3TOUA

Crystal structure of glutathione transferase (target efi-501058) from ralstonia solanacearum gmi1000 with gsh bound
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
212
structure length
212
Chain Sequence
VMKLIGSHASPYTRKVRVVLAEKKIDYQFVLEDVWNADTQIHQFNPLGKVPCLVMDDGGALFDSRVIAEYADTLSPVARLIPPSGRERVEVRCWEALADGLLDAAVALRVEQTQRTPEQRSESWITRQHHKIDEALKAMSRGLADRTWCNGNHLTLADIAVGCALAYLDFRQPQVDWREQHANLAAFYTRIEKRPSFLETQPQAENLYFQSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione s-transferase protein
publication title Crystal structure of GLUTATHIONE S-TRANSFERASE from Ralstonia solanacearum
rcsb
source organism Ralstonia solanacearum
molecule tags Transferase
total genus 76
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain
A PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3touA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3touA01
3G7IA 2X8GA 3TCOA 3IXRA 3ME7A 4GSSA 4EVMA 3CRUA 1X0RA 1DE2A 1MD4A 2OBIA 3L4NA 1FO5A 4EUYA 3UMAA 1W4VA 1TU7A 1XWAA 2EC4A 2H0HA 3L9UA 3GH9A 3GURA 1KTEA 3EMXA 1OAZA 3HKRA 2JZRA 5ECQB 5IMVA 5ECSA 20GSA 1U6TA 3FZ5A 3E9JB 5HR1A 4MZCA 4BWSA 1B48A 1TRUA 1EP8A 2VM1A 4O32A 1VF4A 4NHWA 2C3NA 4JU5A 1SD8A 2NBSA 3D0ZA 2QC7A 2CZ3A 1THXA 4L0UA 5LNKe 4MPGA 4X1UA 2FNOA 2H71A 5IPGA 2HT9A 2WFCA 3GKNA 2B1LA 1O81A 2IL3A 5IPHA 1SJ6A 5H5RA 1KEBA 3O6TA 3DGQA 5JCGA 3UL3A 5INYA 1LJRA 2IMDA 1QXHA 4K7IA 5EY6A 1FAAA 4EXJA 1O85A 3TGZA 5GSSA 5D96A 5HR2A 2XHFA 4TN8A 2DJJA 2PUKC 1JLVA 4TXOA 4ACSA 1Y25A 2E7PA 4DSQA 5DQSA 5A4WA 2I9HA 1V40A 3HCZA 4HU9A 3GH6A 4J57E 3UBKA 2GSRA 2V41A 3EU3A 4TR4A 2ALBA 1PKWA 1G7EA 3J7Yk 4KUNA 5F07A 4D73A 1PMTA 5AIXA 1ZZYA 2K8SA 3GRXA 2B5YA 3CMIA 1XVQA 1GL8A 4KGIA 1V9WA 5IOXA 4XS4B 1A2LA 4GRFA 1Z9HA 5JWRB 3ZRDA 3TRQA 2B5EA 2LRTA 3ZZXA 1GSYA 5DCGA 4K0NA 1X5DA 2B7KA 4O5RA 1Q98A 2DSAA 4RQRA 4HS1A 1K0AA 5D9WA 5G1LA 1GUMA 2YZUA 4XHMA 3DVWA 4NWYA 4AF2A 2DLXA 1R5PA 1T4YA 4I2UA 2R6KA 4L5OA 3UOMA 3KZQA 4PQIA 2AYTA 4EF0A 2AJQB 1SENA 17GSA 3H8QA 4HU7A 1HNBA 5B8AA 2VM2A 3QMXA 2R5GA 4I8BA 3DWVA 4H86A 2GSSA 1URMA 5ELAA 3D21A 1A2JA 2L5LA 1I5GA 1RQMA 2X99A 3QAVA 2DJ0A 2ZCTA 3PR8A 3HJMA 4WF5A 4ZL8A 1X9SB 1YZXA 2FD3A 1OC3A 1HYUA 5D9XA 1V58A 3TJKA 3IOSA 4F82A 1TK8B 2IIYA 2KUCA 2GDRA 2RUEA 2I81A 1TU8A 4WBRD 5B7CA 1TK0B 4MP4A 3CSIA 1MDIA 3BD2A 1T00A 2M80A 4MH3A 4LL1B 5J5NA 4ECIA 2JL4A 5F8BA 2XPDA 3KH7A 1BJXA 3GKKA 2HZEB 2JADA 3ZVJD 3CSHA 2LTKA 4J56E 2HE3A 3NOFA 1GTUA 1GNWA 1VGLA 3HA9A 4HOJA 4N10A 4IGJA 4EDYA 4N0ZA 3VPQA 1WJKA 2NPBA 1YKCA 3N5OA 2H30A 13GSA 3P90A 2HRKB 1ZL9A 4TVEA 4RI7A 2PVQA 1K0CA 2WRTA 3ZFLA 5DAKB 4IS0A 2LNTA 3HYPA 3A2WA 2K18A 3UAPA 4F9ZA 1IYIA 1GTBA 3WT1A 1VF1A 3F9UA 4HJ2A 3WT2A 5KN2A 2YWNA 4XIHA 3F3RA 3Q19A 2A2RA 1ZMAA 1JHBA 1XW6A 1J9BA 2TIRA 2FUG2 1B8XA 5EPFA 22GSA 3Q74A 5CNWA 1UVZA 4KB3A 2VLTA 3EC3A 1ZYEA 3U5RE 1SKSB 3IRAA 2H19A 4DSSA 1K3YA 5IOWA 4PURA 2LV3A 2WB9A 4KSMA 2H1AA 1FVKA 4ZB8A 4AJ8A 2F51A 1VRSD 4G0IA 1XXUA 2LJKA 2RM6A 5ECMB 1AAZA 4Q5QA 4NMUA 3HJPA 4K7OA 1EEMA 3CBUA 5HFIA 4K0GA 3A2VA 1NHOA 1WWJA 1TRSA 3LYPA 2ZNMA 5ABRA 1SK0A 2G0FA 1O6JA 3FR6A 1BQ7A 4MDCA 4G10A 2FY6A 5DBQA 4XRAA 2X8HA 2OACA 2GVPA 4CDOA 3W6GA 1S3CA 4I97A 1TRVA 4BVXB 1TXXA 4KW6A 2C4JA 4JEDA 4EKZA 2V6OA 2OADA 5DALB 4PTSA 2C1YA 3KXOA 1THOA 1MDKA 3GN3A 4GLTA 1ZGNA 3VLNA 2HRNA 3VWXA 3BOAA 1EEJA 1OKDA 2OE0A 2H6YA 1SL0B 2H1GA 1FOVA 1XFLA 1YJ6A 3RAZA 3W8JA 4YAPA 1GP1A 3TKSA 1B4PA 3G7JA 2G2QA 2IN3A 1U87A 1PL1A 2HZFA 1V98A 3HY2A 4MCUA 5CRHA 1OVNA 3ZREA 5J4UA 1MDJA 2CT6A 4HZ4A 2V2GA 1ERVA 2HRKA 3D6IA 4YH2A 2DBCA 5AISA 1YKAA 3VWVA 3I43A 3RBTA 1SU9A 1WPIA 2HSMB 4XTSA 4ZILA 2IMFA 4JZQA 2P5QA 4PUAA 1AQWA 1QK8A 1OKTA 5CAXA 3UARA 5A5KA 4DEJA 4ECBA 3CXGA 2F8AA 5IIZA 5IO2A 2LJRA 3TRXA 2I3YA 3FK8A 4LMWA 3EMPA 1M99A 3TJGA 2M72A 3APSA 1SL2B 5JWQB 4TR1B 4F03A 2MMAA 1J08A 4KSOA 4ZL7A 4ULXA 3IHQA 4ZBAA 1JZRA 3LXZA 16GSA 1F37A 2R2JA 2H72A 3K8NA 2PERA 4MABA 3F0IA 4HQZA 5CRWA 4WXTA 3KJYA 3EVIA 3GSTA 3FR3A 3TJJA 4WBJA 2F8FA 3ZL5A 1Z6NA 4EL1A 5DDLA 1U3AA 3RPPA 1XW9A 1Y6EA 4IW9A 1AC1A 1QUWA 2HSYA 2ON5A 3BJ5A 1QFNA 2EIOA 1Z7RA 3ERGA 1GLPA 2R3XA 2H75A 4BVXA 5A4UA 3M0FA 5DALA 3HZ8A 4FIWA 1F2EA 1T1VA 4ECCA 3ISOA 2C3QA 4V1Ag 1N8JA 4F2IA 1R26A 3MWHA 1GLQA 3GFKA 5G2ZA 2P0GA 4WR5A 5ECRB 2FWFA 3GHAA 3QOUA 1ML6A 6GSVA 3IAM2 3GX8A 2HFDA 2OBKA 4CW9A 4TXVA 5KN0A 3FZ9A 2J23A 4PQHA 2FWEA 3C8EA 3D4MA 3C73A 3QR6A 2O8VB 4POMA 4WF4A 1SYXA 5CRGA 4TKYA 5ECIB 4KDUA 4YQUA 3ZIJA 1F3BA 4E8EA 3EURA 2C0EA 2HSMA 1X9MB 5H5SA 2R37A 2L6DA 2DC5A 2IPAA 1JLWA 10GSA 4V1Ap 1ERTA 4LA1A 4QL7A 4IELA 1LU4A 5G5EA 1K0DA 1IYHA 3KMNA 3DRNA 1N2AA 3IBHA 5F06A 4ECJA 4AJ7A 2DMMA 2PPTA 5IQYA 1W89A 3KTBA 1TI3A 4IP6A 2HSHA 2WS2A 1M2DA 2E0QA 1X9WB 1TRWA 4TR1A 3LXTA 4V2MA 5G1KA 1BG5A 3LEFA 3L78A 5HFKA 3D22A 5ECKB 2H6XA 2KP2A 4IN0A 1YF0A 2VCWA 2DJ2A 2A2SA 5EL8A 1KNGA 1YDKA 1EGRA 2VIMA 3MNGA 3ZFBA 4LMVA 6GSSA 2MBSA 2OA7A 1BEDA 2DJKA 5D93A 3R2QA 1GSEA 3D5JA 2YV7A 2C80A 2UZ8A 4OCFA 2YWOA 4F0CA 2KP1A 3VI7A 3DIEA 3BCIA 3C71A 4OCEA 5ECOB 2OJLA 4TRXA 2ZUPA 3DXBA 2IMKA 4DSSB 2VD0A 4IQAA 2RIIA 2HQTA 2FWGA 4Z7XA 2YOIA 2HRAA 3M3MA 2H0IA 1PL2A 1YQ1A 3C1SA 3M1GA 5D9VA 1ILOA 1UC7A 3LORA 1GH2A 2FHEA 4JE1A 3IA1A 3KEBA 5DJLA 3FEUA 5ELGA 2YWIA 3TKQA 5GZZB 5H5QA 5HR0A 5FWGA 4AJ6A 3TRPA 2E2GA 3DVXA 3FR9A 1K3LA 1PN9A 3SBCA 3QCPA 1TP9A 3OR5A 3BCKA 4KF9A 4MPFA 5J9CA 2JZTA 4IBPA 1T3BA 4KCEA 4HUAA 2NDOA 1M0UA 2PBJA 1A24A 2J9HA 1SJIA 3Q6OA 3LG6A 2TRCP 1K0NA 2HRFA 1K0MA 2GZPA 2N5AA 3KM6A 1A8LA 3TOUA 3ME8A 3NIVA 2YNXA 3TJBA 4O92A 1T4ZA 1M2BA 1O8WA 4POKA 2PVOC 4ZB6A 5CRDA 4JRRA 3UVHA 2O7KA 3CRTA 3A2XA 3F3QA 3D4TA 4JR4A 4HEA2 1ON4A 2C0GA 2WCIA 3I6AA 3EWLA 2VCTA 6GSXA 1SD9A 2CZ2A 2DMLA 2GSQA 4YQVA 3HVVA 2YANA 3HD5A 2V32A 3P8WA 3VK9A 3RHCA 3IDVA 4GQFA 1UN2A 2L59A 3IPZA 1A8YA 3ZMLA 2MZCA 3ZVJA 3E3EA 2CVBA 2JSYA 2B6MA 2AUVA 19GSA 4G19A 2P31A 2FA8A 5LD0A 4K9ZA 4E8HA 2C0DA 2GQLA 5ECNB 4K2DA 4KNDA 3V1WA 3PPUA 2VCQA 4Q5FA 3AY8A 4G0LA 3GL3A 3RDWA 1K3OA 1XIYA 1E2YA 2QSIA 4MA9A 4V2LA 5F05A 2B7JA 3GL5A 5IM9A 3TUEA 4L5LA 5ECHB 2CVKA 4EE0A 4GF0A 3GUSA 2YPMA 2N5FA 3ERFA 1ST9A 1YF1A 2XBQA 4OFMA 1JZWA 3US3A 2GZYA 4OFTA 1BX9A 2DIYA 4NV5A 4FYUA 4BL7A 3NZNA 4POBA 2KLXA 2H6ZA 3BBYA 2H1BA 4ML1A 4ZBDA 2C0FA 1MTCA 5A4VA 4HDEA 4GCIA 5ECLB 3HDCA 2GSTA 4OO5A 3MDKA 2AAWA 1DSBA 1TDIA 4L0WA 4ZBBA 1JFUA 1U88A 2CQ9A 2LKUA 1ZCPA 2FCHA 5B8BA 1NM3A 1ERWA 3F4SA 5EVOA 3R3EA 4CHSA 3TKSE 1SL1B 1EP7A 3FW2A 4GSTA 3P2AA 1U3IA 1AXDA 1WRYA 4LLRA 3EYTA 4MMMA 2F3MA 2E2MA 4OO4A 4N0VA 1C72A 1PRXA 1XZOA 1A23A 1WMJA 2FA4A 3HZ4A 4DSRA 3L9SA 3RPNA 2VOCA 4YQMA 2GLRA 4O7HA 1ABAA 4GXZA 2CV4A 3FY7A 3KIJA 1OE8A 3F4TA 3DKSA 2K9FA 2H01A 4QL9A 1GSUA 3VWUA 5F0GA 4DVCA 3EINA 1GTIA 4YAVA 4PNFA 3FZ4A 4JBBA 2C8UA 2RUFA 4IP1A 3IC4A 1GSFA 4FYCA 1R5AA 2IFQA 2LRNA 1FB0A 5CYYA 5KN1A 2PN8A 1X5EA 2VL2A 2K6VA 1K0OA 1XPVA 1DUGA 2P5RA 1NHYA 3GYKA 9GSSA 4X43A 4ZL9A 4GWRA 1SKWB 4G2EA 2CA8A 4PGTA 3QPMA 4POLA 1AW9A 4IQ1A 2WJUA 2VCZA 3HVSA 1V2AA 1DE1A 4KDYA 4BWQA 1XWGA 1EOHA 2YCDA 3M8NA 5D73A 2I4AA 1A0FA 2X64A 4MF7A 1OE7A 3N9JA 4I6XA 1M9BA 1ERUA 5GAND 2H70A 1EZKA 1SYRA 1JZDA 3GA4A 1GUHA 1G6YA 2H8LA 5B6MA 3IAS2 1ZYQB 2L5OA 1OC8A 3TDGA 3UBLA 2AHEA 2VL9A 4MJCA 5J41A 2LQQA 2GZZA 3M9JA 2IWTA 3ZIVA 3JCML 5JCUA 1EV9A 2JSZA 4TR0A 1GUKA 4MZBA 4GQCA 5FHIA 1MD3A 2YV9A 4NV2A 5DQYA 3LFLA 3QAWA 3M9KA 5ECPB 1F6MC 2GQMA 2HXKA 5DJMA 3I69A 3WYWA 5AIVA 4WETA 4G9HA 1MEKA 3FZAA 3GTUB 3E0UA 1EGOA 2VL2C 1B9XC 4PQ1A 1NSWA 1R4WA 2XBIA 5C00A 1G0TA 4KA0A 1HNAA 2O87A 1AIUA 5KEJA 4OWYA 2H74A 2A4VA 2QGVA 2H1DA 1AUCA 4IJIA 1O7UA 4HI7A 6GSUA 1QGVA 2GS3A 5CREA 4X0XA 6GSTA 3W8SA 1R7HA 1BYEA 6GSYA 3CTFA 2DJ1A 3VWWA 2EIQA 3CTGA 1YEPA 3G9BA 3KH9A 1RK4A 1XWBA 6GSWA 1FB6A 4NAXA 1KBNA 3F6DA 1XVWA 2NVLA 4F0BA 2LRCA 1G6WA 4MK3A 1GNEA 3QDNA 5E59A 5AGYA 7GSSA 3QD9A 3TKRA 3IK9A 3HHVA 1XW5A 1QMVA 1EV4A 2WDUA 1WIKA 2OE1A 3I9V2 4FH8A 3GX0A 3C1RA 2REMA 4OFNA 2VCVA 1YY7A 3TB2A 3GNJA 2PGTA 5IMCA 1GRXA 2I1UA 3TKPA 1Z5YE 4GTUA 1WE0A 4I5QA 5J3RA 1TJDA 1HD2A 2MMZA 1SKRB 2O85A 1XCCA 5D8IA 4EC0A 1QQ2A 3KP8A 1GSQA 3H79A 3KCMA 2BJXA 4WEYA 1RW1A 4OMVA 3GIXA 4KH7A 2FGXA 1FHEA 4KDXA 1G7OA 3MSZA 5IMFA 3ERWA 1F9MA 5ENUA 2KOKA 5GAPD 2C3TA 3O3TA 3FKFA 2HYXA 2JU5A 2LEGA 2VUPA 4RI6A 4ZXGA 3WGEA 1XWKA 2DIZA 3UEMA 1LBKA 1BAYA 1B4QA 5ID2B 1S3DA 5IMAA 4HJMA 3LWAA 2L6CA 4PXOA 3GTUA 4EO3A 4FYBA 4EDZA 2HI7A 4V2NA 1CQHA 4BL7B 3J7Yb 4N30A 3F4RA 1F3AA 1PGTA 4I2TA 3DEXA 4PX1A 2LUSA 1TTZA 2BTOT 1Z7PA 2HLSA 1SK2A 5HQPA 4XS1A 1H4OA 3UJ1A 1M7TA 4G0KA 2VD1A 3QFAC 1J0FA 2ON7A 4Q5RA 4TR3A 4LL4B 4HQSA 4OD7A 4P3YB 3HVXA 3WGDA 1PA3A 4BA7A 1PX7A 2EIRA 4K7NA 3CYNA 5G5FA 1S3AA 1CQGA 3F6FA 3TJFA 3UVTA 5CP1A 2WZ9A 3GKMA 1XOBA 1GSSA 3ZMKA 3PGTA 4BVYB 4MZWA 1EOGA 2TRXA 2YJ7A 1GWCA 3F8UA 3APQA 1XOAA 2OKAA 2GTUA 4WKWA 3UIWA 4KCAA 1ACVA 3P7XA 4NHZA 2B1KA 4KE3A 2B3SA 3GKXA 1GULA 2PMTA 5E4WA 2YP6A 4Q5NA 3WGXA 5C04A 2LSTA 2H76A 2R4VA 1TK5B 1TI1A 2CX3A 2BMXA 4J2FA 2B5XA 14GSA 3KMOA 2XPEA 4XS4A 4MF6A 4ZB9A 2H73A 2AB6A 2IFQB 1GSDA 3LJRA 2L4CA 2MBTA 3APOA 4JR6A 1Z6MA 1I9DA 3Q18A 4IKHA 1OC9B 3GV1A 2NTOA 4FQUA 2ES7A 3FHKA 3LQ7A 3VI5A 1V57A 2LNSA 1PQNA 4HZ2A 2LS5A 3A5WA 2WGRA 4ILFA 1UA5A 1TW9A 3L9VA 4PNGA 3VFIA 5ID2A 5HR3A 1A0RP 4QQ7A 4XRDA 1E6BA 4MJBA 2V6KA 1DBYA 2F9SA 2PU9C 5JWOB 2IMEA 1SK1A 4ISDA 5AN1A 3ZTLA 3CSJA 4MJAA 5FT3A 3TOTA 3PINA 3LSZA 2JZSA 2DJ3A 2YZHA 2MYGA 1HQOA 2K8VA 4RQXA 1B9YC 1JZOA 11GSA 1XBSA 5DCHA 5KN3A 2VLUA 12GSA 1WP0A 3QFBC 3GMFA 8GSSA 2IJYA 5G31A 2L4QA 1H75A 4K6XA 5IMZA 2GT6A 3FYGA 1USBA 2WULA 2OE3A 1XWCA 1GTAA 3HJOA 5DVBA 3ZYWA 2AV4A 3L0HA 2YJHA 3EE2A 3WD6A 1O73A 5BMUA 3EU4A 2IMIA 3DYRA 2H0GA 4NPBA 1M9AA 5COHA 2CAIA 2L57A 4IVFA 3ED3A 4N11A 4MF5A 4K8MA 4BVYA 2LQOA 1AQVA 2D2ZA 3IR4A 1PX6A 2HZEA 2N5BA 2CVDA 1NW2A 3KP9A 5IO0A 1EWXA 2GQKA 1SJZA 2JACA 2VCXA 2GT5A 2XC2A 2H66A 4ML6A 5G30A 2LJAA 2CX4A 4TW5A 1OYJA 3FRCA 4NXIA 1FVJA 2RM5A 3A3TA 3G7YA 3ZITA 5DAKA 2X8CA 4IJ3A 3QAGA 5CO3A 3KD0A 3F63A 4MH2A 4USSA 4PUFC 1T8EB 2VLVA 2KHPA 1HNCA 3SWLA 3VPTA 2VAFA 5D9TA 1YEXA 1K0BA 1A2MA 4KAEA 2RLIA 1PKZA 3DMLA 4GSNA 2PWJA 1VF2A 2V1MA 1M2AA 3H1NA 4ID0A 1OC9A 5GSTA 2MMOA 4XCSA 3H4KA 1FW1A 1TKDB 1AQXA 3IC8A 5LCZA 2CAQA 4BPYA 3IK7A 1X5CA 18GSA 4ZIJA 4TXOB 3MAKA 3S9FA 1WOUA 2O89A 1VF3A 4TOPA 4AGSA 3KGKA 4MLYA 1TOFA 5B6NA 2Z9SA 4L8EA 3IE3A 4MJEA 4K1FA 2FLSA 2YWMA 3LGCA 4FO5A 1ZOFA 3U6VA 5L71A 3GSSA 2FWHA 3IV4A 2HSNB 1FG4A 4D73B 3C7MA 3DD3A 1PD21 3ZLPA 1Q4JA 5IMDA 2HNLA 4KX4A 2MMNA 4WR4A 2M46A 3H93A 3PH9A 5HFGA 3HXSA 2VO4A 3LYKA 3O76A 1PSQA 2QKEA 1T7PB 1Z3EA 2VL3A 1O8XA 4RUVA 3VURA 4IHUA 4XS6A 3RHBA 2GGTA 3KTLA 5J9BA 5JCWA 3TKSC 2YN1A
