3TOVA

The crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
SNAMELDYKRIVVTFLMHLGDVILTTPFLEVLRKAAPHSHITYVIDEKLQQVMEYNPNIDELIVVDKKGRHNSISGLNEVAREINAKGKTDIVINLHPNERTSYLAWKIHAPITTGMSHFLFRPFMTKYTRLDRKTRHAADMYINVLEQLGVTDTSNSGLHIEICEEWRCQAQEFYSSHGLTDTDILIGFNIGSAVPEKRWPAERFAHVADYFGRLGYKTVFFGGPMDLEMVQPVVEQMETKPIVATGKFQLGPLAAAMNRCNLLITNDSGPMHVGISQGVPIVALYGPSNPFFYGPYQAHAIVLETMDSYEIGKSMKKIIKEGNYKGLSVISEEQVIKAAETLLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008
rcsb
source organism Veillonella parvula
molecule tags Transferase
molecule keywords Glycosyl transferase family 9
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01075 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltransferase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3tovA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3tovA01
4N3AA 2AZDA 2Q6VA 4W6QA 3NCHA 1FTYA 5DU2A 4XI9A 1YGPA 3MS7A 3D0QA 3OTGA 4RIEA 2QNBA 3CUVA 5DLDA 3S28A 3SYMA 3HBNA 3VUEA 2FFRA 2XA2A 2XMPA 3MRVA 3CEJA 2VCHA 3MTAA 1UQTA 4AN4A 2C1ZA 2X6QA 4CTOA 1QKJA 1WV1A 2IYFA 2R68A 1RRVA 3CUTA 1LWOA 2JJMA 2IUYA 3WAGA 2QLNA 2VG8A 1JG7A 2JLBA 4M7PA 3H4IA 3WC4A 4BFCA 3S2UA 1L5WA 1BX3A 3T3IA 3T5TA 1AHPA 3HBMA 4MI9A 4F9FA 2QRPA 3CUYA 2QN9A 3MTBA 4RENA 1WV0A 4RELA 1HLFA 2H1FA 3L7AA 1NVKA 1L6IA 3DDSA 4WACA 3OY2A 1Y6FA 2R4UA 4GZ6A 3ZCUA 4QLBA 1L5RA 2SKEA 3RSCA 1NOKA 1L5QA 2FETA 1PSWA 3MSCA 4MI3A 1FC0A 1UZUA 3BEOA 4GYYA 3OTHA 1GGNA 1KTIA 4RIIA 1LWNA 3MS2A 4GZ3A 3L7CA 1WW2A 3ZCVA 4EKYA 2X6RA 2AW3A 3G2LA 4KQ2A 4FZRA 3MT7A 1IXYA 3ZCQA 1PYGA 2QN3A 3ZCRA 3L79A 1P2GA 3NAZA 3OKPA 4BQIA 2ACVA 3G2IA 4AY5A 2IV3A 3C48A 1RZUA 1Z6PA 2C9ZA 4WADA 1EM6A 1JIVA 3Q3HA 3G2NA 2O6LA 3Q3EA 5TMBA 3C4QA 3OY7A 1Y8ZA 4PQGA 3BD8A 3H4TA 3QHPA 2GM9A 1V4VA 3G2KA 2F3SA 1JG6A 1RZVA 2F3PA 3RSZA 2X0EA 3NC4A 1M5RA 1L5VA 2VSNA 1P2BA 1GG8A 3E3OA 2AV6A 2SKDA 