3TOVA

The crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
b'SNAMELDYKRIVVTFLMHLGDVILTTPFLEVLRKAAPHSHITYVIDEKLQQVMEYNPNIDELIVVDKKGRHNSISGLNEVAREINAKGKTDIVINLHPNERTSYLAWKIHAPITTGMSHFLFRPFMTKYTRLDRKTRHAADMYINVLEQLGVTDTSNSGLHIEICEEWRCQAQEFYSSHGLTDTDILIGFNIGSAVPEKRWPAERFAHVADYFGRLGYKTVFFGGPMDLEMVQPVVEQMETKPIVATGKFQLGPLAAAMNRCNLLITNDSGPMHVGISQGVPIVALYGPSNPFFYGPYQAHAIVLETMDSYEIGKSMKKIIKEGNYKGLSVISEEQVIKAAETLLLES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl transferase family 9
molecule tags Transferase
source organism Veillonella parvula
publication title The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008
rcsb
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01075 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltransferase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3tovA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3tovA01
2GT1A 4XIFA 2QRMA 3TAXA 2OFFA 4NEQA 3COPA 4EKYA 3G2KA 4N3BA 3G2JA 3L7DA 3EBPA 2QRPA 5DLDA 3D0RA 1FU8A 4WHMA 1YGPA 3T3GA 2GPAA 2VG8A 1Y6FA 4EL0A 1FTQA 5JTUA 3ZCRA 2VSNA 2AMVA 1L5WA 1C8KA 5TVGA 4GYYA 5HXAA 5IKPA 4AY5A 3BCUA 3H4TA 3MT7A 1HLFA 2QRGA 2QN8A 3L7CA 3CUUA 3VDMA 3OTHA 2GEJA 4MICA 3ZCUA 4M7PA 2SKCA 1XOIA 1XL0A 3VUEA 3E3LA 3G2HA 2QN1A 2IYFA 2IUYA 3CEJA 4AY6A 2BISA 3UYKA 4RELA 2H1HA 1XKXA 2AV6A 3RHZA 3S28A 1GZ5A 1P4GA 1YA6A 3NPAA 1NZFA 5DXFA 2SKDA 3MS2A 3ZCPA 3OKAA 2PRJA 2ATIA 3D1JA 1GPBA 4N9WA 2R4UA 4AMBA 2O6LA 1E4OA 3NC4A 2IV3A 3NB0A 2XCUA 3MTAA 1RZUA 1P2DA 3MS4A 4EJ2A 3IA7A 2X6RA 4M83A 2G9QA 2H1FA 1AXRA 2FETA 3HBFA 2X6QA 5ENZA 2XGMA 3SYMA 1L5SA 3GUHA 2G9VA 8GPBA 1Z6QA 1JIXA 4WACA 4AN4A 1GPAA 3DZCA 2XA1A 1KTIA 1XV5A 1NVKA 3T3HA 1WW3A 3MT9A 2HY7A 2ASVA 2IEGA 4YI5A 4FKZA 3CUTA 1EXVA 3E3OA 2VCHA 1NOJA 3G2NA 1L6IA 2ECPA 1GPYA 2IEIA 3CV3A 4KQ1A 1FTWA 1C50A 2JJMA 3SYRA 1Z62A 1IXYA 3MBOA 1J39A 2X0FA 4GZ6A 4RIIA 2XA2A 3G2LA 5C1DA 3S0JA 2PYIA 5TMBA 4EKEA 4Z5XA 4RENA 1GFZA 1F0KA 1P29A 2SKEA 1WUTA 3QHPA 4LEIA 4X7MA 4N3AA 3HBMA 3IAAA 3CUVA 4MHSA 3GPBA 3L7AA 3Q3EA 1WW2A 2KS6A 2FF5A 3FROA 3OKPA 2JLBA 3TOVA 1B4DA 3D0QA 1A8IA 2VSYA 3L7BA 4F96A 1RRVA 3O3CA 4X7PA 1Y8ZA 1XL1A 1UZUA 1UQTA 2ACVA 1JIVA 4RIEA 4HLNA 4AMGA 3BD6A 3MRVA 2AZDA 2C1XA 1GGNA 3MT8A 3HBJA 4GYWA 2XGOA 4W6QA 1FC0A 2IYAA 2F3PA 1E1YA 2BGUA 3CEHA 2ZB2A 1C3JA 9GPBA 5D00A 2P6PA 1EM6A 4F9FA 4RIGA 1Y6GA 1K06A 3C48A 2XCIA 5I45A 4GZ5A 4MRAA 3L79A 2F3SA 1ABBA 2R4TA 3BEOA 3RSCA 3BCSA 1P2BA 3BD7A 2G9UA 4WADA 3RSZA 3PE3A 2XMPA 3ZCSA 3H4IA 1UQUA 3NP9A 2QN9A 2GEKA 3T5TA 3OY7A 1WUYA 1FA9A 3VDNB 2R60A 2QLMA 1H5UA 4X6LA 3PE4A 4CTOA 1JG6A 5DU2A 1NZDA 3MTDA 3E3NA 4N39A 1FTYA 4BQFA 3DD1A 4BQEA 1FU4A 1PYGA 2FFRA 1O6CA 1NLMA 6GPBA 4YUAA 1RZVA 4NC9A 1FU7A 2QRQA 4YI3A 3AMVA 1P2GA 2QN7A 1FS4A 2VCEA 4RIHA 4MHOA 1L5VA 3CEMA 3CUWA 2QRHA 4GZ3A 3ZCVA 2QNBA 2BFWA 4M60A 3T7DA 4GPBA 2F3QA 3TSAA 1LWNA 3OT5A 4MI6A 4X7RA 3OTGA 1K08A 4KQ2A 1PNVA 1L5QA 1NOIA 3L01A 3ZCQA 3BD8A 3WADA 1P4HA 7GPBA 1AHPA 2GPBA 2PYDA 3Q3HA 4HWGA 3HBNA 5BNWA 1JIUA 5TMEA 2R68A 3BDAA 3MQFA 2Q6VA 1NOKA 2PQ6A 1LWOA 3T3EA 1P4JA 2ACWA 1JEJA 1JG7A 3MS7A 4BQIA 2XGSA 5GPBA 3S27A 3MTBA 4RIFA 4EL5A 3WC4A 2IW1A 2QLLA 3MRTA 5LQDA 4MI9A 4XI9A 2GPNA 3VUFA 4BFCA 2C4MA 3DDSA 3CUYA 2JZCA 3ZCTA 3NP7A 3CX4A 3MRXA 3OY2A 4CTMA 1GG8A 1WV0A 2QLNA 1V4VA 3OTIA 1L7XA 2GM9A 2QN3A 2X0DA 3G2IA 1QKJA 3MSCA 3NAZA 1SXPA 1PSWA 2C9ZA 2IV7A 2C1ZA 5JTTA 1PN3A 5TMDA 1M5RA 3RT1A 2BGTA 3C4QA 3QKWA 3UYLA 4REMA 3OKCA 4CTNA 4QLBA 1C8LA 5IKOA 3T3DA 3S29A 3Q3IA 3EBOA 1IIRA 2QN2A 1XC7A 3S2UA 2F3UA 3DDWA 4F97A 3WAGA 1WV1A 2F9FA 4N3CA 2G9RA 5D01A 2GJ4A 3C4VA 4KQMA 2XA9A 1F6DA 4FZRA 2QZSA 4NESA 4RBNA 3BCRA 4MI3A 4PQGA 4L22A 1BX3A 4CDRA 2R66A 2YJNA 3T3IA 1QM5A 2X0EA 1L5RA 2PRIA 4LDPA 2AW3A 3NCHA 1Z8DA 1VGVA 4G2TA 1Z6PA 1SXQA 2WTXA
chains in the Genus database with same CATH superfamily
1IEXA 1QIEA 1XZDA 2E18A 3DSRA 2PGOA 1HSZA 3E8XA 4OGLA 5DZSA 5LYJB 3VO9A 2PUTA 5FD8A 5FP0A 4HNHA 4HO1X 1GKKA 1PLKA 2YXBA 3ABOB 5H80A 4M22A 2Q6LA 3P9QA 2PVPA 5CNMA 3CINA 3TEJA 5KX5F 4B4WA 3QKSA 1C2YA 1YS4A 2VPZA 1FDTA 1LEHA 2DUUA 2ZE8A 4WHMA 4C89A 1C7EA 1EA5A 1NQAO 3DDOA 4LJLA 4FEAA 2EKDA 5FHRA 2BCGY 3Q7TA 1M34B 3B6MA 1K7CA 4UAJA 4I0WB 4TSFD 5CLGA 4V02A 3ZTTA 3O1LA 5ALIA 1W76A 3G9TA 2CNBA 4JX9A 2PX2A 2V6GA 4UPVA 3ZV4A 2Y1LA 3OECA 2I67A 4DJTA 5IM4F 2HNBA 3GNTA 4B4VA 4MHTA 5DHRA 1U8EA 5I01A 1H4SA 2QS9A 2BGIA 1U7TA 3CB2A 2OCAA 4R05A 1R74A 4U8HA 1UMBA 1SEVA 5HXAA 1QRTA 2AEFA 5JIBA 2PMDA 3JALB 1QHHB 1E9CA 3KT8A 3G9XA 1MC8A 3HSKA 4G1MB 4Y6PA 2C4WA 3SF8A 4DC0A 5JYBA 5CCDA 2AXNA 1W52X 3ZE2B 2ICAA 3ECCA 3ZQJA 4AUEA 3Q7SA 1SKUA 3Q2OA 3O0DA 4G0YA 5HWSA 1A8UA 3GA5A 3WMRA 2HHLA 1QB8A 2QB5A 3RS7A 3L6RA 1VE5A 2JAWA 4AN1A 3D3QA 4PQFA 1A96A 1EQUA 3QUBA 1GN8A 3O5AA 4EZBA 2E87A 3NIGB 4K9RA 4CIBA 2G0TA 6CHYA 2W2NA 2EKLA 1WSBA 3IPLA 3BTSA 4AY6A 2XB4A 4V3BA 4TUYF 4FYIA 1J90A 1R8JA 5L7WA 4FCWA 3RTGA 1Z0IA 4YAEA 4CKCA 1Y9EA 4RYDA 3RHZA 4AF8A 4DZRA 3K53A 3DWFA 2G71A 4BV8A 2C2GA 2QKYA 2WM3A 4X97A 3SHOA 4BLPA 2ZIUB 4AZTA 3QIAA 4YAGA 1BHO1 3N74A 1KZ1A 1YCGA 1ATZA 1EHCA 5LKRA 2ATIA 5LWHA 3JR7A 3EOZA 3W3AD 3OZFA 