA 2NPBA 2EIQA 3M8NA 3AY8A 4MA9A 1HNAA 1A23A 4FYBA 5IM9A 4JU5A 4EXJA 1SU9A 4K8MA 5BMUA 2UZ8A 3G9BA 1XBSA 8GSSA 4L8EA 4N3ZA 1G7EA 5D9WA 4MP4A 5A4WA 1GTAA 3HHVA 5D9XA 4TOPA 1IYIA 4MZBA 5C00A 1SKRB 1BX9A 2LJRA 5CRHA 2A4HA 2VO4A 1U88A 5D9TA 3D0ZA 4TW5A 1URMA 1EZKA 2YJHA 2VKZG 1JZWA 1TI3A 2VCQA 1NM3A 2N5AA 4AKIA 2M80A 2H01A 2NTOA 4TXVA 2QSIA 5J41A 1LBKA 1X9SB 4ID0A 2H66A 1TK5B 3FR9A 2YPMA 4ZL8A 2LJKA 4CW9A 3FZAA 4AKXB 2C0GA 1YKAA 3VWWA 4FO5A 5IPGA 4V2MA 1WIKA 1N8JA 2ON7A 4O32A 1FVKA 3I6AA 4N10A 4EO3A 2GTUA 5IOWA 18GSA 1B4QA 3Q74A 1G0TA 1S3AA 5ECHB 3JCML 1GUHA 3RPNA 4KA0A 2B5YA 2GQMA 4WXTA 2YV7A 3IDVA 4NHWA 1ZOFA 5J40A 4YAPA 4Z2RA 3RHCA 4ZB9A 4PNFA 2O85A 3TJFA 2C0FA 2XPEA 2K8SA 5G31A 2PMTA 4D73A 1UC7A 1ZCPA 2LUSA 3VPTA 5J47A 4KH7A 4DVCA 4EIPA 4ZB7A 2OE0A 1T00A 3O6TA 3G7JA 1SKWB 2GZYA 1R7HA 3RAZA 7GSSA 4EDYA 1JLWA 2RM5A 3F3QA 1YJ6A 2YZHA 5DALB 2LSTA 2ALBA 3BD2A 3VLNA 3ZMLA 3N9JA 2H19A 3ERGA 1DSBA 3GX8A 2DJ0A 2K6VA 2L4QA 3F6DA 1H75A 2H1DA 3IHQA 1PKZA 4HS1A 5H5QA 5D8IA 3TKSE 3N5OA 3MAKA 4GDFA 3I43A 4P3YB 1EV4A 3HCZA 4KAEA 1A2MA 1QGVA 2V1MA 1Z7PA 3CSHA 1ZL9A 4DSQA 1TDIA 4CHSA 2CZ2A 17GSA 4WEYA 5B8AA 4RQXA 2I4AA 2B1KA 3KD0A 5ELGA 1EGRA 1U6TA 3WGEA 1K0MA 4ZBDA 2YV9A 5DALA 2DJ3A 3GURA 2E2MA 3GKMA 4PXOA 3KZQA 5E59A 3RHBA 3TRQA 5F05A 1FOVA 1ERVA 2KUCA 5CP1A 4KB3A 2LRNA 5D93A 2HSMA 2PGTA 2I81A 2MMZA 3HJMA 1TTZA 3TGZA 2PBJA 2HLSA 4HU7A 2VLTA 1UA5A 2GSSA 2K9FA 3LGCA 5A34A 1GTUA 3H1NA 3UVHA 4LL4B 2DJJA 1SENA 2YWNA 4AJ8A 4GF0A 3QAGA 3HVSA 3A2XA 1EGOA 3VPQA 1LU4A 3DVXA 3QMXA 2BJXA 2GSRA 5A5HB 2YNXA 2OBIA 1QMVA 3NZNA 1TJDA 4TKYA 3TJKA 4X0XA 2F8AA 2XPDA 4I5QA 4CDOA 4PQIA 5AGYA 3WT1A 5ECSA 2MMNA 1XWKA 3LYPA 3APOA 1AC1A 3SBCA 3UL3A 4IELA 4YAVA 1SKSB 2VCXA 3TKPA 2YWOA 5B7CA 3ZTLA 4Z2UA 1B4PA 1F9MA 4MCUA 1TRVA 2VL9A 1O8XA 2AAWA 4HZ4A 4IQAA 5J9CA 3GKXA 3QDNA 5J4VA 1XW5A 1O85A 3KH9A 4ULXA 4MJCA 13GSA 3FR6A 5F07A 2L59A 2FCHA 2IPAA 3FK8A 3TDGA 5GAPD 5A5HA 1FG4A 2HYXA 4JR6A 4KDUA 1FOHA 3IRAA 2YOIA 2GQLA 4G2EA 1ZZYA 1W4VA 3BCIA 4MH3A 3KGKA 1HNCA 1S3DA 2IWTA 4LA1A 5IMCA 3M9JA 1BG5A 2VL2A 4TR3A 1B9XC 3LXZA 1M9BA 2H72A 2OADA 1WWJA 4H86A 4K9ZA 3R3EA 2TRXA 5INYA 3D5JA 4PURA 1M99A 2C4JA 5JCUA 19GSA 4IGJA 2B5EA 1I9DA 3HZ4A 2IN3A 4L5OA 1PX7A 4LMWA 1JZOA 4DEJA 4N30A 1TU7A 3I9V2 1V2AA 3WGXA 3TOTA 5G30A 3C71A 1H4OA 1ZMAA 3LSZA 2X8CA 4I2UA 2YZUA 5D9VA 4YQUA 4EIQA 3GIXA 2MBSA 1R4WA 3E0UA 3KH7A 3A2WA 4K7OA 3TKRA 2WB9A 3EVIA 4I8BA 4I6XA 2H75A 4POLA 3K8NA 1EWXA 4ZXGA 2PN8A 4MPFA 3LWAA 1SYXA 1X5EA 5B8BA 4WF5A 1SK1A 3HDCA 1DE1A 1T1VA 1WJKA 1TOFA 1ZYEA 4EL1A 3DMLA 4X1UA 2C1YA 2JL4A 3VK9A 2O7KA 4GTUA 4N11A 1AQWA 1XVWA 1THXA 4RI7A 1GNEA 4GWRA 5E4WA 3TCOA 2CVBA 5ECRB 1QUWA 4G01A 1V40A 3TRXA 2FA8A 2PVQA 2DKIA 1M7TA 5B6MA 4YKFA 2NBSA 1QFNA 4HJ2A 3ZFLA 1PN9A 5DBQA 2OT3A 3RPPA 1GSSA 2PPTA 2X99A 2LKUA 3BCKA 4K7IA 4NAXA 4ICYA 3HY2A 5GSSA 2GDRA 2C0EA 2J9HA 3F4TA 2C80A 3GTUB 4GQFA 5CAXA 2AYTA 3MSZA 4IKHA 1A24A 5C04A 5A4UA 3RBTA 3UJ1A 3UEMA 3W8SA 3WGDA 1J0FA 5ABRA 1VGLA 1M0UA 1FHEA 4X43A 3DVWA 2DC5A 1THOA 2R37A 3MDKA 5IMVA 1VRSD 4EUYA 4NMUA 3P8WA 1X0RA 2HRKA 4TXOB 3UIWA 3FZ5A 5HR2A 2H8LA 1JHBA 2OE1A 1M2BA 4XTSA 2ON5A 2LJAA 2CX3A 4ZB8A 1J08A 1WE0A 1HQOA 1A0FA 1BJXA 3FZ4A 1HNBA 3EPTA 3FY7A 1B8XA 4MJAA 1SVLA 3CYNA 4MK3A 14GSA 1Z5YE 3ZL5A 3FYGA 4GLTA 3J7Yk 4RI6A 2DJ2A 2VCTA 5KOWA 2K18A 1EV9A 1Y6EA 2FWHA 5KEJA 1WMJA 3EU4A 3CTGA 3FRCA 5JCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIN A;  4KDX A;  4ML6 A;  4G9H A;  3LXT A;  2GGT A;  5KN2 A;  3TRP A;  2I9H A;  2ZUP A;  4LLR A;  1GLP A;  5ID2 A;  1QQ2 A;  1PL2 A;  4TXO A;  4PQH A;  2GT5 A;  4XIH A;  3TUE A;  2P0G A;  1EEM A;  2VM2 A;  3PH9 A;  1YY7 A;  5CNW A;  3ZRD A;  4DSR A;  1OE8 A;  4KE3 A;  3UAR A;  2NVL A;  1DBY A;  1NHO A;  4OFN A;  3UBK A;  4EF0 A;  1V98 A;  2RUE A;  1NSW A;  4MZW A;  3R2Q A;  1T4Z A;  4YQM A;  1PD2 1;  4BA7 A;  4FQU A;  4POB A;  5IO0 A;  5FT3 A;  1A8Y A;  1OKD A;  1ACV A;  2PUK C;  3P90 A;  2MMA A;  2C3T A;  3UVT A;  1GLQ A;  1KBN A;  1OKT A;  5ECM B;  5IMA A;  3UMA A;  2IMI A;  1AQX A;  1XZO A;  3ZIV A;  1PL1 A;  1YF0 A;  1JZD A;  2H6X A;  2RLI A;  3DGQ A;  1SYR A;  1VF4 A;  1M2A A;  1GSF A;  3LEF A;  1XXU A;  5ECO B;  2R3X A;  1ZYQ B;  4XHM A;  2FUG 2;  2H30 A;  5EL8 A;  2YWI A;  1X5D A;  2RM6 A;  2LNT A;  2R5G A;  3Q6O A;  3H8Q A;  4HQZ A;  1MDJ A;  4XRD A;  3TJB A;  1K3L A;  5COH A;  2YCD A;  2XBI A;  3GSS A;  1SK0 A;  3GKK A;  3GL3 A;  1F3B A;  2GS3 A;  4K0G A;  1AIU A;  3F0I A;  3V1W A;  2JSZ A;  5IPH A;  2NDO A;  3HVV A;  5LCZ A;  1XWB A;  3KTB A;  2LV3 A;  1GSY A;  5ECL B;  4ISD A;  5KN0 A;  4ZL9 A;  2N5B A;  1O8W A;  5HFI A;  1TP9 A;  1XWG A;  1DUG A;  2V6K A;  2FWF A;  4K6X A;  1TRU A;  2OKA A;  1K0N A;  3W6G A;  1U87 A;  4N0Z A;  1Q4J A;  4KDY A;  2VAF A;  5J4U A;  3HVX A;  5CRD A;  2MYG A;  2BMX A;  3CSI A;  3ZVJ A;  4QL9 A;  4IW9 A;  1FW1 A;  3KMN A;  1Z6M A;  3J7Y b;  4ML1 A;  4OMV A;  2QC7 A;  3F4R A;  4DSS B;  4OO4 A;  4JBB A;  2HSN B;  1C72 A;  2O8V B;  4HDE A;  5IOX A;  4BVX B;  9GSS A;  3NOF A;  1XW6 A;  4PNG A;  5DCH A;  1GUK A;  2GSQ A;  4ZB6 A;  1S3C A;  3EWL A;  1Y25 A;  3TJJ A;  2IMK A;  4IS0 A;  3C1R A;  5DVB A;  2L5O A;  2HNL A;  5A4V A;  3GUS A;  5KN1 A;  3WT2 A;  1OVN A;  1TRS A;  3UOM A;  3C1S A;  1MDK A;  3GX0 A;  1JFU A;  2CX4 A;  2GZP A;  3CRT A;  1E2Y A;  5L71 A;  3G7Y A;  3H79 A;  1OC3 A;  5ECK B;  1G6W A;  1ERU A;  2G0F A;  2B6M A;  5EVO A;  1Z6N A;  1FVJ A;  1R5P A;  1UN2 A;  2RUF A;  2AJQ B;  1EOH A;  1YF1 A;  4XCS A;  1XVQ A;  4FH8 A;  1ERT A;  1RK4 A;  4TR4 A;  4OD7 A;  4Q5R A;  4BVX A;  1X9W B;  4G0I A;  4PUF C;  4IBP A;  3TJG A;  1YZX A;  4K2D A;  4KCE A;  5CYY A;  4E8E A;  4Q5N A;  3GST A;  2JU5 A;  2CVK A;  1WOU A;  2E0Q A;  2QGV A;  2LS5 A;  3DKS A;  5GST A;  3EMX A;  2FY6 A;  3VI5 A;  1CQH A;  2GLR A;  3GH6 A;  1SD9 A;  2JSY A;  3HYP A;  5D96 A;  5HR0 A;  2GT6 A;  2VUP A;  4F2I A;  3GH9 A;  1GTI A;  2L57 A;  3F4S A;  1ERW A;  6GSY A;  4KUN A;  5AIX A;  2V32 A;  1K0D A;  3C8E A;  2ZCT A;  1X5C A;  4GSN A;  2OBK A;  5CRE A;  4HOJ A;  5GZZ B;  4MDC A;  1U3A A;  