1B4DA 4YI3A 3L7DA 4LDPA 1L5SA 3EBOA 2C1XA 2XCIA 3S29A 3BD6A 5IKPA 4LEIA 4N39A 3MBOA 2XGSA 5ENZA 1Z62A 4MRAA 2F9FA 2IW1A 1L7XA 4F97A 3C4VA 2GPAA 3COPA 2VSYA 1Y6GA 5TMEA 3L01A 1FA9A 3CV3A 2QRHA 4CTNA 2PRIA 3DZCA 4BQFA 4AMBA 1XOIA 1FS4A 3DD1A 3HBJA 1FU7A 2SKCA 4MHSA 4F96A 1Z6QA 2XCUA 7GPBA 2QRGA 1WUTA 2PYDA 3O3CA 2FF5A 2G9RA 2C4MA 1SXPA 2QRQA 3MTDA 4GYWA 3S27A 1H5UA 2QZSA 4MICA 3WADA 4M83A 1F6DA 2GPBA 2JZCA 4L22A 3NB0A 1NOJA 2ZB2A 1P4HA 2F3QA 3UYLA 2P6PA 2QN8A 3CUWA 2X0DA 3L7BA 3MRTA 5DXFA 1J39A 1XKXA 3MRXA 5GPBA 3PE3A 4AY6A 1K08A 1ABBA 2R60A 2QN2A 4RIHA 3VDNB 2F3UA 2HY7A 2PYIA 3RT1A 1Z8DA 2WTXA 3NP9A 2H1HA 2BGTA 1NOIA 3IAAA 3UYKA 1AXRA 3BCSA 2ECPA 3NPAA 1P4GA 3FROA 4BQEA 2PRJA 4Z5XA 3CX4A 1YA6A 1C3JA 4RBNA 4M60A 2G9UA 3S0JA 4CTMA 1JIUA 3VUFA 4XIFA 1NLMA 2YJNA 3MQFA 2PQ6A 3NP7A 4X7MA 2ASVA 1EXVA 4EKEA 3MT8A 1A8IA 1XV5A 5I45A 4MI6A 2IEGA 1C50A 1P29A 1WW3A 3EBPA 1PN3A 3E3NA 1FU4A 2X0FA 2R4TA 5TMDA 3DDWA 4N3CA 2QN7A 1UQUA 2GPNA 4KQ1A 2XGMA 3PE4A 2IYAA 4NESA 5IKOA 4REMA 4RIFA 1PNVA 2GEKA 3GUHA 1E4OA 4X7PA 1GZ5A 3BCUA 4MHOA 2OFFA 2XA9A 5TVGA 4FKZA 1FU8A 5D01A 3T7DA 3T3EA 1GPYA 3IA7A 2QRMA 3TSAA 1QM5A 3GPBA 3MS4A 3OKAA 1XL1A 1F0KA 2AMVA 4YUAA 2G9VA 2XA1A 3QKWA 5JTTA 3T3GA 1JIXA 1GPAA 2BFWA 5HXAA 1FTWA 4X7RA 1P2DA 3D0RA 1NZDA 4X6LA 3T3DA 3CEHA 4N9WA 2XGOA 4EL5A 1VGVA 4GPBA 4NEQA 1GPBA 1P4JA 1JEJA 5D00A 4GZ5A 1GFZA 3HBFA 4RIGA 3ZCPA 2QLMA 2VCEA 3BD7A 1K06A 2IV7A 3G2JA 3TOVA 8GPBA 4WHMA 1C8KA 1E1YA 2R66A 3RHZA 4KQMA 6GPBA 3SYRA 3E3LA 2G9QA 4HLNA 3CEMA 2IEIA 4AMGA 3TAXA 3OT5A 3ZCTA 2ATIA 4EJ2A 3CUUA 1O6CA 4G2TA 3OTIA 5C1DA 4NC9A 1XC7A 2QN1A 1C8LA 3MT9A 1XL0A 2BISA 1IIRA 3T3HA 1FTQA 4CDRA 5BNWA 4YI5A 4EL0A 3BCRA 3G2HA 5JTUA 2KS6A 2GEJA 5LQDA 1WUYA 2ACWA 4HWGA 3BDAA 9GPBA 3AMVA 3VDMA 2QLLA 2GJ4A 1SXQA 3Q3IA 3ZCSA 3D1JA 4N3BA 3OKCA 2GT1A 2BGUA 1NZFA