chains in the Genus database with same CATH superfamily
3G7IA 2X8GA 3TCOA 3IXRA 3ME7A 4GSSA 4EVMA 3CRUA 1X0RA 1DE2A 1MD4A 2OBIA 3L4NA 1FO5A 4EUYA 3UMAA 1W4VA 1TU7A 1XWAA 2EC4A 2H0HA 3L9UA 3GH9A 3GURA 1KTEA 3EMXA 1OAZA 3HKRA 2JZRA 5ECQB 5IMVA 5ECSA 2R0CA 20GSA 1U6TA 3FZ5A 3E9JB 5HR1A 4MZCA 4BWSA 1B48A 1TRUA 1EP8A 2VM1A 4CY8A 4O32A 1VF4A 4NHWA 2C3NA 4JU5A 1SD8A 2NBSA 3D0ZA 2QC7A 2CZ3A 1THXA 2X49A 4L0UA 5LNKe 4MPGA 4X1UA 2FNOA 2H71A 5IPGA 2HT9A 2WFCA 3GKNA 2B1LA 1O81A 2IL3A 5IPHA 1SJ6A 5H5RA 1KEBA 3O6TA 3DGQA 5JCGA 3UL3A 5INYA 5A34B 1LJRA 2IMDA 1QXHA 2WZSA 4K7IA 5EY6A 1FAAA 4EXJA 1O85A 3TGZA 5GSSA 5D96A 5HR2A 2XHFA 1M3IA 2DJJA 2PUKC 4TN8A 1JLVA 4TXOA 4ACSA 1Y25A 2E7PA 3RGBC 4DSQA 5DQSA 5A4WA 2I9HA 1V40A 3HCZA 4HU9A 3GH6A 4J57E 3UBKA 2GSRA 5A5HB 2V41A 3EU3A 4TR4A 2ALBA 1PKWA 1G7EA 3J7Yk 4KUNA 2HSNA 5F07A 4D73A 3FMWA 1PMTA 5AIXA 1ZZYA 2K8SA 3GRXA 2B5YA 3CMIA 1XVQA 1GL8A 4KGIA 1V9WA 5IOXA 4XS4B 1A2LA 4GRFA 1Z9HA 5JWRB 3ZRDA 3TRQA 2B5EA 2WVXA 2LRTA 3ZZXA 1GSYA 5DCGA 3CWGA 4K0NA 1X5DA 2B7KA 4O5RA 1S3RA 1Q98A 1SVMA 2DSAA 4RQRA 4HS1A 1K0AA 5D9WA 5G1LA 1GUMA 2YZUA 4XHMA 3DVWA 4NWYA 4AF2A 2DLXA 1R5PA 4YKFA 1T4YA 4I2UA 2R6KA 4L5OA 3UOMA 3KZQA 4PQIA 2AYTA 4EF0A 2AJQB 1SENA 17GSA 3H8QA 4ZB7A 4HU7A 1HNBA 5B8AA 2VM2A 3QMXA 2R5GA 4I8BA 3DWVA 4H86A 2GSSA 1URMA 5ELAA 3D21A 1A2JA 2L5LA 1I5GA 1RQMA 2X99A 3QAVA 2DJ0A 2ZCTA 3PR8A 3HJMA 4WF5A 4ZL8A 1X9SB 1YZXA 2FD3A 1OC3A 4O5UA 4Z2RA 1HYUA 5D9XA 4G01A 1V58A 3TJKA 3IOSA 1M3JA 4F82A 1TK8B 2IIYA 2KUCA 2GDRA 2RUEA 2UV8G 2I81A 1TU8A 4WBRD 5B7CA 1TK0B 4MP4A 5A34A 3CSIA 1MDIA 3BD2A 4K2XA 1T00A 2DKIA 5BMUB 2M80A 4MH3A 4LL1B 5J5NA 2OT3A 4ECIA 2JL4A 5F8BA 2XPDA 3KH7A 1BJXA 3GKKA 2HZEB 2JADA 3ZVJD 3CSHA 2LTKA 4J56E 2HE3A 3NOFA 1GTUA 1GNWA 2A4HA 1VGLA 3HA9A 4HOJA 4N10A 4IGJA 4MNNA 4EDYA 4N0ZA 3VPQA 1WJKA 2NPBA 1YKCA 3N5OA 2H30A 13GSA 3P90A 2HRKB 1ZL9A 4TVEA 4RI7A 2PVQA 1K0CA 2WRTA 3ZFLA 5DAKB 4IS0A 2LNTA 3HYPA 3A2WA 2K18A 3UAPA 4F9ZA 1IYIA 1GTBA 3WT1A 1VF1A 3F9UA 4HJ2A 3WT2A 5KN2A 2YWNA 4XIHA 3F3RA 3Q19A 1YEWC 2A2RA 1ZMAA 1JHBA 1XW6A 1J9BA 2TIRA 2FUG2 1B8XA 5EPFA 22GSA 3Q74A 5CNWA 1UVZA 4KB3A 2VLTA 3EC3A 1ZYEA 3U5RE 1SKSB 3IRAA 2H19A 4DSSA 1K3YA 5IOWA 4PURA 2LV3A 2WB9A 4KSMA 2H1AA 1FVKA 4ZB8A 4AJ8A 2F51A 1VRSD 1FOHA 4G0IA 1XXUA 2LJKA 2RM6A 5ECMB 1AAZA 4Q5QA 2O3EA 4NMUA 3HJPA 4K7OA 1EEMA 3CBUA 5HFIA 4K0GA 3A2VA 1NHOA 1WWJA 1TRSA 3LYPA 2ZNMA 5KOWA 5ABRA 1SK0A 3LW9A 2G0FA 1O6JA 3FR6A 1BQ7A 4MDCA 4G10A 2FY6A 5DBQA 4XRAA 2X8HA 2OACA 2GVPA 4CDOA 3W6GA 1S3CA 4I97A 1TRVA 4BVXB 4E68A 1TXXA 4KW6A 2C4JA 4JEDA 4EKZA 2V6OA 2OADA 5DALB 4PTSA 2C1YA 3KXOA 3A5IA 1THOA 1MDKA 3GN3A 4GLTA 1ZGNA 3VLNA 2HRNA 3VWXA 3BOAA 1EEJA 4N3ZA 1OKDA 3MYDA 2OE0A 2H6YA 1SL0B 2H1GA 1FOVA 1XFLA 1YJ6A 3RAZA 3W8JA 4YAPA 1GP1A 3TKSA 1B4PA 3G7JA 2G2QA 2IN3A 1U87A 1PL1A 2HZFA 1V98A 3HY2A 4MCUA 5CRHA 1OVNA 3ZREA 5J4UA 1MDJA 2CT6A 4HZ4A 2V2GA 1ERVA 2HRKA 3D6IA 4YH2A 2DBCA 5AISA 1YKAA 3VWVA 3I43A 3RBTA 1SU9A 1WPIA 2HSMB 4XTSA 4ZILA 2IMFA 4JZQA 2P5QA 4PUAA 1AQWA 1QK8A 1OKTA 5CAXA 3UARA 5A5KA 4DEJA 4ECBA 3CXGA 2F8AA 5IIZA 5IO2A 2LJRA 2A2PA 3TRXA 2I3YA 3FK8A 4LMWA 3EMPA 1M99A 3TJGA 2M72A 3APSA 4ICYA 1SL2B 5JWQB 4TR1B 4F03A 2MMAA 1J08A 4KSOA 4ZL7A 4ULXA 3IHQA 4ZBAA 1JZRA 3LXZA 16GSA 1F37A 2R2JA 2H72A 3K8NA 2PERA 4MABA 3F0IA 4AI6A 4HQZA 5CRWA 4WXTA 3KJYA 1I1IP 3EVIA 3GSTA 3FR3A 3TJJA 4WBJA 2F8FA 3ZL5A 1Z6NA 4EL1A 5DDLA 1U3AA 3RPPA 5A1NA 1XW9A 1Y6EA 4IW9A 1AC1A 1QUWA 2HSYA 2ON5A 3BJ5A 1QFNA 2EIOA 1Z7RA 3ERGA 1GLPA 2R3XA 2H75A 4BVXA 5A4UA 3M0FA 5DALA 3HZ8A 4FIWA 1F2EA 1T1VA 4ECCA 2O5VA 3ISOA 2C3QA 4V1Ag 1N8JA 1SVOA 4YKGA 4F2IA 4K5RA 1R26A 3MWHA 1GLQA 3GFKA 5G2ZA 2P0GA 4WR5A 5ECRB 2FWFA 3HVNA 4EIQA 3GHAA 3QOUA 1ML6A 6GSVA 3IAM2 3GX8A 2WW3A 2HFDA 2OBKA 4CW9A 4TXVA 5KN0A 2WVYA 3FZ9A 2J23A 4PQHA 2FWEA 1S4BP 3C8EA 3D4MA 3C73A 3QR6A 2O8VB 4POMA 4WF4A 1SYXA 5CRGA 4TKYA 5ECIB 4KDUA 4YQUA 3ZIJA 3IHGA 1F3BA 4E8EA 3EURA 2C0EA 2HSMA 1X9MB 5H5SA 2R37A 2L6DA 2DC5A 2IPAA 1JLWA 10GSA 4EIPA 4V1Ap 1ERTA 4LA1A 4QL7A 4IELA 1LU4A 5G5EA 1K0DA 3DRNA 1IYHA 3KMNA 1N2AA 3IBHA 5F06A 4ECJA 4AJ7A 2DMMA 2PPTA 5IQYA 1W89A 4AKHA 3KTBA 1TI3A 4IP6A 2HSHA 2WS2A 1M2DA 2E0QA 1X9WB 1TRWA 4TR1A 3LXTA 4V2MA 5G1KA 1BG5A 3LEFA 3L78A 5HFKA 3D22A 5ECKB 2WW1A 2H6XA 2KP2A 4IN0A 1YF0A 2VCWA 2DJ2A 2A2SA 5EL8A 1KNGA 1YDKA 1EGRA 2VIMA 3MNGA 3ZFBA 4LMVA 6GSSA 2MBSA 2OA7A 1BEDA 2DJKA 4FXYP 5D93A 3R2QA 1GSEA 3D5JA 2YV7A 2C80A 2UZ8A 4OCFA 2YWOA 4F0CA 2KP1A 3VI7A 3DIEA 3BCIA 3C71A 4OCEA 5ECOB 2OJLA 4TRXA 2ZUPA 3DXBA 2IMKA 4DSSB 2VD0A 4IQAA 2RIIA 2HQTA 2FWGA 4Z7XA 2YOIA 2HRAA 3M3MA 2H0IA 1PL2A 1YQ1A 3C1SA 3M1GA 5D9VA 1ILOA 1UC7A 3LORA 1GH2A 2FHEA 4JE1A 3IA1A 3KEBA 5DJLA 3FEUA 5ELGA 2YWIA 3TKQA 5GZZB 5H5QA 5HR0A 5FWGA 4AJ6A 3TRPA 2E2GA 3DVXA 1N25A 3FR9A 1K3LA 1PN9A 3SBCA 1TP9A 3QCPA 3OR5A 3BCKA 4KF9A 4MPFA 5J9CA 2JZTA 4IBPA 2QA2A 1T3BA 4KCEA 4HUAA 2NDOA 1M0UA 2PBJA 1A24A 2J9HA 1SJIA 3Q6OA 3LG6A 2TRCP 1K0NA 2HRFA 1K0MA 2GZPA 2N5AA 3KM6A 1A8LA 3TOUA 3ME8A 3NIVA 2YNXA 3TJBA 4O92A 1BF5A 1T4ZA 1TXUA 1M2BA 1O8WA 4POKA 2PVOC 4ZB6A 5CRDA 4JRRA 3UVHA 2O7KA 3CRTA 3A2XA 3F3QA 3D4TA 4JR4A 4HEA2 1ON4A 2C0GA 2WCIA 3I6AA 3EWLA 2VCTA 4AKXB 6GSXA 1SD9A 2CZ2A 2DMLA 2GSQA 4YQVA 3HVVA 2YANA 3HD5A 2V32A 3P8WA 3VK9A 3RHCA 3IDVA 4GQFA 1UN2A 2L59A 3IPZA 1A8YA 3ZMLA 2MZCA 3ZVJA 3E3EA 2CVBA 2JSYA 4PHZC 2B6MA 2AUVA 19GSA 4G19A 1XG8A 2P31A 2FA8A 5LD0A 4K9ZA 5J40A 4E8HA 2C0DA 2GQLA 5ECNB 4K2DA 5J4YA 4KNDA 3V1WA 3PPUA 2VCQA 4Q5FA 3AY8A 4G0LA 3GL3A 3RDWA 1K3OA 1XIYA 1E2YA 2QSIA 4MA9A 4V2LA 5F05A 2B7JA 3GL5A 5IM9A 3MIXA 2VKZG 3TUEA 4L5LA 5ECHB 2CVKA 4EE0A 4GF0A 3GUSA 2YPMA 2N5FA 3ERFA 1ST9A 1YF1A 2XBQA 4OFMA 1JZWA 3US3A 2GZYA 4OFTA 5A1NB 1BX9A 2DIYA 4NV5A 4FYUA 4BL7A 3NZNA 4POBA 2KLXA 2H6ZA 3BBYA 2R0GA 2H1BA 4ML1A 4ZBDA 2C0FA 1MTCA 1YVLA 5A4VA 4HDEA 4GCIA 5ECLB 3HDCA 2GSTA 4OO5A 3MDKA 4QMKA 4Z2TA 2AAWA 1DSBA 1TDIA 4L0WA 4ZBBA 1JFUA 1U88A 2CQ9A 2LKUA 1ZCPA 2FCHA 5B8BA 1NM3A 1ERWA 3F4SA 5EVOA 3R3EA 4CHSA 3TKSE 1SL1B 1EP7A 3FW2A 4GSTA 3P2AA 1U3IA 1AXDA 1WRYA 4LLRA 3EYTA 4MMMA 2F3MA 2E2MA 4CY6A 4OO4A 4N0VA 1C72A 1PRXA 1XZOA 1A23A 1WMJA 2FA4A 3HZ4A 4DSRA 3TU3B 3L9SA 3RPNA 2VOCA 4YQMA 2GLRA 4O7HA 4GDFA 4AKGA 1ABAA 4GXZA 2CV4A 3FY7A 3KIJA 1OE8A 3F4TA 3DKSA 2K9FA 2H01A 4QL9A 1GSUA 3VWUA 5F0GA 4DVCA 3EINA 1GTIA 4YAVA 4PNFA 3FZ4A 4JBBA 1Y1UA 2C8UA 2RUFA 4IP1A 3IC4A 4K5SA 1GSFA 4FYCA 1R5AA 2IFQA 2LRNA 1FB0A 5CYYA 5KN1A 2PN8A 1X5EA 2VL2A 2K6VA 1K0OA 1XPVA 1DUGA 2P5RA 1NHYA 3GYKA 9GSSA 4X43A 3RFRC 4ZL9A 4GWRA 1SKWB 4G2EA 2CA8A 4PGTA 3QPMA 4POLA 1AW9A 4IQ1A 2WJUA 2VCZA 3HVSA 1V2AA 1DE1A 4KDYA 2R0PA 4BWQA 1XWGA 1EOHA 2YCDA 3M8NA 5D73A 2I4AA 1A0FA 2X64A 4MF7A 4Z2UA 1OE7A 3N9JA 4I6XA 1M9BA 1ERUA 5GAND 2H70A 1EZKA 1SYRA 1JZDA 3GA4A 1GUHA 1G6YA 2H8LA 5B6MA 3IAS2 1ZYQB 2L5OA 1OC8A 3TDGA 3UBLA 2AHEA 2VL9A 4MJCA 5J41A 2LQQA 2EFCA 2GZZA 3M9JA 2IWTA 3ZIVA 3JCML 3HMJG 5JCUA 1EV9A 2JSZA 4TR0A 1GUKA 4MZBA 4GQCA 5FHIA 1MD3A 2YV9A 4NV2A 5DQYA 3LFLA 3QAWA 3M9KA 5ECPB 1F6MC 2GQMA 2HXKA 5DJMA 3I69A 3WYWA 5AIVA 4WETA 4G9HA 5BRTA 1MEKA 3FZAA 3GTUB 3E0UA 1EGOA 2VL2C 1B9XC 4PQ1A 1NSWA 1R4WA 2EFHA 2XBIA 2EFDA 4HSCX 5C00A 1G0TA 4KA0A 1HNAA 2O87A 1AIUA 5KEJA 4OWYA 2H74A 2A4VA 2QGVA 2H1DA 1AUCA 4IJIA 1O7UA 2QA1A 4HI7A 6GSUA 1QGVA 2GS3A 5CREA 4X0XA 6GSTA 3W8SA 1R7HA 1BYEA 6GSYA 3CTFA 2DJ1A 3VWWA 2EIQA 3CTGA 1YEPA 3G9BA 3KH9A 1RK4A 1XWBA 6GSWA 1FB6A 4NAXA 1KBNA 3F6DA 1XVWA 2NVLA 4F0BA 2LRCA 1G6WA 4MK3A 1GNEA 3QDNA 5E59A 5AGYA 7GSSA 3QD9A 3TKRA 3IK9A 3HHVA 3EPTA 1XW5A 1QMVA 1EV4A 2WDUA 1WIKA 2OE1A 3I9V2 4FH8A 3GX0A 3C1RA 2REMA 4OFNA 2VCVA 1YY7A 3TB2A 3GNJA 2PGTA 5IMCA 1GRXA 2I1UA 3TKPA 1Z5YE 4GTUA 1WE0A 4I5QA 5J3RA 1TJDA 1HD2A 2MMZA 1SKRB 2O85A 1XCCA 5D8IA 4EC0A 1QQ2A 3KP8A 1GSQA 3H79A 3KCMA 1SVLA 2BJXA 4WEYA 1RW1A 4OMVA 3GIXA 4KH7A 2FGXA 1FHEA 4KDXA 1G7OA 4O5QA 3MSZA 5IMFA 3ERWA 1F9MA 5ENUA 2KOKA 5GAPD 2C3TA 3O3TA 3FKFA 2HYXA 2JU5A 2LEGA 2VUPA 4RI6A 4ZXGA 3WGEA 1XWKA 2DIZA 3UEMA 1LBKA 1BAYA 1B4QA 5ID2B 1S3DA 5IMAA 4HJMA 3LWAA 2L6CA 4PXOA 3GTUA 4EO3A 4FYBA 4EDZA 2HI7A 4V2NA 1CQHA 4BL7B 2WW0A 3J7Yb 4X4JA 4N30A 3F4RA 1F3AA 1PGTA 4I2TA 3DEXA 4PX1A 2LUSA 1TTZA 2BTOT 1Z7PA 2HLSA 1SK2A 5HQPA 4XS1A 1H4OA 3UJ1A 1M7TA 4G0KA 2VD1A 3QFAC 1J0FA 2ON7A 4Q5RA 1BG1A 4TR3A 4LL4B 4PI0C 4HQSA 4OD7A 4P3YB 3HVXA 2EFEA 3WGDA 1PA3A 4BA7A 2DKHA 1PX7A 2EIRA 1PFOA 4K7NA 3CYNA 5G5FA 1PN0A 1S3AA 1CQGA 3F6FA 3TJFA 3UVTA 5CP1A 2WZ9A 3GKMA 1XOBA 1GSSA 3ZMKA 3PGTA 4BVYB 4MZWA 1EOGA 2TRXA 2YJ7A 1GWCA 3F8UA 3APQA 1XOAA 2OKAA 2GTUA 4WKWA 3UIWA 4KCAA 1ACVA 3P7XA 5A5HA 4NHZA 2B1KA 4KE3A 2B3SA 3GKXA 1GULA 2PMTA 5E4WA 2YP6A 4Q5NA 3WGXA 5C04A 2LSTA 2H76A 2R4VA 1TK5B 1TI1A 2CX3A 2BMXA 