4V1A g;  3W8J A;  5IMD A;  5AIV A;  5G5E A;  1K0C A;  4YQV A;  2HRA A;  2FLS A;  5ECI B;  4NV2 A;  4MJE A;  3EU3 A;  2CA8 A;  2A2R A;  4MZC A;  4I97 A;  4XRA A;  1PRX A;  4IJ3 A;  11GS A;  3L78 A;  2HSY A;  2I1U A;  1FB0 A;  2DIY A;  3Q19 A;  3D4M A;  2FHE A;  3LOR A;  2KP2 A;  1SJZ A;  2WCI A;  3IC8 A;  1HD2 A;  3KM6 A;  4MLY A;  3GL5 A;  4G0K A;  3GKN A;  3M0F A;  2RII A;  3GFK A;  5CRW A;  3US3 A;  2PWJ A;  4JZQ A;  1N2A A;  1ILO A;  3HZ8 A;  2E7P A;  4WBR D;  4V2L A;  2MMO A;  1YEX A;  2IIY A;  3APQ A;  1I5G A;  2YP6 A;  3BJ5 A;  3HJO A;  2A2S A;  2C3N A;  4YH2 A;  1OAZ A;  4ZBA A;  4IP6 A;  2EIR A;  3KP9 A;  4POM A;  2AB6 A;  2G2Q A;  2VLU A;  3IR4 A;  1VF2 A;  2K8V A;  4ECJ A;  3QOU A;  2C8U A;  3FW2 A;  4IVF A;  2HRN A;  3F6F A;  3LQ7 A;  1R5A A;  2EIO A;  1PMT A;  2H6Y A;  5IMZ A;  1F3A A;  5HQP A;  3S9F A;  3ZIT A;  4HEA 2;  1T3B A;  1GSQ A;  1GSU A;  3L9S A;  4GQC A;  1XW9 A;  1XOA A;  3PPU A;  3IK9 A;  16GS A;  4MF7 A;  2P5Q A;  2B7K A;  4XS6 A;  4IP1 A;  3IA1 A;  4NPB A;  2B5X A;  1X9M B;  2DSA A;  2HT9 A;  3GRX A;  3E9J B;  2MBT A;  1BQ7 A;  1ON4 A;  3FZ9 A;  1TKD B;  2DJ1 A;  3QFA C;  3WD6 A;  5A5K A;  2DJK A;  4FYC A;  2DBC A;  4ZIL A;  1A2L A;  6GSX A;  3PGT A;  2IFQ B;  4G10 A;  4QL7 A;  4MH2 A;  5FHI A;  2QKE A;  1YKC A;  2E2G A;  3IXR A;  5CRG A;  3CBU A;  1QK8 A;  4O5R A;  5HR3 A;  1A0R P;  4KSO A;  3UBL A;  2CV4 A;  3KMO A;  5JWO B;  5DCG A;  2F9S A;  2HRF A;  3KXO A;  3ISO A;  2X8G A;  4PUA A;  1B9Y C;  3KIJ A;  1YQ1 A;  4NXI A;  2LEG A;  3LJR A;  1SJI A;  1GTB A;  1SD8 A;  4GST A;  4WF4 A;  1J9B A;  2TRC P;  4K7N A;  2PVO C;  5G1L A;  1O7U A;  3VUR A;  1KTE A;  4L0U A;  3GYK A;  3EC3 A;  2H1B A;  5ELA A;  2KLX A;  1TK8 B;  4HI7 A;  2LQQ A;  2TIR A;  1G7O A;  1A2J A;  2H0I A;  3MNG A;  3GTU A;  4FYU A;  1XPV A;  4BWQ A;  2LRC A;  2CQ9 A;  4ZL7 A;  4LMV A;  1GL8 A;  1AXD A;  3EUR A;  1GRX A;  3ERW A;  3CSJ A;  2PU9 C;  4XS1 A;  5DAK B;  4K1F A;  5FWG A;  2R6K A;  4KW6 A;  4MJB A;  4KSM A;  2XBQ A;  2IL3 A;  3DXB A;  5H5R A;  3TKS C;  3FKF A;  1ABA A;  4OCF A;  2CAI A;  2R2J A;  4USS A;  1OE7 A;  2WFC A;  3L9U A;  2DLX A;  2VIM A;  2VM1 A;  1TI1 A;  2HSH A;  1TRW A;  2V2G A;  1PA3 A;  1AUC A;  1TK0 B;  2YJ7 A;  2YWM A;  5ECN B;  3H93 A;  1WRY A;  3EMP A;  3TB2 A;  4OO5 A;  1MD4 A;  2AV4 A;  2DMM A;  3M3M A;  4D73 B;  2JZR A;  2JAC A;  1GP1 A;  4PGT A;  3H4K A;  2VCZ A;  3D6I A;  3QR6 A;  2J23 A;  1O81 A;  5DAK A;  5DQY A;  4EKZ A;  5IQY A;  3F8U A;  2HQT A;  2N5F A;  3WYW A;  2AUV A;  3D21 A;  6GSU A;  3HD5 A;  3DYR A;  1WP0 A;  1Z3E A;  5CO3 A;  10GS A;  4ECC A;  4OFM A;  1Z7R A;  1XOB A;  4N0V A;  3O3T A;  1UVZ A;  2DIZ A;  2O87 A;  2H0H A;  1NW2 A;  5B6N A;  3DD3 A;  2M72 A;  3IC4 A;  1PX6 A;  1EOG A;  1E6B A;  1XCC A;  5JWR B;  4G19 A;  2HE3 A;  2L4C A;  4MF6 A;  3IV4 A;  2ZNM A;  1YEP A;  4OFT A;  2XHF A;  4JED A;  3A3T A;  3QPM A;  3C73 A;  2OA7 A;  2HXK A;  3QAW A;  3ZRE A;  4F82 A;  4BVY B;  2VOC A;  2B1L A;  5J3R A;  1AW9 A;  4GXZ A;  3IK7 A;  2R4V A;  4V1A p;  1DE2 A;  2H76 A;  1AQV A;  4KF9 A;  4Q5F A;  5DDL A;  4POK A;  4AGS A;  2OAC A;  4IJI A;  3Q18 A;  4K0N A;  3GN3 A;  3L4N A;  5G1K A;  3IAM 2;  2YAN A;  5J9B A;  4HJM A;  4F0B A;  3FEU A;  2FD3 A;  3DEX A;  2KOK A;  4E8H A;  2H6Z A;  2FWE A;  1W89 A;  2HSM B;  1LJR A;  1SL1 B;  2L6C A;  1R26 A;  3VWX A;  4IHU A;  5ECQ B;  2LTK A;  4BL7 B;  3GNJ A;  2FA4 A;  2DML A;  4AJ7 A;  4PQ1 A;  3F3R A;  1HYU A;  4TR0 A;  1ST9 A;  3L9V A;  3PR8 A;  2OJL A;  4ECI A;  3E3E A;  4J57 E;  2WDU A;  4BVY A;  5EPF A;  1TW9 A;  5G2Z A;  3UAP A;  3U6V A;  3IOS A;  6GSW A;  5HR1 A;  5LNK e;  3I69 A;  1FO5 A;  1MD3 A;  1EEJ A;  5ECP B;  1XFL A;  4NV5 A;  22GS A;  3QD9 A;  3TOU A;  1PQN A;  5AIS A;  1Z9H A;  2WUL A;  3ZLP A;  1WPI A;  2ES7 A;  12GS A;  2HFD A;  1T8E B;  3VI7 A;  4HQS A;  2L6D A;  1PKW A;  4EC0 A;  1VF3 A;  4O7H A;  2FGX A;  3ZVJ D;  3A5W A;  5IO2 A;  4RQR A;  1O73 A;  1GUM A;  3EE2 A;  2KHP A;  2IMD A;  3QFB C;  4TR1 B;  4KX4 A;  4BL7 A;  1XIY A;  1T7P B;  3IE3 A;  2GST A;  5ENU A;  2P5R A;  4XS4 B;  1ZGN A;  4GCI A;  4PX1 A;  1MTC A;  6GSV A;  1B48 A;  2JAD A;  4ECB A;  3GMF A;  1V57 A;  1KNG A;  3VWU A;  5DQS A;  3KTL A;  4Z7X A;  3BBY A;  2M46 A;  2H74 A;  1U3I A;  1V58 A;  5HFK A;  4GSS A;  3A2V A;  2I3Y A;  3SWL A;  4L0W A;  2HZF A;  1XWC A;  1OC8 A;  3ZYW A;  4EVM A;  2CZ3 A;  1RW1 A;  4AF2 A;  5H5S A;  1PSQ A;  4WBJ A;  3GHA A;  4J2F A;  4EDZ A;  4DSS A;  4ZBB A;  2VLV A;  4FIW A;  2H73 A;  3TKQ A;  4V2N A;  1GWC A;  1BED A;  1M2D A;  3LYK A;  2V6O A;  3ME7 A;  3IAS 2;  4J56 E;  2C0D A;  1TU8 A;  1F2E A;  2H70 A;  5DJL A;  3D4T A;  2H1A A;  20GS A;  4TR1 A;  4JE1 A;  4PTS A;  3U5R E;  4GRF A;  1GNW A;  4XS4 A;  4TRX A;  4MF5 A;  4HUA A;  2OE3 A;  1GUL A;  4MPG A;  1M9A A;  1AAZ A;  4ZIJ A;  2CVD A;  5IIZ A;  3KCM A;  2H1G A;  4WR4 A;  2P31 A;  5D73 A;  5J5N A;  3F63 A;  3ERF A;  1QXH A;  2JZT A;  3ME8 A;  5KN3 A;  3IBH A;  3KEB A;  5GAN D;  1ML6 A;  3M9K A;  3ZMK A;  1CQG A;  1BAY A;  3EIN A;  2B3S A;  4BWS A;  5AN1 A;  2IJY A;  3P7X A;  4KCA A;  3OR5 A;  1JLV A;  3ZFB A;  1GSD A;  1EP7 A;  2HZE B;  3DWV A;  2PER A;  2CT6 A;  2GVP A;  3QCP A;  5JWQ B;  4F0C A;  3P2A A;  3ZZX A;  2CAQ A;  2VL3 A;  3CTF A;  2V41 A;  4L5L A;  3O76 A;  1OC9 B;  5F8B A;  4WET A;  2L5L A;  4G0L A;  1XWA A;  4NWY A;  4KGI A;  3QAV A;  1K3Y A;  1K3O A;  2LNS A;  2O89 A;  4ACS A;  1OYJ A;  2C3Q A;  1GH2 A;  2H0G A;  3L0H A;  1FB6 A;  4OWY A;  1A8L A;  2X8H A;  3GV1 A;  5EY6 A;  3EYT A;  5JCG A;  1SL2 B;  2F8F A;  4LL1 B;  1TXX A;  3CXG A;  4BPY A;  1O6J A;  3C7M A;  3RDW A;  2MZC A;  2HZE A;  4OCE A;  5LD0 A;  1G6Y A;  3HA9 A;  3G7I A;  3KP8 A;  2VD1 A;  1K0A A;  3FHK A;  4JRR A;  6GSS A;  1JZR A;  3KJY A;  4MMM A;  2WZ9 A;  2GZZ A;  3D22 A;  4F9Z A;  1T4Y A;  2A4V A;  4ILF A;  2F51 A;  2WRT A;  4HZ2 A;  1OC9 A;  1F6M C;  2H71 A;  3ED3 A;  4EE0 A;  1IYH A;  4QQ7 A;  1F37 A;  1YDK A;  2VCV A;  1SK2 A;  2F3M A;  3CRU A;  4HU9 A;  2EC4 A;  4I2T A;  5IMF A;  