chains in the Genus database with same CATH superfamily
2QI9C 3O5AA 2NSHA 2IF2A 2TECE 3L4JA 1BH2A 4ENRA 1D4FA 5BT9A 3N0XA 3V8BA 4HEQA 2WYOA 3TLXA 5CCXA 5AMXA 5DU2A 4I99A 2OAEA 4ZEWA 2NSDA 2V59A 4W5JA 4X41A 2W11A 1X1BA 2QAGC 4PM4A 3KOMA 1NQVA 2X9LA 1NVMB 2Y1CA 4KV7A 1HYHA 5A7FA 2GN8A 2P78A 1JALA 3DTNA 5EINA 2QTTA 5AUNB 5B64A 3CUVA 2FPMA 2PSEA 4CRWB 3I5MA 9MHTA 1FY2A 1KZ6A 1X8JA 1Z4QA 4BWFB 4C4XA 1GUDA 3UXEA 1NJ8A 3GAFA 2XCLA 3ADCA 3QVGB 3ZD9A 4IWXA 5FWDA 2PJRA 4IOJA 2CVOA 4TKVB 4LJ8A 1R37A 2I2CA 3ESRA 1DC5A 2DVMA 1UC8A 2R8BA 3FYSA 3H9CA 4HLDA 2C58A 2ADFA 2D4AA 3J81k 5CB4B 1ZU4A 3N2IA 1RRVA 4YYZA 2IDZA 1U9IA 2W2VA 3CUTA 3VU3A 6REQB 1L7DA 4XVCA 1PKXA 4BNXA 4I08A 5BUSA 4XOUA 2QTHA 3C15C 2QLNA 4F86A 1U8YA 4OPMA 3OE4A 4JZKA 5EC8A 2VNHA 1QRAA 4PLHA 4LAFA 3NJ4A 3B53X 4DXAA 3I53A 3R41A 1SRQA 4UTZA 4MUEA 4U5XA 4ROTA 3SBXA 4Q4CA 2A9JA 3O91A 5MN5A 2ZM6B 4WVLA 4C78A 1O5OA 2Y0DA 3KKQA 5HBGA 5JAHA 4JH0A 5KWVA 2VNSA 1NNUA 2EJVA 2H3EA 1QP8A 2GN9A 5FTJA 3REGA 4AJOA 4H16A 3VH1A 1EZ1A 4JT8A 4RENA 3CE6A 1T5IA 4D9MA 3W6UA 1KFBB 4RKRA 1FXUA 3RJ9A 4G1VA 1JQ3A 1Z6XA 3RASA 3SEAA 2CLOB 4ASUD 1U1FA 2CXOA 2LRHA 5CJJA 1GN9A 5IFLA 1V3QE 4YP1A 4AZWA 5EYPA 3WGHA 3EZ2A 2JDIA 1N7HA 2PZLA 1EJ0A 1L6IA 3AEQB 3E6AA 4M55A 4IKOA 5BWNA 2EZ9A 1Z6GA 3QFSA 5FHRA 2J41A 3CZPA 4PZPA 2W37A 2X13A 1UKAA 2P1DA 2QPAA 4HYTA 1LDYA 1OB2A 1H2BA 1C0LA 1NBHA 5CLQA 3R5KA 1PZMA 4QLBA 1MC1A 2IYVA 4G89A 4NZOA 5B55A 5LR6A 1SULA 3ZZ1A 3AFMA 1PD1A 1MA3A 4QNRA 4CMIB 5IM4A 4MVJD 5KTKA 3D3JA 3UV7A 1JEAA 2OBNA 4JUDX 2HIHA 3S44A 5EIEA 4RS4A 1T0PA 3FI9A 5FBKA 4DCPA 3RYHA 4IMPA 1C0IA 5HQTA 3U3MA 1U4NA 4JJEA 1IQUA 5D85A 1QKIA 2XUHA 1D9XA 1SB9A 3UXMA 1OXUA 3S1SA 3L77A 3LBFA 1T5LA 3FIUA 1RDFA 4N7MA 4OP1A 2AI3A 2GYWA 4E2WA 2FSFA 4OHPA 3E23A 4B87A 4QQKA 4ZHQB 3L7CA 3KE9A 3K9WA 4J6EA 1YDHA 3SE7A 1YI0A 3CIFA 2EFGA 3MGGA 2ONCA 2VEOA 4KW7A 5CT4A 4BAUA 