4JP3A 4DUZB 4TYWA 3DWEX 4N7BA 1YS6A 5HCIA 1H94A 3KSRA 5BOVA 4HR7A 4M9QA 4XJTA 1E4OA 3AFOA 1QYRA 1Z0KA 1CERA 3IUBA 3P4XA 1K7XB 2VUUA 2G1PA 3L8MA 1FB5A 4DRZA 3WTCA 1NBAA 4TLEA 3RIGA 4X54A 3OBIA 2GO7A 2P4SA 4C7XA 1VCIA 1MQSA 4US0R 1I36A 2ENUA 1BW9A 3K8OE 4EVRA 2QM3A 1VRCA 1KZ9A 4Y2TA 1SURA 3EZGA 3KG2A 3RUPA 1YDEA 3PWZA 2EZ4A 1W19A 4KLNA 2OYCA 3VI3B 2QD4A 2BM0A 4FDLA 4YDHB 4EH1A 2VJKA 1G8YA 1IHOA 3V1NA 2YN0A 4DJEC 3A9UA 5JD3A 3FPJA 2G1KA 2XMGA 5CDGA 4PGHA 3CSUA 1MAHA 2XUGA 1NKTA 4I3FA 2CVFA 4UVIA 3DE5X 2Y0EA 3VQTA 3ZBPA 4IJMA 4H4DA 1KC3A 3S5UA 2IP2A 3E8SA 4J2OA 2ID8A 1K8ZB 1WSAA 4LC9A 1G7SA 2HBZA 3GRUA 4KPGA 1X7WA 1CKEA 3FOAA 4JQSA 3TBFA 3VSAA 2PZGA 3X3HA 4RJTA 1NY6A 3TVDA 4KK3A 5G02A 2FUNB 1DFGA 2YCBA 3DVLA 1XJCA 1NV9A 4HB2A 3MJSA 1JKXA 4Y18A 5E4JA 4WFQA 3ZWYA 4A36A 4EEXA 1Y8QB 3PHBE 1BQ4A 1P60A 4MZXA 1R0WA 4JHLA 1V43A 4NNOA 1E7YA 5AHKA 4CZ2A 2GN9A 1RAHA 1OIXA 1GADO 1A9TA 3G5UA 1A5TA 1E5QA 5AJVB 4G89A 3VBCA 2V3CC 5L4LA 1Y3BE 4JV5B 1UR5A 1PJBA 5FOQA 3FVTA 1JPVA 2XT6A 4MKFA 1MDFA 3ENVA 1VKZA 4MUBA 3DT8A 2W5UA 3EN0A 1Q95A 3R0IA 3SFZA 5FI3A 3CX8A 5A7FA 5K7SA 4H1TA 5MN4A 3DS8A 4WINA 4V0OA 1V1RA 3WJ2A 1YZLA 1FDUA 2XKBA 4MYCA 4PNEA 2XDYA 1OWPA 3W9BA 2ZIZA 3F6RA 4BE4A 1V1MB 2DVMA 3ZD7A 1NP6A 2ZYHA 1IZ0A 3PGJA 5KC8A 3SYRA 3PLAE 5IZCA 2L18A 3HI4A 4E13A 4YV0A 2ZAOA 5JAZA 4PN7A 1IIBA 3PA8A 2I1LA 5G0VA 4DR2B 2BMFA 4XSGA 4PHGA 1H5NA 3K1YA 4TYMA 1E8NA 2Z4RA 3DMGA 4KZPA 4X66B 1NBIA 2VHZA 3I2HA 1KYTA 1Y7IA 2ZZKA 5JALA 1AY0A 1ND5A 3EIXA 3H1GA 1HZZA 1JYSA 3ND9A 1KBOA 4QHTA 5ALFA 3VR6D 2L42A 1ECCA 1P3Y1 3TIGA 3O4JA 3VZQA 5LQKA 5H7XA 4I36A 1P1HA 1Y7TA 5B4TA 5KYYA 1N6LA 2CE7A 5CXSA 4EJ6A 3JSXA 4M46A 4P81A 1X3SA 1DG9A 1QZUA 1E9BA 2HEIA 5HOEA 2J0QA 3QKRA 3NUZA 1K75A 3R3UA 3EOAI 1QFMA 1DO0A 4H77A 1SCKA 1XHFA 1ZNZA 2EFHB 2QJRA 3EAQA 2PJZA 2ZRAA 3ITKA 1QAQA 5IEBA 3UHAA 1VCOA 2IEDA 1EWQA 3L7YA 4AG6A 4URFA 3AWDA 1PL7A 3T7EA 4XCVA 3FPEA 3RV4A 1HUQA 2Q3CA 3T1HB 2SECE 4AJJA 5GP1A 2VDRB 5TS3A 3EGVA 4HDSB 3DE4X 3KSMA 3NKFA 1NG1A 2ZCUA 2YV1A 4GICA 4N82A 3TRJA 3I2YX 3PUIA 5ALOA 3ZXUB 5AVVA 2Z6AA 4GI3A 3CKMA 2FJ0A 2WPDA 1VP9A 1UQTA 3C3DA 3A6EA 3CW9A 3ESZA 1EWYA 1M2KA 3LTEA 2AOXA 4WBXC 5K09A 3AHHA 4OQLA 2NZXA 4J4TA 2GYYA 1G5IA 3MRVA 4XIGS 4HWOA 4MUKA 4UHHA 1U7UA 5HA5A 2A9KA 5EMMA 3QEMA 4MW0A 1QMPA 4BNJA 2ZB4A 1VJGA 3VPGA 4Q21A 3DE1X 4B31A 2C04A 2ZRMA 4MS3B 2AG6A 4ND3A 3UMFA 4ZAGA 3O3MB 2YWFA 3KKEA 4DTIA 1YHYA 4BO8A 3A70A 2ECKA 4EJ0A 4ZI2A 1H4QA 3ZW7A 4I9FA 3AVWA 4JC8A 3B53X 5AKJA 4GMHA 1S9HA 4MQMA 2WVAA 2ZI5A 4UUQA 5K1ZA 2UYYA 1TL7C 5D00A 2QLBA 4YPOA 1VXRA 3V9AA 3HB5X 4UPDA 1EE1A 1N8SA 2HTFA 1AKMA 4R98A 5TJHA 3KVVA 3VV3A 1U3CA 4Z8XA 3U13A 2ISSD 2GNAA 2M98A 1KJYA 4LA4A 2XRMA 4Q1CA 4N41A 2Z0MA 1B8PA 1ENPA 4L4RA 2QMQA 3FWHA 4E14A 1AQUA 2EDCA 2FW6A 1R3DA 1OI4A 2FSUA 4CLOA 2QYTA 1IAVA 2OV6A 2FTKE 4GI5A 1K88A 1QX4A 3DV0A 3NO4A 4V0KA 1UMCB 1DKRA 4W5JA 1I51A 4C03A 4C5CA 5DWDA 4QEDA 1UC5B 2GEVA 4C0XA 2NZ2A 1O96B 4B3CA 2DQSA 3WL6A 4LOAA 3L1JA 4JX8A 2H16A 2IXEA 1CNEA 4ZDIA 3EDRA 4CWAA 3KZMA 1VB3A 1VLMA 3RF6A 4NH0A 2E5LB 3VVCA 1U0SY 3CF6R 1K4MA 3V1TC 1NRWA 3F3SA 3ZQ6A 1N9GA 2EP8A 2VDOB 3KJXA 1SVWA 1GR1A 2HF8A 2YFKA 4HG2A 5KDOA 2IS4A 3I04M 4C3OB 1E0JA 3CE6A 5IAKA 1UM9A 1U7XA 5GONA 4YHHB 1RI5A 1U0HC 1TKAA 5M3BA 3P0FA 1YAHA 3IA2A 2HPZA 5A5DA 3QNUA 1XK6A 1V8DA 2QX7A 1OB5A 4M0FA 3MB5A 1GARA 3D5EA 1IN5A 1DX4A 1M2WA 1L5YA 1V4BA 4O8CA 4YLGA 5DHUA 2YC4C 4YO8A 2Q50A 4G4IA 1ABFA 2FMFA 5B37A 3HR8A 3PL5A 3EYWA 4YI3A 5FKJA 5BPFA 1U98A 4QT0A 3T1OA 3TBKA 1KPIA 3ZZNA 2ZSIA 4KI0A 1P8AA 4AJ1A 1AB5A 5CVCA 1N2EA 1KAQA 1NZJA 3E1KA 3EF3A 4NE2A 2QTLA 1OV4A 2XUKA 4MHOA 4AJNA 4RDXA 4XFJA 3WYEA 2OAEA 4YFVA 4WKOA 4X5OA 5F9MA 5LQUA 1CWUA 2QRHA 2OWDA 4GS5A 4NS4A 3BICA 4LJ4A 2G4VA 4UBIA 4KTTE 2WFMA 3HP1A 3A27A 4HAIA 4IW3B 4MIOA 5JSFA 1CUUA 4HAUA 1TRKA 3SQOA 2BT4A 3UHPA 1NRIA 2WT8A 3MELA 3EPRA 4GXQA 3FMFA 2CHUA 4BP8A 4AUKA 1K08A 1Z73A 3AR7A 3IIKA 2Q3DA 2EZ8A 3REFA 3PXCX 2PKEA 4NI5A 4JI8B 3DUFA 3TLXA 3UB3A 1A72A 2AG5A 2GN1A 1P0CA 3RYHA 4EATA 1TO6A 3A1FA 3IDFA 4RGYA 1DJNA 4G07A 2HT1A 4DYDA 4G97A 1X70A 1ZD9A 2YFHA 1NVVQ 2I91A 3EZYA 4PLTA 4CQLA 4X3PA 1O96A 3B52X 1AHPA 4ZYZA 5AK3A 5CPBA 4RACA 1TJ5A 5D6OA 4G09A 4RKWA 3CBQA 2C5AA 3TWOA 1Z38A 1OFVA 3C0KA 2RC6A 1L4GA 3GGGA 4ZVOA 4W9MC 2AKAB 4C21A 3AWIA 2QY6A 3DZIA 2H1IA 2HUNA 5DCLA 3R7LA 4R71A 4FE7A 2HQ1A 1GUZA 4HWPA 2H1WA 1SVSA 3F3MA 2FSVC 3QF7A 2I7CA 3VSCA 1FUEA 3F3YA 4CGYA 3IMCA 1W36D 4UJ5A 4DPKA 3B1XA 4HX2A 3A7EA 3VC3A 1BKSB 3A11A 2HMTA 1YCDA 3R3ZA 4CF3A 1V8ZA 2I8CA 5JW6A 5KZMB 4PXYA 3ICWA 4CLRA 1RYYA 3P97A 2XEXA 4MS4B 2AA3A 4IVPA 3SEFA 1ODFA 3PB3A 3WG9A 5MFPA 3RIXA 2X1HA 1TTQB 4N49A 4G25A 4TWJA 3FCSB 3RVMA 4BNMA 2UYCA 2OECA 3NZEA 4YUWA 3LJKA 2KI5A 5CDSA 4OLBA 1NN1A 3LOUA 3V7YA 2WOOA 2CHQA 7REQB 2VAWA 3ROEA 1ONPA 2FSIA 1R10A 4NR0A 5G1PA 5JVDF 1CYEA 3GVIA 2JGDB 3AM3A 1CY8A 4M1WA 4V39A 3SE0A 4OP3A 3HP4A 3BMQB 1H1DA 2I3ZA 1QRUA 2PLRA 3ZX4A 1VPVA 3LQKA 1NR7A 3N2YA 2PGLA 4FFOA 1MPTA 1X1RA 1HYEA 1VBFA 4Q47A 3DUWA 1N4AA 3TD9A 4L9SA 3Q72A 1D2GA 2J45A 1MBZA 2IELA 1H6BA 3OJOA 1YGYA 1SULA 4O2BA 3CLRD 2AN1A 5LMZA 