4J2FA 2B5XA 14GSA 3KMOA 2XPEA 4XS4A 4MF6A 4ZB9A 2H73A 2AB6A 3CHXC 2IFQB 1GSDA 3LJRA 2L4CA 2MBTA 3APOA 4JR6A 1Z6MA 1I9DA 4BIKA 3Q18A 4IKHA 1OC9B 3GV1A 2NTOA 4FQUA 2ES7A 3FHKA 3LQ7A 3VI5A 1V57A 2LNSA 2WVZA 4HZ2A 1PQNA 2LS5A 3A5WA 2WGRA 4ILFA 1UA5A 1TW9A 3L9VA 4PNGA 3VFIA 5ID2A 5HR3A 1A0RP 4QQ7A 4XRDA 1E6BA 4MJBA 2V6KA 1DBYA 2F9SA 2PU9C 5JWOB 2IMEA 1SK1A 1ZYNA 4ISDA 5AN1A 3ZTLA 3CSJA 4MJAA 5FT3A 3TOTA 3PINA 3LSZA 2JZSA 2DJ3A 2YZHA 2MYGA 1HQOA 2K8VA 4RQXA 1B9YC 1JZOA 11GSA 1XBSA 2H1LA 5DCHA 5KN3A 2VLUA 12GSA 1WP0A 3QFBC 3GMFA 8GSSA 2IJYA 5G31A 2L4QA 1H75A 4K6XA 5IMZA 2GT6A 3FYGA 1USBA 2WULA 2OE3A 1XWCA 1GTAA 3HJOA 5DVBA 3ZYWA 2AV4A 3L0HA 2YJHA 3EE2A 3WD6A 1O73A 5BMUA 3EU4A 2IMIA 3DYRA 2H0GA 4NPBA 1M9AA 5COHA 2CAIA 2L57A 4IVFA 1ZYPA 3ED3A 4N11A 3CQFA 4MF5A 4K8MA 4BVYA 2LQOA 1AQVA 2D2ZA 3IR4A 1PX6A 2HZEA 2N5BA 2CVDA 1NW2A 3KP9A 5IO0A 1EWXA 2GQKA 1SJZA 2JACA 2VCXA 2GT5A 2XC2A 2H66A 4ML6A 5G30A 2LJAA 2CX4A 4TW5A 1OYJA 3FRCA 4NXIA 1FVJA 2RM5A 3A3TA 3G7YA 3ZITA 5DAKA 2X8CA 4IJ3A 3QAGA 5CO3A 3KD0A 3F63A 4MH2A 4USSA 4PUFC 1T8EB 2VLVA 2KHPA 1HNCA 3SWLA 5J4VA 3VPTA 2VAFA 5D9TA 1YEXA 1K0BA 1A2MA 4KAEA 2RLIA 3DMLA 1PKZA 4GSNA 2PWJA 1VF2A 2V1MA 1M2AA 3H1NA 4ID0A 1OC9A 5GSTA 2MMOA 4XCSA 3H4KA 1FW1A 1TKDB 1AQXA 3IC8A 5LCZA 2CAQA 4BPYA 3IK7A 1X5CA 18GSA 4ZIJA 4TXOB 3MAKA 3S9FA 1WOUA 2O89A 1VF3A 4TOPA 4AGSA 3KGKA 4MLYA 1TOFA 5B6NA 2Z9SA 4A5PA 4L8EA 3IE3A 4MJEA 4K1FA 2FLSA 2YWMA 3LGCA 4FO5A 1ZOFA 3U6VA 5L71A 3GSSA 2FWHA 3IV4A 2HSNB 1FG4A 4D73B 3C7MA 3DD3A 1PD21 3ZLPA 1Q4JA 5IMDA 2HNLA 4KX4A 2MMNA 4WR4A 2M46A 3H93A 2O36A 3PH9A 5HFGA 3HXSA 2VO4A 3LYKA 2X4AA 3O76A 1PSQA 2QKEA 1T7PB 1Z3EA 2WVXB 4W66A 2VL3A 1O8XA 4RUVA 3VURA 4IHUA 4XS6A 2WW2A 3RHBA 5KOXA 2GGTA 4AKIA 4PI2C 3KTLA 5J9BA 5JCWA 3TKSC 2YN1A 5J47A
chains in the Genus database with same CATH topology
3G7IA 2X8GA 3TCOA 3IXRA 3ME7A 4GSSA 4EVMA 3CRUA 1X0RA 1DE2A 1MD4A 2OBIA 3L4NA 1FO5A 4EUYA 3UMAA 1W4VA 1TU7A 1XWAA 2EC4A 2H0HA 3L9UA 3GH9A 3GURA 1KTEA 3EMXA 1OAZA 3HKRA 2JZRA 5ECQB 5IMVA 5ECSA 2R0CA 20GSA 1U6TA 3FZ5A 3E9JB 5HR1A 4MZCA 4BWSA 1B48A 1TRUA 1EP8A 2VM1A 4CY8A 4O32A 1VF4A 4NHWA 2C3NA 4JU5A 1SD8A 2NBSA 3D0ZA 2QC7A 2CZ3A 1THXA 2X49A 4L0UA 5LNKe 4MPGA 4X1UA 2FNOA 2H71A 5IPGA 2HT9A 2WFCA 3GKNA 2B1LA 1O81A 2IL3A 5IPHA 1SJ6A 5H5RA 1KEBA 3O6TA 3DGQA 5JCGA 3UL3A 5INYA 5A34B 1LJRA 2IMDA 1QXHA 4K7IA 5EY6A 1FAAA 4EXJA 1O85A 3TGZA 5GSSA 5D96A 5HR2A 2XHFA 4TN8A 2DJJA 2PUKC 1JLVA 4TXOA 4ACSA 1Y25A 2E7PA 4DSQA 5DQSA 5A4WA 2I9HA 1V40A 3HCZA 4HU9A 3GH6A 4J57E 3UBKA 2GSRA 5A5HB 2V41A 3EU3A 4TR4A 2ALBA 1PKWA 1G7EA 3J7Yk 4KUNA 2HSNA 5F07A 4D73A 3FMWA 1PMTA 5AIXA 1ZZYA 2K8SA 3GRXA 2B5YA 3CMIA 1XVQA 1GL8A 4KGIA 1V9WA 5IOXA 4XS4B 1A2LA 4GRFA 1Z9HA 5JWRB 3ZRDA 3TRQA 2B5EA 2LRTA 3ZZXA 1GSYA 5DCGA 3CWGA 4K0NA 1X5DA 2B7KA 4O5RA 1Q98A 1SVMA 2DSAA 4RQRA 4HS1A 1K0AA 5D9WA 5G1LA 1GUMA 2YZUA 4XHMA 3DVWA 4NWYA 4AF2A 2DLXA 1R5PA 4YKFA 1T4YA 4I2UA 2R6KA 4L5OA 3UOMA 3KZQA 4PQIA 2AYTA 4EF0A 2AJQB 1SENA 17GSA 3H8QA 4ZB7A 4HU7A 1HNBA 5B8AA 2VM2A 3QMXA 2R5GA 4I8BA 3DWVA 4H86A 2GSSA 1URMA 5ELAA 3D21A 1A2JA 2L5LA 1I5GA 1RQMA 2X99A 3QAVA 2DJ0A 2ZCTA 3PR8A 3HJMA 4WF5A 4ZL8A 1X9SB 1YZXA 2FD3A 1OC3A 4O5UA 4Z2RA 1HYUA 5D9XA 4G01A 1V58A 3TJKA 3IOSA 4F82A 1TK8B 2IIYA 2KUCA 2GDRA 2RUEA 2UV8G 2I81A 1TU8A 4WBRD 5B7CA 1TK0B 4MP4A 5A34A 3CSIA 1MDIA 3BD2A 4K2XA 1T00A 2DKIA 5BMUB 2M80A 4MH3A 4LL1B 5J5NA 2OT3A 4ECIA 2JL4A 5F8BA 2XPDA 3KH7A 1BJXA 3GKKA 2HZEB 2JADA 3ZVJD 3CSHA 2LTKA 4J56E 2HE3A 3NOFA 1GTUA 1GNWA 2A4HA 1VGLA 3HA9A 4HOJA 4N10A 4IGJA 4MNNA 4EDYA 4N0ZA 3VPQA 1WJKA 2NPBA 1YKCA 3N5OA 2H30A 13GSA 3P90A 2HRKB 1ZL9A 4TVEA 4RI7A 2PVQA 1K0CA 2WRTA 3ZFLA 5DAKB 4IS0A 2LNTA 3HYPA 3A2WA 2K18A 3UAPA 4F9ZA 1IYIA 1GTBA 3WT1A 1VF1A 3F9UA 4HJ2A 3WT2A 5KN2A 2YWNA 4XIHA 3F3RA 3Q19A 2A2RA 1ZMAA 1JHBA 1XW6A 1J9BA 2TIRA 2FUG2 1B8XA 5EPFA 22GSA 3Q74A 5CNWA 1UVZA 4KB3A 2VLTA 3EC3A 1ZYEA 3U5RE 1SKSB 3IRAA 2H19A 4DSSA 1K3YA 5IOWA 4PURA 2LV3A 2WB9A 4KSMA 2H1AA 1FVKA 4ZB8A 4AJ8A 2F51A 1VRSD 1FOHA 4G0IA 1XXUA 2LJKA 2RM6A 5ECMB 1AAZA 4Q5QA 4NMUA 3HJPA 4K7OA 1EEMA 3CBUA 5HFIA 4K0GA 3A2VA 1NHOA 1WWJA 1TRSA 3LYPA 2ZNMA 5KOWA 5ABRA 1SK0A 3LW9A 2G0FA 1O6JA 3FR6A 1BQ7A 4MDCA 4G10A 2FY6A 5DBQA 4XRAA 2X8HA 2OACA 2GVPA 4CDOA 3W6GA 1S3CA 4I97A 1TRVA 4BVXB 4E68A 1TXXA 4KW6A 2C4JA 4JEDA 4EKZA 2V6OA 2OADA 5DALB 4PTSA 2C1YA 3KXOA 3A5IA 1THOA 1MDKA 3GN3A 4GLTA 1ZGNA 3VLNA 2HRNA 3VWXA 3BOAA 1EEJA 4N3ZA 1OKDA 3MYDA 2OE0A 2H6YA 1SL0B 2H1GA 1FOVA 1XFLA 1YJ6A 3RAZA 3W8JA 4YAPA 1GP1A 3TKSA 1B4PA 3G7JA 2G2QA 2IN3A 1U87A 1PL1A 2HZFA 1V98A 3HY2A 4MCUA 5CRHA 1OVNA 3ZREA 5J4UA 1MDJA 2CT6A 4HZ4A 2V2GA 1ERVA 2HRKA 3D6IA 4YH2A 2DBCA 5AISA 1YKAA 3VWVA 3I43A 3RBTA 1SU9A 1WPIA 2HSMB 4XTSA 4ZILA 2IMFA 4JZQA 2P5QA 4PUAA 1AQWA 1QK8A 1OKTA 5CAXA 3UARA 5A5KA 4DEJA 4ECBA 3CXGA 2F8AA 5IIZA 5IO2A 2LJRA 2A2PA 3TRXA 2I3YA 3FK8A 4LMWA 3EMPA 1M99A 3TJGA 2M72A 3APSA 4ICYA 1SL2B 5JWQB 4TR1B 4F03A 2MMAA 1J08A 4KSOA 4ZL7A 4ULXA 3IHQA 4ZBAA 1JZRA 3LXZA 16GSA 1F37A 2R2JA 2H72A 3K8NA 2PERA 4MABA 3F0IA 4AI6A 4HQZA 5CRWA 4WXTA 3KJYA 3EVIA 3GSTA 3FR3A 3TJJA 4WBJA 2F8FA 3ZL5A 1Z6NA 4EL1A 5DDLA 1U3AA 3RPPA 5A1NA 1XW9A 1Y6EA 4IW9A 1AC1A 1QUWA 2HSYA 2ON5A 3BJ5A 1QFNA 2EIOA 1Z7RA 3ERGA 1GLPA 2R3XA 2H75A 4BVXA 5A4UA 3M0FA 5DALA 3HZ8A 4FIWA 1F2EA 1T1VA 4ECCA 2O5VA 3ISOA 2C3QA 4V1Ag 1N8JA 1SVOA 4YKGA 4F2IA 4K5RA 1R26A 3MWHA 1GLQA 3GFKA 5G2ZA 2P0GA 4WR5A 5ECRB 2FWFA 4EIQA 3GHAA 3QOUA 1ML6A 6GSVA 3IAM2 3GX8A 2HFDA 2OBKA 4CW9A 4TXVA 5KN0A 3FZ9A 2J23A 4PQHA 2FWEA 3C8EA 3D4MA 3C73A 3QR6A 2O8VB 4POMA 4WF4A 1SYXA 5CRGA 4TKYA 5ECIB 4KDUA 4YQUA 3ZIJA 3IHGA 1F3BA 4E8EA 3EURA 2C0EA 2HSMA 1X9MB 5H5SA 2R37A 2L6DA 2DC5A 2IPAA 1JLWA 10GSA 4EIPA 4V1Ap 1ERTA 4LA1A 4QL7A 4IELA 1LU4A 5G5EA 1K0DA 3DRNA 1IYHA 3KMNA 1N2AA 3IBHA 5F06A 4ECJA 4AJ7A 2DMMA 2PPTA 5IQYA 1W89A 4AKHA 3KTBA 1TI3A 4IP6A 2HSHA 2WS2A 1M2DA 2E0QA 1X9WB 1TRWA 4TR1A 3LXTA 4V2MA 5G1KA 1BG5A 3LEFA 3L78A 5HFKA 3D22A 5ECKB 2H6XA 2KP2A 4IN0A 1YF0A 2VCWA 2DJ2A 2A2SA 5EL8A 1KNGA 1YDKA 1EGRA 2VIMA 3MNGA 3ZFBA 4LMVA 6GSSA 2MBSA 2OA7A 1BEDA 2DJKA 5D93A 3R2QA 1GSEA 3D5JA 2YV7A 2C80A 2UZ8A 4OCFA 2YWOA 4F0CA 2KP1A 3VI7A 3DIEA 3BCIA 3C71A 4OCEA 5ECOB 2OJLA 4TRXA 2ZUPA 3DXBA 2IMKA 4DSSB 2VD0A 4IQAA 2RIIA 2HQTA 2FWGA 4Z7XA 2YOIA 2HRAA 3M3MA 2H0IA 1PL2A 1YQ1A 3C1SA 3M1GA 5D9VA 1ILOA 1UC7A 3LORA 1GH2A 2FHEA 4JE1A 3IA1A 3KEBA 5DJLA 3FEUA 5ELGA 2YWIA 3TKQA 5GZZB 5H5QA 5HR0A 5FWGA 4AJ6A 3TRPA 2E2GA 3DVXA 1N25A 3FR9A 1K3LA 1PN9A 3SBCA 1TP9A 3QCPA 3OR5A 3BCKA 4KF9A 4MPFA 5J9CA 2JZTA 4IBPA 2QA2A 1T3BA 4KCEA 4HUAA 2NDOA 1M0UA 2PBJA 1A24A 2J9HA 1SJIA 3Q6OA 3LG6A 2TRCP 1K0NA 2HRFA 1K0MA 2GZPA 2N5AA 3KM6A 1A8LA 3TOUA 3ME8A 3NIVA 2YNXA 3TJBA 4O92A 1BF5A 1T4ZA 1TXUA 1M2BA 1O8WA 4POKA 2PVOC 4ZB6A 5CRDA 4JRRA 3UVHA 2O7KA 3CRTA 3A2XA 3F3QA 3D4TA 4JR4A 4HEA2 1ON4A 2C0GA 2WCIA 3I6AA 3EWLA 2VCTA 4AKXB 6GSXA 1SD9A 2CZ2A 2DMLA 2GSQA 4YQVA 3HVVA 2YANA 3HD5A 2V32A 3P8WA 3VK9A 3RHCA 3IDVA 4GQFA 1UN2A 2L59A 3IPZA 1A8YA 3ZMLA 2MZCA 3ZVJA 3E3EA 2CVBA 2JSYA 2B6MA 2AUVA 19GSA 4G19A 2P31A 2FA8A 5LD0A 4K9ZA 5J40A 4E8HA 2C0DA 2GQLA 5ECNB 4K2DA 5J4YA 4KNDA 3V1WA 3PPUA 2VCQA 4Q5FA 3AY8A 4G0LA 3GL3A 3RDWA 1K3OA 1XIYA 1E2YA 2QSIA 4MA9A 4V2LA 5F05A 2B7JA 3GL5A 5IM9A 3MIXA 2VKZG 3TUEA 4L5LA 5ECHB 2CVKA 4EE0A 4GF0A 3GUSA 2YPMA 2N5FA 3ERFA 1ST9A 1YF1A 2XBQA 4OFMA 1JZWA 3US3A 2GZYA 4OFTA 5A1NB 1BX9A 2DIYA 4NV5A 4FYUA 4BL7A 3NZNA 4POBA 2KLXA 2H6ZA 3BBYA 2R0GA 2H1BA 4ML1A 4ZBDA 2C0FA 1MTCA 1YVLA 5A4VA 4HDEA 4GCIA 5ECLB 3HDCA 2GSTA 4OO5A 3MDKA 4QMKA 4Z2TA 2AAWA 1DSBA 1TDIA 4L0WA 4ZBBA 1JFUA 1U88A 2CQ9A 2LKUA 1ZCPA 2FCHA 5B8BA 1NM3A 1ERWA 3F4SA 5EVOA 3R3EA 4CHSA 3TKSE 1SL1B 1EP7A 3FW2A 4GSTA 3P2AA 1U3IA 1AXDA 1WRYA 4LLRA 3EYTA 4MMMA 2F3MA 2E2MA 4CY6A 4OO4A 4N0VA 1C72A 1PRXA 1XZOA 1A23A 1WMJA 2FA4A 3HZ4A 4DSRA 3TU3B 3L9SA 3RPNA 2VOCA 4YQMA 2GLRA 4O7HA 4GDFA 4AKGA 1ABAA 4GXZA 2CV4A 3FY7A 3KIJA 1OE8A 3F4TA 3DKSA 2K9FA 2H01A 4QL9A 1GSUA 3VWUA 5F0GA 4DVCA 3EINA 1GTIA 4YAVA 4PNFA 3FZ4A 4JBBA 1Y1UA 2C8UA 2RUFA 4IP1A 3IC4A 4K5SA 1GSFA 4FYCA 1R5AA 2IFQA 2LRNA 1FB0A 5CYYA 5KN1A 2PN8A 1X5EA 2VL2A 2K6VA 1K0OA 1XPVA 1DUGA 2P5RA 1NHYA 3GYKA 9GSSA 4X43A 4ZL9A 4GWRA 1SKWB 4G2EA 2CA8A 4PGTA 3QPMA 4POLA 1AW9A 4IQ1A 2WJUA 2VCZA 3HVSA 1V2AA 1DE1A 4KDYA 2R0PA 4BWQA 1XWGA 1EOHA 2YCDA 3M8NA 5D73A 2I4AA 1A0FA 2X64A 4MF7A 4Z2UA 1OE7A 3N9JA 4I6XA 1M9BA 1ERUA 5GAND 2H70A 1EZKA 1SYRA 1JZDA 3GA4A 1GUHA 1G6YA 2H8LA 5B6MA 3IAS2 1ZYQB 2L5OA 1OC8A 3TDGA 3UBLA 2AHEA 2VL9A 4MJCA 5J41A 2LQQA 2EFCA 2GZZA 3M9JA 2IWTA 3ZIVA 3JCML 3HMJG 5JCUA 1EV9A 2JSZA 4TR0A 1GUKA 4MZBA 4GQCA 5FHIA 1MD3A 2YV9A 4NV2A 5DQYA 3LFLA 3QAWA 3M9KA 5ECPB 1F6MC 2GQMA 2HXKA 5DJMA 3I69A 3WYWA 5AIVA 4WETA 4G9HA 5BRTA 1MEKA 3FZAA 3GTUB 3E0UA 1EGOA 2VL2C 1B9XC 4PQ1A 1NSWA 1R4WA 2EFHA 2XBIA 2EFDA 5C00A 1G0TA 4KA0A 1HNAA 2O87A 1AIUA 5KEJA 4OWYA 2H74A 2A4VA 2QGVA 2H1DA 1AUCA 4IJIA 1O7UA 2QA1A 4HI7A 6GSUA 1QGVA 2GS3A 5CREA 4X0XA 6GSTA 3W8SA 1R7HA 1BYEA 6GSYA 3CTFA 2DJ1A 3VWWA 2EIQA 3CTGA 1YEPA 3G9BA 3KH9A 1RK4A 1XWBA 6GSWA 1FB6A 4NAXA 1KBNA 3F6DA 1XVWA 2NVLA 4F0BA 2LRCA 1G6WA 4MK3A 1GNEA 3QDNA 5E59A 5AGYA 7GSSA 3QD9A 3TKRA 3IK9A 3HHVA 3EPTA 1XW5A 1QMVA 1EV4A 2WDUA 1WIKA 2OE1A 3I9V2 4FH8A 3GX0A 3C1RA 2REMA 4OFNA 2VCVA 1YY7A 3TB2A 3GNJA 2PGTA 5IMCA 1GRXA 2I1UA 3TKPA 1Z5YE 4GTUA 1WE0A 4I5QA 5J3RA 1TJDA 1HD2A 2MMZA 1SKRB 2O85A 1XCCA 5D8IA 4EC0A 1QQ2A 3KP8A 1GSQA 3H79A 3KCMA 1SVLA 2BJXA 4WEYA 1RW1A 4OMVA 3GIXA 4KH7A 2FGXA 1FHEA 4KDXA 1G7OA 4O5QA 3MSZA 5IMFA 3ERWA 1F9MA 5ENUA 2KOKA 5GAPD 2C3TA 3O3TA 3FKFA 2HYXA 2JU5A 2LEGA 2VUPA 4RI6A 4ZXGA 3WGEA 1XWKA 2DIZA 