1KEB A;  4F03 A;  4JR4 A;  3MWH A;  2REM A;  1SL0 B;  4WR5 A;  3VFI A;  3TKS A;  1PGT A;  2LRT A;  3FR3 A;  2VCW A;  4O92 A;  3DIE A;  1K0B A;  2HI7 A;  6GST A;  2LQO A;  2VD0 A;  2KP1 A;  4TVE A;  2YN1 A;  4IN0 A;  4IQ1 A;  3GA4 A;  2IME A;  3HXS A;  2HRK B;  2VL2 C;  1EP8 A;  5G5F A;  3ZIJ A;  3APS A;  1MEK A;  4RUV A;  1NHY A;  2GQK A;  2X64 A;  1GSE A;  2WJU A;  1RQM A;  3BOA A;  3IPZ A;  1VF1 A;  3HJP A;  1SJ6 A;  2FNO A;  2B7J A;  2BTO T;  3VWV A;  4KND A;  4TN8 A;  5F06 A;  3NIV A;  1MDI A;  1V9W A;  3LG6 A;  2JZS A;  4NHZ A;  1K0O A;  2D2Z A;  3LFL A;  4AJ6 A;  3DRN A;  5F0G A;  1Q98 A;  3HKR A;  2Z9S A;  2WGR A;  2WS2 A;  1USB A;  3M1G A;  3F9U A;  1FAA A;  3CMI A;  2XC2 A;  5DJM A;  4Q5Q A;  5ID2 B;  2IFQ A;  2IMF A;  2AHE A;  4MAB A;  5HFG A;  2FWG A;  1BYE A;  4WKW A;  2NPB A;  2EIQ A;  3M8N A;  3AY8 A;  4MA9 A;  1HNA A;  1A23 A;  4FYB A;  5IM9 A;  4JU5 A;  4EXJ A;  1SU9 A;  4K8M A;  5BMU A;  2UZ8 A;  3G9B A;  1XBS A;  8GSS A;  4L8E A;  1G7E A;  5D9W A;  4MP4 A;  5A4W A;  1GTA A;  3HHV A;  5D9X A;  4TOP A;  1IYI A;  4MZB A;  5C00 A;  1SKR B;  1BX9 A;  2LJR A;  5CRH A;  2VO4 A;  1U88 A;  5D9T A;  3D0Z A;  4TW5 A;  1URM A;  1EZK A;  2YJH A;  1JZW A;  1TI3 A;  2VCQ A;  1NM3 A;  2N5A A;  2M80 A;  2H01 A;  2NTO A;  4TXV A;  2QSI A;  5J41 A;  1LBK A;  1X9S B;  4ID0 A;  2H66 A;  1TK5 B;  3FR9 A;  2YPM A;  4ZL8 A;  2LJK A;  4CW9 A;  3FZA A;  2C0G A;  1YKA A;  3VWW A;  4FO5 A;  5IPG A;  4V2M A;  1WIK A;  1N8J A;  2ON7 A;  4O32 A;  1FVK A;  3I6A A;  4N10 A;  4EO3 A;  2GTU A;  5IOW A;  18GS A;  1B4Q A;  3Q74 A;  1G0T A;  1S3A A;  5ECH B;  3JCM L;  1GUH A;  3RPN A;  4KA0 A;  2B5Y A;  2GQM A;  4WXT A;  2YV7 A;  3IDV A;  4NHW A;  1ZOF A;  4YAP A;  3RHC A;  4ZB9 A;  4PNF A;  2O85 A;  3TJF A;  2C0F A;  2XPE A;  2K8S A;  5G31 A;  2PMT A;  4D73 A;  1UC7 A;  1ZCP A;  2LUS A;  3VPT A;  4KH7 A;  4DVC A;  2OE0 A;  1T00 A;  3O6T A;  3G7J A;  1SKW B;  2GZY A;  1R7H A;  3RAZ A;  7GSS A;  4EDY A;  1JLW A;  2RM5 A;  3F3Q A;  1YJ6 A;  2YZH A;  5DAL B;  2LST A;  2ALB A;  3BD2 A;  3VLN A;  3ZML A;  3N9J A;  2H19 A;  3ERG A;  1DSB A;  3GX8 A;  2DJ0 A;  2K6V A;  2L4Q A;  3F6D A;  1H75 A;  2H1D A;  3IHQ A;  1PKZ A;  4HS1 A;  5H5Q A;  5D8I A;  3TKS E;  3N5O A;  3MAK A;  3I43 A;  4P3Y B;  1EV4 A;  3HCZ A;  4KAE A;  1A2M A;  1QGV A;  2V1M A;  1Z7P A;  3CSH A;  1ZL9 A;  4DSQ A;  1TDI A;  4CHS A;  2CZ2 A;  17GS A;  4WEY A;  5B8A A;  4RQX A;  2I4A A;  2B1K A;  3KD0 A;  5ELG A;  1EGR A;  1U6T A;  3WGE A;  1K0M A;  4ZBD A;  2YV9 A;  5DAL A;  2DJ3 A;  3GUR A;  2E2M A;  3GKM A;  4PXO A;  3KZQ A;  5E59 A;  3RHB A;  3TRQ A;  5F05 A;  1FOV A;  1ERV A;  2KUC A;  5CP1 A;  4KB3 A;  2LRN A;  5D93 A;  2HSM A;  2PGT A;  2I81 A;  2MMZ A;  3HJM A;  1TTZ A;  3TGZ A;  2PBJ A;  2HLS A;  4HU7 A;  2VLT A;  1UA5 A;  2GSS A;  2K9F A;  3LGC A;  1GTU A;  3H1N A;  3UVH A;  4LL4 B;  2DJJ A;  1SEN A;  2YWN A;  4AJ8 A;  4GF0 A;  3QAG A;  3HVS A;  3A2X A;  1EGO A;  3VPQ A;  1LU4 A;  3DVX A;  3QMX A;  2BJX A;  2GSR A;  2YNX A;  2OBI A;  1QMV A;  3NZN A;  1TJD A;  4TKY A;  3TJK A;  4X0X A;  2F8A A;  2XPD A;  4I5Q A;  4CDO A;  4PQI A;  5AGY A;  3WT1 A;  5ECS A;  2MMN A;  1XWK A;  3LYP A;  3APO A;  1AC1 A;  3SBC A;  3UL3 A;  4IEL A;  4YAV A;  1SKS B;  2VCX A;  3TKP A;  2YWO A;  5B7C A;  3ZTL A;  1B4P A;  1F9M A;  4MCU A;  1TRV A;  2VL9 A;  1O8X A;  2AAW A;  4HZ4 A;  4IQA A;  5J9C A;  3GKX A;  3QDN A;  1XW5 A;  1O85 A;  3KH9 A;  4ULX A;  4MJC A;  13GS A;  3FR6 A;  5F07 A;  2L59 A;  2FCH A;  2IPA A;  3FK8 A;  3TDG A;  5GAP D;  1FG4 A;  2HYX A;  4JR6 A;  4KDU A;  3IRA A;  2YOI A;  2GQL A;  4G2E A;  1ZZY A;  1W4V A;  3BCI A;  4MH3 A;  3KGK A;  1HNC A;  1S3D A;  2IWT A;  4LA1 A;  5IMC A;  3M9J A;  1BG5 A;  2VL2 A;  4TR3 A;  1B9X C;  3LXZ A;  1M9B A;  2H72 A;  2OAD A;  1WWJ A;  4H86 A;  4K9Z A;  3R3E A;  2TRX A;  5INY A;  3D5J A;  4PUR A;  1M99 A;  2C4J A;  5JCU A;  19GS A;  4IGJ A;  2B5E A;  1I9D A;  3HZ4 A;  2IN3 A;  4L5O A;  1PX7 A;  4LMW A;  1JZO A;  4DEJ A;  4N30 A;  1TU7 A;  3I9V 2;  1V2A A;  3WGX A;  3TOT A;  5G30 A;  3C71 A;  1H4O A;  1ZMA A;  3LSZ A;  2X8C A;  4I2U A;  2YZU A;  5D9V A;  4YQU A;  3GIX A;  2MBS A;  1R4W A;  3E0U A;  3KH7 A;  3A2W A;  4K7O A;  3TKR A;  2WB9 A;  3EVI A;  4I8B A;  4I6X A;  2H75 A;  4POL A;  3K8N A;  1EWX A;  4ZXG A;  2PN8 A;  4MPF A;  3LWA A;  1SYX A;  1X5E A;  5B8B A;  4WF5 A;  1SK1 A;  3HDC A;  1DE1 A;  1T1V A;  1WJK A;  1TOF A;  1ZYE A;  4EL1 A;  3DML A;  4X1U A;  2C1Y A;  2JL4 A;  3VK9 A;  2O7K A;  4GTU A;  4N11 A;  1AQW A;  1XVW A;  1THX A;  4RI7 A;  1GNE A;  4GWR A;  5E4W A;  3TCO A;  2CVB A;  5ECR B;  1QUW A;  1V40 A;  3TRX A;  2FA8 A;  2PVQ A;  1M7T A;  5B6M A;  2NBS A;  1QFN A;  4HJ2 A;  3ZFL A;  1PN9 A;  5DBQ A;  3RPP A;  1GSS A;  2PPT A;  2X99 A;  2LKU A;  3BCK A;  4K7I A;  4NAX A;  3HY2 A;  5GSS A;  2GDR A;  2C0E A;  2J9H A;  3F4T A;  2C80 A;  3GTU B;  4GQF A;  5CAX A;  2AYT A;  3MSZ A;  4IKH A;  1A24 A;  5C04 A;  5A4U A;  3RBT A;  3UJ1 A;  3UEM A;  3W8S A;  3WGD A;  1J0F A;  5ABR A;  1VGL A;  1M0U A;  1FHE A;  4X43 A;  3DVW A;  2DC5 A;  1THO A;  2R37 A;  3MDK A;  5IMV A;  1VRS D;  4EUY A;  4NMU A;  3P8W A;  1X0R A;  2HRK A;  4TXO B;  3UIW A;  3FZ5 A;  5HR2 A;  2H8L A;  1JHB A;  2OE1 A;  1M2B A;  4XTS A;  2ON5 A;  2LJA A;  2CX3 A;  4ZB8 A;  1J08 A;  1WE0 A;  1HQO A;  1A0F A;  1BJX A;  3FZ4 A;  1HNB A;  3FY7 A;  1B8X A;  4MJA A;  3CYN A;  4MK3 A;  14GS A;  1Z5Y E;  3ZL5 A;  3FYG A;  4GLT A;  3J7Y k;  4RI6 A;  2DJ2 A;  2VCT A;  2K18 A;  1EV9 A;  1Y6E A;  2FWH A;  5KEJ A;  1WMJ A;  3EU4 A;  3CTG A;  3FRC A;  5JCW A; 
#chains in the Genus database with same CATH topology