3KAKA 2NLOA 3I64A 4I1UA 4BWGA 1P7YA 2JJ2A 3KQLA 2HOQA 4TL9A 1QH0A 1SOWA 1VJCA 1I5OA 2LIPA 2VYND 4U3JB 4IHJA 1LSJA 3P8ZA 4GOKA 1ICEA 1QKJA 1ZFNA 5JAQA 4TT8A 2C9ZA 2MINA 4G5QA 5TARA 3TLCA 1PUXA 3H1FA 3TDNA 4BMXA 4P82A 2PD3A 2J5BA 3ELYA 5L3SB 2J1LA 1G20E 3OLQA 1YB2A 3S2GA 3TL3A 1H1LB 3ADDA 3GEHA 1Q3KA 2PJUA 2CL6X 1BE0A 2XJ4A 1O94A 4YP7A 3T9FA 3RR2A 1AA6A 3AOEA 4REMA 4W7IA 1ZD5A 4D46A 3PC7A 2F2TA 3HJGA 1QLHA 2JKYA 1H2EA 3ABRB 3N2ZB 1TEHA 2QP3A 2YS7A 5EEGA 5EWMA 3T3DA 4C5BA 4E2XA 3ASVA 2Y1EA 3Q3IA 1TUBB 4IDNA 3ZDEA 3U19A 4DJAA 1XDGA 2GCEA 3DT9A 3GUVA 1XYVA 2BFBB 5THKA 2CJWA 2Q6OA 1HNXB 1I3NA 2C2WA 1BMQA 1IOLA 1KZ4A 1OXMA 1PZMA 1YMQA 4IAOA 2M6LA 3N8NA 4CBVA 4L6IA 4JQCA 1SD1A 4DLAA 3HFRA 5DW0A 3AR6A 1YR1A 4LSWA 2ERYA 4Q0MA 2FQWA 1GGHA 1U9JA 1WDMA 2AUNA 1VZ2A 2P6MA 1NYLA 1BX1A 2ZRHA 4CR6A 4CE6A 5EFZA 1KZ6A 4ZXFA 1XQ9A 5A3VA 1CETA 4RNDB 4RK4A 3VNBA 3C3CA 2Y1DA 3NOOA 4GYJA 1V25A 1VJTA 3B8EA 4TMZA 1MT0A 4LPSA 4Q4DA 4C08A 3FDIA 4CKEB 5GVSA 2XYPA 5BW5A 1HG1A 4OX9B 4MI3A 3DPIA 5G3ZA 3RFUA 1YFKA 4CEIA 4M1SA 5GONB 3EUWA 4Q05A 2JBHA 3ZKAA 2R66A 4RTQA 2IFTA 2Z4TA 4UDNA 4FHZA 4HFMA 4IIYA 4O2BF 2XF2A 5T8KC 4FX2A 3RS4A 3HLTA 2FPIA 4HQ6A 3KOOA 1AUOA 5BXQC 1QG0A 3L0YA 4QWWA 5F76A 2GPWA 5KTMA 2DCUA 1KY4A 3DOJA 1FFSA 3JQFA 1KL7A 3PF8A 2ZUVA 3T5CA 5HP4A 1ISHA 4RDCA 3FZNA 3BMCB 4D3SA 1VGRA 4IJKA 1E9FA 5EP4A 4YUZA 2R7NA 1HBJA 1I13A 2C7BA 2BFCB 1SHZA 4Y2PA 2HNAA 3OJLA 1C4WA 4UQOA 3D8UA 1CF9A 5A2GA 3I9V1 4AYTA 1I14A 1NF9A 1W85B 3KOYA 2QRMA 3LT1A 1N1MA 3UNXA 1KEPA 5HDBB 3QUCA 2XW6A 5K0FA 1U6IA 2FU5C 4MPTA 1RJDA 9ATCA 3VR5A 2HLDA 4C7VA 3TFWA 4A91A 2XD9A 1TT5B 3LAWA 3ZHVA 3OE1A 3P0RA 2ATCA 3M5PA 4W5WA 3MK31 5FHQA 3BWEA 2VHCA 2X7HA 3C3JA 3D0RA 4OLHA 1YGPA 3MFQA 3N70A 2ZBGA 1NT4A 3QXJA 4GPTA 2M2IA 3B7PA 4PEVA 3RB8A 4B6RA 4MV0A 1Y6FA 2CLIB 1MR3F 4KZKA 1TYZA 5J2UA 4ZVVA 1T1SA 2NSHA 1YDWA 1EHIA 3WHLA 4MPJA 4QBTA 4HRVA 2D06A 4PZEA 3GMTA 4A6EA 3AR5A 4D9GA 1ZRHA 2F64A 2FE1A 3DQPA 3LHSA 1MLDA 2IODA 3CG4A 1M34E 1P6XA 4GYYA 4E15A 2R1VB 4WXHA 1HURA 5HJEA 3U9LA 1SCJA 4P54A 5KCMA 3O31A 4YMUA 3BCUA 7ADHA 3M9WA 1MDBA 1U9CA 2CJPA 1KYQA 3L6UA 2C7PA 1LH0A 4B76A 3GUCA 2BFDB 1CY6A 4L2IA 2QTVA 2BM8A 3QENA 3VKVA 2FY8A 2NXEA 3H2GA 3S55A 2NACA 2R44A 3ADPA 4MCJA 3TQHA 1JKMA 2JCBA 1ZUNB 2LPMA 1KH2A 1L4HA 3DOUA 3OQIA 3P0EA 4P31A 4RNCA 1YZQA 2GGSA 3U7QA 4F4HA 3B82A 5TF4A 2NZVG 3AI3A 1J49A 1MAVA 2RH9B 2R6FA 3MMPA 1AC5A 1CQJA 1ZQ9A 3KVNA 3M6LA 4LZJA 5EZQA 3ZZ1A 4BGUA 2IEBA 5C7YA 5AIBA 1H42A 3MXOA 3M4XA 4CT5A 2HSWA 1N6NA 2M6SA 2VUHB 4MAFA 1GZ5A 1USUA 2GSWA 5IBCA 4RZ3A 3EPJA 5F98A 1UJCA 2WUDA 3HNOA 5BW4A 2IYXA 4YP9A 3RYFB 2IYQA 3IEKA 2WR8A 3NI2A 2O1EA 2O2HA 2WF9A 5C8ZA 2Q2NA 3CNQS 3GVHA 3ACBA 3MN1A 5IYZF 4H3HB 4DARA 1VKJA 3RHTA 2C57A 4A0HA 1IYZA 3TSOA 2I1QA 2QTVB 3DEIA 3WDMA 4EVIA 5AOAA 2VF8A 4HH0A 3BE6A 3IOBA 4I6EA 2IV3A 1NN3A 1Z4NA 3HZRA 4Q18A 2QMYA 3H1BA 5EGNA 5AT1A 2O8DB 1TA9A 3ESCA 5TT0A 1R4MB 3ONWA 3MTAA 3MB8A 1ZOOA 3UW3A 3RHSA 4JA2A 2YQ4A 4QHSA 1EGQA 4QICA 4CCYB 5CHYA 1E7MA 4HHEA 4EA6A 1EM8A 4U2EA 5ADHA 3H9GA 2NVWA 3L8HA 3A3KA 3TLJA 1E4EA 3L18A 3DT6A 4DSTA 4RK1A 3IAUA 5B64A 1O6ZA 3OIFA 4WCVA 2OD9A 5FEMA 2FETA 3H99A 1RYZA 3SN6A 1G59A 4BJHB 3JWHA 4AIRA 1OLUB 4G1BA 2I4LA 4XCXA 5JQWA 3DP7A 1NXQA 1UXOA 1TDJA 5JT1A 3ELDA 1OCEA 1GQQA 3OKFA 1BCSB 3LQFA 3UT5B 3GUHA 3SR3A 5CT8A 1GYQA 2A1UA 3NGMA 5T6BA 4AWBA 3HCAA 4IGEA 1QWSA 5EUBA 5EJAA 3TDMA 1TXGA 4HVAA 4PLHA 1XTQA 3FYSA 4FFBB 3WK9A 3C70A 4XH9B 4QPNA 5F2KA 2JLQA 2WB4A 2OD7A 2BDTA 5E2BA 4KGVA 5I3ZA 3BE8A 1XKTA 2WY2D 3R8FA 4QDXA 5LLSA 5TLSA 1YDHA 1NX9A 1EFDN 1YH3A 2PRZA 2J9FB 1S2NA 3MPUA 2XDQB 2JFFA 2FZ5A 2YIJA 4EUNA 2BHTA 3CPEA 1S8FA 3HN6A 3SF0A 1XX6A 5GVRA 3PX7A 3CH6A 3O8RA 3MJDA 4I5EA 2XZLA 1EP3B 2DWOA 3OQPA 3R3WA 1RDFA 1M34A 2G5GX 3A25A 2K6GA 4RPCA 5DWVA 5BQOA 5D6NA 2X3YA 3IDAA 3FLEA 3PFGA 1AKWA 4GXTA 2A9PA 2J31A 1F2VA 1E89A 1O97D 1CUFA 2Q4BA 1Z4PX 4KWCA 5ALZA 3LS2A 2QM0A 4ZDWA 4ES6A 1WMFA 1UZNA 1DXQA 2FNAA 2V7QD 2X0FA 3VNRA 3W6PA 3WRYC 2P6OA 1PK8A 1QP8A 2WD7B 2ZAYA 3DMRA 3GZNA 4QQKA 4J43A 4HVLA 2HNKA 1T4GA 2WJ3A 1EVJA 1X13A 4Q9HA 1XTUA 4ZDJA 5KYKA 4Z4GA 1G1AA 1YVDA 3H6HA 1GILA 1UDRA 2IIVA 2R8EA 2F3TA 3HXPA 2QPOA 2IBTA 3USES 1HDRA 4RY2A 4H27A 3QHPA 1DAOA 5CH8A 4EY5A 5LPNA 1SCDA 1GTG1 2P5YA 3QEKA 2OXIA 4L16A 1BKYA 3AY3A 5KVQA 2GMWA 3Q3EA 2DG2A 3FCAA 1YJAA 4QPDA 4YRKA 3N2GB 2FF5A 4DYVA 2VAXA 1FRVA 4P3NA 3II6X 1QR6A 4PNHA 3C15C 2JLXA 3DKPA 3FROA 1E6MA 1L8QA 1LTKA 3N2IA 4QBIA 1Z2DA 5F5NA 5GTDA 1E8MA 4FFNA 4O6VA 1CTQA 1DDOA 4U39A 3L7BA 4ZPJA 4EHDA 4KWTA 2D1QA 2VUSA 1YQDA 3QMMA 3WB9A 5A1JA 4UCQA 4JL6A 2HZBA 5GAJA 1A98A 4AK9A 4CFZA 2YZNA 3IJPA 4QQRA 5ALSA 2J6BA 1QHYA 4ZIRA 1YI8A 1DBPA 1YZ3A 3DLPX 7MDHA 2ADFA 3E5HA 1ZEJA 1BE6A 3U0VA 1OC4A 4U0KA 2COKA 1OX4A 1U3UA 3FVVA 3PNKA 4O4JB 2ZJ8A 3HBJA 4RPIA 4HUTA 3HK2A 2XGOA 2HBQA 2H85A 4HUQA 4B3FX 2ODAA 2IPXA 1XALA 3CZAA 3N58A 2Z9DA 1S7GA 3BAZA 5CAEB 4GI7A 2AMFA 1WMAA 3WI7A 4JOBA 1TTTA 2MMGA 4HKTA 4AMZA 4K0KB 1HH4A 3EJWA 2R1TA 1LRLA 1OAOA 3TGPA 4OHFA 5L6MB 5FDFA 3IB6A 4YCLA 1DQYA 3G3EA 4D80A 1QQBA 2PUBA 1BWSA 4GPAA 5BW6B 3OMLA 1RI3A 4UOZA 2FEXA 2V98A 