3UEMA 1LBKA 1BAYA 1B4QA 5ID2B 1S3DA 5IMAA 4HJMA 3LWAA 2L6CA 4PXOA 3GTUA 4EO3A 4FYBA 4EDZA 2HI7A 4V2NA 1CQHA 4BL7B 3J7Yb 4X4JA 4N30A 3F4RA 1F3AA 1PGTA 4I2TA 3DEXA 4PX1A 2LUSA 1TTZA 2BTOT 1Z7PA 2HLSA 1SK2A 5HQPA 4XS1A 1H4OA 3UJ1A 1M7TA 4G0KA 2VD1A 3QFAC 1J0FA 2ON7A 4Q5RA 1BG1A 4TR3A 4LL4B 4HQSA 4OD7A 4P3YB 3HVXA 2EFEA 3WGDA 1PA3A 4BA7A 2DKHA 1PX7A 2EIRA 4K7NA 3CYNA 5G5FA 1PN0A 1S3AA 1CQGA 3F6FA 3TJFA 3UVTA 5CP1A 2WZ9A 3GKMA 1XOBA 1GSSA 3ZMKA 3PGTA 4BVYB 4MZWA 1EOGA 2TRXA 2YJ7A 1GWCA 3F8UA 3APQA 1XOAA 2OKAA 2GTUA 4WKWA 3UIWA 4KCAA 1ACVA 3P7XA 5A5HA 4NHZA 2B1KA 4KE3A 2B3SA 3GKXA 1GULA 2PMTA 5E4WA 2YP6A 4Q5NA 3WGXA 5C04A 2LSTA 2H76A 2R4VA 1TK5B 1TI1A 2CX3A 2BMXA 4J2FA 2B5XA 14GSA 3KMOA 2XPEA 4XS4A 4MF6A 4ZB9A 2H73A 2AB6A 2IFQB 1GSDA 3LJRA 2L4CA 2MBTA 3APOA 4JR6A 1Z6MA 1I9DA 3Q18A 4IKHA 1OC9B 3GV1A 2NTOA 4FQUA 2ES7A 3FHKA 3LQ7A 3VI5A 1V57A 2LNSA 1PQNA 4HZ2A 2LS5A 3A5WA 2WGRA 4ILFA 1UA5A 1TW9A 3L9VA 4PNGA 3VFIA 5ID2A 5HR3A 1A0RP 4QQ7A 4XRDA 1E6BA 4MJBA 2V6KA 1DBYA 2F9SA 2PU9C 5JWOB 2IMEA 1SK1A 1ZYNA 4ISDA 5AN1A 3ZTLA 3CSJA 4MJAA 5FT3A 3TOTA 3PINA 3LSZA 2JZSA 2DJ3A 2YZHA 2MYGA 1HQOA 2K8VA 4RQXA 1B9YC 1JZOA 11GSA 1XBSA 2H1LA 5DCHA 5KN3A 2VLUA 12GSA 1WP0A 3QFBC 3GMFA 8GSSA 2IJYA 5G31A 2L4QA 1H75A 4K6XA 5IMZA 2GT6A 3FYGA 1USBA 2WULA 2OE3A 1XWCA 1GTAA 3HJOA 5DVBA 3ZYWA 2AV4A 3L0HA 2YJHA 3EE2A 3WD6A 1O73A 5BMUA 3EU4A 2IMIA 3DYRA 2H0GA 4NPBA 1M9AA 5COHA 2CAIA 2L57A 4IVFA 1ZYPA 3ED3A 4N11A 4MF5A 4K8MA 4BVYA 2LQOA 1AQVA 2D2ZA 3IR4A 1PX6A 2HZEA 2N5BA 2CVDA 1NW2A 3KP9A 5IO0A 1EWXA 2GQKA 1SJZA 2JACA 2VCXA 2GT5A 2XC2A 2H66A 4ML6A 5G30A 2LJAA 2CX4A 4TW5A 1OYJA 3FRCA 4NXIA 1FVJA 2RM5A 3A3TA 3G7YA 3ZITA 5DAKA 2X8CA 4IJ3A 3QAGA 5CO3A 3KD0A 3F63A 4MH2A 4USSA 4PUFC 1T8EB 2VLVA 2KHPA 1HNCA 3SWLA 5J4VA 3VPTA 2VAFA 5D9TA 1YEXA 1K0BA 1A2MA 4KAEA 2RLIA 3DMLA 1PKZA 4GSNA 2PWJA 1VF2A 2V1MA 1M2AA 3H1NA 4ID0A 1OC9A 5GSTA 2MMOA 4XCSA 3H4KA 1FW1A 1TKDB 1AQXA 3IC8A 5LCZA 2CAQA 4BPYA 3IK7A 1X5CA 18GSA 4ZIJA 4TXOB 3MAKA 3S9FA 1WOUA 2O89A 1VF3A 4TOPA 4AGSA 3KGKA 4MLYA 1TOFA 5B6NA 2Z9SA 4A5PA 4L8EA 3IE3A 4MJEA 4K1FA 2FLSA 2YWMA 3LGCA 4FO5A 1ZOFA 3U6VA 5L71A 3GSSA 2FWHA 3IV4A 2HSNB 1FG4A 4D73B 3C7MA 3DD3A 1PD21 3ZLPA 1Q4JA 5IMDA 2HNLA 4KX4A 2MMNA 4WR4A 2M46A 3H93A 3PH9A 5HFGA 3HXSA 2VO4A 3LYKA 2X4AA 3O76A 1PSQA 2QKEA 1T7PB 1Z3EA 4W66A 2VL3A 1O8XA 4RUVA 3VURA 4IHUA 4XS6A 3RHBA 5KOXA 2GGTA 4AKIA 3KTLA 5J9BA 5JCWA 3TKSC 2YN1A 5J47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7I A;  2X8G A;  3TCO A;  3IXR A;  3ME7 A;  4GSS A;  4EVM A;  3CRU A;  1X0R A;  1DE2 A;  1MD4 A;  2OBI A;  3L4N A;  1FO5 A;  4EUY A;  3UMA A;  1W4V A;  1TU7 A;  1XWA A;  2EC4 A;  2H0H A;  3L9U A;  3GH9 A;  3GUR A;  1KTE A;  3EMX A;  1OAZ A;  3HKR A;  2JZR A;  5ECQ B;  5IMV A;  5ECS A;  20GS A;  1U6T A;  3FZ5 A;  3E9J B;  5HR1 A;  4MZC A;  4BWS A;  1B48 A;  1TRU A;  1EP8 A;  2VM1 A;  4O32 A;  1VF4 A;  4NHW A;  2C3N A;  4JU5 A;  1SD8 A;  2NBS A;  3D0Z A;  2QC7 A;  2CZ3 A;  1THX A;  4L0U A;  5LNK e;  4MPG A;  4X1U A;  2FNO A;  2H71 A;  5IPG A;  2HT9 A;  2WFC A;  3GKN A;  2B1L A;  1O81 A;  2IL3 A;  5IPH A;  1SJ6 A;  5H5R A;  1KEB A;  3O6T A;  3DGQ A;  5JCG A;  3UL3 A;  5INY A;  1LJR A;  2IMD A;  1QXH A;  4K7I A;  5EY6 A;  1FAA A;  4EXJ A;  1O85 A;  3TGZ A;  5GSS A;  5D96 A;  5HR2 A;  2XHF A;  4TN8 A;  2DJJ A;  2PUK C;  1JLV A;  4TXO A;  4ACS A;  1Y25 A;  2E7P A;  4DSQ A;  5DQS A;  5A4W A;  2I9H A;  1V40 A;  3HCZ A;  4HU9 A;  3GH6 A;  4J57 E;  3UBK A;  2GSR A;  2V41 A;  3EU3 A;  4TR4 A;  2ALB A;  1PKW A;  1G7E A;  3J7Y k;  4KUN A;  5F07 A;  4D73 A;  1PMT A;  5AIX A;  1ZZY A;  2K8S A;  3GRX A;  2B5Y A;  3CMI A;  1XVQ A;  1GL8 A;  4KGI A;  1V9W A;  5IOX A;  4XS4 B;  1A2L A;  4GRF A;  1Z9H A;  5JWR B;  3ZRD A;  3TRQ A;  2B5E A;  2LRT A;  3ZZX A;  1GSY A;  5DCG A;  4K0N A;  1X5D A;  2B7K A;  4O5R A;  1Q98 A;  2DSA A;  4RQR A;  4HS1 A;  1K0A A;  5D9W A;  5G1L A;  1GUM A;  2YZU A;  4XHM A;  3DVW A;  4NWY A;  4AF2 A;  2DLX A;  1R5P A;  1T4Y A;  4I2U A;  2R6K A;  4L5O A;  3UOM A;  3KZQ A;  4PQI A;  2AYT A;  4EF0 A;  2AJQ B;  1SEN A;  17GS A;  3H8Q A;  4HU7 A;  1HNB A;  5B8A A;  2VM2 A;  3QMX A;  2R5G A;  4I8B A;  3DWV A;  4H86 A;  2GSS A;  1URM A;  5ELA A;  3D21 A;  1A2J A;  2L5L A;  1I5G A;  1RQM A;  2X99 A;  3QAV A;  2DJ0 A;  2ZCT A;  3PR8 A;  3HJM A;  4WF5 A;  4ZL8 A;  1X9S B;  1YZX A;  2FD3 A;  1OC3 A;  1HYU A;  5D9X A;  1V58 A;  3TJK A;  3IOS A;  4F82 A;  1TK8 B;  2IIY A;  2KUC A;  2GDR A;  2RUE A;  2I81 A;  1TU8 A;  4WBR D;  5B7C A;  1TK0 B;  4MP4 A;  3CSI A;  1MDI A;  3BD2 A;  1T00 A;  2M80 A;  4MH3 A;  4LL1 B;  5J5N A;  4ECI A;  2JL4 A;  5F8B A;  2XPD A;  3KH7 A;  1BJX A;  3GKK A;  2HZE B;  2JAD A;  3ZVJ D;  3CSH A;  2LTK A;  4J56 E;  2HE3 A;  3NOF A;  1GTU A;  1GNW A;  1VGL A;  3HA9 A;  4HOJ A;  4N10 A;  4IGJ A;  4EDY A;  4N0Z A;  3VPQ A;  1WJK A;  2NPB A;  1YKC A;  3N5O A;  2H30 A;  13GS A;  3P90 A;  2HRK B;  1ZL9 A;  4TVE A;  4RI7 A;  2PVQ A;  1K0C A;  2WRT A;  3ZFL A;  5DAK B;  4IS0 A;  2LNT A;  3HYP A;  3A2W A;  2K18 A;  3UAP A;  4F9Z A;  1IYI A;  1GTB A;  3WT1 A;  1VF1 A;  3F9U A;  4HJ2 A;  3WT2 A;  5KN2 A;  2YWN A;  4XIH A;  3F3R A;  3Q19 A;  2A2R A;  1ZMA A;  1JHB A;  1XW6 A;  1J9B A;  2TIR A;  2FUG 2;  1B8X A;  5EPF A;  22GS A;  3Q74 A;  5CNW A;  1UVZ A;  4KB3 A;  2VLT A;  3EC3 A;  1ZYE A;  3U5R E;  1SKS B;  3IRA A;  2H19 A;  4DSS A;  1K3Y A;  5IOW A;  4PUR A;  2LV3 A;  2WB9 A;  4KSM A;  2H1A A;  1FVK A;  4ZB8 A;  4AJ8 A;  2F51 A;  1VRS D;  4G0I A;  1XXU A;  2LJK A;  2RM6 A;  5ECM B;  1AAZ A;  4Q5Q A;  4NMU A;  3HJP A;  4K7O A;  1EEM A;  3CBU A;  5HFI A;  4K0G A;  3A2V A;  1NHO A;  1WWJ A;  1TRS A;  3LYP A;  2ZNM A;  5ABR A;  1SK0 A;  2G0F A;  1O6J A;  3FR6 A;  1BQ7 A;  4MDC A;  4G10 A;  2FY6 A;  5DBQ A;  4XRA A;  2X8H A;  2OAC A;  2GVP A;  4CDO A;  3W6G A;  1S3C A;  4I97 A;  1TRV A;  4BVX B;  1TXX A;  4KW6 A;  2C4J A;  4JED A;  4EKZ A;  2V6O A;  2OAD A;  5DAL B;  4PTS A;  2C1Y A;  3KXO A;  1THO A;  1MDK A;  3GN3 A;  4GLT A;  1ZGN A;  3VLN A;  2HRN A;  3VWX A;  3BOA A;  1EEJ A;  1OKD A;  2OE0 A;  2H6Y A;  1SL0 B;  2H1G A;  1FOV A;  1XFL A;  1YJ6 A;  3RAZ A;  3W8J A;  4YAP A;  1GP1 A;  3TKS A;  1B4P A;  3G7J A;  2G2Q A;  2IN3 A;  1U87 A;  1PL1 A;  2HZF A;  1V98 A;  3HY2 A;  4MCU A;  5CRH A;  1OVN A;  3ZRE A;  5J4U A;  1MDJ A;  2CT6 A;  4HZ4 A;  2V2G A;  1ERV A;  2HRK A;  3D6I A;  4YH2 A;  2DBC A;  5AIS A;  1YKA A;  3VWV A;  3I43 A;  3RBT A;  1SU9 A;  1WPI A;  2HSM B;  4XTS A;  4ZIL A;  2IMF A;  4JZQ A;  2P5Q A;  4PUA A;  1AQW A;  1QK8 A;  1OKT A;  5CAX A;  3UAR A;  5A5K A;  4DEJ A;  4ECB A;  3CXG A;  2F8A A;  5IIZ A;  5IO2 A;  2LJR A;  3TRX A;  2I3Y A;  3FK8 A;  4LMW A;  3EMP A;  1M99 A;  3TJG A;  2M72 A;  3APS A;  1SL2 B;  5JWQ B;  4TR1 B;  4F03 A;  2MMA A;  1J08 A;  4KSO A;  4ZL7 A;  4ULX A;  3IHQ A;  4ZBA A;  1JZR A;  3LXZ A;  16GS A;  1F37 A;  2R2J A;  2H72 A;  3K8N A;  2PER A;  4MAB A;  3F0I A;  4HQZ A;  5CRW A;  4WXT A;  3KJY A;  3EVI A;  3GST A;  3FR3 A;  3TJJ A;  4WBJ A;  2F8F A;  3ZL5 A;  1Z6N A;  4EL1 A;  5DDL A;  1U3A A;  3RPP A;  1XW9 A;  1Y6E A;  4IW9 A;  1AC1 A;  1QUW A;  2HSY A;  2ON5 A;  3BJ5 A;  1QFN A;  2EIO A;  1Z7R A;  3ERG A;  1GLP A;  2R3X A;  2H75 A;  4BVX A;  5A4U A;  3M0F A;  5DAL A;  3HZ8 A;  4FIW A;  1F2E A;  1T1V A;  4ECC A;  3ISO A;  2C3Q A;  4V1A g;  1N8J A;  4F2I A;  1R26 A;  3MWH A;  1GLQ A;  3GFK A;  5G2Z A;  2P0G A;  4WR5 A;  5ECR B;  2FWF A;  3GHA A;  3QOU A;  1ML6 A;  6GSV A;  3IAM 2;  3GX8 A;  2HFD A;  2OBK A;  4CW9 A;  4TXV A;  5KN0 A;  3FZ9 A;  2J23 A;  4PQH A;  2FWE A;  3C8E A;  3D4M A;  3C73 A;  3QR6 A;  2O8V B;  4POM A;  4WF4 A;  1SYX A;  5CRG A;  4TKY A;  5ECI B;  4KDU A;  4YQU A;  3ZIJ A;  1F3B A;  4E8E A;  3EUR A;  2C0E A;  2HSM A;  1X9M B;  5H5S A;  2R37 A;  2L6D A;  2DC5 A;  2IPA A;  1JLW A;  10GS A;  4V1A p;  1ERT A;  4LA1 A;  4QL7 A;  4IEL A;  1LU4 A;  5G5E A;  1K0D A;  1IYH A;  3KMN A;  3DRN A;  1N2A A;  3IBH A;  5F06 A;  4ECJ A;  4AJ7 A;  2DMM A;  2PPT A;  5IQY A;  1W89 A;  3KTB A;  1TI3 A;  4IP6 A;  2HSH A;  2WS2 A;  1M2D A;  2E0Q A;  1X9W B;  1TRW A;  4TR1 A;  3LXT A;  4V2M A;  5G1K A;  1BG5 A;  3LEF A;  3L78 A;  5HFK A;  3D22 A;  5ECK B;  2H6X A;  2KP2 A;  4IN0 A;  1YF0 A;  2VCW A;  2DJ2 A;  2A2S A;  5EL8 A;  1KNG A;  1YDK A;  1EGR A;  2VIM A;  3MNG A;  3ZFB A;  4LMV A;  6GSS A;  2MBS A;  2OA7 A;  1BED A;  2DJK A;  5D93 A;  3R2Q A;  1GSE A;  3D5J A;  2YV7 A;  2C80 A;  2UZ8 A;  4OCF A;  2YWO A;  4F0C A;  2KP1 A;  3VI7 A;  3DIE A;  3BCI A;  3C71 A;  4OCE A;  5ECO B;  2OJL A;  4TRX A;  2ZUP A;  3DXB A;  2IMK A;  4DSS B;  2VD0 A;  4IQA A;  2RII A;  2HQT A;  2FWG A;  4Z7X A;  2YOI A;  2HRA A;  3M3M A;  2H0I A;  1PL2 A;  1YQ1 A;  3C1S A;  3M1G A;  5D9V A;  1ILO A;  1UC7 A;  3LOR A;  1GH2 A;  2FHE A;  4JE1 A;  3IA1 A;  3KEB A;  5DJL A;  3FEU A;  5ELG A;  2YWI A;  3TKQ A;  5GZZ B;  5H5Q A;  5HR0 A;  5FWG A;  4AJ6 A;  3TRP A;  2E2G A;  3DVX A;  3FR9 A;  1K3L A;  1PN9 A;  3SBC A;  3QCP A;  1TP9 A;  3OR5 A;  3BCK A;  4KF9 A;  4MPF A;  5J9C A;  2JZT A;  4IBP A;  1T3B A;  4KCE A;  4HUA A;  2NDO A;  1M0U A;  2PBJ A;  1A24 A;  2J9H A;  1SJI A;  3Q6O A;  3LG6 A;  2TRC P;  1K0N A;  2HRF A;  1K0M A;  2GZP A;  2N5A A;  3KM6 A;  1A8L A;  3TOU A;  3ME8 A;  3NIV A;  2YNX A;  3TJB A;  4O92 A;  1T4Z A;  1M2B A;  1O8W A;  4POK A;  2PVO C;  4ZB6 A;  5CRD A;  4JRR A;  3UVH A;  2O7K A;  3CRT A;  3A2X A;  3F3Q A;  3D4T A;  4JR4 A;  4HEA 2;  1ON4 A;  2C0G A;  2WCI A;  3I6A A;  3EWL A;  2VCT A;  6GSX A;  1SD9 