 3PIN A;  4KDX A;  4ML6 A;  4G9H A;  3LXT A;  2GGT A;  5KN2 A;  4YKG A;  3TRP A;  2I9H A;  2ZUP A;  4LLR A;  1GLP A;  5ID2 A;  1QQ2 A;  1PL2 A;  4TXO A;  4PQH A;  2GT5 A;  4XIH A;  3TUE A;  2P0G A;  4CY6 A;  1EEM A;  2VM2 A;  3PH9 A;  1YY7 A;  5CNW A;  3ZRD A;  2X4A A;  4DSR A;  1OE8 A;  4KE3 A;  3UAR A;  2NVL A;  1DBY A;  1NHO A;  4OFN A;  3UBK A;  4EF0 A;  1V98 A;  2RUE A;  1NSW A;  4MZW A;  3R2Q A;  1T4Z A;  4YQM A;  1PD2 1;  4BA7 A;  4FQU A;  4POB A;  5IO0 A;  5FT3 A;  1A8Y A;  1TXU A;  1OKD A;  1ACV A;  2PUK C;  3P90 A;  2MMA A;  2C3T A;  3UVT A;  1GLQ A;  1KBN A;  1OKT A;  5ECM B;  5IMA A;  3UMA A;  1YEW C;  1AQX A;  2IMI A;  1XZO A;  3ZIV A;  1PL1 A;  1YF0 A;  1JZD A;  1M3J A;  2H6X A;  2RLI A;  3DGQ A;  4PI2 C;  1SYR A;  1VF4 A;  1M2A A;  1GSF A;  3LEF A;  1XXU A;  5ECO B;  2R3X A;  1ZYQ B;  4XHM A;  2FUG 2;  2H30 A;  5EL8 A;  2YWI A;  1X5D A;  2RM6 A;  2LNT A;  2R5G A;  3Q6O A;  3H8Q A;  4HQZ A;  1MDJ A;  4XRD A;  1Y1U A;  3TJB A;  1K3L A;  5COH A;  2YCD A;  2XBI A;  3GSS A;  1SK0 A;  3GKK A;  4E68 A;  3GL3 A;  1F3B A;  2GS3 A;  4K0G A;  1AIU A;  3F0I A;  3V1W A;  2JSZ A;  2R0G A;  5IPH A;  2NDO A;  3HVV A;  5LCZ A;  4AKH A;  1XWB A;  3KTB A;  2LV3 A;  1GSY A;  5ECL B;  4ISD A;  5KN0 A;  4ZL9 A;  2N5B A;  1O8W A;  5HFI A;  1TP9 A;  1XWG A;  1PN0 A;  1DUG A;  2V6K A;  2FWF A;  4K6X A;  1TRU A;  2OKA A;  1K0N A;  3W6G A;  1U87 A;  4N0Z A;  1Q4J A;  4KDY A;  2VAF A;  5J4U A;  3HVX A;  5CRD A;  2MYG A;  2BMX A;  3CSI A;  3ZVJ A;  4QL9 A;  4MNN A;  2R0C A;  4IW9 A;  1FW1 A;  4K5S A;  3KMN A;  1Z6M A;  3J7Y b;  4ML1 A;  4OMV A;  2QC7 A;  3F4R A;  4DSS B;  4OO4 A;  4JBB A;  2HSN B;  1C72 A;  2O8V B;  4HDE A;  5IOX A;  4BVX B;  9GSS A;  3NOF A;  1XW6 A;  4PNG A;  5DCH A;  1GUK A;  2GSQ A;  4ZB6 A;  1S3C A;  3EWL A;  1Y25 A;  3TJJ A;  2IMK A;  4IS0 A;  3C1R A;  5DVB A;  2L5O A;  2HNL A;  5A4V A;  3GUS A;  5KN1 A;  4K5R A;  2EFD A;  3WT2 A;  1OVN A;  1TRS A;  3UOM A;  3C1S A;  1MDK A;  3GX0 A;  1JFU A;  2CX4 A;  2GZP A;  3CRT A;  1E2Y A;  5L71 A;  3G7Y A;  3H79 A;  1OC3 A;  5ECK B;  1G6W A;  1ERU A;  2G0F A;  2B6M A;  2X49 A;  5EVO A;  4BIK A;  1Z6N A;  1FVJ A;  1R5P A;  1UN2 A;  2RUF A;  2AJQ B;  1EOH A;  1YF1 A;  4XCS A;  1XVQ A;  2HSN A;  4FH8 A;  1ERT A;  1RK4 A;  4TR4 A;  4OD7 A;  4Q5R A;  4BVX A;  1X9W B;  4G0I A;  4PUF C;  4IBP A;  3TJG A;  1YZX A;  4K2D A;  2EFE A;  4KCE A;  5CYY A;  4E8E A;  3FMW A;  4Q5N A;  3GST A;  2JU5 A;  2CVK A;  1WOU A;  2E0Q A;  2QA2 A;  2QGV A;  2LS5 A;  3DKS A;  5GST A;  3EMX A;  2FY6 A;  3VI5 A;  1CQH A;  2GLR A;  3GH6 A;  3LW9 A;  1SD9 A;  2JSY A;  3HYP A;  5D96 A;  5HR0 A;  2GT6 A;  2VUP A;  4F2I A;  3GH9 A;  1GTI A;  2L57 A;  4O5U A;  3F4S A;  1ERW A;  6GSY A;  4KUN A;  5AIX A;  2V32 A;  1K0D A;  3C8E A;  2O36 A;  2ZCT A;  1X5C A;  4GSN A;  2OBK A;  5CRE A;  4HOJ A;  5GZZ B;  4MDC A;  1U3A A;  4V1A g;  3W8J A;  5IMD A;  5AIV A;  5G5E A;  1K0C A;  4YQV A;  2HRA A;  2FLS A;  4AKG A;  5ECI B;  4NV2 A;  4MJE A;  4QMK A;  3EU3 A;  2CA8 A;  2A2R A;  4MZC A;  4I97 A;  4XRA A;  1PRX A;  4IJ3 A;  11GS A;  3L78 A;  2HSY A;  2I1U A;  1FB0 A;  2DIY A;  3Q19 A;  3D4M A;  2FHE A;  3LOR A;  2KP2 A;  1SJZ A;  2WCI A;  3IC8 A;  1HD2 A;  4CY8 A;  3KM6 A;  4MLY A;  3GL5 A;  4G0K A;  3GKN A;  3M0F A;  2RII A;  3GFK A;  5CRW A;  3US3 A;  2PWJ A;  4JZQ A;  1N2A A;  1ILO A;  3HZ8 A;  2E7P A;  4WBR D;  4V2L A;  2MMO A;  1YEX A;  2IIY A;  3APQ A;  1I5G A;  2YP6 A;  3BJ5 A;  3HJO A;  2A2S A;  2C3N A;  4YH2 A;  1OAZ A;  4ZBA A;  4IP6 A;  2EIR A;  3KP9 A;  2WVY A;  4POM A;  2AB6 A;  2G2Q A;  2VLU A;  3IR4 A;  1VF2 A;  2K8V A;  4ECJ A;  3QOU A;  2C8U A;  3FW2 A;  4IVF A;  2HRN A;  3F6F A;  3LQ7 A;  1R5A A;  2EIO A;  1PMT A;  2H6Y A;  5IMZ A;  1F3A A;  5HQP A;  3S9F A;  3ZIT A;  4HEA 2;  1T3B A;  1GSQ A;  1GSU A;  3L9S A;  4GQC A;  1XW9 A;  3RGB C;  1XOA A;  3PPU A;  3IK9 A;  16GS A;  4MF7 A;  2P5Q A;  2B7K A;  4XS6 A;  4IP1 A;  3IA1 A;  4NPB A;  2B5X A;  1X9M B;  2DSA A;  2HT9 A;  3GRX A;  3E9J B;  2MBT A;  1BQ7 A;  1ON4 A;  3FZ9 A;  1TKD B;  2DJ1 A;  3QFA C;  3WD6 A;  5A5K A;  2DJK A;  3A5I A;  4FYC A;  2DBC A;  4ZIL A;  1A2L A;  6GSX A;  3PGT A;  2IFQ B;  4G10 A;  4QL7 A;  1S3R A;  4MH2 A;  5FHI A;  4PHZ C;  2QKE A;  1YKC A;  2E2G A;  3IXR A;  5CRG A;  3CBU A;  1QK8 A;  4O5R A;  5HR3 A;  1A0R P;  4KSO A;  3UBL A;  2CV4 A;  3KMO A;  5JWO B;  5DCG A;  2F9S A;  2HRF A;  3KXO A;  5BRT A;  3ISO A;  2X8G A;  4PUA A;  1SVO A;  4W66 A;  1B9Y C;  3KIJ A;  1YQ1 A;  4NXI A;  2LEG A;  3LJR A;  1SJI A;  1GTB A;  1SD8 A;  4GST A;  4WF4 A;  1J9B A;  2TRC P;  1I1I P;  4K7N A;  2PVO C;  5G1L A;  1O7U A;  3VUR A;  1KTE A;  4L0U A;  3GYK A;  3EC3 A;  2H1B A;  5ELA A;  2KLX A;  1TK8 B;  4HI7 A;  2LQQ A;  2TIR A;  1G7O A;  1A2J A;  2H0I A;  3MNG A;  3GTU A;  4FYU A;  1XPV A;  2QA1 A;  4BWQ A;  2LRC A;  2CQ9 A;  4ZL7 A;  4LMV A;  1GL8 A;  1AXD A;  3EUR A;  1GRX A;  3ERW A;  3CSJ A;  2PU9 C;  4XS1 A;  5DAK B;  4K1F A;  5FWG A;  2R6K A;  4KW6 A;  4MJB A;  4KSM A;  2XBQ A;  3IHG A;  2IL3 A;  3DXB A;  5H5R A;  3TKS C;  3FKF A;  1ABA A;  4OCF A;  2CAI A;  2R2J A;  4USS A;  1OE7 A;  2WFC A;  3L9U A;  2DLX A;  2VIM A;  5J4Y A;  2VM1 A;  1TI1 A;  2HSH A;  1TRW A;  2V2G A;  1PA3 A;  1AUC A;  1TK0 B;  2YJ7 A;  2YWM A;  5ECN B;  3H93 A;  1WRY A;  3EMP A;  3TB2 A;  4OO5 A;  1MD4 A;  2AV4 A;  2DMM A;  3M3M A;  4D73 B;  2JZR A;  2JAC A;  1GP1 A;  4PGT A;  3H4K A;  2VCZ A;  3D6I A;  3QR6 A;  2J23 A;  1O81 A;  5DAK A;  5DQY A;  4EKZ A;  4O5Q A;  5IQY A;  3F8U A;  1PFO A;  2HQT A;  2N5F A;  3WYW A;  2AUV A;  3D21 A;  6GSU A;  3HD5 A;  3DYR A;  1WP0 A;  1Z3E A;  5CO3 A;  10GS A;  4ECC A;  4OFM A;  2O5V A;  1Z7R A;  1XOB A;  4N0V A;  3O3T A;  1UVZ A;  2DIZ A;  2O87 A;  2H0H A;  1NW2 A;  5B6N A;  3DD3 A;  2M72 A;  3IC4 A;  2O3E A;  1PX6 A;  1EOG A;  1E6B A;  1XCC A;  5JWR B;  4G19 A;  2HE3 A;  2L4C A;  4MF6 A;  3IV4 A;  2ZNM A;  1YEP A;  4OFT A;  2XHF A;  4JED A;  3A3T A;  3QPM A;  3C73 A;  2OA7 A;  2HXK A;  3QAW A;  3ZRE A;  4F82 A;  4BVY B;  2VOC A;  2B1L A;  5J3R A;  1AW9 A;  4GXZ A;  3IK7 A;  2R4V A;  4V1A p;  1DE2 A;  2H76 A;  1AQV A;  4KF9 A;  4Q5F A;  5DDL A;  4POK A;  2WW2 A;  4AGS A;  2OAC A;  4IJI A;  3Q18 A;  4K0N A;  3GN3 A;  3L4N A;  5G1K A;  3IAM 2;  2YAN A;  5J9B A;  4HJM A;  4F0B A;  3FEU A;  2FD3 A;  3DEX A;  2KOK A;  4E8H A;  2H6Z A;  2FWE A;  1W89 A;  2HSM B;  1LJR A;  1SL1 B;  2L6C A;  1R26 