4WJLA 1JLKA 3FFAA 1HYEA 3H84A 3HR8A 3O9VA 4A5SA 3Q7RA 4LY6A 3Q40A 1UM9A 5AOCA 1GUBA 1Y8RA 4YRIA 4ZEMA 5IFKA 3LIPA 1Z8FA 2FFAA 3OJCA 2IRWA 5LZ7A 2VXYA 1PYGA 5FXMA 2AKAB 4R2KA 2VYVD 3FCAA 4MUMA 3RYFB 2JVJA 4G07A 3HTXA 4IS2A 2NU7B 1WLYA 3W1WA 4JXXA 1XROA 1ZNXA 4FGSA 2WM9B 2VJMA 1JXQA 4OHYA 3E5HA 3Q3GE 4GM0A 4TKUB 3F6BX 2IYSA 3C5VA 3PUZA 2TMDA 4IICA 2YUTA 3VSBA 3PU6A 4ZCQA 2NV2B 1I51A 4BLSA 3U17A 2ZXUA 2CKMA 1TZCA 3U60B 4HB3A 1QB8A 4BFXA 1L7PA 1OASA 5F5XA 3SY8A 3KOZA 1C5KA 1MJHA 3AL0C 3UH0A 4GLJA 1KXJA 3U37A 2PD6A 5F2EA 4WNCA 4C4PA 1XGKA 2QRKA 1DBWA 3FB1A 1CQXA 3B2NA 3FN4A 1E9DA 2OECA 4K6GA 1CUSA 2FN4A 2Z3VA 2ZTMA 2XYGA 1ZMOA 3U6KA 2Y68A 1ZKMA 3PGLA 3UCEA 1CHNA 3CNQS 2VAPA 5DTMA 2ZPAA 5C0OE 4A8HA 2OG2A 5IC4A 3FFXA 2NTEA 3AZQA 1E0SA 4W9NC 1NBOA 1TEXA 1EFPB 1MKYA 2QA5A 1ZOLA 1JYFA 4A15A 3N3BC 1PEKE 3EBOA 3OOHA 3VTFA 3H1BA 4B6QA 4K6OA 4RVCA 1M2EA 4YAKA 1ZR2A 3TLYA 3QBVA 4YJ2A 3DCYA 1GU7A 1JL3A 4D92A 5A4IS 5A9RA 1EP1B 4IW3B 2A0KA 4UKDA 1NXSA 5CDFA 3RTEA 3FMIA 3KV3O 1FXWF 1IB0A 4RLSA 4A6XA 2X15A 1KZ7B 4HDQB 1ZJJA 5KNBA 1VPWA 2I8AA 2BGIA 1T8TA 2XGGA 3QQPA 1FPMA 4OM7A 4QBFA 1TIKA 1ID8A 1E5DA 4CM8A 4JBXA 3THXB 4DBVO 3S68A 1XRRA 1QK3A 4XGQA 4BZWA 4PRLA 3H4VA 2KM1A 2EFDB 1TGVA 1QCDA 3GLSA 1FTNA 3B82A 2PKCA 4YUXA 5JMTA 4QO8A 4EGJA 5JWOA 2QLFA 4IM7A 4F4IA 2J5RA 4J0DA 4IPTA 2R8EA 5K0CA 1X1RA 2C5FA 2IVZA 4DA4A 4RVUA 1QBGA 3RC1A 1B15A 2VPTA 4YK7A 2A9VA 2PRIA 2XW6A 3AOGA 1YJXA 3ELBA 2EYQA 2P8JA 4F9EA 5BSEA 3PLRA 4H7KA 1TYDE 4NARA 1JT2A 3EGIA 3VH4A 3L4EA 3FMFA 4FKMA 4TYYA 3VYRB 3U3ZA 3DD1A 3TEJA 3A04A 5DM60 1IOZA 2SKCA 1XN1A 2ZBGA 2I7TA 3LTNC 5ILQA 1Z6AA 5EJMA 4HATA 2DFPA 1J8MF 2GEVA 1AB5A 1Z6QA 3GUUA 3PD0A 4G6ZA 2WU0A 2ZE8A 3FOAA 4NHEA 4Y6GB 5EIBD 4HVCA 2Z8ZA 1HDZA 2F8TA 4UCQA 4YJFB 3I62A 1RXIA 2H4YA 2DQ4A 3FW1A 1YBHA 3HB1A 3NANA 1NF3A 3M6IA 3O3CA 4MYHA 4I1OA 4HAWA 5JZBA 5EUCA 