1E1RD 1N4DA 2ZW9A 2H5JA 3OZEA 2QV0A 1PEKE 2X14A 1DXHA 3KKPA 3PI7A 3FFTA 3KZVA 3MGKA 3W79A 1KI4A 4J0DA 4WFKA 3R0XA 2Y0PA 1M6VB 1PEDA 1W4CA 2YH2A 3P9NA 1VGQA 2XYRA 3L05A 1R8YA 3Q7QA 3VPDA 3FBTA 3D3JA 4E5VA 1NTOA 1HE8B 1K6EA 2GWHA 3TEFA 1JU9A 3EIFA 1UEJA 1WXWA 3ZWPA 1SPBS 3WGYA 4C4RA 3Q8MA 2HDHA 3DL7A 3QFHA 1IJEA 3BGIA 5JU6A 1Z13A 4IOJA 3EXHC 4WY5A 5GZ3A 5LQMA 2TMDA 1NVBA 1QGOA 1NBMD 4Q3LA 1ZCBA 3NP9A 4R8SA 3VH1A 1E1LA 3P52A 4MX8A 2YL2A 2IOFK 5EVJA 1X1AA 3LTNC 4FT2A 3LRXA 2YHAA 2G0NA 5TXGA 4YREA 3ZVNA 1LPBB 4PCAA 2NZUG 1FLVA 1Q0LA 1O94C 3NUQA 1QRDA 2J4FA 4QNRA 3EG9B 4C2AA 1R3UA 3I2JA 2HMYB 2ZWPA 5TQJA 1YZYA 3LHIA 5K2MA 1Y8QA 3AL3A 3M82A 1MFPA 3MJHA 2WM9B 2VUTA 3AXSA 2EZ9A 1TCVA 2HR1A 1X2EA 1SK8A 2P9JA 1I01A 4HLQB 4PINA 2R8OA 4MVJG 1EFAA 2KBEA 3EIWA 2JGIA 3A31A 4RO0A 3NFRA 1W85A 3KOMA 4NC9A 2IYPA 5K0TA 4Q3AA 1DEKA 4E6EA 2XYQA 3HDYA 1QIGA 3FJ1A 4EPVA 4XVHA 1K3TA 3I01A 4H59A 2X5JO 4IWYA 4KI7A 1EFRD 4OLFA 2GTHA 4KDCA 1X1CA 3EWSA 3RSLA 3EXFA 3STTA 1U5BB 2DFNA 4Z4QA 2G5CA 4W5OA 4PIMA 4ON9A 2SICE 3AEQA 2PO5A 3A3YA 3LWDA 4O3FA 4FQ8A 2QLTA 4TXMA 3I23A 1DEOA 1AUQA 1TJPB 4O4LA 3M6UA 1XRRA 4NBUA 3EUAA 1KAOA 4JC4A 3UATA 2IWRA 1EEHA 1EZ1A 2A88A 5KQRA 3ZIUA 1S4MA 3ADOA 4A2PA 3V32A 1R1DA 5EJ4A 5JE8A 3VYVA 3GELA 5GGYA 4YMWA 1WULS 2OKGA 2XB8A 3NX4A 3CVJA 1NUPA 1W581 4RFLA 3ITEA 1MB3A 4Z4EA 2BEWB 3KKQA 3S40A 3GJ3A 1CRQA 4ZJUA 1H23A 1MXHA 2FPPB 5KYNA 1IMJA 4BY9E 3MWLA 3THOA 2JH3A 4BJ1A 4I4TF 3QQ5A 1EK6A 2WJZB 4ITRC 2H2GA 5BNWA 5EXEA 4FFRA 3MJFA 4PAGA 2VT2A 4MV6A 4BO2A 4DCUA 2JCGA 5FUQA 5TMEA 1T3SA 2GN0A 2BBTA 1ESDA 2FCAA 4GDFA 1ZWLA 2QM8A 2QW0X 3SFVA 3D1LA 4Z2YA 2VHVA 5TQ0B 4EGSA 3GP5A 1B14A 5K3FA 2RBGA 5A4MS 2FGKA 5HBGA 2DBRA 1A2KC 2W8ZA 4FOLA 2JEZA 5B3JA 1ZOIA 4IG4A 2WYWA 4DR1B 4DSNA 4UHEA 4R41A 3GJXC 4QGAA 5T5QA 3ZLVA 4AJHA 3WKBA 3GBSA 1MB0A 2XGSA 3GMIA 3NTUA 4IO0A 1EP9A 4PXSA 3MFYA 2YDYA 4Z3DA 4JEIA 1LNQA 2JLCA 1AXGA 4CNQA 1WPQA 5SY9A 2G36A 3NDIA 3CRNA 4OXRA 1O5OA 2J59A 2X0JA 2FZLA 2I54A 2XBUA 3LUDA 3MYRA 5CR9A 4ZOBA 4YRSA 1QP7A 4KR3A 2OFWA 5JZVA 3P9XA 3F47A 3V7WA 2RD2A 5AUNB 1I8TA 3SSNA 5B3LA 4XWKA 4MTLA 4NK5A 3MRTA 1LLCA 1VA4A 3WMGA 5IKEA 1QCYA 4H35A 3CVYA 1KEVA 2G8NA 4WZAB 1RYEA 3ES9A 3VVLA 5MFZA 1EVLA 2MJLA 5DB4A 2YUIA 3OG9A 4GLJA 3UO8B 4C04A 1NM5A 1QKKA 2AYYA 1IG3A 5TQ0A 2JHAA 5KOIA 2Q1TA 5H8WA 1E3IA 1JHAA 4B9EA 1KYVA 1L5HB 2QD3A 1I30A 5BUZA 1B0AA 2B8TA 4DV2B 4CU2A 4ARIA 3L0ZA 2QG6A 1ZX1A 3ZBUA 3YASA 2V97A 1KQOA 4PPFA 4DQVA 2P2LA 1BJTA 1P7VA 5DNEA 4TYQA 2IU3A 1Z0SA 2H7VA 4X8LA 3AJRA 3JQ7B 4HS9A 4BVLA 4BNGA 1LTHR 3FVQA 4YRQA 3G2IA 1A2OA 4LRWA 4RHEA 3RVRA 5FPQA 3FDXA 3WJAA 1USIA 1LS6A 3ETHA 2HMUA 5A05A 5E9AA 2XUFA 5FTNA 2DWQA 1Z2NX 1PN3A 1XG5A 1BAPA 1HO3A 1M2GA 4X85A 5TMDA 3UCEA 4ALIA 1M5RA 4PWYA 4YQFA 1PGPA 3FUVA 5FI0B 1DPFA 3UWDA 1U0TA 4J7XA 1AQIA 2H2AA 3TMYA 3WP1B 4HN2A 3K5WA 1VXOA 2YRXA 1XZHA 2XE6A 2HSDA 2QTAA 1Q5PA 4NH4A 3JVVA 4ZMBA 4FR0A 1EVIA 4QLBA 1DUSA 3I42A 4AJPA 2PJRA 1U1FA 2I9PA 1Y81A 4DW8A 1RFLA 2GK4A 1TMOA 5L4NA 1HDEA 5FI5A 2ACEA 3FYCA 1NPDA 2CNWA 3KT6A 2GB4A 4UULA 5DHTA 3L1VA 5IMBA 4YRIA 5B6JA 4FNGA 1E1CB 1ODSA 1BWPA 1YJCA 2JJ2D 4LVCA 2EL9A 1GIAA 2Q28A 2IHZA 4MSUA 1I7SB 4QBFA 1VPEA 2C8LA 4MVJP 3TR5A 1NW9B 1W7AA 2XTZA 1G8AA 4HXYA 4H15A 1GQSA 4R1PA 1DAIA 4F7WA 5L3QB 4L5IA 4N5MA 4PX9A 3BXPA 2FPRA 1G6OA 2WUVA 4CLEA 4LZOA 3AHEA 4QPPA 1QZ3A 2BR5A 2WNIA 3LFUA 2J3HA 4J1NA 4URVR 1YJQA 1UXIA 4XOUA 1FYWA 1R27A 3FCEA 3IQIX 5A7HA 6ABPA 3MMNA 1UBEA 5AFSA 1Z15A 3FOBA 4IFBA 1WB4A 4QFDA 4ETWA 4MDEA 3DMDA 3N3BC 1E62A 1CIJA 2PX0A 4UEWA 4MKXA 2YJNA 4I1YA 1FMFA 1QB7A 3EQ7A 2VDPB 3K32A 2F17A 2MWMA 4A0GA 2TECE 4ARVA 4N48A 4FGSA 1WUKS 5EXTA 1CVIA 3GPIA 1V2HE 3KQSA 2QUIA 2VDWA 4JLSA 2AOWA 4UDYX 4NAHA 1QO9A 3BIWA 2PGDA 2WHEA 1VYUA 1V37A 2NUBA 3AJEA 3CZRA 1YBMA 3IUQA 1I5RA 5B7QA 3LZCA 2E48A 3AIMA 5FR2A 1W47A 3QW2A 2RHCA 2C9DA 1CR2A 1IXSB 2QIOA 1V9CA 3B1VA 4BB9A 1NX6A 2Q5EA 3IKLA 5TT1A 4U6SA 4QKQA 4LNUB 2AFHE 4QRHA 3A1TA 1OYWA 4ZRDA 3UJAA 4RA9B 2ZYRA 3A9SA 4Y1GA 2QD5A 4XIFA 4EY3A 3HRKA 3T4UA 2HJWA 4PO9A 4DNOA 1DO8A 1YU9A 1U31A 3PX3A 2G83A 1HDXA 3DZFA 3VSDA 4DZTA 4YIHA 2DTEA 2P3QA 3SVZA 3MCAA 1GNSA 5L51A 1RBYA 2GHQA 1R5NA 3NHAA 5KOJB 4MARA 3NU1A 4C4TA 1RIIA 5JNRA 3N7AA 2OOKA 3NHPA 1HEIA 3QOWA 3B2NA 1H9AA 1U1CA 1LVHA 3JALA 3MIIA 3DBOB 3X1YA 3K7EA 5LMNB 1A95A 3N2LA 2V7TA 3GG2A 5K3AA 4KRXA 2G07A 3CA8A 4IFTA 4XTRA 4HLUC 1FDIA 1SOMA 2WTUA 5F64A 2PIAA 4FFLA 3DC2A 1NJ6A 3G8AA 1F4PA 4WLUA 1CR4A 5K8IA 3FCOA 4FP9A 3B6KA 3TXXA 1G6KA 1ZIOA 3IP7A 2ECQA 4TL6A 2C4HA 1TCUA 1ZSNA 1M8PA 4H9GA 4HXEB 4IHJB 3EXG2 4TZTA 3BE4A 2ANCA 1XEFA 3LM8A 1JDVA 1VYVA 1ZEMA 4KCGA 1KMHB 5D84A 3ROPA 4MWSA 4B09A 2XEDA 6ADHA 4KFCA 1IB6A 2ZVQX 3IKMB 2Q99A 3NYIA 4LFBB 1YB6A 1N3LA 2VRNA 4PW0A 1LZLA 3FTFA 5CEFA 4KLRA 4P2BA 3RC1A 4EG3A 4RTNA 1IHXA 2VK1A 4PRZA 4QG3A 3QE3A 3UAWA 3CVXA 4YRCA 4L0DA 1XTBA 3A4YA 4EEKA 3UMJA 1L8XA 1PQ4A 2X3FA 4XGNA 1QO7A 4D0NA 5LXTB 1L5FA 2Q9CA 2KM1A 1L5KA 4NK4A 4KL8S 1XF9A 2IUYA 2YFYA 1FP4B 3WTBA 2KLHA 4OGGA 3AI1A 3F5DA 1DHTA 2H1HA 5DRTA 2JLVA 2CFRA 4WCFC 2BHLA 2B83A 5A4FS 1R4ZA 1D0VA 3W9YA 4UUAA 1F14A 1EE9A 1F60A 