A;  3VWX A;  4IHU A;  4HSC X;  5ECQ B;  2LTK A;  4BL7 B;  3GNJ A;  2FA4 A;  2DML A;  4AJ7 A;  2EFH A;  4PQ1 A;  3F3R A;  1HYU A;  4TR0 A;  1ST9 A;  3L9V A;  3PR8 A;  2OJL A;  4ECI A;  3E3E A;  4J57 E;  5A34 B;  2WDU A;  4BVY A;  5EPF A;  1TW9 A;  5G2Z A;  3UAP A;  3U6V A;  3IOS A;  6GSW A;  5HR1 A;  5LNK e;  3I69 A;  1FO5 A;  1MD3 A;  1EEJ A;  5ECP B;  1XFL A;  4Z2T A;  4NV5 A;  2H1L A;  22GS A;  3QD9 A;  3TOU A;  1PQN A;  5AIS A;  1Z9H A;  2WUL A;  3ZLP A;  1WPI A;  1XG8 A;  2ES7 A;  12GS A;  2HFD A;  1T8E B;  4X4J A;  3VI7 A;  4HQS A;  2L6D A;  1PKW A;  4EC0 A;  1VF3 A;  4O7H A;  2FGX A;  3ZVJ D;  3A5W A;  5IO2 A;  4RQR A;  1O73 A;  1GUM A;  3EE2 A;  2KHP A;  2IMD A;  3QFB C;  4TR1 B;  4KX4 A;  4BL7 A;  1XIY A;  1T7P B;  3IE3 A;  2GST A;  5ENU A;  2P5R A;  4XS4 B;  1ZGN A;  4GCI A;  4PX1 A;  1MTC A;  6GSV A;  2A2P A;  1B48 A;  1ZYN A;  2JAD A;  4ECB A;  3GMF A;  1V57 A;  1KNG A;  3VWU A;  5DQS A;  3KTL A;  4Z7X A;  3BBY A;  2M46 A;  2H74 A;  1U3I A;  1V58 A;  5HFK A;  4GSS A;  3A2V A;  2I3Y A;  3SWL A;  4L0W A;  2HZF A;  1XWC A;  1OC8 A;  3ZYW A;  4EVM A;  2CZ3 A;  1RW1 A;  4AF2 A;  5H5S A;  1PSQ A;  4WBJ A;  3GHA A;  4J2F A;  4EDZ A;  4DSS A;  4ZBB A;  2UV8 G;  2VLV A;  4FIW A;  2H73 A;  3TKQ A;  4V2N A;  4FXY P;  1GWC A;  1BED A;  1M2D A;  3LYK A;  2V6O A;  3ME7 A;  3IAS 2;  4J56 E;  2C0D A;  1TU8 A;  1F2E A;  2H70 A;  5DJL A;  3D4T A;  2H1A A;  3MYD A;  20GS A;  4TR1 A;  4JE1 A;  4PTS A;  3U5R E;  4GRF A;  1SVM A;  1GNW A;  4XS4 A;  4TRX A;  4MF5 A;  4HUA A;  2OE3 A;  1GUL A;  4MPG A;  1M9A A;  2EFC A;  1AAZ A;  4ZIJ A;  2CVD A;  5IIZ A;  3KCM A;  2H1G A;  3CWG A;  4WR4 A;  2P31 A;  5D73 A;  5J5N A;  3F63 A;  3ERF A;  1QXH A;  2JZT A;  3ME8 A;  5KN3 A;  3IBH A;  3KEB A;  5GAN D;  1ML6 A;  3M9K A;  3ZMK A;  1CQG A;  1BAY A;  3EIN A;  2B3S A;  4BWS A;  5AN1 A;  2IJY A;  3P7X A;  4KCA A;  3OR5 A;  1JLV A;  3ZFB A;  1GSD A;  1EP7 A;  2HZE B;  3DWV A;  2PER A;  2CT6 A;  2GVP A;  3QCP A;  5JWQ B;  4F0C A;  3P2A A;  3ZZX A;  1BG1 A;  3MIX A;  2CAQ A;  2VL3 A;  3CTF A;  2V41 A;  4L5L A;  3O76 A;  1OC9 B;  5F8B A;  4WET A;  2L5L A;  4G0L A;  1XWA A;  4NWY A;  4KGI A;  3QAV A;  1K3Y A;  1K3O A;  2LNS A;  2O89 A;  4ACS A;  1OYJ A;  2C3Q A;  1GH2 A;  2H0G A;  3L0H A;  1FB6 A;  4OWY A;  1A8L A;  2X8H A;  3GV1 A;  5EY6 A;  3EYT A;  5JCG A;  5KOX A;  1SL2 B;  2F8F A;  4LL1 B;  1TXX A;  3CXG A;  4BPY A;  1O6J A;  3C7M A;  3RDW A;  2MZC A;  2HZE A;  4OCE A;  5LD0 A;  1G6Y A;  3HA9 A;  1BF5 A;  3G7I A;  3KP8 A;  2VD1 A;  1K0A A;  3FHK A;  4JRR A;  6GSS A;  1JZR A;  3KJY A;  4A5P A;  4MMM A;  5A1N B;  2WZ9 A;  2GZZ A;  3D22 A;  4F9Z A;  1T4Y A;  2A4V A;  4ILF A;  2F51 A;  2WRT A;  4HZ2 A;  1OC9 A;  2WW1 A;  1F6M C;  1N25 A;  2H71 A;  3HMJ G;  3ED3 A;  3TU3 B;  4EE0 A;  4K2X A;  1IYH A;  4QQ7 A;  1F37 A;  1YDK A;  2VCV A;  1SK2 A;  2F3M A;  3CRU A;  4HU9 A;  2EC4 A;  4I2T A;  5IMF A;  1KEB A;  4F03 A;  4JR4 A;  3MWH A;  2REM A;  1SL0 B;  4WR5 A;  2R0P A;  3VFI A;  3TKS A;  1PGT A;  2LRT A;  3FR3 A;  2VCW A;  4O92 A;  3DIE A;  1K0B A;  2HI7 A;  6GST A;  2LQO A;  2VD0 A;  2KP1 A;  4TVE A;  2YN1 A;  4IN0 A;  4IQ1 A;  3GA4 A;  2IME A;  3HXS A;  5A1N A;  2HRK B;  2VL2 C;  1EP8 A;  5G5F A;  3ZIJ A;  3APS A;  1ZYP A;  1MEK A;  4RUV A;  1NHY A;  2GQK A;  2X64 A;  1GSE A;  2WJU A;  2WVX B;  1RQM A;  2WW3 A;  3BOA A;  3IPZ A;  1VF1 A;  3HJP A;  1SJ6 A;  2FNO A;  2B7J A;  2BTO T;  3VWV A;  4KND A;  5BMU B;  4AI6 A;  4TN8 A;  5F06 A;  3NIV A;  1YVL A;  1MDI A;  1V9W A;  3LG6 A;  2JZS A;  4NHZ A;  1K0O A;  2D2Z A;  3LFL A;  4AJ6 A;  3DRN A;  5F0G A;  1Q98 A;  3HKR A;  2Z9S A;  2WGR A;  2WS2 A;  1USB A;  3M1G A;  3F9U A;  1FAA A;  3CMI A;  2XC2 A;  5DJM A;  4Q5Q A;  5ID2 B;  2IFQ A;  2IMF A;  2AHE A;  4MAB A;  5HFG A;  2FWG A;  2DKH A;  1BYE A;  4WKW A;  2NPB A;  2EIQ A;  3M8N A;  2WVX A;  3AY8 A;  4MA9 A;  1HNA A;  1A23 A;  4FYB A;  5IM9 A;  4JU5 A;  4EXJ A;  1SU9 A;  4K8M A;  5BMU A;  2UZ8 A;  3G9B A;  1XBS A;  8GSS A;  4L8E A;  4N3Z A;  1G7E A;  5D9W A;  4MP4 A;  5A4W A;  1GTA A;  3HHV A;  5D9X A;  4TOP A;  1IYI A;  4MZB A;  3CQF A;  5C00 A;  1SKR B;  1BX9 A;  2LJR A;  5CRH A;  2A4H A;  2VO4 A;  1U88 A;  5D9T A;  3D0Z A;  4TW5 A;  1URM A;  1EZK A;  2YJH A;  2VKZ G;  1JZW A;  1TI3 A;  3HVN A;  2VCQ A;  1NM3 A;  2N5A A;  4AKI A;  2M80 A;  2H01 A;  2NTO A;  4TXV A;  2QSI A;  5J41 A;  1LBK A;  1X9S B;  4ID0 A;  2H66 A;  1TK5 B;  3FR9 A;  2YPM A;  4ZL8 A;  2LJK A;  4CW9 A;  3FZA A;  4AKX B;  2C0G A;  1YKA A;  3VWW A;  4FO5 A;  5IPG A;  4V2M A;  1WIK A;  1N8J A;  2ON7 A;  4O32 A;  1FVK A;  3I6A A;  4N10 A;  4EO3 A;  2GTU A;  5IOW A;  18GS A;  1B4Q A;  3Q74 A;  1G0T A;  1S3A A;  5ECH B;  3JCM L;  1GUH A;  3RPN A;  4KA0 A;  2B5Y A;  2GQM A;  4WXT A;  2YV7 A;  3IDV A;  4NHW A;  1ZOF A;  5J40 A;  4YAP A;  4Z2R A;  3RHC A;  4ZB9 A;  4PNF A;  2O85 A;  3TJF A;  2C0F A;  2XPE A;  2K8S A;  5G31 A;  2PMT A;  4D73 A;  1UC7 A;  1ZCP A;  2LUS A;  3VPT A;  5J47 A;  4KH7 A;  4DVC A;  4EIP A;  4ZB7 A;  2OE0 A;  1T00 A;  3O6T A;  1M3I A;  3G7J A;  2WW0 A;  1SKW B;  2GZY A;  1R7H A;  3RAZ A;  7GSS A;  4EDY A;  1JLW A;  2RM5 A;  3F3Q A;  1YJ6 A;  2YZH A;  5DAL B;  2LST A;  2ALB A;  3BD2 A;  3VLN A;  3ZML A;  3N9J A;  2H19 A;  3ERG A;  1DSB A;  3GX8 A;  2DJ0 A;  2K6V A;  2L4Q A;  3F6D A;  1H75 A;  2H1D A;  3IHQ A;  1PKZ A;  4HS1 A;  5H5Q A;  5D8I A;  3TKS E;  2WVZ A;  3N5O A;  3MAK A;  4GDF A;  3I43 A;  4P3Y B;  1EV4 A;  3HCZ A;  4KAE A;  1A2M A;  1QGV A;  2V1M A;  1Z7P A;  3CSH A;  1ZL9 A;  4DSQ A;  1TDI A;  4CHS A;  2CZ2 A;  17GS A;  4WEY A;  5B8A A;  4RQX A;  2I4A A;  2B1K A;  3KD0 A;  5ELG A;  1EGR A;  1U6T A;  3WGE A;  1K0M A;  4ZBD A;  2YV9 A;  5DAL A;  2DJ3 A;  3GUR A;  2E2M A;  3GKM A;  4PXO A;  3KZQ A;  5E59 A;  3RHB A;  3TRQ A;  5F05 A;  1FOV A;  1ERV A;  2KUC A;  5CP1 A;  4KB3 A;  2LRN A;  5D93 A;  2HSM A;  2PGT A;  2I81 A;  2MMZ A;  3HJM A;  1TTZ A;  3TGZ A;  2PBJ A;  2HLS A;  4HU7 A;  2VLT A;  1UA5 A;  2GSS A;  2K9F A;  3LGC A;  5A34 A;  1GTU A;  3H1N A;  