A;  2CZ2 A;  2DML A;  2GSQ A;  4YQV A;  3HVV A;  2YAN A;  3HD5 A;  2V32 A;  3P8W A;  3VK9 A;  3RHC A;  3IDV A;  4GQF A;  1UN2 A;  2L59 A;  3IPZ A;  1A8Y A;  3ZML A;  2MZC A;  3ZVJ A;  3E3E A;  2CVB A;  2JSY A;  2B6M A;  2AUV A;  19GS A;  4G19 A;  2P31 A;  2FA8 A;  5LD0 A;  4K9Z A;  4E8H A;  2C0D A;  2GQL A;  5ECN B;  4K2D A;  4KND A;  3V1W A;  3PPU A;  2VCQ A;  4Q5F A;  3AY8 A;  4G0L A;  3GL3 A;  3RDW A;  1K3O A;  1XIY A;  1E2Y A;  2QSI A;  4MA9 A;  4V2L A;  5F05 A;  2B7J A;  3GL5 A;  5IM9 A;  3TUE A;  4L5L A;  5ECH B;  2CVK A;  4EE0 A;  4GF0 A;  3GUS A;  2YPM A;  2N5F A;  3ERF A;  1ST9 A;  1YF1 A;  2XBQ A;  4OFM A;  1JZW A;  3US3 A;  2GZY A;  4OFT A;  1BX9 A;  2DIY A;  4NV5 A;  4FYU A;  4BL7 A;  3NZN A;  4POB A;  2KLX A;  2H6Z A;  3BBY A;  2H1B A;  4ML1 A;  4ZBD A;  2C0F A;  1MTC A;  5A4V A;  4HDE A;  4GCI A;  5ECL B;  3HDC A;  2GST A;  4OO5 A;  3MDK A;  2AAW A;  1DSB A;  1TDI A;  4L0W A;  4ZBB A;  1JFU A;  1U88 A;  2CQ9 A;  2LKU A;  1ZCP A;  2FCH A;  5B8B A;  1NM3 A;  1ERW A;  3F4S A;  5EVO A;  3R3E A;  4CHS A;  3TKS E;  1SL1 B;  1EP7 A;  3FW2 A;  4GST A;  3P2A A;  1U3I A;  1AXD A;  1WRY A;  4LLR A;  3EYT A;  4MMM A;  2F3M A;  2E2M A;  4OO4 A;  4N0V A;  1C72 A;  1PRX A;  1XZO A;  1A23 A;  1WMJ A;  2FA4 A;  3HZ4 A;  4DSR A;  3L9S A;  3RPN A;  2VOC A;  4YQM A;  2GLR A;  4O7H A;  1ABA A;  4GXZ A;  2CV4 A;  3FY7 A;  3KIJ A;  1OE8 A;  3F4T A;  3DKS A;  2K9F A;  2H01 A;  4QL9 A;  1GSU A;  3VWU A;  5F0G A;  4DVC A;  3EIN A;  1GTI A;  4YAV A;  4PNF A;  3FZ4 A;  4JBB A;  2C8U A;  2RUF A;  4IP1 A;  3IC4 A;  1GSF A;  4FYC A;  1R5A A;  2IFQ A;  2LRN A;  1FB0 A;  5CYY A;  5KN1 A;  2PN8 A;  1X5E A;  2VL2 A;  2K6V A;  1K0O A;  1XPV A;  1DUG A;  2P5R A;  1NHY A;  3GYK A;  9GSS A;  4X43 A;  4ZL9 A;  4GWR A;  1SKW B;  4G2E A;  2CA8 A;  4PGT A;  3QPM A;  4POL A;  1AW9 A;  4IQ1 A;  2WJU A;  2VCZ A;  3HVS A;  1V2A A;  1DE1 A;  4KDY A;  4BWQ A;  1XWG A;  1EOH A;  2YCD A;  3M8N A;  5D73 A;  2I4A A;  1A0F A;  2X64 A;  4MF7 A;  1OE7 A;  3N9J A;  4I6X A;  1M9B A;  1ERU A;  5GAN D;  2H70 A;  1EZK A;  1SYR A;  1JZD A;  3GA4 A;  1GUH A;  1G6Y A;  2H8L A;  5B6M A;  3IAS 2;  1ZYQ B;  2L5O A;  1OC8 A;  3TDG A;  3UBL A;  2AHE A;  2VL9 A;  4MJC A;  5J41 A;  2LQQ A;  2GZZ A;  3M9J A;  2IWT A;  3ZIV A;  3JCM L;  5JCU A;  1EV9 A;  2JSZ A;  4TR0 A;  1GUK A;  4MZB A;  4GQC A;  5FHI A;  1MD3 A;  2YV9 A;  4NV2 A;  5DQY A;  3LFL A;  3QAW A;  3M9K A;  5ECP B;  1F6M C;  2GQM A;  2HXK A;  5DJM A;  3I69 A;  3WYW A;  5AIV A;  4WET A;  4G9H A;  1MEK A;  3FZA A;  3GTU B;  3E0U A;  1EGO A;  2VL2 C;  1B9X C;  4PQ1 A;  1NSW A;  1R4W A;  2XBI A;  5C00 A;  1G0T A;  4KA0 A;  1HNA A;  2O87 A;  1AIU A;  5KEJ A;  4OWY A;  2H74 A;  2A4V A;  2QGV A;  2H1D A;  1AUC A;  4IJI A;  1O7U A;  4HI7 A;  6GSU A;  1QGV A;  2GS3 A;  5CRE A;  4X0X A;  6GST A;  3W8S A;  1R7H A;  1BYE A;  6GSY A;  3CTF A;  2DJ1 A;  3VWW A;  2EIQ A;  3CTG A;  1YEP A;  3G9B A;  3KH9 A;  1RK4 A;  1XWB A;  6GSW A;  1FB6 A;  4NAX A;  1KBN A;  3F6D A;  1XVW A;  2NVL A;  4F0B A;  2LRC A;  1G6W A;  4MK3 A;  1GNE A;  3QDN A;  5E59 A;  5AGY A;  7GSS A;  3QD9 A;  3TKR A;  3IK9 A;  3HHV A;  1XW5 A;  1QMV A;  1EV4 A;  2WDU A;  1WIK A;  2OE1 A;  3I9V 2;  4FH8 A;  3GX0 A;  3C1R A;  2REM A;  4OFN A;  2VCV A;  1YY7 A;  3TB2 A;  3GNJ A;  2PGT A;  5IMC A;  1GRX A;  2I1U A;  3TKP A;  1Z5Y E;  4GTU A;  1WE0 A;  4I5Q A;  5J3R A;  1TJD A;  1HD2 A;  2MMZ A;  1SKR B;  2O85 A;  1XCC A;  5D8I A;  4EC0 A;  1QQ2 A;  3KP8 A;  1GSQ A;  3H79 A;  3KCM A;  2BJX A;  4WEY A;  1RW1 A;  4OMV A;  3GIX A;  4KH7 A;  2FGX A;  1FHE A;  4KDX A;  1G7O A;  3MSZ A;  5IMF A;  3ERW A;  1F9M A;  5ENU A;  2KOK A;  5GAP D;  2C3T A;  3O3T A;  3FKF A;  2HYX A;  2JU5 A;  2LEG A;  2VUP A;  4RI6 A;  4ZXG A;  3WGE A;  1XWK A;  2DIZ A;  3UEM A;  1LBK A;  1BAY A;  1B4Q A;  5ID2 B;  1S3D A;  5IMA A;  4HJM A;  3LWA A;  2L6C A;  4PXO A;  3GTU A;  4EO3 A;  4FYB A;  4EDZ A;  2HI7 A;  4V2N A;  1CQH A;  4BL7 B;  3J7Y b;  4N30 A;  3F4R A;  1F3A A;  1PGT A;  4I2T A;  3DEX A;  4PX1 A;  2LUS A;  1TTZ A;  2BTO T;  1Z7P A;  2HLS A;  1SK2 A;  5HQP A;  4XS1 A;  1H4O A;  3UJ1 A;  1M7T A;  4G0K A;  2VD1 A;  3QFA C;  1J0F A;  2ON7 A;  4Q5R A;  4TR3 A;  4LL4 B;  4HQS A;  4OD7 A;  4P3Y B;  3HVX A;  3WGD A;  1PA3 A;  4BA7 A;  1PX7 A;  2EIR A;  4K7N A;  3CYN A;  5G5F A;  1S3A A;  1CQG A;  3F6F A;  3TJF A;  3UVT A;  5CP1 A;  2WZ9 A;  3GKM A;  1XOB A;  1GSS A;  3ZMK A;  3PGT A;  4BVY B;  4MZW A;  1EOG A;  2TRX A;  2YJ7 A;  1GWC A;  3F8U A;  3APQ A;  1XOA A;  2OKA A;  2GTU A;  4WKW A;  3UIW A;  4KCA A;  1ACV A;  3P7X A;  4NHZ A;  2B1K A;  4KE3 A;  2B3S A;  3GKX A;  1GUL A;  2PMT A;  5E4W A;  2YP6 A;  4Q5N A;  3WGX A;  5C04 A;  2LST A;  2H76 A;  2R4V A;  1TK5 B;  1TI1 A;  2CX3 A;  2BMX A;  4J2F A;  2B5X A;  14GS A;  3KMO A;  2XPE A;  4XS4 A;  4MF6 A;  4ZB9 A;  2H73 A;  2AB6 A;  2IFQ B;  1GSD A;  3LJR A;  2L4C A;  2MBT A;  3APO A;  4JR6 A;  1Z6M A;  1I9D A;  3Q18 A;  4IKH A;  1OC9 B;  3GV1 A;  2NTO A;  4FQU A;  2ES7 A;  3FHK A;  3LQ7 A;  3VI5 A;  1V57 A;  2LNS A;  1PQN A;  4HZ2 A;  2LS5 A;  3A5W A;  2WGR A;  4ILF A;  1UA5 A;  1TW9 A;  3L9V A;  4PNG A;  3VFI A;  5ID2 A;  5HR3 A;  1A0R P;  4QQ7 A;  4XRD A;  1E6B A;  4MJB A;  2V6K A;  1DBY A;  2F9S A;  2PU9 C;  5JWO B;  2IME A;  1SK1 A;  4ISD A;  5AN1 A;  3ZTL A;  3CSJ A;  4MJA A;  5FT3 A;  3TOT A;  3PIN A;  3LSZ A;  2JZS A;  2DJ3 A;  2YZH A;  2MYG A;  1HQO A;  2K8V A;  4RQX A;  1B9Y C;  1JZO A;  11GS A;  1XBS A;  5DCH A;  5KN3 A;  2VLU A;  12GS A;  1WP0 A;  3QFB C;  3GMF A;  8GSS A;  2IJY A;  5G31 A;  2L4Q A;  1H75 A;  4K6X A;  5IMZ A;  2GT6 A;  3FYG A;  1USB A;  2WUL A;  2OE3 A;  1XWC A;  1GTA A;  3HJO A;  5DVB A;  3ZYW A;  2AV4 A;  3L0H A;  2YJH A;  3EE2 A;  3WD6 A;  1O73 A;  5BMU A;  3EU4 A;  2IMI A;  3DYR A;  2H0G A;  4NPB A;  1M9A A;  5COH A;  2CAI A;  2L57 A;  4IVF A;  3ED3 A;  4N11 A;  4MF5 A;  4K8M A;  4BVY A;  2LQO A;  1AQV A;  2D2Z A;  3IR4 A;  1PX6 A;  2HZE A;  2N5B A;  2CVD A;  1NW2 A;  3KP9 A;  5IO0 A;  1EWX A;  2GQK A;  1SJZ A;  2JAC A;  2VCX A;  2GT5 A;  2XC2 A;  2H66 A;  4ML6 A;  5G30 A;  2LJA A;  2CX4 A;  4TW5 A;  1OYJ A;  3FRC A;  4NXI A;  1FVJ A;  2RM5 A;  3A3T A;  3G7Y A;  3ZIT A;  5DAK A;  2X8C A;  4IJ3 A;  3QAG A;  5CO3 A;  3KD0 A;  3F63 A;  4MH2 A;  4USS A;  4PUF C;  1T8E B;  2VLV A;  2KHP A;  1HNC A;  3SWL A;  3VPT A;  2VAF A;  5D9T A;  1YEX A;  1K0B A;  1A2M A;  4KAE A;  2RLI A;  1PKZ A;  3DML A;  4GSN A;  2PWJ A;  1VF2 A;  2V1M A;  1M2A A;  3H1N A;  4ID0 A;  1OC9 A;  5GST A;  2MMO A;  4XCS A;  3H4K A;  1FW1 A;  1TKD B;  1AQX A;  3IC8 A;  5LCZ A;  2CAQ A;  4BPY A;  3IK7 A;  1X5C A;  18GS A;  4ZIJ A;  4TXO B;  3MAK A;  3S9F A;  1WOU A;  2O89 A;  1VF3 A;  4TOP A;  4AGS A;  3KGK A;  4MLY A;  1TOF A;  5B6N A;  2Z9S A;  4L8E A;  3IE3 A;  4MJE A;  4K1F A;  2FLS A;  2YWM A;  3LGC A;  4FO5 A;  1ZOF A;  3U6V A;  5L71 A;  3GSS A;  2FWH A;  3IV4 A;  2HSN B;  1FG4 A;  4D73 B;  3C7M A;  3DD3 A;  1PD2 1;  3ZLP A;  1Q4J A;  5IMD A;  2HNL A;  4KX4 A;  2MMN A;  4WR4 A;  2M46 A;  3H93 A;  3PH9 A;  5HFG A;  3HXS A;  2VO4 A;  3LYK A;  3O76 A;  1PSQ A;  2QKE A;  1T7P B;  1Z3E A;  2VL3 A;  1O8X A;  4RUV A;  3VUR A;  4IHU A;  4XS6 A;  3RHB A;  2GGT A;  3KTL A;  5J9B A;  5JCW A;  3TKS C;  2YN1 A; 
#chains in the Genus database with same CATH topology
 3G7I A;  2X8G A;  3TCO A;  3IXR A;  3ME7 A;  4GSS A;  4EVM A;  3CRU A;  1X0R A;  1DE2 A;  1MD4 A;  2OBI A;  3L4N A;  1FO5 A;  4EUY A;  3UMA A;  1W4V A;  1TU7 A;  1XWA A;  2EC4 A;  2H0H A;  3L9U A;  3GH9 A;  3GUR A;  1KTE A;  3EMX A;  1OAZ A;  3HKR A;  2JZR A;  5ECQ B;  5IMV A;  5ECS A;  2R0C A;  20GS A;  1U6T A;  3FZ5 A;  3E9J B;  5HR1 A;  4MZC A;  4BWS A;  1B48 A;  1TRU A;  1EP8 A;  2VM1 A;  4CY8 A;  4O32 A;  1VF4 A;  4NHW A;  2C3N A;  4JU5 A;  1SD8 A;  2NBS A;  3D0Z A;  2QC7 A;  2CZ3 A;  1THX A;  2X49 A;  4L0U A;  5LNK e;  4MPG A;  4X1U A;  2FNO A;  2H71 A;  5IPG A;  2HT9 A;  2WFC A;  3GKN A;  2B1L A;  1O81 A;  2IL3 A;  5IPH A;  1SJ6 A;  5H5R A;  1KEB A;  3O6T A;  3DGQ A;  5JCG A;  3UL3 A;  5INY A;  5A34 B;  1LJR A;  2IMD A;  1QXH A;  2WZS A;  4K7I A;  5EY6 A;  1FAA A;  4EXJ A;  1O85 A;  3TGZ A;  5GSS A;  5D96 A;  5HR2 A;  2XHF A;  1M3I A;  2DJJ A;  2PUK C;  4TN8 A;  1JLV A;  4TXO A;  4ACS A;  1Y25 A;  2E7P A;  3RGB C;  4DSQ A;  5DQS A;  5A4W A;  2I9H A;  1V40 A;  3HCZ A;  4HU9 A;  3GH6 A;  4J57 E;  3UBK A;  2GSR A;  5A5H B;  2V41 A;  3EU3 A;  4TR4 A;  2ALB A;  1PKW A;  1G7E A;  3J7Y k;  4KUN A;  2HSN A;  5F07 A;  4D73 A;  3FMW A;  1PMT A;  5AIX A;  1ZZY A;  2K8S A;  3GRX A;  2B5Y A;  3CMI A;  1XVQ A;  1GL8 A;  4KGI A;  1V9W A;  5IOX A;  4XS4 B;  1A2L A;  4GRF A;  1Z9H A;  5JWR B;  3ZRD A;  3TRQ A;  2B5E A;  2WVX A;  2LRT A;  3ZZX A;  1GSY A;  5DCG A;  3CWG A;  4K0N A;  1X5D A;  2B7K A;  4O5R A;  1S3R A;  1Q98 A;  1SVM A;  2DSA A;  4RQR A;  4HS1 A;  1K0A A;  5D9W A;  5G1L A;  1GUM A;  2YZU A;  4XHM A;  3DVW A;  4NWY A;  4AF2 A;  2DLX A;  1R5P A;  4YKF A;  1T4Y A;  4I2U A;  2R6K A;  4L5O A;  3UOM A;  3KZQ A;  4PQI A;  2AYT A;  4EF0 A;  2AJQ B;  1SEN A;  17GS A;  3H8Q A;  4ZB7 A;  4HU7 A;  1HNB A;  5B8A A;  2VM2 A;  3QMX A;  2R5G A;  4I8B A;  3DWV A;  4H86 A;  2GSS A;  1URM A;  5ELA A;  3D21 A;  1A2J A;  2L5L A;  1I5G A;  1RQM A;  2X99 A;  3QAV A;  2DJ0 A;  2ZCT A;  3PR8 A;  3HJM A;  4WF5 A;  4ZL8 A;  1X9S B;  1YZX A;  2FD3 A;  1OC3 A;  4O5U A;  4Z2R A;  1HYU A;  5D9X A;  4G01 A;  1V58 A;  3TJK A;  3IOS A;  1M3J A;  4F82 A;  1TK8 B;  2IIY A;  