1JSCA 1T1JA 1EJ2A 2RH4A 2Y93A 3MS2A 4KDRA 5JPIA 2PZLA 3NTVA 3TOCA 2XB2A 4WVFA 5B7GA 2R6CA 3R8XA 3QLTA 1CCWA 1YMUA 3AF4A 2NYVA 2N42A 1T36A 3OCXA 2VDJA 3GGPA 1TD9A 4QBGB 2VP3A 5I7UA 2XNSA 3O1HB 5LB4A 1CQIA 5E8RA 3E22A 2JGEA 4BPBA 3JWIA 3UZUA 2VJMB 5BSFA 2M1XA 2CJWB 4HC4A 3CT4A 5I9TA 3UW1A 2XX3A 2D1YA 1ORIA 1GKYA 4L1KA 1RZUA 4H4CA 1OGJA 4EB0A 3VKGA 1P2DA 4R84A 3M3HA 5CW2A 3IA7A 1KY2A 4K2AA 4NS1A 3FMPB 2FVXA 3PPYA 4UMFA 2ZB3A 1V7CA 2O8EA 1KOJA 3NAGA 1OGYA 1KVUA 4IXDA 3HA3A 4OJQA 1HTTA 1N77A 221PA 4JFAA 3BZBA 5JCOC 3DLHA 5GZ1A 1VBKA 1N36B 5EZ5A 1T2CA 2CBGA 4DFDA 2D6FA 1QLJA 1EJ6A 1YQWA 1KVRA 3JAWB 1I4OA 3WBFA 1ZH0A 3SSAA 2ZRGA 1AHHA 1IH8A 3KRTA 4R3UC 1CQIB 4E5KA 3CXRA 4LTNA 1Z06A 2JAPA 3KWLA 1QKIA 3NLLA 1A1SA 3G0BA 3WYGA 4DLLA 1UC9A 5J1SB 4YR7A 1Y8RB 3SKXA 4NV0A 1E1NA 3Q5GA 4LJ8A 4L5JA 4GG1A 1S89A 2OKCA 4N7JA 3AHIA 4EHJA 1I32A 3P4UA 3EVTA 2ZUSA 3CF4A 3VYTB 4BMSA 3T3HA 5K45A 2HXSA 2OXCA 3GLHE 1SIWA 5KTOA 4AD8A 4KITB 4UHCA 3GRCA 5DYYA 4KLZA 5IKXA 2FG6C 2HK8A 1XZBA 3CH7A 1C9NA 4JEHA 3MJRA 3A6PC 1S0UA 3ONNA 3RCBA 4RKFA 2EKZA 3L0PA 3G2NA 4CLXA 1L6IA 2IUTA 3N8DA 4DPMA 1QQAA 4LHYA 5TDHA 2FLKA 3B6IA 1B1CA 2DLNA 2OORA 3FUWA 4EM6A 1HT1E 4RKEA 4Q1EA 4C0AC 1E0SA 4Q82A 3G9UA 4HATA 1R6VA 5BWLA 1ADYA 5CIYA 2H00A 3OM8A 4G85A 4HX9A 5GOZA 2PUHA 1NN0A 1VKHA 3QOXA 1ZHHA 1SY7A 1LDYA 3C8MA 2WUFA 1CB0A 1H2HA 4KPFC 2VP6A 4CFSA 1RADA 2KYRA 3AFHA 5TMBA 2WQZA 5HE8A 3GYBA 1ZQ1A 2W6MA 2O0LA 4HUQB 5ARCA 4AZSA 5DW3A 2NAPA 1E63A 4N0MA 4EJSA 3GLGA 1WA5A 2NNLD 4OBWA 4E7PA 1HGXA 1Y8CA 5B30A 3GBVA 4KJXA 3DFUA 1BEUB 3LRTA 5FOUA 1KJZA 1TNDA 2R2GA 4MHSA 4WXPA 3QJGA 1WMDA 1Q0ZA 2R6ZA 2Y99A 4H6VA 5EHGA 4OAQA 2FA9A 2HF2A 4DV0B 1H8HA 1KO7A 4L4XA 1E2FA 1G63A 2OG2A 2PK3A 4EY8A 1N2IA 2DSNA 3MGBA 4PYNA 1N2CE 2O1XA 4A8JC 4D9NA 2UZ3A 4HAXA 1SVLA 1W0JA 1GQ2A 1Y6JA 2IDJA 5JNSA 1II8A 3KWJA 4ENSA 5AQ1A 1NDUA 2RSLA 5H4GA 3D8TA 1NA5A 1UZUA 3OIDA 2EX4A 3GT4A 4C3ZA 1U1IA 4EA7A 1U94A 2Z5VA 3WL8A 4FFWA 1ZVJA 3RC9A 4D9FA 5EIAA 1E9SA 4ANFA 1QC5B 2FFQA 2OHHA 1S3FA 4OV6B 4X20A 1UDXA 1UKEA 2W2MA 1XZGA 4JXKA 4JZYA 5JDCC 3V00A 5CMLA 1EVQA 2EQBA 1A8QA 4Z54A 3I5XA 4PQRA 1E9DA 1O3YA 1ZW6A 4JROA 3I72A 4WLOA 5CUQA 5AW7A 2DLCX 5M5BA 1CY1A 3DEHA 3W3AA 4FYYA 5F21A 3NJRA 4MV4A 3MWJA 1ZA1A 2AE2A 4RH1A 3VV2A 4BFTA 2J6CA 4OHWA 4M0UA 1KO4A 2O1SA 2XWSA 3KKNA 3GD7A 4B2LA 3DAFA 1ZK3A 3GOQA 3WQRA 1NQTA 2QTNA 1OA1A 2FPWA 3C97A 1FRZA 3KHTA 1QYVA 2UYQA 3H0KA 1MB2A 4FDUA 5ANRB 2C03A 3D31A 2OG1A 3O93A 5FNVF 2OXTA 4RDIA 5JUWA 4QC2A 3O9VA 4AN0A 4YJFB 2IH4A 1XLVA 2W37A 3RRYA 5BO5A 2J07A 3LUBA 2QX4A 3REOA 4MV7A 4RF3A 2C07A 1LZKA 4X61A 4CLDA 5JSUA 3R3JA 3Q2KA 4PYOA 2D13A 4ZQFA 2W70A 1P9OA 4ZYTA 4IRXA 5IRCD 3BTOA 4LFAB 1YA8A 3MA0A 1GU7A 2GHTA 3VKFA 5IANA 4D92A 1CS0A 1SKAA 2VJYA 3H4IA 3STUA 4F1KA 2H4YA 1LD3A 2XRFA 3OQHA 1RWWA 5C46F 3PYXA 4XIYA 4HV4A 1FA9A 3PXEA 1GZ4A 1S1CA 4N8SA 1GD1O 3BGSA 4DLVA 3FIJA 3SJAA 2OGZA 1JWBB 2IUEA 2YWDA 3P2EA 2I3BA 5EIOA 3GJ5A 4F5DA 3R41A 1DKMA 1RNLA 3OP4A 2Q45A 1TECE 1DADA 4U3JA 4UASA 5IC4A 3M6FA 3KOXA 5HHTA 2WB2A 3PP8A 1UJBA 1RLJA 2L2QA 5FQNA 2HD4A 2ZJZA 1M1NB 2OHJA 4CKBB 1X9IA 1XCOA 2X86A 5EKUA 5JNWA 1CSEE 2N47A 4R54A 1TQ8A 2CNKA 3KO8A 1L0BA 1ZG3A 4LI0A 3TIFA 1GG5A 1XEWX 3MTGA 4B3BA 5LIRA 4OHRA 1GTSA 5ALWA 1MJFA 1V41E 4Q34A 1ZAKA 3HXTA 1P39A 3OQMA 2I8AA 2XITA 4H7JA 1WDKA 4JP5A 1UDAA 1W4ZA 4C14A 1GNRA 3KR2A 1SA0B 4Y2XA 2ADMA 4YA6A 3TH5A 3I3SR 4PYIA 1GFWA 4KUHA 3HGQA 4F85A 2ODQA 2XZPA 3TVYA 3HKCA 4OM8A 3DM9B 5FUXA 4QQFA 1PDOA 3CF4G 2C8VA 4L85A 3ZCVA 2PXXA 2WWRA 3Q8KA 2VOJA 4JWKA 4U4AA 1C7ZA 1XQ6A 3IQEA 3VHXA 2P7IA 3NNNA 1N9GB 4TRJA 5SY6A 4B6OA 1EM8B 4FWTA 1RAIA 4BBPA 1VP3A 3QP9A 1KYIA 4WNCA 1KKUA 1YL7A 2QVZX 3P7MA 1DTSA 1KZHA 4ACAA 1SRRA 4KN5A 5CD9A 1JXMA 1NJSA 1RQPA 2F4NA 3EGDA 1IJBA 2ONZA 3CLVA 4AWAA 5L6LB 3B6ZA 3G5LA 3EASA 4Y6GB 4OKSA 4NOJA 3VR2A 3D0OA 2C20A 1NVGA 1PKXA 3RUAA 3PTAA 1Y5NA 2KHZA 1X80B 4DSZA 1Z5ZA 4J6EA 5U4QA 4F3RA 2CLFB 4YLEA 4F4JA 3PNPA 5LP6F 2J9GA 1RPAA 3H3JA 1PD0A 2SBTA 3GOHA 3P9KA 2KQUA 4MA0A 5C80A 1C30A 4JLDA 1GAWA 4OFWA 1EWRA 3GW8A 5ECYA 1HQKA 3IPYA 3UHFA 5HUHA 3FVWA 2XVYA 4KDFA 1TMKA 5K0EA 4MLCA 1QPZA 1Q7CA 4WNAB 5LBIA 4TKZA 2W9XA 4UNIA 4C6HA 1EK5A 4MRRA 2WYIA 3DZJA 1WY7A 4D5EA 4IQ8A 1NOKA 3BXOA 1S6YA 2XBMA 2RJOA 1U2GA 1D1TA 2NO6A 3M3PA 4MINA 3ZS8A 4C3UA 1SU6A 3HADA 2DKFA 3THXB 1G5PA 2XLBA 1ZIYA 1U5AA 1EKXA 2C2YA 2LCFA 2R1VA 5JMWA 1HLPA 1KP9A 4OXQA 1I0ZA 4PHHA 2IYWA 2WDPA 1O03A 3B3GA 2J0UA 4GO1A 3FYUA 3VVBA 3LBFA 4Q93A 4DZZA 4S04A 3KEFA 1DEAA 1PNTA 1D2HA 3D8RA 1NATA 3UK1A 3FFBA 2BFDA 2QXUA 2OUIA 2EFCB 1ZGZA 2YMLA 3WC4A 4EY4A 2LRHA 2WKPA 3COVA 5MDHA 1FS6A 3DCYA 3FZYA 2QMZA 2YWBA 3WGUA 5IM4A 4LGYA 2G9ZA 1R4MA 4TTTS 3K5IA 1DQPA 3I53A 1IAQA 1XVTA 2VOEA 2OCGA 3KJHA 1PTJA 1R0XA 4KAFA 2JGFA 2Q4TA 3U4MA 2WJWA 5BQFA 1IK6A 1N2SA 2CYCA 1ECFA 4Y2RA 4RTOA 2A5YB 3DZGA 5E7IA 5KYUA 1SCIA 1KH1A 2H51A 1FSPA 2CUNA 1EJBA 1VLQA 3I8OA 4KNWA 2OQRA 5EE1A 3NP7A 4TN5A 1CK4A 1CLEA 2YICA 4GRDA 2PLAA 2ZJ5A 2CXRA 2J46A 3KJIA 1W6UA 2GD6A 1NVFA 4K28A 4GR5A 3QRWA 1NIJA 3RF7A 9ABPA 4JB8A 3K5PA 1Q19A 3HE3A 1VJ0A 1X80A 3HZOA 1I9CA 4BFZA 1KI6A 1WG8A 