3UVH A;  4LL4 B;  2DJJ A;  1SEN A;  2YWN A;  4AJ8 A;  4GF0 A;  3QAG A;  3HVS A;  3A2X A;  1EGO A;  3VPQ A;  1LU4 A;  3DVX A;  3QMX A;  2BJX A;  2GSR A;  5A5H B;  2YNX A;  2OBI A;  1QMV A;  3NZN A;  1TJD A;  4TKY A;  3TJK A;  4X0X A;  2F8A A;  2XPD A;  4I5Q A;  4CDO A;  4PQI A;  5AGY A;  3WT1 A;  5ECS A;  2MMN A;  1XWK A;  3LYP A;  3APO A;  1AC1 A;  3SBC A;  3UL3 A;  4IEL A;  4YAV A;  1SKS B;  2VCX A;  3TKP A;  2YWO A;  5B7C A;  3ZTL A;  4Z2U A;  1B4P A;  1F9M A;  4MCU A;  1TRV A;  2VL9 A;  1O8X A;  2AAW A;  4HZ4 A;  4IQA A;  5J9C A;  3GKX A;  3QDN A;  5J4V A;  1XW5 A;  1O85 A;  3KH9 A;  4ULX A;  4MJC A;  13GS A;  3FR6 A;  5F07 A;  2L59 A;  2FCH A;  2IPA A;  3FK8 A;  3TDG A;  5GAP D;  5A5H A;  1FG4 A;  2HYX A;  4JR6 A;  4KDU A;  1FOH A;  3IRA A;  2YOI A;  2GQL A;  4G2E A;  1ZZY A;  1W4V A;  3BCI A;  4MH3 A;  3KGK A;  1HNC A;  1S3D A;  2IWT A;  4LA1 A;  5IMC A;  3M9J A;  1BG5 A;  2VL2 A;  4TR3 A;  1B9X C;  3LXZ A;  1M9B A;  2H72 A;  2OAD A;  1WWJ A;  4H86 A;  4K9Z A;  3R3E A;  2TRX A;  5INY A;  3D5J A;  4PUR A;  1M99 A;  2C4J A;  5JCU A;  19GS A;  4IGJ A;  2B5E A;  1I9D A;  3HZ4 A;  2IN3 A;  4L5O A;  1PX7 A;  4LMW A;  1JZO A;  4DEJ A;  4N30 A;  1TU7 A;  3I9V 2;  1V2A A;  3WGX A;  3TOT A;  5G30 A;  3C71 A;  1H4O A;  1ZMA A;  3LSZ A;  2X8C A;  4I2U A;  2YZU A;  5D9V A;  4YQU A;  4EIQ A;  3GIX A;  2MBS A;  1R4W A;  3E0U A;  3KH7 A;  3A2W A;  4K7O A;  3TKR A;  2WB9 A;  3EVI A;  4I8B A;  4I6X A;  2H75 A;  3RFR C;  4POL A;  4PI0 C;  3K8N A;  1EWX A;  4ZXG A;  2PN8 A;  4MPF A;  3LWA A;  1SYX A;  1X5E A;  5B8B A;  4WF5 A;  1SK1 A;  3HDC A;  1DE1 A;  1T1V A;  1WJK A;  1TOF A;  1ZYE A;  4EL1 A;  3DML A;  4X1U A;  2C1Y A;  2JL4 A;  3VK9 A;  2O7K A;  4GTU A;  4N11 A;  1AQW A;  1XVW A;  1THX A;  4RI7 A;  1GNE A;  4GWR A;  5E4W A;  3TCO A;  2CVB A;  5ECR B;  1QUW A;  4G01 A;  1V40 A;  3TRX A;  2FA8 A;  2PVQ A;  2DKI A;  1M7T A;  5B6M A;  4YKF A;  2NBS A;  1QFN A;  4HJ2 A;  3ZFL A;  1PN9 A;  5DBQ A;  2OT3 A;  3RPP A;  1GSS A;  2PPT A;  2X99 A;  2LKU A;  3BCK A;  3CHX C;  4K7I A;  4NAX A;  4ICY A;  3HY2 A;  5GSS A;  2GDR A;  2C0E A;  2J9H A;  3F4T A;  2C80 A;  3GTU B;  4GQF A;  5CAX A;  2AYT A;  3MSZ A;  4IKH A;  1A24 A;  5C04 A;  5A4U A;  3RBT A;  3UJ1 A;  3UEM A;  3W8S A;  3WGD A;  1J0F A;  5ABR A;  1VGL A;  1M0U A;  1FHE A;  4X43 A;  3DVW A;  2DC5 A;  1THO A;  2R37 A;  3MDK A;  5IMV A;  1VRS D;  4EUY A;  4NMU A;  3P8W A;  1X0R A;  2HRK A;  4TXO B;  3UIW A;  3FZ5 A;  5HR2 A;  2H8L A;  1JHB A;  2OE1 A;  1M2B A;  4XTS A;  1S4B P;  2ON5 A;  2LJA A;  2CX3 A;  4ZB8 A;  1J08 A;  1WE0 A;  2WZS A;  1HQO A;  1A0F A;  1BJX A;  3FZ4 A;  1HNB A;  3EPT A;  3FY7 A;  1B8X A;  4MJA A;  1SVL A;  3CYN A;  4MK3 A;  14GS A;  1Z5Y E;  3ZL5 A;  3FYG A;  4GLT A;  3J7Y k;  4RI6 A;  2DJ2 A;  2VCT A;  5KOW A;  2K18 A;  1EV9 A;  1Y6E A;  2FWH A;  5KEJ A;  1WMJ A;  3EU4 A;  3CTG A;  3FRC A;  5JCW A; 
#chains in the Genus database with same CATH homology
 3PIN A;  4KDX A;  4ML6 A;  4G9H A;  3LXT A;  2GGT A;  5KN2 A;  4YKG A;  3TRP A;  2I9H A;  2ZUP A;  4LLR A;  1GLP A;  5ID2 A;  1QQ2 A;  1PL2 A;  4TXO A;  4PQH A;  2GT5 A;  4XIH A;  3TUE A;  2P0G A;  4CY6 A;  1EEM A;  2VM2 A;  3PH9 A;  1YY7 A;  5CNW A;  3ZRD A;  2X4A A;  4DSR A;  1OE8 A;  4KE3 A;  3UAR A;  2NVL A;  1DBY A;  1NHO A;  4OFN A;  3UBK A;  4EF0 A;  1V98 A;  2RUE A;  1NSW A;  4MZW A;  3R2Q A;  1T4Z A;  4YQM A;  1PD2 1;  4BA7 A;  4FQU A;  4POB A;  5IO0 A;  5FT3 A;  1A8Y A;  1TXU A;  1OKD A;  1ACV A;  2PUK C;  3P90 A;  2MMA A;  2C3T A;  3UVT A;  1GLQ A;  1KBN A;  1OKT A;  5ECM B;  5IMA A;  3UMA A;  2IMI A;  1AQX A;  1XZO A;  3ZIV A;  1PL1 A;  1YF0 A;  1JZD A;  2H6X A;  2RLI A;  3DGQ A;  1SYR A;  1VF4 A;  1M2A A;  1GSF A;  3LEF A;  1XXU A;  5ECO B;  2R3X A;  1ZYQ B;  4XHM A;  2FUG 2;  2H30 A;  5EL8 A;  2YWI A;  1X5D A;  2RM6 A;  2LNT A;  2R5G A;  3Q6O A;  3H8Q A;  4HQZ A;  1MDJ A;  4XRD A;  1Y1U A;  3TJB A;  1K3L A;  5COH A;  2YCD A;  2XBI A;  3GSS A;  1SK0 A;  3GKK A;  4E68 A;  3GL3 A;  1F3B A;  2GS3 A;  4K0G A;  1AIU A;  3F0I A;  3V1W A;  2JSZ A;  2R0G A;  5IPH A;  2NDO A;  3HVV A;  5LCZ A;  4AKH A;  1XWB A;  3KTB A;  2LV3 A;  1GSY A;  5ECL B;  4ISD A;  5KN0 A;  4ZL9 A;  2N5B A;  1O8W A;  5HFI A;  1TP9 A;  1XWG A;  1PN0 A;  1DUG A;  2V6K A;  2FWF A;  4K6X A;  1TRU A;  2OKA A;  1K0N A;  3W6G A;  1U87 A;  4N0Z A;  1Q4J A;  4KDY A;  2VAF A;  5J4U A;  3HVX A;  5CRD A;  2MYG A;  2BMX A;  3CSI A;  3ZVJ A;  4QL9 A;  4MNN A;  2R0C A;  4IW9 A;  1FW1 A;  4K5S A;  3KMN A;  1Z6M A;  3J7Y b;  4ML1 A;  4OMV A;  2QC7 A;  3F4R A;  4DSS B;  4OO4 A;  4JBB A;  2HSN B;  1C72 A;  2O8V B;  4HDE A;  5IOX A;  4BVX B;  9GSS A;  3NOF A;  1XW6 A;  4PNG A;  5DCH A;  1GUK A;  2GSQ A;  4ZB6 A;  1S3C A;  3EWL A;  1Y25 A;  3TJJ A;  2IMK A;  4IS0 A;  3C1R A;  5DVB A;  2L5O A;  2HNL A;  5A4V A;  3GUS A;  5KN1 A;  4K5R A;  2EFD A;  3WT2 A;  1OVN A;  1TRS A;  3UOM A;  3C1S A;  1MDK A;  3GX0 A;  1JFU A;  2CX4 A;  2GZP A;  3CRT A;  1E2Y A;  5L71 A;  3G7Y A;  3H79 A;  1OC3 A;  5ECK B;  1G6W A;  1ERU A;  2G0F A;  2B6M A;  2X49 A;  5EVO A;  1Z6N A;  1FVJ A;  1R5P A;  1UN2 A;  2RUF A;  2AJQ B;  1EOH A;  1YF1 A;  4XCS A;  1XVQ A;  2HSN A;  4FH8 A;  1ERT A;  1RK4 A;  4TR4 A;  4OD7 A;  4Q5R A;  4BVX A;  1X9W B;  4G0I A;  4PUF C;  4IBP A;  3TJG A;  1YZX A;  4K2D A;  2EFE A;  4KCE A;  5CYY A;  4E8E A;  3FMW A;  4Q5N A;  3GST A;  2JU5 A;  2CVK A;  1WOU A;  2E0Q A;  2QA2 A;  2QGV A;  2LS5 A;  3DKS A;  5GST A;  3EMX A;  2FY6 A;  3VI5 A;  1CQH A;  2GLR A;  3GH6 A;  3LW9 A;  1SD9 A;  2JSY A;  3HYP A;  5D96 A;  5HR0 A;  2GT6 A;  2VUP A;  4F2I A;  3GH9 A;  1GTI A;  2L57 A;  4O5U A;  3F4S A;  1ERW A;  6GSY A;  4KUN A;  5AIX A;  2V32 A;  1K0D A;  3C8E A;  2ZCT A;  1X5C A;  4GSN A;  2OBK A;  5CRE A;  4HOJ A;  5GZZ B;  4MDC A;  1U3A A;  4V1A g;  3W8J A;  5IMD A;  5AIV A;  5G5E A;  1K0C A;  4YQV A;  2HRA A;  2FLS A;  4AKG A;  5ECI B;  4NV2 A;  4MJE A;  4QMK A;  3EU3 A;  2CA8 A;  2A2R A;  4MZC A;  4I97 A;  4XRA A;  1PRX A;  4IJ3 A;  11GS A;  3L78 A;  2HSY A;  