3RVOA 4JXZA 2G9RA 1BMFA 5BN3B 3HEAA 4JUCA 5J4VA 5CLJA 3V4FA 3LC1O 3WB9A 2ZYAA 4M0MA 3CRRA 4LI3X 2WWTA 4MICA 5J5CA 1K2WA 2TMYA 2X0IA 3H9JA 3PNMA 3R3HA 4EB0A 3OP1A 2WAOA 1PJRA 4ZARA 1HXHA 4TSFD 3UZUA 4S35A 4BJ6A 2OCLA 4LDAA 2C92A 4FMPA 4M9CA 4NJMA 4BLOA 1NFQA 1IEWA 4OQNA 4TMXA 3T7TA 5FORA 3LF2A 4BMPB 4UC0A 2ZRNA 3W8EA 4EB3A 3L07A 2NUPB 1I2ZA 3HV2A 2EZUA 3W5UA 3ODPA 1V3TA 5JE8A 3F3YA 3N2EA 2I8CA 2XTNA 2PUHA 3R77A 2JLRA 4UDOA 1ZIOA 3PKJA 2WIBA 5FTLA 4DMLA 2F1KA 1PWZA 1PQ4A 1U8TA 3AWIA 1E2IA 3JS5A 1J39A 1ZM2A 3P5SA 5AFSA 2XOXA 1M6EX 3CF2A 3JQGB 4C20A 2NYUA 3CVJA 1QIGA 2TMGA 3WLEA 1ZLYA 2OUKA 5CVJA 1OXBB 4IZIA 1YBMA 4XJSA 5K4AA 4L1KA 5JCOA 2HY7A 2FMTA 1WY5A 3G0GA 4YBZA 4ALKA 1CS0B 4J1NA 4IOKA 4CU2A 5KVQA 2JPDA 5B58C 1KVQA 4J03A 4D98A 4AKIA 1R0ZA 2ZT7A 3AUSA 3UXHA 4LQ4A 3F3KA 3E18A 1OZGA 5CVVA 4CWAA 2QK4A 3JQAB 1N6LA 3QXXA 1TM2A 4ZT2A 1P1FA 2PZEA 1OJ7A 4DCUA 4GZLA 4MDEA 1A9OA 4MKHA 4DR2B 2CCJA 4PN7A 4FGWA 5JSZA 4F1JA 1DEXA 2BD0A 5JCPA 5ALTA 5AJTA 5I7WA 5E7IA 2VRNA 3N0RA 1KIAA 2R6JA 5H80A 2COKA 5JZ9A 1KVSA 4WNAB 5T3YA 2HIAA 4C04A 2ANBA 3QF4B 3M6WA 1DLJA 1RKQA 1U5BB 4KRYA 1U81A 4PCLA 3O6VA 2X0KA 4IXTA 2I4IA 4RZ3A 4JASB 5KWJA 4YEDA 1EXVA 2FQ1A 1P7PA 1ZUHA 1G4HA 1WE2A 2C0PA 2VBCA 4JYPA 4Q01A 4BQRA 4DAEA 1L5FA 5AVWA 2IEGA 1CEEA 3HJAA 4IHJF 3ZH2A 2HEIA 1LLFA 2VDQB 4JI6B 5C37A 4DRXA 1ZH0A 1OILA 1AZLA 2OV3A 3GT3A 4ZPXA 5KREA 1PN3A 4XPIB 5IARA 1VIMA 1C14A 1GRRA 4Y30A 1T1IA 1GAWA 5FBQB 3TD2A 1QGOA 2R8YA 2BW0A 4X91A 4D3ZA 2D6FA 4NOJA 3AEQA 4KGDA 4B71A 3TKYA 4MVXA 4L2IB 3G0DA 1KAEA 1AKEA 4JI3B 4ZT5A 4CMCA 2HLHA 4OU5A 3UG7A 2QQFA 4KH1A 3AH8A 2FZGA 1V7QA 1C30A 4HNVA 2DAPA 4FHZA 3EFEA 4JI1B 5ITZB 2ZUDA 4ME6A 1YJ5A 2GNPA 4RY9A 2XD4A 3NHSA 4TQAA 5DASA 2CE2X 2WFZA 3R5SA 4JQCA 3SFTA 3KQNA 4IBOA 3GLIA 2QZJA 3LNCA 5CLHA 4CLOB 1KMCA 1UKVY 2QD1A 3ORFA 1FP4A 5BYAA 1IH8A 3I76A 2VHZA 