2KUC A;  2GDR A;  2RUE A;  2UV8 G;  2I81 A;  1TU8 A;  4WBR D;  5B7C A;  1TK0 B;  4MP4 A;  5A34 A;  3CSI A;  1MDI A;  3BD2 A;  4K2X A;  1T00 A;  2DKI A;  5BMU B;  2M80 A;  4MH3 A;  4LL1 B;  5J5N A;  2OT3 A;  4ECI A;  2JL4 A;  5F8B A;  2XPD A;  3KH7 A;  1BJX A;  3GKK A;  2HZE B;  2JAD A;  3ZVJ D;  3CSH A;  2LTK A;  4J56 E;  2HE3 A;  3NOF A;  1GTU A;  1GNW A;  2A4H A;  1VGL A;  3HA9 A;  4HOJ A;  4N10 A;  4IGJ A;  4MNN A;  4EDY A;  4N0Z A;  3VPQ A;  1WJK A;  2NPB A;  1YKC A;  3N5O A;  2H30 A;  13GS A;  3P90 A;  2HRK B;  1ZL9 A;  4TVE A;  4RI7 A;  2PVQ A;  1K0C A;  2WRT A;  3ZFL A;  5DAK B;  4IS0 A;  2LNT A;  3HYP A;  3A2W A;  2K18 A;  3UAP A;  4F9Z A;  1IYI A;  1GTB A;  3WT1 A;  1VF1 A;  3F9U A;  4HJ2 A;  3WT2 A;  5KN2 A;  2YWN A;  4XIH A;  3F3R A;  3Q19 A;  1YEW C;  2A2R A;  1ZMA A;  1JHB A;  1XW6 A;  1J9B A;  2TIR A;  2FUG 2;  1B8X A;  5EPF A;  22GS A;  3Q74 A;  5CNW A;  1UVZ A;  4KB3 A;  2VLT A;  3EC3 A;  1ZYE A;  3U5R E;  1SKS B;  3IRA A;  2H19 A;  4DSS A;  1K3Y A;  5IOW A;  4PUR A;  2LV3 A;  2WB9 A;  4KSM A;  2H1A A;  1FVK A;  4ZB8 A;  4AJ8 A;  2F51 A;  1VRS D;  1FOH A;  4G0I A;  1XXU A;  2LJK A;  2RM6 A;  5ECM B;  1AAZ A;  4Q5Q A;  2O3E A;  4NMU A;  3HJP A;  4K7O A;  1EEM A;  3CBU A;  5HFI A;  4K0G A;  3A2V A;  1NHO A;  1WWJ A;  1TRS A;  3LYP A;  2ZNM A;  5KOW A;  5ABR A;  1SK0 A;  3LW9 A;  2G0F A;  1O6J A;  3FR6 A;  1BQ7 A;  4MDC A;  4G10 A;  2FY6 A;  5DBQ A;  4XRA A;  2X8H A;  2OAC A;  2GVP A;  4CDO A;  3W6G A;  1S3C A;  4I97 A;  1TRV A;  4BVX B;  4E68 A;  1TXX A;  4KW6 A;  2C4J A;  4JED A;  4EKZ A;  2V6O A;  2OAD A;  5DAL B;  4PTS A;  2C1Y A;  3KXO A;  3A5I A;  1THO A;  1MDK A;  3GN3 A;  4GLT A;  1ZGN A;  3VLN A;  2HRN A;  3VWX A;  3BOA A;  1EEJ A;  4N3Z A;  1OKD A;  3MYD A;  2OE0 A;  2H6Y A;  1SL0 B;  2H1G A;  1FOV A;  1XFL A;  1YJ6 A;  3RAZ A;  3W8J A;  4YAP A;  1GP1 A;  3TKS A;  1B4P A;  3G7J A;  2G2Q A;  2IN3 A;  1U87 A;  1PL1 A;  2HZF A;  1V98 A;  3HY2 A;  4MCU A;  5CRH A;  1OVN A;  3ZRE A;  5J4U A;  1MDJ A;  2CT6 A;  4HZ4 A;  2V2G A;  1ERV A;  2HRK A;  3D6I A;  4YH2 A;  2DBC A;  5AIS A;  1YKA A;  3VWV A;  3I43 A;  3RBT A;  1SU9 A;  1WPI A;  2HSM B;  4XTS A;  4ZIL A;  2IMF A;  4JZQ A;  2P5Q A;  4PUA A;  1AQW A;  1QK8 A;  1OKT A;  5CAX A;  3UAR A;  5A5K A;  4DEJ A;  4ECB A;  3CXG A;  2F8A A;  5IIZ A;  5IO2 A;  2LJR A;  2A2P A;  3TRX A;  2I3Y A;  3FK8 A;  4LMW A;  3EMP A;  1M99 A;  3TJG A;  2M72 A;  3APS A;  4ICY A;  1SL2 B;  5JWQ B;  4TR1 B;  4F03 A;  2MMA A;  1J08 A;  4KSO A;  4ZL7 A;  4ULX A;  3IHQ A;  4ZBA A;  1JZR A;  3LXZ A;  16GS A;  1F37 A;  2R2J A;  2H72 A;  3K8N A;  2PER A;  4MAB A;  3F0I A;  4AI6 A;  4HQZ A;  5CRW A;  4WXT A;  3KJY A;  1I1I P;  3EVI A;  3GST A;  3FR3 A;  3TJJ A;  4WBJ A;  2F8F A;  3ZL5 A;  1Z6N A;  4EL1 A;  5DDL A;  1U3A A;  3RPP A;  5A1N A;  1XW9 A;  1Y6E A;  4IW9 A;  1AC1 A;  1QUW A;  2HSY A;  2ON5 A;  3BJ5 A;  1QFN A;  2EIO A;  1Z7R A;  3ERG A;  1GLP A;  2R3X A;  2H75 A;  4BVX A;  5A4U A;  3M0F A;  5DAL A;  3HZ8 A;  4FIW A;  1F2E A;  1T1V A;  4ECC A;  2O5V A;  3ISO A;  2C3Q A;  4V1A g;  1N8J A;  1SVO A;  4YKG A;  4F2I A;  4K5R A;  1R26 A;  3MWH A;  1GLQ A;  3GFK A;  5G2Z A;  2P0G A;  4WR5 A;  5ECR B;  2FWF A;  3HVN A;  4EIQ A;  3GHA A;  3QOU A;  1ML6 A;  6GSV A;  3IAM 2;  3GX8 A;  2WW3 A;  2HFD A;  2OBK A;  4CW9 A;  4TXV A;  5KN0 A;  2WVY A;  3FZ9 A;  2J23 A;  4PQH A;  2FWE A;  1S4B P;  3C8E A;  3D4M A;  3C73 A;  3QR6 A;  2O8V B;  4POM A;  4WF4 A;  1SYX A;  5CRG A;  4TKY A;  5ECI B;  4KDU A;  4YQU A;  3ZIJ A;  3IHG A;  1F3B A;  4E8E A;  3EUR A;  2C0E A;  2HSM A;  1X9M B;  5H5S A;  2R37 A;  2L6D A;  2DC5 A;  2IPA A;  1JLW A;  10GS A;  4EIP A;  4V1A p;  1ERT A;  4LA1 A;  4QL7 A;  4IEL A;  1LU4 A;  5G5E A;  1K0D A;  3DRN A;  1IYH A;  3KMN A;  1N2A A;  3IBH A;  5F06 A;  4ECJ A;  4AJ7 A;  2DMM A;  2PPT A;  5IQY A;  1W89 A;  4AKH A;  3KTB A;  1TI3 A;  4IP6 A;  2HSH A;  2WS2 A;  1M2D A;  2E0Q A;  1X9W B;  1TRW A;  4TR1 A;  3LXT A;  4V2M A;  5G1K A;  1BG5 A;  3LEF A;  3L78 A;  5HFK A;  3D22 A;  5ECK B;  2WW1 A;  2H6X A;  2KP2 A;  4IN0 A;  1YF0 A;  2VCW A;  2DJ2 A;  2A2S A;  5EL8 A;  1KNG A;  1YDK A;  1EGR A;  2VIM A;  3MNG A;  3ZFB A;  4LMV A;  6GSS A;  2MBS A;  2OA7 A;  1BED A;  2DJK A;  4FXY P;  5D93 A;  3R2Q A;  1GSE A;  3D5J A;  2YV7 A;  2C80 A;  2UZ8 A;  4OCF A;  2YWO A;  4F0C A;  2KP1 A;  3VI7 A;  3DIE A;  3BCI A;  3C71 A;  4OCE A;  5ECO B;  2OJL A;  4TRX A;  2ZUP A;  3DXB A;  2IMK A;  4DSS B;  2VD0 A;  4IQA A;  2RII A;  2HQT A;  2FWG A;  4Z7X A;  2YOI A;  2HRA A;  3M3M A;  2H0I A;  1PL2 A;  1YQ1 A;  3C1S A;  3M1G A;  5D9V A;  1ILO A;  1UC7 A;  3LOR A;  1GH2 A;  2FHE A;  4JE1 A;  3IA1 A;  3KEB A;  5DJL A;  3FEU A;  5ELG A;  2YWI A;  3TKQ A;  5GZZ B;  5H5Q A;  5HR0 A;  5FWG A;  4AJ6 A;  3TRP A;  2E2G A;  3DVX A;  1N25 A;  3FR9 A;  1K3L A;  1PN9 A;  3SBC A;  1TP9 A;  3QCP A;  3OR5 A;  3BCK A;  4KF9 A;  4MPF A;  5J9C A;  2JZT A;  4IBP A;  2QA2 A;  1T3B A;  4KCE A;  4HUA A;  2NDO A;  1M0U A;  2PBJ A;  1A24 A;  2J9H A;  1SJI A;  3Q6O A;  3LG6 A;  2TRC P;  1K0N A;  2HRF A;  1K0M A;  2GZP A;  2N5A A;  3KM6 A;  1A8L A;  3TOU A;  3ME8 A;  3NIV A;  2YNX A;  3TJB A;  4O92 A;  1BF5 A;  1T4Z A;  1TXU A;  1M2B A;  1O8W A;  4POK A;  2PVO C;  4ZB6 A;  5CRD A;  4JRR A;  3UVH A;  2O7K A;  3CRT A;  3A2X A;  3F3Q A;  3D4T A;  4JR4 A;  4HEA 2;  1ON4 A;  2C0G A;  2WCI A;  3I6A A;  3EWL A;  2VCT A;  4AKX B;  6GSX A;  1SD9 A;  2CZ2 A;  2DML A;  2GSQ A;  4YQV A;  3HVV A;  2YAN A;  3HD5 A;  2V32 A;  3P8W A;  3VK9 A;  3RHC A;  3IDV A;  4GQF A;  1UN2 A;  2L59 A;  3IPZ A;  1A8Y A;  3ZML A;  2MZC A;  3ZVJ A;  3E3E A;  2CVB A;  2JSY A;  4PHZ C;  2B6M A;  2AUV A;  19GS A;  4G19 A;  1XG8 A;  2P31 A;  2FA8 A;  5LD0 A;  4K9Z A;  5J40 A;  4E8H A;  2C0D A;  2GQL A;  5ECN B;  4K2D A;  5J4Y A;  4KND A;  3V1W A;  3PPU A;  2VCQ A;  4Q5F A;  3AY8 A;  4G0L A;  3GL3 A;  3RDW A;  1K3O A;  1XIY A;  1E2Y A;  2QSI A;  4MA9 A;  4V2L A;  5F05 A;  2B7J A;  3GL5 A;  5IM9 A;  3MIX A;  2VKZ G;  3TUE A;  4L5L A;  5ECH B;  2CVK A;  4EE0 A;  4GF0 A;  3GUS A;  2YPM A;  2N5F A;  3ERF A;  1ST9 A;  1YF1 A;  2XBQ A;  4OFM A;  1JZW A;  3US3 A;  2GZY A;  4OFT A;  5A1N B;  1BX9 A;  2DIY A;  4NV5 A;  4FYU A;  4BL7 A;  3NZN A;  4POB A;  2KLX A;  2H6Z A;  3BBY A;  2R0G A;  2H1B A;  4ML1 A;  4ZBD A;  2C0F A;  1MTC A;  1YVL A;  5A4V A;  4HDE A;  4GCI A;  5ECL B;  3HDC A;  2GST A;  4OO5 A;  3MDK A;  4QMK A;  4Z2T A;  2AAW A;  1DSB A;  1TDI A;  4L0W A;  4ZBB A;  1JFU A;  1U88 A;  2CQ9 A;  2LKU A;  1ZCP A;  2FCH A;  5B8B A;  1NM3 A;  1ERW A;  3F4S A;  5EVO A;  3R3E A;  4CHS A;  3TKS E;  1SL1 B;  1EP7 A;  3FW2 A;  4GST A;  3P2A A;  1U3I A;  1AXD A;  1WRY A;  4LLR A;  3EYT A;  4MMM A;  2F3M A;  2E2M A;  4CY6 A;  4OO4 A;  4N0V A;  1C72 A;  1PRX A;  1XZO A;  1A23 A;  1WMJ A;  2FA4 A;  3HZ4 A;  4DSR A;  3TU3 B;  3L9S A;  3RPN A;  2VOC A;  4YQM A;  2GLR A;  4O7H A;  4GDF A;  4AKG A;  1ABA A;  4GXZ A;  2CV4 A;  3FY7 A;  3KIJ A;  1OE8 A;  3F4T A;  3DKS A;  2K9F A;  2H01 A;  4QL9 A;  1GSU A;  3VWU A;  5F0G A;  4DVC A;  3EIN A;  1GTI A;  4YAV A;  4PNF A;  3FZ4 A;  4JBB A;  1Y1U A;  2C8U A;  2RUF A;  4IP1 A;  3IC4 A;  4K5S A;  1GSF A;  4FYC A;  1R5A A;  2IFQ A;  2LRN A;  1FB0 A;  5CYY A;  5KN1 A;  2PN8 A;  1X5E A;  2VL2 A;  2K6V A;  1K0O A;  1XPV A;  1DUG A;  2P5R A;  1NHY A;  3GYK A;  9GSS A;  4X43 A;  3RFR C;  4ZL9 A;  4GWR A;  1SKW B;  4G2E A;  2CA8 A;  4PGT A;  3QPM A;  4POL A;  1AW9 A;  4IQ1 A;  2WJU A;  2VCZ A;  3HVS A;  1V2A A;  1DE1 A;  4KDY A;  2R0P A;  4BWQ A;  1XWG A;  1EOH A;  2YCD A;  3M8N A;  5D73 A;  2I4A A;  1A0F A;  2X64 A;  4MF7 A;  4Z2U A;  1OE7 A;  3N9J A;  4I6X A;  1M9B A;  1ERU A;  5GAN D;  2H70 A;  1EZK A;  1SYR A;  1JZD A;  3GA4 A;  1GUH A;  1G6Y A;  2H8L A;  5B6M A;  3IAS 2;  1ZYQ B;  2L5O A;  1OC8 A;  3TDG A;  3UBL A;  2AHE A;  2VL9 A;  4MJC A;  5J41 A;  2LQQ A;  2EFC A;  2GZZ A;  3M9J A;  2IWT A;  3ZIV A;  3JCM L;  3HMJ G;  5JCU A;  1EV9 A;  2JSZ A;  4TR0 A;  1GUK A;  4MZB A;  4GQC A;  5FHI A;  1MD3 A;  2YV9 A;  4NV2 A;  5DQY A;  3LFL A;  3QAW A;  3M9K A;  5ECP B;  1F6M C;  2GQM A;  2HXK A;  5DJM A;  3I69 A;  3WYW A;  5AIV A;  4WET A;  4G9H A;  5BRT A;  1MEK A;  3FZA A;  3GTU B;  3E0U A;  1EGO A;  2VL2 C;  1B9X C;  4PQ1 A;  1NSW A;  1R4W A;  2EFH A;  2XBI A;  2EFD A;  4HSC X;  5C00 A;  1G0T A;  4KA0 A;  1HNA A;  2O87 A;  1AIU A;  5KEJ A;  4OWY A;  2H74 A;  2A4V A;  2QGV A;  2H1D A;  1AUC A;  4IJI A;  1O7U A;  2QA1 A;  4HI7 A;  6GSU A;  1QGV A;  2GS3 A;  5CRE A;  4X0X A;  6GST A;  3W8S A;  1R7H A;  1BYE A;  6GSY A;  3CTF A;  2DJ1 A;  3VWW A;  2EIQ A;  3CTG A;  1YEP A;  3G9B A;  3KH9 A;  1RK4 A;  1XWB A;  6GSW A;  1FB6 A;  4NAX A;  1KBN A;  3F6D A;  1XVW A;  2NVL A;  4F0B A;  2LRC A;  1G6W A;  4MK3 A;  1GNE A;  3QDN A;  5E59 A;  5AGY A;  7GSS A;  3QD9 A;  3TKR A;  3IK9 A;  3HHV A;  3EPT A;  1XW5 A;  1QMV A;  1EV4 A;  2WDU A;  1WIK A;  2OE1 A;  3I9V 2;  4FH8 A;  3GX0 A;  3C1R A;  2REM A;  4OFN A;  2VCV A;  1YY7 A;  3TB2 A;  3GNJ A;  2PGT A;  5IMC A;  1GRX A;  2I1U A;  3TKP A;  1Z5Y E;  4GTU A;  1WE0 A;  4I5Q A;  5J3R A;  1TJD A;  1HD2 A;  2MMZ A;  1SKR B;  2O85 A;  1XCC A;  5D8I A;  4EC0 A;  1QQ2 A;  3KP8 A;  1GSQ A;  3H79 A;  3KCM A;  1SVL A;  2BJX A;  4WEY A;  1RW1 A;  4OMV A;  3GIX A;  4KH7 A;  2FGX A;  1FHE A;  4KDX A;  1G7O A;  4O5Q A;  3MSZ A;  5IMF A;  3ERW A;  1F9M A;  5ENU A;  2KOK A;  5GAP D;  2C3T A;  3O3T A;  3FKF A;  2HYX A;  2JU5 A;  2LEG A;  2VUP A;  4RI6 A;  4ZXG A;  3WGE