4CEHB 2YC2C 3E9YA 1XN4A 3G02A 3HYTA 1NBHA 3JARB 1E69A 1YBVA 4I50F 4LIPD 5BSVA 2QL7A 3WRVA 3R40A 4ZAFA 3OVMA 2XT0A 4H6XA 4OX9Y 4G41A 1KJJA 2I4MA 1OB2A 1DG1G 1UPTA 4QUKA 3P4YA 5AK6A 4Z2AA 1VDMA 3FIUA 2JBWA 3QMPA 1GOTA 2X76A 5LC1A 4ARSA 1KRWA 1K66A 2JFOA 1B0PA 3HV0A 3UYLA 5A5FA 4CM9D 3BTVA 1QHEA 3WGMA 3R5SA 1OILA 2FMTA 1CF2O 5CT6A 5AI9A 1H0KA 1EEXB 1HT3A 2PXHA 1FLNA 2NYAA 4LCJA 1GTMA 4MYTA 1JDBC 4PZLA 2AF4C 3ODGA 3ZEIA 4PLCA 1ZNYA 2FZVA 4L6CA 3S99A 2RGEA 2WKWA 3G13A 4HJRA 3SNKA 4EG6A 5E6SA 2FQXA 1J0CA 4FVTA 4B79A 4GF5A 1QVVA 2JCSA 3WZ2A 3ZV7A 5ITZB 1TA4A 1VPTA 1M1YB 4LJ6A 4BMDA 3HY4A 5H16A 2AFHA 4EPTA 3QU2A 4DB4A 2QMUA 1JQ3A 3E53A 1GAJA 1G64A 1YZHA 2GK3A 3B6JA 4RAQA 4DIBA 3I1JA 2UVPB 5AJHA 1SVIA 1RVV1 2AS0A 1QJ4A 2M6RA 2VJBA 4F97A 2XVZA 3G8YA 1WV1A 3AB7A 2Y67A 3UWPA 3I0ZA 5D01A 4BMNA 5TPWA 2XUJA 2WMOB 1HNWB 2PD4A 3V1LA 2DERA 2VS1A 3RRFA 1OTYA 2FWJA 1ZICA 2UVQA 4E2WA 1C81A 3C1OA 4BE7B 5F2OA 4EG5A 1YV9A 3MCWA 5K0GA 2HDWA 3LKDA 1WXEA 4IJWA 4AG3A 4HQFA 1OLOA 1WMBA 2LD4A 3JQGB 2MYUA 3BCRA 4NJOA 3ZDAA 4M54A 2XB6A 1AQLA 2D0DA 2OQIA 4TN1A 4BPRA 2PUGA 5DEIA 2W2KB 3P2IA 2HCBA 3OPYI 4GUAA 4MUNA 3ANXA 4E6PA 3OX2A 1D4FA 4GOOD 2CMHA 4D9JA 2YNMD 4UTOA 4LJ7A 4YDSA 4E1VA 3S81A 4D7AA 3UV6A 1QIDA 2GVDC 1T10A 4OIFA 4TMXA 3QUAA 1ZOPA 3FB1A 1HOTA 1NXWA 1TZ2A 2B8NA 4GOLD 3QBJA 3T38A 1I4DD 5TSDA 5CCBA 1NVDA 4HFJA 3NBZC 3GT3A 4JSRA 1JBKA 1JSXA 4K6OA 4E5MA 4NMMA 3TAXA 3E9QA 2JLYA 1CZKA 2QAJA 3PCTA 5D3ZA 2OFFA 5FH9A 3L8FA 3SM3A 3SS9X 4WCDA 3IDSA 4PZCA 1FDWA 3V8EA 4Q5IA 3X1MA 1Z83A 1EIWA 3K09A 3THYA 3QMWA 2QHXA 2P4HX 1ONNA 3W3ZB 3MAJA 4DY4A 1OXSC 2UUCB 2IDMA 3RRXA 4L4ZA 2VK4A 4L51A 1XD2A 3L40A 1C4OA 1Y6QA 2ZRJA 3VSEA 3ZE0B 2ACKA 2CFTA 2WG0A 3X43A 1NVWQ 1KS2A 1SQFA 2VSFA 2B0JA 5B1HA 3ZI0A 4FHDA 4X3CA 2RAFA 1DAFA 5AK0A 3V1YA 1Y3IA 1E18A 4YRBA 2I0FA 1X7HA 4QLAA 3FAKA 2HWUA 2WG1A 1OREA 4UDOA 2Q4OA 3PRHA 2EFGA 2ZBEA 1TZJA 2KMLA 4YRDA 4R01A 1PX2A 2Z04A 2JLWA 4MJ7A 4QASA 5FA5A 4ENUA 1W0JD 3DXYA 4FOTA 3S8MA 1EVEA 1GKUB 3ZDXB 4KFSA 4AY5A 3GFFA 5AI0A 2WBLC 1MENA 2HN9A 2G17A 4R6WA 3I61A 4S3MA 2B6NA 1XQXA 4HYYA 4CW7A 2WJJA 4JASB 4BEWA 3MJ4A 2ZBDA 2D4HA 3UKOA 4RQTA 4LGVA 1RWOA 2XWBF 3I3OA 1VIVA 4J9VA 5DTRA 3SC4A 3MSXA 4EUHA 4MICA 3AB8A 1J2RA 3QK7A 1VCHA 1VE6A 2WJ6A 2ZRQA 3O2SB 2UZIR 1XOIA 3ORFA 2I9KA 3PC6A 4Q3NA 3WYFA 1UBUS 2OV1A 4GD3Q 4OHZA 2BF7A 2C3MA 2ZYIA 1KAGA 1Y4ZA 5JC8A 2Y1OA 2IYFA 3AVVA 4I9HA 1KJNA 3ODPA 1V3VA 5EZ6B 2O8EB 3W05A 3ZV3A 1EDDA 5GM2A 5KTSA 1IWOA 5GINE 1VRVA 2AV6A 3SJZA 1R37A 4KWHA 1JHMA 1LUAA 4IDCA 3NFYA 3DMYA 4IJQA 4YR9A 1YA6A 1COWD 4MB0A 3L1KA 2CW5A 3PQ7A 5FPTA 1NR5A 1MMFB 4X62B 1KNXA 2HU8A 3Q5DA 3SBXA 4B75A 4DT1A 1J2YA 4RM3A 4XWAA 5KSWB 3AEUB 4FBGA 4Q6WA 3D1JA 4JP2A 4KFTA 5LUBA 1L9KA 2JG3A 3E15A 1BYIA 4Z7QB 2UXBB 3K9FC 3O9MA 4INPA 4NBWA 2XZOA 2NTVA 4PCLA 2TMYA 5JEDA 3NB0A 4L2IB 4YFYA 5KNCA 4B7XA 2CFIA 2JRLA 4EKNB 3OUTA 3AUAA 2Y05A 3Q3JB 4COOA 3OPVA 1FK8A 2PS1A 3QVWA 3SDBA 4JJIA 3ZE8A 1IY9A 8AT1A 4WGFA 2X6RA 3QVVA 4A8PA 2CWWA 1Z8HA 1DT5A 1ESEA 1SOAA 4GZMA 3LPDA 2OCPA 1WZUA 3ZWWA 2AC4A 2OY0A 1Y0BA 3H7IA 4BL5A 3AEXA 4RF4A 1EZ4A 4AZVA 4WCFB 2OVBA 1MORA 3CZQA 3ZD8A 2LIVA 3HHPA 2FG5A 721PA 3MTEA 3RUHA 3IDZA 4I7EA 4HQKA 1JR2A 3HACA 3PT9A 1P5RA 1N33B 3Q41A 4PX3A 3WLFA 1Q7GA 1T6ZA 2NAFA 4EHHA 1L5SA 4L3WA 1JPUA 4NEHB 1G0OA 4UNPA 5HBRA 3ORYA 4V24A 4HYEA 4M36A 1JQAA 1U8AA 4RHYA 4Y1RA 1JIXA 2ZITA 4MCAA 1LS1A 5BY2A 1ZAYA 1USWA 4XR4A 3CR7A 1Z2CA 3KXDA 5IC5A 1E4VA 4DRYA 3RIHA 2NV0A 4PM4A 3SXUA 1WEHA 2BZGA 3EQ8A 5B58C 1D9XA 1FW8A 2QRLA 2OHVA 4F6RB 1RQ2A 3U4DA 3KB1A 4EG4A 3OCJA 1JRLA 3IQDB 3PQDA 4LZLA 1F2DA 1N7GA 2QR3A 5J1TB 3LYLA 3RU9A 2Q5IA 4PZUA 4BQOA 3TF5A 2RGRA 1F38A 2WWVD 2PVCA 4M21A 3BE5A 4TTPA 2QV7A 4FXOA 4MUYA 5DNAA 5TNXA 1IOZA 4LDQA 1EXVA 2FP4A 3GJ4A 4LYHA 2CV1A 2CHEA 3UXHA 4BBZA 3E05A 1WVMA 1BW9B 5KSOA 4GGOA 1PV2A 4Q9AA 1JNYA 3P26A 3GRAA 5DHAA 5ETJA 4E12A 4BYGA 2FRDA 4QQNA 5FL7A 1IZYA 2XY4A 2YOGA 5BR7A 4QM6A 1UPAA 4EI8A 2BGGA 3R75A 1P0MA 5JHGB 3GFOA 5IPFA 2CDNA 2H52A 3EXEB 5AW2A 3NT2A 4DL9A 3AM4A 1NFFA 1T43A 1WCIA 5CHEA 3G2LA 2AF3C 1U11A 1OFIA 2HFKA 2CDRA 1QO0D 1XTIA 1XD9A 1ZNQO 3KHKA 3DF9A 3K8QA 4I55B 4OP2A 4KE8A 5KJ1A 4O4HB 2FPGA 3S2IA 2MT9A 1A8PA 2DAPA 3JTMA 2R6JA 3BXHA 1TCAA 4LQ4A 3WZMA 1J5PA 1QYXA 3UGJA 1QHNA 3SMQA 2FPXA 3CUVA 3Q85A 4OJYA 3AIKA 4Y2VA 1XEXA 1WW2A 3ZZMA 2XVMA 3QFTA 4N5IX 3IQHX 5JOQA 3K6KA 4RESA 1N6KA 1E3WA 4GM4A 2JIDA 2A5DA 2EJVA 4I8XA 4F8EA 4J3JA 1F06A 4XX0B 2H59A 4TVBA 4B7UA 4C7OB 4PQYA 3EVDA 4Z0TA 3BKWA 4B46A 1Z07A 4UOEA 3I73A 1E96A 1RXYA 1NI5A 4JI3B 1C2TA 2ZR9A 4JLJA 5HUQA 3UM9A 1E64A 4JLBA 1YBHA 4PC3A 1BEEA 2YJ6A 4PYKA 3PDJA 4MJLA 2VNJA 4W1RA 3LOPA 1SCBA 2KLBA 4LYJA 2BKEA 3IEVA 1N7HA 2Q27A 2VPQA 3EWAA 3ZGXA 1ZO8A 1BRMA 1GU1A 1P5JA 3NBQA 4G0NA 5IBPA 2MYPA 1CEXA 4IX9A 1N0IA 2O4UX 2V8OA 4MR7B 2ZJ2A 2DETA 1DWOA 1JTEA 4A0SA 1L4YA 3H8VA 2D0PB 4FGUA 4S1NA 3PJFA 5F4BA 3ZDYB 5CDYA 1HYGA 2F9MA 1DXYA 1FYFA 2QSUA 2Y1GA 1ZMBA 1KP3A 1MD9A 1Q20A 1GZ6A 1SJ9A 2XCIA 2FSGA 2EJTA 3M1IA 3R5FA 4B3DA 4DR5B 4A15A 1CR6A 2HW8A 3K8YA 4R68A 3I04A 5HILA 2GAAA 4M7RA 4RKQA 3SKYA 3UJ6A 2BMVA 4H16A 