2I1U A;  1FB0 A;  2DIY A;  3Q19 A;  3D4M A;  2FHE A;  3LOR A;  2KP2 A;  1SJZ A;  2WCI A;  3IC8 A;  1HD2 A;  4CY8 A;  3KM6 A;  4MLY A;  3GL5 A;  4G0K A;  3GKN A;  3M0F A;  2RII A;  3GFK A;  5CRW A;  3US3 A;  2PWJ A;  4JZQ A;  1N2A A;  1ILO A;  3HZ8 A;  2E7P A;  4WBR D;  4V2L A;  2MMO A;  1YEX A;  2IIY A;  3APQ A;  1I5G A;  2YP6 A;  3BJ5 A;  3HJO A;  2A2S A;  2C3N A;  4YH2 A;  1OAZ A;  4ZBA A;  4IP6 A;  2EIR A;  3KP9 A;  4POM A;  2AB6 A;  2G2Q A;  2VLU A;  3IR4 A;  1VF2 A;  2K8V A;  4ECJ A;  3QOU A;  2C8U A;  3FW2 A;  4IVF A;  2HRN A;  3F6F A;  3LQ7 A;  1R5A A;  2EIO A;  1PMT A;  2H6Y A;  5IMZ A;  1F3A A;  5HQP A;  3S9F A;  3ZIT A;  4HEA 2;  1T3B A;  1GSQ A;  1GSU A;  3L9S A;  4GQC A;  1XW9 A;  1XOA A;  3PPU A;  3IK9 A;  16GS A;  4MF7 A;  2P5Q A;  2B7K A;  4XS6 A;  4IP1 A;  3IA1 A;  4NPB A;  2B5X A;  1X9M B;  2DSA A;  2HT9 A;  3GRX A;  3E9J B;  2MBT A;  1BQ7 A;  1ON4 A;  3FZ9 A;  1TKD B;  2DJ1 A;  3QFA C;  3WD6 A;  5A5K A;  2DJK A;  3A5I A;  4FYC A;  2DBC A;  4ZIL A;  1A2L A;  6GSX A;  3PGT A;  2IFQ B;  4G10 A;  4QL7 A;  4MH2 A;  5FHI A;  2QKE A;  1YKC A;  2E2G A;  3IXR A;  5CRG A;  3CBU A;  1QK8 A;  4O5R A;  5HR3 A;  1A0R P;  4KSO A;  3UBL A;  2CV4 A;  3KMO A;  5JWO B;  5DCG A;  2F9S A;  2HRF A;  3KXO A;  5BRT A;  3ISO A;  2X8G A;  4PUA A;  1SVO A;  4W66 A;  1B9Y C;  3KIJ A;  1YQ1 A;  4NXI A;  2LEG A;  3LJR A;  1SJI A;  1GTB A;  1SD8 A;  4GST A;  4WF4 A;  1J9B A;  2TRC P;  4K7N A;  2PVO C;  5G1L A;  1O7U A;  3VUR A;  1KTE A;  4L0U A;  3GYK A;  3EC3 A;  2H1B A;  5ELA A;  2KLX A;  1TK8 B;  4HI7 A;  2LQQ A;  2TIR A;  1G7O A;  1A2J A;  2H0I A;  3MNG A;  3GTU A;  4FYU A;  1XPV A;  2QA1 A;  4BWQ A;  2LRC A;  2CQ9 A;  4ZL7 A;  4LMV A;  1GL8 A;  1AXD A;  3EUR A;  1GRX A;  3ERW A;  3CSJ A;  2PU9 C;  4XS1 A;  5DAK B;  4K1F A;  5FWG A;  2R6K A;  4KW6 A;  4MJB A;  4KSM A;  2XBQ A;  3IHG A;  2IL3 A;  3DXB A;  5H5R A;  3TKS C;  3FKF A;  1ABA A;  4OCF A;  2CAI A;  2R2J A;  4USS A;  1OE7 A;  2WFC A;  3L9U A;  2DLX A;  2VIM A;  5J4Y A;  2VM1 A;  1TI1 A;  2HSH A;  1TRW A;  2V2G A;  1PA3 A;  1AUC A;  1TK0 B;  2YJ7 A;  2YWM A;  5ECN B;  3H93 A;  1WRY A;  3EMP A;  3TB2 A;  4OO5 A;  1MD4 A;  2AV4 A;  2DMM A;  3M3M A;  4D73 B;  2JZR A;  2JAC A;  1GP1 A;  4PGT A;  3H4K A;  2VCZ A;  3D6I A;  3QR6 A;  2J23 A;  1O81 A;  5DAK A;  5DQY A;  4EKZ A;  4O5Q A;  5IQY A;  3F8U A;  2HQT A;  2N5F A;  3WYW A;  2AUV A;  3D21 A;  6GSU A;  3HD5 A;  3DYR A;  1WP0 A;  1Z3E A;  5CO3 A;  10GS A;  4ECC A;  4OFM A;  2O5V A;  1Z7R A;  1XOB A;  4N0V A;  3O3T A;  1UVZ A;  2DIZ A;  2O87 A;  2H0H A;  1NW2 A;  5B6N A;  3DD3 A;  2M72 A;  3IC4 A;  1PX6 A;  1EOG A;  1E6B A;  1XCC A;  5JWR B;  4G19 A;  2HE3 A;  2L4C A;  4MF6 A;  3IV4 A;  2ZNM A;  1YEP A;  4OFT A;  2XHF A;  4JED A;  3A3T A;  3QPM A;  3C73 A;  2OA7 A;  2HXK A;  3QAW A;  3ZRE A;  4F82 A;  4BVY B;  2VOC A;  2B1L A;  5J3R A;  1AW9 A;  4GXZ A;  3IK7 A;  2R4V A;  4V1A p;  1DE2 A;  2H76 A;  1AQV A;  4KF9 A;  4Q5F A;  5DDL A;  4POK A;  4AGS A;  2OAC A;  4IJI A;  3Q18 A;  4K0N A;  3GN3 A;  3L4N A;  5G1K A;  3IAM 2;  2YAN A;  5J9B A;  4HJM A;  4F0B A;  3FEU A;  2FD3 A;  3DEX A;  2KOK A;  4E8H A;  2H6Z A;  2FWE A;  1W89 A;  2HSM B;  1LJR A;  1SL1 B;  2L6C A;  1R26 A;  3VWX A;  4IHU A;  5ECQ B;  2LTK A;  4BL7 B;  3GNJ A;  2FA4 A;  2DML A;  4AJ7 A;  2EFH A;  4PQ1 A;  3F3R A;  1HYU A;  4TR0 A;  1ST9 A;  3L9V A;  3PR8 A;  2OJL A;  4ECI A;  3E3E A;  4J57 E;  5A34 B;  2WDU A;  4BVY A;  5EPF A;  1TW9 A;  5G2Z A;  3UAP A;  3U6V A;  3IOS A;  6GSW A;  5HR1 A;  5LNK e;  3I69 A;  1FO5 A;  1MD3 A;  1EEJ A;  5ECP B;  1XFL A;  4Z2T A;  4NV5 A;  2H1L A;  22GS A;  3QD9 A;  3TOU A;  1PQN A;  5AIS A;  1Z9H A;  2WUL A;  3ZLP A;  1WPI A;  2ES7 A;  12GS A;  2HFD A;  1T8E B;  4X4J A;  3VI7 A;  4HQS A;  2L6D A;  1PKW A;  4EC0 A;  1VF3 A;  4O7H A;  2FGX A;  3ZVJ D;  3A5W A;  5IO2 A;  4RQR A;  1O73 A;  1GUM A;  3EE2 A;  2KHP A;  2IMD A;  3QFB C;  4TR1 B;  4KX4 A;  4BL7 A;  1XIY A;  1T7P B;  3IE3 A;  2GST A;  5ENU A;  2P5R A;  4XS4 B;  1ZGN A;  4GCI A;  4PX1 A;  1MTC A;  6GSV A;  2A2P A;  1B48 A;  1ZYN A;  2JAD A;  4ECB A;  3GMF A;  1V57 A;  1KNG A;  3VWU A;  5DQS A;  3KTL A;  4Z7X A;  3BBY A;  2M46 A;  2H74 A;  1U3I A;  1V58 A;  5HFK A;  4GSS A;  3A2V A;  2I3Y A;  3SWL A;  4L0W A;  2HZF A;  1XWC A;  1OC8 A;  3ZYW A;  4EVM A;  2CZ3 A;  1RW1 A;  4AF2 A;  5H5S A;  1PSQ A;  4WBJ A;  3GHA A;  4J2F A;  4EDZ A;  4DSS A;  4ZBB A;  2UV8 G;  2VLV A;  4FIW A;  2H73 A;  3TKQ A;  4V2N A;  1GWC A;  1BED A;  1M2D A;  3LYK A;  2V6O A;  3ME7 A;  3IAS 2;  4J56 E;  2C0D A;  1TU8 A;  1F2E A;  2H70 A;  5DJL A;  3D4T A;  2H1A A;  3MYD A;  20GS A;  4TR1 A;  4JE1 A;  4PTS A;  3U5R E;  4GRF A;  1SVM A;  1GNW A;  4XS4 A;  4TRX A;  4MF5 A;  4HUA A;  2OE3 A;  1GUL A;  4MPG A;  1M9A A;  2EFC A;  1AAZ A;  4ZIJ A;  2CVD A;  5IIZ A;  3KCM A;  2H1G A;  3CWG A;  4WR4 A;  2P31 A;  5D73 A;  5J5N A;  3F63 A;  3ERF A;  1QXH A;  2JZT A;  3ME8 A;  5KN3 A;  3IBH A;  3KEB A;  5GAN D;  1ML6 A;  3M9K A;  3ZMK A;  1CQG A;  1BAY A;  3EIN A;  2B3S A;  4BWS A;  5AN1 A;  2IJY A;  3P7X A;  4KCA A;  3OR5 A;  1JLV A;  3ZFB A;  1GSD A;  1EP7 A;  2HZE B;  3DWV A;  2PER A;  2CT6 A;  2GVP A;  3QCP A;  5JWQ B;  4F0C A;  3P2A A;  3ZZX A;  1BG1 A;  3MIX A;  2CAQ A;  2VL3 A;  3CTF A;  2V41 A;  4L5L A;  3O76 A;  1OC9 B;  5F8B A;  4WET A;  2L5L A;  4G0L A;  1XWA A;  4NWY A;  4KGI A;  3QAV A;  1K3Y A;  1K3O A;  2LNS A;  2O89 A;  4ACS A;  1OYJ A;  2C3Q A;  1GH2 A;  2H0G A;  3L0H A;  1FB6 A;  4OWY A;  1A8L A;  2X8H A;  3GV1 A;  5EY6 A;  3EYT A;  5JCG A;  5KOX A;  1SL2 B;  2F8F A;  4LL1 B;  1TXX A;  3CXG A;  4BPY A;  1O6J A;  3C7M A;  3RDW A;  2MZC A;  2HZE A;  4OCE A;  5LD0 A;  1G6Y A;  3HA9 A;  1BF5 A;  3G7I A;  3KP8 A;  2VD1 A;  1K0A A;  3FHK A;  4JRR A;  6GSS A;  1JZR A;  3KJY A;  4A5P A;  4MMM A;  5A1N B;  2WZ9 A;  2GZZ A;  3D22 A;  4F9Z A;  1T4Y A;  2A4V A;  4ILF A;  2F51 A;  2WRT A;  4HZ2 A;  1OC9 A;  1F6M C;  1N25 A;  2H71 A;  3HMJ G;  3ED3 A;  3TU3 B;  4EE0 A;  4K2X A;  1IYH A;  4QQ7 A;  1F37 A;  1YDK