A;  1XWK A;  2DIZ A;  3UEM A;  1LBK A;  1BAY A;  1B4Q A;  5ID2 B;  1S3D A;  5IMA A;  4HJM A;  3LWA A;  2L6C A;  4PXO A;  3GTU A;  4EO3 A;  4FYB A;  4EDZ A;  2HI7 A;  4V2N A;  1CQH A;  4BL7 B;  2WW0 A;  3J7Y b;  4X4J A;  4N30 A;  3F4R A;  1F3A A;  1PGT A;  4I2T A;  3DEX A;  4PX1 A;  2LUS A;  1TTZ A;  2BTO T;  1Z7P A;  2HLS A;  1SK2 A;  5HQP A;  4XS1 A;  1H4O A;  3UJ1 A;  1M7T A;  4G0K A;  2VD1 A;  3QFA C;  1J0F A;  2ON7 A;  4Q5R A;  1BG1 A;  4TR3 A;  4LL4 B;  4PI0 C;  4HQS A;  4OD7 A;  4P3Y B;  3HVX A;  2EFE A;  3WGD A;  1PA3 A;  4BA7 A;  2DKH A;  1PX7 A;  2EIR A;  1PFO A;  4K7N A;  3CYN A;  5G5F A;  1PN0 A;  1S3A A;  1CQG A;  3F6F A;  3TJF A;  3UVT A;  5CP1 A;  2WZ9 A;  3GKM A;  1XOB A;  1GSS A;  3ZMK A;  3PGT A;  4BVY B;  4MZW A;  1EOG A;  2TRX A;  2YJ7 A;  1GWC A;  3F8U A;  3APQ A;  1XOA A;  2OKA A;  2GTU A;  4WKW A;  3UIW A;  4KCA A;  1ACV A;  3P7X A;  5A5H A;  4NHZ A;  2B1K A;  4KE3 A;  2B3S A;  3GKX A;  1GUL A;  2PMT A;  5E4W A;  2YP6 A;  4Q5N A;  3WGX A;  5C04 A;  2LST A;  2H76 A;  2R4V A;  1TK5 B;  1TI1 A;  2CX3 A;  2BMX A;  4J2F A;  2B5X A;  14GS A;  3KMO A;  2XPE A;  4XS4 A;  4MF6 A;  4ZB9 A;  2H73 A;  2AB6 A;  3CHX C;  2IFQ B;  1GSD A;  3LJR A;  2L4C A;  2MBT A;  3APO A;  4JR6 A;  1Z6M A;  1I9D A;  4BIK A;  3Q18 A;  4IKH A;  1OC9 B;  3GV1 A;  2NTO A;  4FQU A;  2ES7 A;  3FHK A;  3LQ7 A;  3VI5 A;  1V57 A;  2LNS A;  2WVZ A;  4HZ2 A;  1PQN A;  2LS5 A;  3A5W A;  2WGR A;  4ILF A;  1UA5 A;  1TW9 A;  3L9V A;  4PNG A;  3VFI A;  5ID2 A;  5HR3 A;  1A0R P;  4QQ7 A;  4XRD A;  1E6B A;  4MJB A;  2V6K A;  1DBY A;  2F9S A;  2PU9 C;  5JWO B;  2IME A;  1SK1 A;  1ZYN A;  4ISD A;  5AN1 A;  3ZTL A;  3CSJ A;  4MJA A;  5FT3 A;  3TOT A;  3PIN A;  3LSZ A;  2JZS A;  2DJ3 A;  2YZH A;  2MYG A;  1HQO A;  2K8V A;  4RQX A;  1B9Y C;  1JZO A;  11GS A;  1XBS A;  2H1L A;  5DCH A;  5KN3 A;  2VLU A;  12GS A;  1WP0 A;  3QFB C;  3GMF A;  8GSS A;  2IJY A;  5G31 A;  2L4Q A;  1H75 A;  4K6X A;  5IMZ A;  2GT6 A;  3FYG A;  1USB A;  2WUL A;  2OE3 A;  1XWC A;  1GTA A;  3HJO A;  5DVB A;  3ZYW A;  2AV4 A;  3L0H A;  2YJH A;  3EE2 A;  3WD6 A;  1O73 A;  5BMU A;  3EU4 A;  2IMI A;  3DYR A;  2H0G A;  4NPB A;  1M9A A;  5COH A;  2CAI A;  2L57 A;  4IVF A;  1ZYP A;  3ED3 A;  4N11 A;  3CQF A;  4MF5 A;  4K8M A;  4BVY A;  2LQO A;  1AQV A;  2D2Z A;  3IR4 A;  1PX6 A;  2HZE A;  2N5B A;  2CVD A;  1NW2 A;  3KP9 A;  5IO0 A;  1EWX A;  2GQK A;  1SJZ A;  2JAC A;  2VCX A;  2GT5 A;  2XC2 A;  2H66 A;  4ML6 A;  5G30 A;  2LJA A;  2CX4 A;  4TW5 A;  1OYJ A;  3FRC A;  4NXI A;  1FVJ A;  2RM5 A;  3A3T A;  3G7Y A;  3ZIT A;  5DAK A;  2X8C A;  4IJ3 A;  3QAG A;  5CO3 A;  3KD0 A;  3F63 A;  4MH2 A;  4USS A;  4PUF C;  1T8E B;  2VLV A;  2KHP A;  1HNC A;  3SWL A;  5J4V A;  3VPT A;  2VAF A;  5D9T A;  1YEX A;  1K0B A;  1A2M A;  4KAE A;  2RLI A;  3DML A;  1PKZ A;  4GSN A;  2PWJ A;  1VF2 A;  2V1M A;  1M2A A;  3H1N A;  4ID0 A;  1OC9 A;  5GST A;  2MMO A;  4XCS A;  3H4K A;  1FW1 A;  1TKD B;  1AQX A;  3IC8 A;  5LCZ A;  2CAQ A;  4BPY A;  3IK7 A;  1X5C A;  18GS A;  4ZIJ A;  4TXO B;  3MAK A;  3S9F A;  1WOU A;  2O89 A;  1VF3 A;  4TOP A;  4AGS A;  3KGK A;  4MLY A;  1TOF A;  5B6N A;  2Z9S A;  4A5P A;  4L8E A;  3IE3 A;  4MJE A;  4K1F A;  2FLS A;  2YWM A;  3LGC A;  4FO5 A;  1ZOF A;  3U6V A;  5L71 A;  3GSS A;  2FWH A;  3IV4 A;  2HSN B;  1FG4 A;  4D73 B;  3C7M A;  3DD3 A;  1PD2 1;  3ZLP A;  1Q4J A;  5IMD A;  2HNL A;  4KX4 A;  2MMN A;  4WR4 A;  2M46 A;  3H93 A;  2O36 A;  3PH9 A;  5HFG A;  3HXS A;  2VO4 A;  3LYK A;  2X4A A;  3O76 A;  1PSQ A;  2QKE A;  1T7P B;  1Z3E A;  2WVX B;  4W66 A;  2VL3 A;  1O8X A;  4RUV A;  3VUR A;  4IHU A;  4XS6 A;  2WW2 A;  3RHB A;  5KOX A;  2GGT A;  4AKI A;  4PI2 C;  3KTL A;  5J9B A;  5JCW A;  3TKS C;  2YN1 A;  5J47 A; 
#chains in the Genus database with same CATH homology
 3G7I A;  2X8G A;  3TCO A;  3IXR A;  3ME7 A;  4GSS A;  4EVM A;  3CRU A;  1X0R A;  1DE2 A;  1MD4 A;  2OBI A;  3L4N A;  1FO5 A;  4EUY A;  3UMA A;  1W4V A;  1TU7 A;  1XWA A;  2EC4 A;  2H0H A;  3L9U A;  3GH9 A;  3GUR A;  1KTE A;  3EMX A;  1OAZ A;  3HKR A;  2JZR A;  5ECQ B;  5IMV A;  5ECS A;  2R0C A;  20GS A;  1U6T A;  3FZ5 A;  3E9J B;  5HR1 A;  4MZC A;  4BWS A;  1B48 A;  1TRU A;  1EP8 A;  2VM1 A;  4CY8 A;  4O32 A;  1VF4 A;  4NHW A;  2C3N A;  4JU5 A;  1SD8 A;  2NBS A;  3D0Z A;  2QC7 A;  2CZ3 A;  1THX A;  2X49 A;  4L0U A;  5LNK e;  4MPG A;  4X1U A;  2FNO A;  2H71 A;  5IPG A;  2HT9 A;  2WFC A;  3GKN A;  2B1L A;  1O81 A;  2IL3 A;  5IPH A;  1SJ6 A;  5H5R A;  1KEB A;  3O6T A;  3DGQ A;  5JCG A;  3UL3 A;  5INY A;  5A34 B;  1LJR A;  2IMD A;  1QXH A;  4K7I A;  5EY6 A;  1FAA A;  4EXJ A;  1O85 A;  3TGZ A;  5GSS A;  5D96 A;  5HR2 A;  2XHF A;  4TN8 A;  2DJJ A;  2PUK C;  1JLV A;  4TXO A;  4ACS A;  1Y25 A;  2E7P A;  4DSQ A;  5DQS A;  5A4W A;  2I9H A;  1V40 A;  3HCZ A;  4HU9 A;  3GH6 A;  4J57 E;  3UBK A;  2GSR A;  5A5H B;  2V41 A;  3EU3 A;  4TR4 A;  2ALB A;  1PKW A;  1G7E A;  3J7Y k;  4KUN A;  2HSN A;  5F07 A;  4D73 A;  3FMW A;  1PMT A;  5AIX A;  1ZZY A;  2K8S A;  3GRX A;  2B5Y A;  3CMI A;  1XVQ A;  1GL8 A;  4KGI A;  1V9W A;  5IOX A;  4XS4 B;  1A2L A;  4GRF A;  1Z9H A;  5JWR B;  3ZRD A;  3TRQ A;  2B5E A;  2LRT A;  3ZZX A;  1GSY A;  5DCG A;  3CWG A;  4K0N A;  1X5D A;  2B7K A;  4O5R A;  1Q98 A;  1SVM A;  2DSA A;  4RQR A;  4HS1 A;  1K0A A;  5D9W A;  5G1L A;  1GUM A;  2YZU A;  4XHM A;  3DVW A;  4NWY A;  4AF2 A;  2DLX A;  1R5P A;  4YKF A;  1T4Y A;  4I2U A;  2R6K A;  4L5O A;  3UOM A;  3KZQ A;  4PQI A;  2AYT A;  4EF0 A;  2AJQ B;  1SEN A;  17GS A;  3H8Q A;  4ZB7 A;  4HU7 A;  1HNB A;  5B8A A;  2VM2 A;  3QMX A;  2R5G A;  4I8B A;  3DWV A;  4H86 A;  2GSS A;  1URM A;  5ELA A;  3D21 A;  1A2J A;  2L5L A;  1I5G A;  1RQM A;  2X99 A;  3QAV A;  2DJ0 A;  2ZCT A;  3PR8 A;  3HJM A;  4WF5 A;  4ZL8 A;  1X9S B;  1YZX A;  2FD3 A;  1OC3 A;  4O5U A;  4Z2R A;  1HYU A;  5D9X A;  4G01 A;  1V58 A;  3TJK A;  3IOS A;  4F82 A;  1TK8 B;  2IIY A;  2KUC A;  2GDR A;  2RUE A;  2UV8 G;  2I81 A;  1TU8 A;  4WBR D;  5B7C A;  1TK0 B;  4MP4 A;  5A34 A;  3CSI A;  1MDI A;  3BD2 A;  4K2X A;  1T00 A;  2DKI A;  5BMU B;  2M80 A;  4MH3 A;  4LL1 B;  5J5N A;  2OT3 A;  4ECI A;  2JL4 A;  5F8B A;  2XPD A;  3KH7 A;  1BJX A;  3GKK A;  2HZE B;  2JAD A;  3ZVJ D;  3CSH A;  2LTK A;  4J56 E;  2HE3 A;  3NOF A;  1GTU A;  1GNW A;  2A4H A;  1VGL A;  3HA9 A;  4HOJ A;  4N10 A;  4IGJ A;  4MNN A;  4EDY A;  4N0Z A;  3VPQ A;  1WJK A;  2NPB A;  1YKC A;  3N5O A;  2H30 A;  13GS A;  3P90 A;  2HRK B;  1ZL9 A;  4TVE A;  4RI7 A;  2PVQ A;  1K0C A;  2WRT A;  3ZFL A;  5DAK B;  4IS0 A;  2LNT A;  3HYP A;  3A2W A;  2K18 A;  3UAP A;  4F9Z A;  1IYI A;  1GTB A;  3WT1 A;  1VF1 A;  3F9U A;  4HJ2 A;  3WT2 A;  5KN2 A;  2YWN A;  4XIH A;  3F3R A;  3Q19 A;  2A2R A;  1ZMA A;  1JHB A;  1XW6 A;  1J9B A;  2TIR A;  2FUG 2;  1B8X A;  5EPF A;  22GS A;  3Q74 A;  5CNW A;  1UVZ A;  4KB3 A;  2VLT A;  3EC3 A;  1ZYE A;  3U5R E;  1SKS B;  3IRA A;  2H19 A;  4DSS A;  1K3Y A;  5IOW A;  4PUR A;  2LV3 A;  2WB9 A;  4KSM A;  2H1A A;  1FVK A;  4ZB8 A;  4AJ8 A;  2F51 A;  1VRS D;  1FOH A;  4G0I A;  1XXU A;  2LJK A;  2RM6 A;  5ECM B;  1AAZ A;  4Q5Q A;  4NMU A;  3HJP A;  4K7O A;  1EEM A;  3CBU A;  5HFI A;  4K0G A;  3A2V A;  1NHO A;  1WWJ A;  1TRS A;  3LYP A;  2ZNM A;  5KOW A;  5ABR A;  1SK0 A;  3LW9 A;  2G0F A;  1O6J A;  3FR6 A;  1BQ7 A;  4MDC A;  4G10 A;  2FY6 A;  5DBQ A;  4XRA A;  2X8H A;  2OAC A;  2GVP A;  4CDO A;  3W6G A;  1S3C A;  4I97 A;  1TRV A;  4BVX B;  4E68 A;  1TXX A;  4KW6 A;  2C4J A;  4JED A;  4EKZ A;  2V6O A;  2OAD A;  5DAL B;  4PTS A;  2C1Y A;  3KXO A;  3A5I A;  1THO A;  1MDK A;  3GN3 A;  4GLT A;  1ZGN A;  3VLN A;  2HRN A;  3VWX A;  3BOA A;  1EEJ A;  4N3Z A;  1OKD A;  3MYD A;  2OE0 A;  2H6Y A;  1SL0 B;  2H1G A;  1FOV A;  1XFL A;  1YJ6 A;  3RAZ A;  3W8J A;  4YAP A;  1GP1 A;  3TKS A;  1B4P A;  3G7J A;  2G2Q A;  2IN3 A;  1U87 A;  1PL1 A;  2HZF A;  1V98 A;  3HY2 A;  4MCU A;  5CRH A;  1OVN A;  3ZRE A;  5J4U A;  1MDJ A;  2CT6 A;  4HZ4 A;  2V2G A;  1ERV A;  2HRK A;  3D6I A;  4YH2 A;  2DBC A;  5AIS A;  1YKA A;  3VWV A;  3I43 A;  3RBT A;  1SU9 A;  1WPI A;  2HSM B;  4XTS A;  4ZIL A;  2IMF A;  4JZQ A;  2P5Q A;  4PUA A;  1AQW A;  1QK8 A;  1OKT A;  5CAX A;  3UAR A;  5A5K A;  4DEJ A;  4ECB A;  3CXG A;  2F8A A;  5IIZ A;  5IO2 A;  2LJR A;  2A2P A;  3TRX A;  2I3Y A;  3FK8 A;  4LMW A;  3EMP A;  1M99 A;  3TJG A;  2M72 A;  3APS A;  4ICY A;  1SL2 B;  5JWQ B;  4TR1 B;  4F03 A;  2MMA A;  1J08 A;  4KSO A;  4ZL7 A;  4ULX A;  3IHQ A;  4ZBA A;  1JZR A;  3LXZ A;  16GS A;  1F37 A;  2R2J A;  2H72 A;  3K8N A;  2PER A;  4MAB A;  3F0I A;  4AI6 A;  4HQZ A;  5CRW A;  4WXT A;  3KJY A;  3EVI A;  3GST A;  3FR3 A;  3TJJ A;  4WBJ A;  2F8F A;  3ZL5 A;  1Z6N A;  4EL1 A;  5DDL A;  1U3A A;  3RPP A;  5A1N A;  1XW9 A;  1Y6E A;  4IW9 A;  1AC1 A;  1QUW A;  2HSY A;  2ON5 A;  3BJ5 A;  1QFN A;  2EIO A;  1Z7R A;  3ERG A;  1GLP A;  2R3X A;  2H75 A;  4BVX A;  5A4U A;  3M0F A;  5DAL A;  3HZ8 A;  4FIW A;  1F2E A;  1T1V A;  4ECC A;  2O5V A;  3ISO A;  2C3Q A;  4V1A g;  1N8J A;  1SVO A;  4YKG A;  4F2I A;  4K5R A;  1R26 A;  3MWH A;  1GLQ A;  3GFK A;  5G2Z A;  2P0G A;  4WR5 A;  5ECR B;  2FWF A;  4EIQ A;  3GHA A;  3QOU A;  1ML6 A;  6GSV A;  3IAM 2;  3GX8 A;  2HFD A;  2OBK A;  4CW9 A;  4TXV A;  5KN0 A;  3FZ9 A;  2J23 A;  4PQH A;  2FWE A;  3C8E A;  3D4M A;  3C73 A;  3QR6 A;  2O8V B;  4POM A;  4WF4 A;  1SYX A;  5CRG A;  4TKY A;  5ECI B;  4KDU A;  4YQU A;  3ZIJ A;  3IHG A;  1F3B A;  4E8E A;  3EUR A;  2C0E A;  2HSM A;  1X9M B;  5H5S A;  2R37 A;  2L6D A;  2DC5 A;  