3ER9A 3EHDA 4JYMA 2PR2A 4MLZA 1Y33E 4OG2A 1Q7TA 1Z4OA 1J7JA 1P5ZB 1CC1S 2CLHB 4Z0PA 3KQKA 3F4LA 4JZKA 2OMEA 4PAOA 2IKSA 3QEMB 4FYVA 4R16A 1YI0A 1BMFA 1BA2A 1DQNA 1LQUA 2FR8A 2P69A 3AYXB 4C4SA 2OGWA 4ENPA 1KFJB 3ILSA 4NAUA 1ZZGA 5EHIA 5KJ6A 5HGXA 2VXBA 4OHYA 1WLSA 1F8YA 4JJEA 3PEEA 1GPH1 1CRZA 1WUYA 3LFHA 5FX2A 4CI9A 2BUAA 2GWRA 2HU5A 3S8YA 2R60A 4FW8A 1RS0A 1EK0A 4ZVNA 1RBQA 5JVDA 1Y9ZA 2I22A 3DA8A 2FFBA 4ZC8A 1JLRA 3WMFA 4U7WA 3GGCA 5IFKA 1G3RA 1O89A 1QBGA 3INNA 1R9GA 1FYVA 1MVNA 2FJUA 3DL2A 4RK7A 2R8BA 5BSTA 2WK1A 4JELA 3U4AA 4IVNA 3AEYA 3RYFA 2QTBA 4NENA 5EPEA 3RM3A 3JWPA 1VA5A 3C3WA 4BNHA 5B55A 4M1EA 3G5TA 4RTPA 4O1HA 3PGKA 1EWVA 1RZVA 3K9BA 2P1RA 3A3NA 3PPXA 2GERA 2Y92A 3OOJA 4TS3A 5DM2A 2ZUFA 1RPJA 1J8YF 2OZKA 4N3NA 1DPGA 4RJLA 2QN7A 2GZMA 1KVSA 5ER9A 3AVTA 4WZBE 4URHA 1JI0A 2QPTA 3VHQA 3EFEA 4TMYA 1T4CB 1DIAA 4K86A 4R9UC 1GPNA 4HGNA 1MC1A 3VKWA 3HYNA 1IBMB 2NU8A 3WQQA 2ZZMA 3D7NA 1GQFA 4CG2A 2QNBA 2Z6UA 5KVAA 2XCLA 4QOHA 1GSHA 3DB2A 3K20A 3TLGA 4EB6A 1JFSA 1DIBA 2DQKA 2V5UA 3PXUA 5HRAA 3ISJA 2DLDA 3GLKA 2ZTHA 1WO8A 2LV8A 3IQZA 4XX0A 5FUMA 4D4GA 3N5KA 4BO6A 2VKQA 5ES3A 1SIOA 1W75A 1P31A 2OP0A 4V1CB 3A1EA 4LUCA 1P80A 3F6PA 3NIFB 5B6IA 2NPFA 3PITA 3H2ZA 2FWIA 3IPAA 4PO1A 4DIEA 1J9GA 3PNMA 4GGPA 3QLVA 3QYAA 1QHIA 1US8B 3GFBA 1U65A 3FPHA 4ND5A 5AOCA 2ZJ4A 4UQLA 3EZNA 1X74A 2Q3LA 4LJAA 3W4JA 2RKWA 4J1QA 1V47A 3RFCA 4I1SA 1BWRA 1E6CA 4U7FA 2D3WA 2G1UA 3L2OB 4J1SA 4F8YA 2CF5A 4YLYA 2PYDA 4UM5A 3I1YA 5I9SA 3FKJA 3D6MA 1ABEA 4LE1A 3U4CA 4D4JA 2ZAMA 5TV2A 3V4RA 1M1UA 1KK1A 4Z53A 3BDAA 1G8KA 2B99A 4LDZA 5EP2A 3WDSA 4ZK6A 3VZCA 5JSZA 4YAOA 1NAHA 3SX4A 1U3DA 1I4EB 1X7WB 4Q3BA 2QUJA 4MUGA 1CZRA 2IWHA 5K8CA 3O4IA 1PS8A 5J3JA 3BF7A 5FOWA 4R7TA 3AIIA 2ZYGA 2EC5A 5DM4A 5EMHA 2WWGA 2ZJ6A 5FLYA 2OFPA 3A6GA 5KNCH 1O8CA 4RD0A 2FR0A 1FUKA 1TPZA 3ITNA 1BOFA 1GGKA 2GD0A 2GSDA 4OXYA 1FUYB 4RD6A 3UXEA 3VTAA 4BLUA 1PIWA 1T9BA 5K0JA 5ILOA 5HMMA 2HQBA 4MA4A 5J58A 4EO9A 1DCKA 2CLMB 5JSYA 3ZLTA 1CHDA 3GT7A 3QWAA 5D7BA 4MQLA 2NO0A 3IULA 1Z4MA 3NONA 3SSOA 1ADJA 5IVIA 1BIFA 2IYOA 1ZN8A 1XRJA 1UKZA 2J08A 4OHPA 4YJFA 4OUDB 4Z9BA 4AWXA 1Y6ZA 2Q5OA 3UBTA 2WVHA 1SC3A 2AFIE 1ZNWA 1T1IA 3HU5A 3KK0A 4L7QA 4MVJE 1N0VC 4QUGA 1C80A 1E7SA 1UJMA 3I28A 3C5VA 3K3PA 3PNLA 5REQA 1FUIA 4QU9A 1MTZA 1WD7A 4YT2A 4C6RA 4OYHA 5FFMA 3EZ6A 3IHKA 1RAFA 4MQFA 4QOFA 3K2EA 5C7LO 1Z75A 2R8RA 1JJ7A 5JD5A 1ULHA 5IVHA 2D5AA 2JIPA 1AT1A 2BDEA 2WT4A 2Z8ZA 3TMAA 4DLRA 4DCOA 3DO5A 1YDFA 3RROA 3HV2A 3LO5A 2VT6A 4U63A 3D2BA 5KQPA 2OGSA 3LKZA 2BELA 1SZPA 3KTFA 1M74A 3C45A 1PS0A 3GLUA 4JEUA 1EXWA 4LXXA 1T5TA 4AKHA 3WGTA 2R3SA 3GEEA 5JAOA 4CHTA 3WYDA 1R8QA 4HAWA 3QLVC 4UM8B 5EPUA 1OASA 1U8UA 3KKMA 1EGAA 2X0RA 2A94A 3AI7A 1JHVA 3VNUA 3QWHA 1PNOA 5JTTA 4N9QA 1Y9AA 3RT7A 2QRJA 2R79A 3GLRA 1EDEA 3PFCA 1ESNA 2JW5A 3F2IA 3BJRA 1RHKA 4NONA 3TPCA 4EMSA 3I2IA 1GR0A 2A3NA 3BXFA 3OU7A 4Y98A 3RJZA 2XUIA 1AE1A 3HB4X 4ISBA 1VIAA 4Q4AA 4K6HA 2QTTA 2R1UA 3DDHA 3GLVA 1C29B 1NU8A 2WTMA 4OJNA 5A3JA 2VHJA 4EB6B 2HB6A 5HRCA 3HVRA 4TSFA 3GMSA 2B1QA 4YUXA 4PZPA 1TQ4A 4PYMA 1KGSA 3W8RA 5THQA 4RMNA 3STWA 2XAUA 3QF4B 1MNAA 2DSTA 2PV7A 2P9TA 2VPTA 4WN3A 4E21A 1VSBA 3M6VA 4I14A 3WS7A 2VJOA 3O90A 4C9BA 5HVNA 3VHRA 4J29A 1HZJA 3X2FA 5TEWA 3ELBA 3RNOA 3GN1A 3EMBA 1P33A 4E5PA 4D4LA 1UOQA 2QRNA 3E2PA 4FIZA 2F62A 5A6SB 4CM3A 5AUOB 1U2RA 4YNBA 3TKYA 1A7UA 3QUQA 3U48A 2WAXA 2QTMA 4BX8A 4DMCA 3PPIA 5HFNA 2PKQO 4UTXA 3OOYA 1LVGA 2BMEA 5C4MA 1J2JA 3IIIA 3JATA 3GLHB 5ITSA 2C94A 2IZ1A 3FOCA 2E9SA 1SNYA 4M89A 2ZULA 3VYWA 1PHRA 1T0UA 1AF4A 1YDGA 5K3BA 3SZ3A 5IJ0B 2GPYA 4GQIA 2ZKLA 2HJSA 2REXB 1UPUA 3PJEA 3WY9A 1YRQA 4J9UE 4E3ZA 3PK0A 1BX3A 1N0WA 3FSGD 4D9EA 3OQJA 2PSJA 2V0GA 4WOJA 3B70A 4BHTA 3I39X 5FLXA 3QF4A 4POOA 1HT0A 5BUSA 4OYYA 3U1TA 1L5RA 4QJ4A 1FFYA 2VYVD 4UOQA 1XI2A 2B8JA 1CDZA 2PRIA 2AW3A 3HVKA 5GIPE 3JV7A 4RTJA 3H18A 1Y1PA 3KL4A 5DP1A 5JNLA 1JWLA 3OCWA 1E2KA 3V7FA 1J23A 2R7MA 3AC0A 4D5GA 1JLSA 4ZV9A 6YASA 4E4RA 1GPLA 4YJ3F 2E4AA 2D1SA 2WWFA 3BRSA 1QNLA 2FF7A 3KJFA 4Z3KA 3VISA 3A3OA 1VMKA 2ZDHA 3IBSA 1Y48E 4UZEA 4XXHA 1WR8A 1F3OA 1G42A 3MPOA 3O4HA 5EJ2A 2DH6A 5J2TF 3TPZA 2G88A 2X1MA 2AOVA 1QIKA 3EC2A 3OZSA 3PBKA 1UM9B 1IM8A 4KXNA 1F4VA 5EE0A 3JQRA 2QTGA 3PD1A 1TUBA 5D7NA 5AM4A 4P7GA 5FOVA 1TX4B 2HREA 2ZI4A 3GJ0A 3UN1A 1RXVA 1LDNA 4CDNA 5T57A 3X1WA 1SBCA 1QGUA 2QRKA 4PLGA 4PLPA 1C0LA 5EUMA 4CKXA 4DDUA 3DMPA 2VH1A 4QOEA 4B9AA 4ZICA 1L5MA 3HO8A 3OLVA 3R7DA 4HAVA 4JBWA 5CDUA 4QIHA 1FUUA 5AOVA 1QGYA 1FTQA 1OBFO 3R7WB 2IOQA 1NI4A 2WFAA 4I50A 2I34A 3OX4A 2Z8XA 3PYLA 1JHPA 2HXYA 2ZPTX 4KQFA 1EXDA 4FJ1A 2C5SA 2YVUA 1TMGE 5JSKA 4CV3A 5A9RA 3T3MB 4CKYA 3LL4A 4M1ZA 4E08A 4EF6A 4JJ7A 4NMWA 4CUKA 1EFVB 3DHNA 3T7RA 1K7FB 2PKCA 3DBRB 4BB5A 4E2YA 3PCXA 2GM4A 3RRJA 3U17A 5A9SA 2QR5A 1K9VF 4AULA 3PWTA 4TKUA 3T4XA 5AKIA 3KFXA 4QYXA 4YH1A 5HZKA 3PDCA 4DBLE 2V0CA 3HCBA 3K2BA 3MGAA 4K8OA 2CFOA 4PVDA 5EA2A 5DLQC 4IQ4A 4M76B 2PKYX 3WFIA 4HEQA 1LNSA 4E22A 4W1PA 2X9NA 3GIDA 4WY8A 4LBZA 1V5FA 3DL0A 1TVEA 4IXMA 1IY2A 4ZI7A 3N2NA 5HF6A 3WB0A 3ENZA 4RHUA 4EEZA 4C7KA 2C95A 1KC1A 4FYWA 4UTNA 1HKUA 3C7DB 