A;  2VCV A;  1SK2 A;  2F3M A;  3CRU A;  4HU9 A;  2EC4 A;  4I2T A;  5IMF A;  1KEB A;  4F03 A;  4JR4 A;  3MWH A;  2REM A;  1SL0 B;  4WR5 A;  2R0P A;  3VFI A;  3TKS A;  1PGT A;  2LRT A;  3FR3 A;  2VCW A;  4O92 A;  3DIE A;  1K0B A;  2HI7 A;  6GST A;  2LQO A;  2VD0 A;  2KP1 A;  4TVE A;  2YN1 A;  4IN0 A;  4IQ1 A;  3GA4 A;  2IME A;  3HXS A;  5A1N A;  2HRK B;  2VL2 C;  1EP8 A;  5G5F A;  3ZIJ A;  3APS A;  1ZYP A;  1MEK A;  4RUV A;  1NHY A;  2GQK A;  2X64 A;  1GSE A;  2WJU A;  1RQM A;  3BOA A;  3IPZ A;  1VF1 A;  3HJP A;  1SJ6 A;  2FNO A;  2B7J A;  2BTO T;  3VWV A;  4KND A;  5BMU B;  4AI6 A;  4TN8 A;  5F06 A;  3NIV A;  1YVL A;  1MDI A;  1V9W A;  3LG6 A;  2JZS A;  4NHZ A;  1K0O A;  2D2Z A;  3LFL A;  4AJ6 A;  3DRN A;  5F0G A;  1Q98 A;  3HKR A;  2Z9S A;  2WGR A;  2WS2 A;  1USB A;  3M1G A;  3F9U A;  1FAA A;  3CMI A;  2XC2 A;  5DJM A;  4Q5Q A;  5ID2 B;  2IFQ A;  2IMF A;  2AHE A;  4MAB A;  5HFG A;  2FWG A;  2DKH A;  1BYE A;  4WKW A;  2NPB A;  2EIQ A;  3M8N A;  3AY8 A;  4MA9 A;  1HNA A;  1A23 A;  4FYB A;  5IM9 A;  4JU5 A;  4EXJ A;  1SU9 A;  4K8M A;  5BMU A;  2UZ8 A;  3G9B A;  1XBS A;  8GSS A;  4L8E A;  4N3Z A;  1G7E A;  5D9W A;  4MP4 A;  5A4W A;  1GTA A;  3HHV A;  5D9X A;  4TOP A;  1IYI A;  4MZB A;  5C00 A;  1SKR B;  1BX9 A;  2LJR A;  5CRH A;  2A4H A;  2VO4 A;  1U88 A;  5D9T A;  3D0Z A;  4TW5 A;  1URM A;  1EZK A;  2YJH A;  2VKZ G;  1JZW A;  1TI3 A;  2VCQ A;  1NM3 A;  2N5A A;  4AKI A;  2M80 A;  2H01 A;  2NTO A;  4TXV A;  2QSI A;  5J41 A;  1LBK A;  1X9S B;  4ID0 A;  2H66 A;  1TK5 B;  3FR9 A;  2YPM A;  4ZL8 A;  2LJK A;  4CW9 A;  3FZA A;  4AKX B;  2C0G A;  1YKA A;  3VWW A;  4FO5 A;  5IPG A;  4V2M A;  1WIK A;  1N8J A;  2ON7 A;  4O32 A;  1FVK A;  3I6A A;  4N10 A;  4EO3 A;  2GTU A;  5IOW A;  18GS A;  1B4Q A;  3Q74 A;  1G0T A;  1S3A A;  5ECH B;  3JCM L;  1GUH A;  3RPN A;  4KA0 A;  2B5Y A;  2GQM A;  4WXT A;  2YV7 A;  3IDV A;  4NHW A;  1ZOF A;  5J40 A;  4YAP A;  4Z2R A;  3RHC A;  4ZB9 A;  4PNF A;  2O85 A;  3TJF A;  2C0F A;  2XPE A;  2K8S A;  5G31 A;  2PMT A;  4D73 A;  1UC7 A;  1ZCP A;  2LUS A;  3VPT A;  5J47 A;  4KH7 A;  4DVC A;  4EIP A;  4ZB7 A;  2OE0 A;  1T00 A;  3O6T A;  3G7J A;  1SKW B;  2GZY A;  1R7H A;  3RAZ A;  7GSS A;  4EDY A;  1JLW A;  2RM5 A;  3F3Q A;  1YJ6 A;  2YZH A;  5DAL B;  2LST A;  2ALB A;  3BD2 A;  3VLN A;  3ZML A;  3N9J A;  2H19 A;  3ERG A;  1DSB A;  3GX8 A;  2DJ0 A;  2K6V A;  2L4Q A;  3F6D A;  1H75 A;  2H1D A;  3IHQ A;  1PKZ A;  4HS1 A;  5H5Q A;  5D8I A;  3TKS E;  3N5O A;  3MAK A;  4GDF A;  3I43 A;  4P3Y B;  1EV4 A;  3HCZ A;  4KAE A;  1A2M A;  1QGV A;  2V1M A;  1Z7P A;  3CSH A;  1ZL9 A;  4DSQ A;  1TDI A;  4CHS A;  2CZ2 A;  17GS A;  4WEY A;  5B8A A;  4RQX A;  2I4A A;  2B1K A;  3KD0 A;  5ELG A;  1EGR A;  1U6T A;  3WGE A;  1K0M A;  4ZBD A;  2YV9 A;  5DAL A;  2DJ3 A;  3GUR A;  2E2M A;  3GKM A;  4PXO A;  3KZQ A;  5E59 A;  3RHB A;  3TRQ A;  5F05 A;  1FOV A;  1ERV A;  2KUC A;  5CP1 A;  4KB3 A;  2LRN A;  5D93 A;  2HSM A;  2PGT A;  2I81 A;  2MMZ A;  3HJM A;  1TTZ A;  3TGZ A;  2PBJ A;  2HLS A;  4HU7 A;  2VLT A;  1UA5 A;  2GSS A;  2K9F A;  3LGC A;  5A34 A;  1GTU A;  3H1N A;  3UVH A;  4LL4 B;  2DJJ A;  1SEN A;  2YWN A;  4AJ8 A;  4GF0 A;  3QAG A;  3HVS A;  3A2X A;  1EGO A;  3VPQ A;  1LU4 A;  3DVX A;  3QMX A;  2BJX A;  2GSR A;  5A5H B;  2YNX A;  2OBI A;  1QMV A;  3NZN A;  1TJD A;  4TKY A;  3TJK A;  4X0X A;  2F8A A;  2XPD A;  4I5Q A;  4CDO A;  4PQI A;  5AGY A;  3WT1 A;  5ECS A;  2MMN A;  1XWK A;  3LYP A;  3APO A;  1AC1 A;  3SBC A;  3UL3 A;  4IEL A;  4YAV A;  1SKS B;  2VCX A;  3TKP A;  2YWO A;  5B7C A;  3ZTL A;  4Z2U A;  1B4P A;  1F9M A;  4MCU A;  1TRV A;  2VL9 A;  1O8X A;  2AAW A;  4HZ4 A;  4IQA A;  5J9C A;  3GKX A;  3QDN A;  5J4V A;  1XW5 A;  1O85 A;  3KH9 A;  4ULX A;  4MJC A;  13GS A;  3FR6 A;  5F07 A;  2L59 A;  2FCH A;  2IPA A;  3FK8 A;  3TDG A;  5GAP D;  5A5H A;  1FG4 A;  2HYX A;  4JR6 A;  4KDU A;  1FOH A;  3IRA A;  2YOI A;  2GQL A;  4G2E A;  1ZZY A;  1W4V A;  3BCI A;  4MH3 A;  3KGK A;  1HNC A;  1S3D A;  2IWT A;  4LA1 A;  5IMC A;  3M9J A;  1BG5 A;  2VL2 A;  4TR3 A;  1B9X C;  3LXZ A;  1M9B A;  2H72 A;  2OAD A;  1WWJ A;  4H86 A;  4K9Z A;  3R3E A;  2TRX A;  5INY A;  3D5J A;  4PUR A;  1M99 A;  2C4J A;  5JCU A;  19GS A;  4IGJ A;  2B5E A;  1I9D A;  3HZ4 A;  2IN3 A;  4L5O A;  1PX7 A;  4LMW A;  1JZO A;  4DEJ A;  4N30 A;  1TU7 A;  3I9V 2;  1V2A A;  3WGX A;  3TOT A;  5G30 A;  3C71 A;  1H4O A;  1ZMA A;  3LSZ A;  2X8C A;  4I2U A;  2YZU A;  5D9V A;  4YQU A;  4EIQ A;  3GIX A;  2MBS A;  1R4W A;  3E0U A;  3KH7 A;  3A2W A;  4K7O A;  3TKR A;  2WB9 A;  3EVI A;  4I8B A;  4I6X A;  2H75 A;  4POL A;  3K8N A;  1EWX A;  4ZXG A;  2PN8 A;  4MPF A;  3LWA A;  1SYX A;  1X5E A;  5B8B A;  4WF5 A;  1SK1 A;  3HDC A;  1DE1 A;  1T1V A;  1WJK A;  1TOF A;  1ZYE A;  4EL1 A;  3DML A;  4X1U A;  2C1Y A;  2JL4 A;  3VK9 A;  2O7K A;  4GTU A;  4N11 A;  1AQW A;  1XVW A;  1THX A;  4RI7 A;  1GNE A;  4GWR A;  5E4W A;  3TCO A;  2CVB A;  5ECR B;  1QUW A;  4G01 A;  1V40 A;  3TRX A;  2FA8 A;  2PVQ A;  2DKI A;  1M7T A;  5B6M A;  4YKF A;  2NBS A;  1QFN A;  4HJ2 A;  3ZFL A;  1PN9 A;  5DBQ A;  2OT3 A;  3RPP A;  1GSS A;  2PPT A;  2X99 A;  2LKU A;  3BCK A;  4K7I A;  4NAX A;  4ICY A;  3HY2 A;  5GSS A;  2GDR A;  2C0E A;  2J9H A;  3F4T A;  2C80 A;  3GTU B;  4GQF A;  5CAX A;  2AYT A;  3MSZ A;  4IKH A;  1A24 A;  5C04 A;  5A4U A;  3RBT A;  3UJ1 A;  3UEM A;  3W8S A;  3WGD A;  1J0F A;  5ABR A;  1VGL A;  1M0U A;  1FHE A;  4X43 A;  3DVW A;  2DC5 A;  1THO A;  2R37 A;  3MDK A;  5IMV A;  1VRS D;  4EUY A;  4NMU A;  3P8W A;  1X0R A;  2HRK A;  4TXO B;  3UIW A;  3FZ5 A;  5HR2 A;  2H8L A;  1JHB A;  2OE1 A;  1M2B A;  4XTS A;  2ON5 A;  2LJA A;  2CX3 A;  4ZB8 A;  1J08 A;  1WE0 A;  1HQO A;  1A0F A;  1BJX A;  3FZ4 A;  1HNB A;  3EPT A;  3FY7 A;  1B8X A;  4MJA A;  1SVL A;  3CYN A;  4MK3 A;  14GS A;  1Z5Y E;  3ZL5 A;  3FYG A;  4GLT A;  3J7Y k;  4RI6 A;  2DJ2 A;  2VCT A;  5KOW A;  2K18 A;  1EV9 A;  1Y6E A;  2FWH A;  5KEJ A;  1WMJ A;  3EU4 A;  3CTG A;  3FRC A;  5JCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...