2IPA A;  1JLW A;  10GS A;  4EIP A;  4V1A p;  1ERT A;  4LA1 A;  4QL7 A;  4IEL A;  1LU4 A;  5G5E A;  1K0D A;  3DRN A;  1IYH A;  3KMN A;  1N2A A;  3IBH A;  5F06 A;  4ECJ A;  4AJ7 A;  2DMM A;  2PPT A;  5IQY A;  1W89 A;  4AKH A;  3KTB A;  1TI3 A;  4IP6 A;  2HSH A;  2WS2 A;  1M2D A;  2E0Q A;  1X9W B;  1TRW A;  4TR1 A;  3LXT A;  4V2M A;  5G1K A;  1BG5 A;  3LEF A;  3L78 A;  5HFK A;  3D22 A;  5ECK B;  2H6X A;  2KP2 A;  4IN0 A;  1YF0 A;  2VCW A;  2DJ2 A;  2A2S A;  5EL8 A;  1KNG A;  1YDK A;  1EGR A;  2VIM A;  3MNG A;  3ZFB A;  4LMV A;  6GSS A;  2MBS A;  2OA7 A;  1BED A;  2DJK A;  5D93 A;  3R2Q A;  1GSE A;  3D5J A;  2YV7 A;  2C80 A;  2UZ8 A;  4OCF A;  2YWO A;  4F0C A;  2KP1 A;  3VI7 A;  3DIE A;  3BCI A;  3C71 A;  4OCE A;  5ECO B;  2OJL A;  4TRX A;  2ZUP A;  3DXB A;  2IMK A;  4DSS B;  2VD0 A;  4IQA A;  2RII A;  2HQT A;  2FWG A;  4Z7X A;  2YOI A;  2HRA A;  3M3M A;  2H0I A;  1PL2 A;  1YQ1 A;  3C1S A;  3M1G A;  5D9V A;  1ILO A;  1UC7 A;  3LOR A;  1GH2 A;  2FHE A;  4JE1 A;  3IA1 A;  3KEB A;  5DJL A;  3FEU A;  5ELG A;  2YWI A;  3TKQ A;  5GZZ B;  5H5Q A;  5HR0 A;  5FWG A;  4AJ6 A;  3TRP A;  2E2G A;  3DVX A;  1N25 A;  3FR9 A;  1K3L A;  1PN9 A;  3SBC A;  1TP9 A;  3QCP A;  3OR5 A;  3BCK A;  4KF9 A;  4MPF A;  5J9C A;  2JZT A;  4IBP A;  2QA2 A;  1T3B A;  4KCE A;  4HUA A;  2NDO A;  1M0U A;  2PBJ A;  1A24 A;  2J9H A;  1SJI A;  3Q6O A;  3LG6 A;  2TRC P;  1K0N A;  2HRF A;  1K0M A;  2GZP A;  2N5A A;  3KM6 A;  1A8L A;  3TOU A;  3ME8 A;  3NIV A;  2YNX A;  3TJB A;  4O92 A;  1BF5 A;  1T4Z A;  1TXU A;  1M2B A;  1O8W A;  4POK A;  2PVO C;  4ZB6 A;  5CRD A;  4JRR A;  3UVH A;  2O7K A;  3CRT A;  3A2X A;  3F3Q A;  3D4T A;  4JR4 A;  4HEA 2;  1ON4 A;  2C0G A;  2WCI A;  3I6A A;  3EWL A;  2VCT A;  4AKX B;  6GSX A;  1SD9 A;  2CZ2 A;  2DML A;  2GSQ A;  4YQV A;  3HVV A;  2YAN A;  3HD5 A;  2V32 A;  3P8W A;  3VK9 A;  3RHC A;  3IDV A;  4GQF A;  1UN2 A;  2L59 A;  3IPZ A;  1A8Y A;  3ZML A;  2MZC A;  3ZVJ A;  3E3E A;  2CVB A;  2JSY A;  2B6M A;  2AUV A;  19GS A;  4G19 A;  2P31 A;  2FA8 A;  5LD0 A;  4K9Z A;  5J40 A;  4E8H A;  2C0D A;  2GQL A;  5ECN B;  4K2D A;  5J4Y A;  4KND A;  3V1W A;  3PPU A;  2VCQ A;  4Q5F A;  3AY8 A;  4G0L A;  3GL3 A;  3RDW A;  1K3O A;  1XIY A;  1E2Y A;  2QSI A;  4MA9 A;  4V2L A;  5F05 A;  2B7J A;  3GL5 A;  5IM9 A;  3MIX A;  2VKZ G;  3TUE A;  4L5L A;  5ECH B;  2CVK A;  4EE0 A;  4GF0 A;  3GUS A;  2YPM A;  2N5F A;  3ERF A;  1ST9 A;  1YF1 A;  2XBQ A;  4OFM A;  1JZW A;  3US3 A;  2GZY A;  4OFT A;  5A1N B;  1BX9 A;  2DIY A;  4NV5 A;  4FYU A;  4BL7 A;  3NZN A;  4POB A;  2KLX A;  2H6Z A;  3BBY A;  2R0G A;  2H1B A;  4ML1 A;  4ZBD A;  2C0F A;  1MTC A;  1YVL A;  5A4V A;  4HDE A;  4GCI A;  5ECL B;  3HDC A;  2GST A;  4OO5 A;  3MDK A;  4QMK A;  4Z2T A;  2AAW A;  1DSB A;  1TDI A;  4L0W A;  4ZBB A;  1JFU A;  1U88 A;  2CQ9 A;  2LKU A;  1ZCP A;  2FCH A;  5B8B A;  1NM3 A;  1ERW A;  3F4S A;  5EVO A;  3R3E A;  4CHS A;  3TKS E;  1SL1 B;  1EP7 A;  3FW2 A;  4GST A;  3P2A A;  1U3I A;  1AXD A;  1WRY A;  4LLR A;  3EYT A;  4MMM A;  2F3M A;  2E2M A;  4CY6 A;  4OO4 A;  4N0V A;  1C72 A;  1PRX A;  1XZO A;  1A23 A;  1WMJ A;  2FA4 A;  3HZ4 A;  4DSR A;  3TU3 B;  3L9S A;  3RPN A;  2VOC A;  4YQM A;  2GLR A;  4O7H A;  4GDF A;  4AKG A;  1ABA A;  4GXZ A;  2CV4 A;  3FY7 A;  3KIJ A;  1OE8 A;  3F4T A;  3DKS A;  2K9F A;  2H01 A;  4QL9 A;  1GSU A;  3VWU A;  5F0G A;  4DVC A;  3EIN A;  1GTI A;  4YAV A;  4PNF A;  3FZ4 A;  4JBB A;  1Y1U A;  2C8U A;  2RUF A;  4IP1 A;  3IC4 A;  4K5S A;  1GSF A;  4FYC A;  1R5A A;  2IFQ A;  2LRN A;  1FB0 A;  5CYY A;  5KN1 A;  2PN8 A;  1X5E A;  2VL2 A;  2K6V A;  1K0O A;  1XPV A;  1DUG A;  2P5R A;  1NHY A;  3GYK A;  9GSS A;  4X43 A;  4ZL9 A;  4GWR A;  1SKW B;  4G2E A;  2CA8 A;  4PGT A;  3QPM A;  4POL A;  1AW9 A;  4IQ1 A;  2WJU A;  2VCZ A;  3HVS A;  1V2A A;  1DE1 A;  4KDY A;  2R0P A;  4BWQ A;  1XWG A;  1EOH A;  2YCD A;  3M8N A;  5D73 A;  2I4A A;  1A0F A;  2X64 A;  4MF7 A;  4Z2U A;  1OE7 A;  3N9J A;  4I6X A;  1M9B A;  1ERU A;  5GAN D;  2H70 A;  1EZK A;  1SYR A;  1JZD A;  3GA4 A;  1GUH A;  1G6Y A;  2H8L A;  5B6M A;  3IAS 2;  1ZYQ B;  2L5O A;  1OC8 A;  3TDG A;  3UBL A;  2AHE A;  2VL9 A;  4MJC A;  5J41 A;  2LQQ A;  2EFC A;  2GZZ A;  3M9J A;  2IWT A;  3ZIV A;  3JCM L;  3HMJ G;  5JCU A;  1EV9 A;  2JSZ A;  4TR0 A;  1GUK A;  4MZB A;  4GQC A;  5FHI A;  1MD3 A;  2YV9 A;  4NV2 A;  5DQY A;  3LFL A;  3QAW A;  3M9K A;  5ECP B;  1F6M C;  2GQM A;  2HXK A;  5DJM A;  3I69 A;  3WYW A;  5AIV A;  4WET A;  4G9H A;  5BRT A;  1MEK A;  3FZA A;  3GTU B;  3E0U A;  1EGO A;  2VL2 C;  1B9X C;  4PQ1 A;  1NSW A;  1R4W A;  2EFH A;  2XBI A;  2EFD A;  5C00 A;  1G0T A;  4KA0 A;  1HNA A;  2O87 A;  1AIU A;  5KEJ A;  4OWY A;  2H74 A;  2A4V A;  2QGV A;  2H1D A;  1AUC A;  4IJI A;  1O7U A;  2QA1 A;  4HI7 A;  6GSU A;  1QGV A;  2GS3 A;  5CRE A;  4X0X A;  6GST A;  3W8S A;  1R7H A;  1BYE A;  6GSY A;  3CTF A;  2DJ1 A;  3VWW A;  2EIQ A;  3CTG A;  1YEP A;  3G9B A;  3KH9 A;  1RK4 A;  1XWB A;  6GSW A;  1FB6 A;  4NAX A;  1KBN A;  3F6D A;  1XVW A;  2NVL A;  4F0B A;  2LRC A;  1G6W A;  4MK3 A;  1GNE A;  3QDN A;  5E59 A;  5AGY A;  7GSS A;  3QD9 A;  3TKR A;  3IK9 A;  3HHV A;  3EPT A;  1XW5 A;  1QMV A;  1EV4 A;  2WDU A;  1WIK A;  2OE1 A;  3I9V 2;  4FH8 A;  3GX0 A;  3C1R A;  2REM A;  4OFN A;  2VCV A;  1YY7 A;  3TB2 A;  3GNJ A;  2PGT A;  5IMC A;  1GRX A;  2I1U A;  3TKP A;  1Z5Y E;  4GTU A;  1WE0 A;  4I5Q A;  5J3R A;  1TJD A;  1HD2 A;  2MMZ A;  1SKR B;  2O85 A;  1XCC A;  5D8I A;  4EC0 A;  1QQ2 A;  3KP8 A;  1GSQ A;  3H79 A;  3KCM A;  1SVL A;  2BJX A;  4WEY A;  1RW1 A;  4OMV A;  3GIX A;  4KH7 A;  2FGX A;  1FHE A;  4KDX A;  1G7O A;  4O5Q A;  3MSZ A;  5IMF A;  3ERW A;  1F9M A;  5ENU A;  2KOK A;  5GAP D;  2C3T A;  3O3T A;  3FKF A;  2HYX A;  2JU5 A;  2LEG A;  2VUP A;  4RI6 A;  4ZXG A;  3WGE A;  1XWK A;  2DIZ A;  3UEM A;  1LBK A;  1BAY A;  1B4Q A;  5ID2 B;  1S3D A;  5IMA A;  4HJM A;  3LWA A;  2L6C A;  4PXO A;  3GTU A;  4EO3 A;  4FYB A;  4EDZ A;  2HI7 A;  4V2N A;  1CQH A;  4BL7 B;  3J7Y b;  4X4J A;  4N30 A;  3F4R A;  1F3A A;  1PGT A;  4I2T A;  3DEX A;  4PX1 A;  2LUS A;  1TTZ A;  2BTO T;  1Z7P A;  2HLS A;  1SK2 A;  5HQP A;  4XS1 A;  1H4O A;  3UJ1 A;  1M7T A;  4G0K A;  2VD1 A;  3QFA C;  1J0F A;  2ON7 A;  4Q5R A;  1BG1 A;  4TR3 A;  4LL4 B;  4HQS A;  4OD7 A;  4P3Y B;  3HVX A;  2EFE A;  3WGD A;  1PA3 A;  4BA7 A;  2DKH A;  1PX7 A;  2EIR A;  4K7N A;  3CYN A;  5G5F A;  1PN0 A;  1S3A A;  1CQG A;  3F6F A;  3TJF A;  3UVT A;  5CP1 A;  2WZ9 A;  3GKM A;  1XOB A;  1GSS A;  3ZMK A;  3PGT A;  4BVY B;  4MZW A;  1EOG A;  2TRX A;  2YJ7 A;  1GWC A;  3F8U A;  3APQ A;  1XOA A;  2OKA A;  2GTU A;  4WKW A;  3UIW A;  4KCA A;  1ACV A;  3P7X A;  5A5H A;  4NHZ A;  2B1K A;  4KE3 A;  2B3S A;  3GKX A;  1GUL A;  2PMT A;  5E4W A;  2YP6 A;  4Q5N A;  3WGX A;  5C04 A;  2LST A;  2H76 A;  2R4V A;  1TK5 B;  1TI1 A;  2CX3 A;  2BMX A;  4J2F A;  2B5X A;  14GS A;  3KMO A;  2XPE A;  4XS4 A;  4MF6 A;  4ZB9 A;  2H73 A;  2AB6 A;  2IFQ B;  1GSD A;  3LJR A;  2L4C A;  2MBT A;  3APO A;  4JR6 A;  1Z6M A;  1I9D A;  3Q18 A;  4IKH A;  1OC9 B;  3GV1 A;  2NTO A;  4FQU A;  2ES7 A;  3FHK A;  3LQ7 A;  3VI5 A;  1V57 A;  2LNS A;  1PQN A;  4HZ2 A;  2LS5 A;  3A5W A;  2WGR A;  4ILF A;  1UA5 A;  1TW9 A;  3L9V A;  4PNG A;  3VFI A;  5ID2 A;  5HR3 A;  1A0R P;  4QQ7 A;  4XRD A;  1E6B A;  4MJB A;  2V6K A;  1DBY A;  2F9S A;  2PU9 C;  5JWO B;  2IME A;  1SK1 A;  1ZYN A;  4ISD A;  5AN1 A;  3ZTL A;  3CSJ A;  4MJA A;  5FT3 A;  3TOT A;  3PIN A;  3LSZ A;  2JZS A;  2DJ3 A;  2YZH A;  2MYG A;  1HQO A;  2K8V A;  4RQX A;  1B9Y C;  1JZO A;  11GS A;  1XBS A;  2H1L A;  5DCH A;  5KN3 A;  2VLU A;  12GS A;  1WP0 A;  3QFB C;  3GMF A;  8GSS A;  2IJY A;  5G31 A;  2L4Q A;  1H75 A;  4K6X A;  5IMZ A;  2GT6 A;  3FYG A;  1USB A;  2WUL A;  2OE3 A;  1XWC A;  1GTA A;  3HJO A;  5DVB A;  3ZYW A;  2AV4 A;  3L0H A;  2YJH A;  3EE2 A;  3WD6 A;  1O73 A;  5BMU A;  3EU4 A;  2IMI A;  3DYR A;  2H0G A;  4NPB A;  1M9A A;  5COH A;  2CAI A;  2L57 A;  4IVF A;  1ZYP A;  3ED3 A;  4N11 A;  4MF5 A;  4K8M A;  4BVY A;  2LQO A;  1AQV A;  2D2Z A;  3IR4 A;  1PX6 A;  2HZE A;  2N5B A;  2CVD A;  1NW2 A;  3KP9 A;  5IO0 A;  1EWX A;  2GQK A;  1SJZ A;  2JAC A;  2VCX A;  2GT5 A;  2XC2 A;  2H66 A;  4ML6 A;  5G30 A;  2LJA A;  2CX4 A;  4TW5 A;  1OYJ A;  3FRC A;  4NXI A;  1FVJ A;  2RM5 A;  3A3T A;  3G7Y A;  3ZIT A;  5DAK A;  2X8C A;  4IJ3 A;  3QAG A;  5CO3 A;  3KD0 A;  3F63 A;  4MH2 A;  4USS A;  4PUF C;  1T8E B;  2VLV A;  2KHP A;  1HNC A;  3SWL A;  5J4V A;  3VPT A;  2VAF A;  5D9T A;  1YEX A;  1K0B A;  1A2M A;  4KAE A;  2RLI A;  3DML A;  1PKZ A;  4GSN A;  2PWJ A;  1VF2 A;  2V1M A;  1M2A A;  3H1N A;  4ID0 A;  1OC9 A;  5GST A;  2MMO A;  4XCS A;  3H4K A;  1FW1 A;  1TKD B;  1AQX A;  3IC8 A;  5LCZ A;  2CAQ A;  4BPY A;  3IK7 A;  1X5C A;  18GS A;  4ZIJ A;  4TXO B;  3MAK A;  3S9F A;  1WOU A;  2O89 A;  1VF3 A;  4TOP A;  4AGS A;  3KGK A;  4MLY A;  1TOF A;  5B6N A;  2Z9S A;  4A5P A;  4L8E A;  3IE3 A;  4MJE A;  4K1F A;  2FLS A;  2YWM A;  3LGC A;  4FO5 A;  1ZOF A;  3U6V A;  5L71 A;  3GSS A;  2FWH A;  3IV4 A;  2HSN B;  1FG4 A;  4D73 B;  3C7M A;  3DD3 A;  1PD2 1;  3ZLP A;  1Q4J A;  5IMD A;  2HNL A;  4KX4 A;  2MMN A;  4WR4 A;  2M46 A;  3H93 A;  3PH9 A;  5HFG A;  3HXS A;  2VO4 A;  3LYK A;  2X4A A;  3O76 A;  1PSQ A;  2QKE A;  1T7P B;  1Z3E A;  4W66 A;  2VL3 A;  1O8X A;  4RUV A;  3VUR A;  4IHU A;  4XS6 A;  3RHB A;  5KOX A;  2GGT A;  4AKI A;  3KTL A;  5J9B A;  5JCW A;  3TKS C;  2YN1 A;  5J47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...