3SQXA 1AIPA 4OK3A 2JD0A 4PONA 2V7QA 2H0RA 3TW6A 4K6KA 3Q1LA 4YP6A 3WO0A 2DKOA 4DB2A 1YC2A 3QVGA 1QPGA 2H7XA 3ESQA 4P5EA 3DDZX 1NZFA 2ZSFA 1O6GA 1U2DA 3Q7EA 5F3DA 1F3LA 1JECA 4BNLA 3LX4A 4WK0B 1C4KA 4MUXA 3EVZA 3LOQA 5JY6A 2G8LA 4NCIA 1TC1A 1FIUA 3O2NA 3VO8A 2EIXA 3VNVA 2EKBA 4H1VA 1OYYA 4QARA 1E0DA 1R0SA 2PT7A 2R4UA 3RSSA 4IBOA 5IBQA 2B78A 4DA8A 1UDBA 3NC4A 4R1UA 3V7NA 1MX9A 5KEIA 1SQ6A 2V9ZA 3KP1A 2C2XA 4OTZA 1TTHA 3WA7A 4YPFA 5ISMA 1GZUA 3FKQA 2WLSA 4LZPA 4LXHA 3L77A 4CTKA 2PGIA 4EJ2A 2WSYB 4B2PA 3RTAA 3B48A 3VR0A 3KC2A 3DLCA 3K0EA 4DJJA 2BUBA 2ISCA 1GLNA 3P20A 3L7LA 1GRRA 1KERA 4W8HA 5JC1A 3KUKA 1IATA 2J3JA 2XKJE 3LXXA 3W5CA 2RK6A 1Q57A 4BQPA 3EVGA 1JVSA 3Q5EA 1TM2A 4W99A 3HCEA 1U2PA 1Q0TA 5LQRA 3ILYA 1WUJS 5E3JA 3DULA 3VOBA 4FOOA 5JS1A 4UE3S 3HB9A 1MO4A 1MV5A 1R64A 3OESA 5AH0A 5LOVF 2V4MA 3D59A 4FNMA 4DV3B 1B7GO 4NNPA 1KKLA 4O59O 4P3XA 4MYHA 1V71A 3W2HA 3L6OO 4LCEA 3DFKA 3VR4H 3QBTA 1U0JA 2PZFA 2H2DA 4ARZA 1OLUA 5KNCD 3CHYA 3RO7A 4C3VA 3C1UA 3M2TA 4RV4A 2PNJA 3ADBA 5CDFE 5AHRA 3W2TA 1WXFA 3EMKA 4FFSA 2L19A 3LXUX 3SZLA 1U90A 3VR1A 3RU7A 1G6Q1 4ZALA 5FF9A 2WF5A 5DASA 4BP9A 4LC0A 1DOZA 3MG9A 1M5UA 4LJYA 1UFQA 3G23A 1PAUA 5HK8A 3PPVA 1PBNA 2NV6A 2OBFA 2WSLA 1TK9A 3U3MA 3WLKX 3I45A 4B87A 4K2HA 1QU3A 1Z26A 1GFIA 3JXEA 1PG5A 4GEGA 4IRMA 4F4UA 4P53A 3K05A 1IY0A 3OFJA 3CTPA 1OFTA 1CFJA 5C4IA 1ISFA 5AVTA 3O82A 1XNQB 2VTEA 2J3IA 3TTYA 2DUJA 1TO1E 3QOYA 3LY9A 3MBOA 4NRDA 4QFCA 5EOVA 5K8VA 3WK6A 2AHOA 2B8WA 4LXUA 2VPYA 5L4SA 3P0IA 1T2VA 1THMA 3DAOA 5DGIA 3BWBA 3EGEA 1VCMA 4G1EB 1QVAA 3INGA 4FE3A 1PUIA 3U3OA 1VJDA 2QL9A 1RXIA 1LPMA 4Z9YA 1DDGA 4KAAA 1NDHA 3KZCA 3HXKA 1M2HA 4C01A 1DAPA 2VSXA 1G8GA 2ZP1A 2VYVA 3RBXA 3WICA 1HQYE 1ITZA 1VQ1A 1DC8A 2ZSJA 3P0JA 2VNHA 3ZU2A 4DE5A 1KK3A 1Y5LA 1P6QA 4JBNA 5IAEA 4Q6BA 1NMQA 2W4MA 3HB0A 3RYIB 3HN7A 2DH5A 3SQMA 4ZGBA 2FP3A 4AZ0B 3GHYA 1KQFA 3TE6A 3DF7A 4XWWA 2IC5A 4OLAA 4DANA 5ICMA 2KBFA 3SVLA 2ALJA 3FKSD 1DC5A 4RL6A 1JXOA 3QFFA 3E82A 3PLNA 1SC9A 1DJOA 4RANA 3ANNA 3PL1A 4DG5A 3D0QA 2YCLA 2X1LA 3QG1A 4F96A 1NJFA 1FX1A 1WY5A 3ZK8A 4EOGA 1AKUA 5DCWA 3LX6A 1A77A 1U9ZA 5JO0A 3WL4A 2O2YA 4BMCA 4LV6A 2ACVA 2Z1DA 2PUWA 3IDQA 1JR4A 4MRMB 3RK1A 1KYWA 3JQDA 3WVNA 4BUCA 1NW5A 4LK3A 4HN9A 2JZNA 3BD6A 1LX6A 4FFMA 1QV6A 3GN2A 1XJWA 2XE8A 4Y2HA 1P9NA 4MVCA 4QWMA 1Z2EA 5J2UB 1T9KA 3H86A 1M75A 3OQ1A 4OMFG 4YN3A 4DIUA 2AI1A 5E1BA 4AM8A 3BGVA 2R87A 5D3KA 4UUPA 5M7EA 5KVCA 2RHRA 3CEHA 5DH9A 1QTRA 1HPLA 1I5EA 2H8KA 3MWGA 5EJMA 1F8XA 4MI9A 3ZU4A 4F06A 2X8JA 1EVZA 3KQQA 1PFQA 1I2MA 1I4TD 1OXXK 1DXOA 5B4UA 3GJ7A 3MCTA 4K87A 2YHIB 3D7KA 2G9NA 3JQAD 1C0KA 2O05A 4QD3A 4XUGB 1KNQA 1JJAA 3IT0A 5FBHA 4F56A 4ZO7A 1S3IA 5B6PA 5CDTA 1TQHA 5I45A 2CYAA 1DDIA 4UU1A 3ZJUA 5EXPA 1SBHA 3ENQA 5CA1F 4XZ3A 3D2CA 5IYZB 3MGGA 5L3ZA 1Z6TA 3I9MA 3O8QB 3UK7A 3RBAA 5KYWB 5A4IS 4N0DA 2JL1A 1FQKA 1KMHA 1BH2A 1G21E 2QQ0A 3OIYA 3GLHA 3WB1A 5TRTA 1P2TA 1CUCA 3PC8A 3CH4B 3IMEA 2ZIEA 2G9UA 3CG0A 3L8YA 4WE3A 3TFQA 3WV4A 2PXAA 4YYEA 1XTRA 3DHWC 2OO5C 3I01M 3H3FA 2GEKA 4QVIA 4FHFA 1KBZA 5L3SA 3EVEA 4U0JA 3TD6A 1NU6A 3ZY6A 1YJBA 4I5GA 3IQXA 1UMDA 3THWB 1Y4DE 4FC6A 3P45A 3UJ3X 5KNDH 3PUVA 3Q12A 3K0AB 4FOPA 2VDKB 3IT1A 4M8IA 3CJTA 3SZMA 2PX5A 4DCVA 3DVAA 5IULC 4N5NA 4UHBA 3M4NA 1N6RA 2R48A 4LHSA 2D7CA 3W7AA 2IYEA 4QTXA 2BF4A 3EXIA 2FFRA 3DAPA 1JT9A 1AMNA 2J33A 4ZANA 3EA5A 1YT5A 2ORWA 1QK5A 1DRUA 3F4KA 4IIUA 2CD9A 1I3KA 2FKNA 3AF0A 4IFEA 3RDPA 3ZQ4A 3OEWA 1TIPA 1WAMA 4JT9A 3TVTA 1VZ3A 1TZMA 3ZNOA 2VL7A 3WYAA 1OV6A 3AMVA 4JS0A 3F2VA 3MZ0A 1V9SA 1LSSA 1WCIB 4BFLA 4F12A 4H7KA 4RTSA 2LCIA 4U7DA 3FWPA 2XYHA 4MP8A 4G8CA 2Z6QA 1O95A 1PZXA 3AX6A 1U7WA 2C9BA 3BHMA 4UKDA 4Z7OB 2OC4A 1WEKA 1R7RA 4HMOA 4MUMA 4MPDA 1TLLA 1P9LA 4KXWA 4WXRA 3RADC 1RWNA 3TW8A 1ZJJA 3UAOA 4NATA 4X7RA 3VH3A 1AK1A 2ZDQA 4TVOA 3WNVA 3RAFC 4TKLA 1EESA 3JQ9C 3OTGA 2OK7A 2PBZA 4WJZA 1DJMA 2F00A 3EEYA 3U61B 3TX6A 1JG4A 4ZXPA 1MU0A 1H9CA 3ZCQA 2B69A 4F4DA 1UP6A 2QDKA 3FYTA 2HRCA 5K01A 4XDZA 1DKQA 1IEWA 2IHVA 3TEMA 1IXRC 3M1AA 4RWZA 4P5PA 4DMKA 3U5ZB 5IZ4A 3UWKA 4MR7A 2GN2A 4GDMA 3OM9A 4QODA 2C0CA 1CR1A 3UICA 1C7QA 3I6IA 2H2IA 2ZWMA 5KJFA 3FG9A 4YCDA 2R00C 1DBIA 5LXTF 3VZBA 1ZKDA 5CAEA 2G6BA 3ET5A 2EV9A 4WKGA 5GQSA 6AT1A 3MTIA 4KO2S 5HK9A 2VHUA 4JFRA 2PQMA 3EEQA 3L5KA 3ZVKA 4G23A 1P4JA 1IUNA 2ACWA 2FZ4A 3F5MA 2J6IA 3PQ6A 4LYDA 4PS0A 4ZEOA 4C4XA 1NVAA 4HAOA 4URWR 5TQVA 5L40A 4L0MA 4XGQA 4GQBA 3EOBI 4BQIA 2V3WA 3WLIA 1DGQA 4DLNA 4MI1A 4MUEA 3BK2A 3AXTA 3PEVA 4NY1A 3M5WA 4P33A 3TR0A 1V8FA 1II0A 4OOEA 3QG5A 3GB9A 2BGWA 3SJBA 4GL2A 2XCRB 1TVCA 3WSVA 2YV3A 3I6BA 3KWFA 2F1IA 2IW1A 3U26A 3BT7A 2QLLA 3NBFA 4FIDA 4Y7DA 3TRHA 3P2KA 3MBIA 2ZBFA 4DIKA 1RSZA 1MN6A 1OW3B 2OCDA 3CRMA 1RRCA 4O2AA 2KX7A 4XI9A 1CQZA 1G6HA 3JQ8A 1MJNA 1FE8A 4ZCQA 3E7FA 3RVSA 1Z8FA 1E2PA 3UGKA 3N28A 5KTKA 1ZM4A 4CM6A 2YQ5A 1HG0A 2JHFA 3BFJA 3GCDA 2JEYA 5FO1A 3UT6A 2C99A 4G0ZA 2W00A 1CUIA 2M9MA 3DMNA 5KTTA 1TT5A 3PFNA 3ZCTA 3FVRA 4D79A 5T7BA 5B1DA 2BM1A 1HFWA 1N5MA 3FNEA 4EYEA 1BXKA 1SUPA 2FWBA 2ZBQA 1P4RA 1AMOA 2NO4A 4HZUA 4Q9KA 4GKVA 1UUFA 4I19A 3SIRA 4K03A 4DQUA 2CJXA 3M6XA 2X0DA