1QYXA 3B7WA 1X7YB 3MB8A 2R5FA 4GPTA 4PW0A 5REQB 3WK6A 5B2FA 4XWKA 1ORVA 1KETA 1D1TA 4KKXB 4TGLA 1R64A 1R0LA 2VCYA 3GBPA 4I14A 1JUDA 4QG7A 2E4UA 2RJOA 3CH6A 1QHNA 2GAFA 1FLNA 5C34B 1R27A 2PVSA 5D87A 5TJ9A 3WLKX 3QIVA 1FSPA 5FL3A 4O0MA 1F0KA 4ZO9A 3UWSA 1Q0LA 2G9VA 2JGLA 3V8PA 3W5DA 3DOEA 5A71A 2XKJE 4N18A 1L4MA 9LDBA 3T12A 4UE6A 3T61A 2V0GA 2Q4OA 4QYWA 3ZWDA 2P3OA 1NNSA 3GUCA 2HPVA 1KK1A 1FUUA 3EVDA 3O1IC 1JW9B 1J70A 4KDEA 4QARA 1G3IA 1SCAA 4EK9A 4IOLA 3WL4A 1POWA 1N1MA 1VJ5A 3KUCA 3G89A 1PEAA 3WS7A 1OV6A 4GSKA 1N75A 1U1CA 1JEJA 5EP3A 4GLLA 1EVIA 4E5MA 4C4AA 5HUJA 4O2AF 1XZLA 3CQ9A 3FHOA 4PC1A 1N7GA 4N5IX 5LLDA 3GUVA 5LVAA 1T35A 3I09A 2E85A 3GFGA 2FPPA 3ANMA 3AXTA 4ZCSA 2WJAA 2EL9A 4BO7A 5BQOA 3MBKA 5JOQA 1ZAYA 2LR0A 4C29A 4AICA 3BFPA 1HH4A 4B5KA 4UHEA 3BWBA 5BWOA 1NC1A 2I1QA 1KVTA 2B78A 4C9BA 4RD3A 4YJDA 2WKSA 2EWMA 3VZPA 3S2EA 4D9GA 3NXSA 1A2QA 5FWYB 2D59A 1UPXA 2G9QA 1YH3A 1W5FA 1T9CA 2C2ZA 4IIJB 1X0VA 5ES3A 3TAXA 1Y34E 2BM0A 5F3RA 4Z9XA 4IDAA 4CM1A 1XMJA 4BNFA 1NN5A 3S2IA 1UBMS 4M98A 4PTZA 3OWHA 4ND6A 2FZEA 5DPMA 2WYHA 3B1YA 1ZESA 2OB1A 4BWGA 4C0LA 4CQLB 2UYHA 1X7WA 1VBMA 1O94C 1EQUA 2IE8A 2MSKA 2ZKLA 1VE6A 1AXGA 1G5RA 1YVUA 1NJSA 2Y2VA 3WKCA 4F8YA 3MGBA 3ZX4A 1ZHFA 3GGOA 3IELA 4K6FA 5KOIA 2Z09A 4CHGA 1M5UA 5KSPA 1V5WA 1DG1G 4X6YA 4XWYA 4U1RA 5SZHB 3DPSA 3DTVB 1WRBA 3V80A 4I3FA 3GCDA 2YWBA 4G1FA 2IY9A 1E1QA 3A4MA 4C7KA 4YALA 5EJGA 3WL5A 2A9KA 2QF7A 1UK9A 1UIMA 3FA2A 3V8NA 4EJMA 3CBQA 1Z6ZA 2NYAA 2AW5A 3WWCA 3WGMA 4N8SA 2EKDA 1DRKA 2QVLA 2RHWA 1ECCA 4FYVA 2Y0BA 5B37A 5LQDA 3LJKA 3TW6A 2ZTUA 5KSZA 3OCUA 3PEFA 3REQA 2JI6A 3ILYA 1OX6A 1X87A 1JJVA 3RWMB 1U3WA 3UJHA 3QLUC 2QXUA 4M87A 4TM8A 1GEEA 1ESMA 4XA8A 1UBKS 4Q02A 4F3YA 1T5TA 5ALSA 2W2KB 2BHRA 3OQ6A 4EG3A 2H7YA 5AQEA 2FMIA 4AQDA 4BKPA 1O57A 2PAAA 2WTNA 3O1HB 4PYMA 5KWSA 5KQRA 5A5FA 5D5QA 1I7SB 3H19A 1JT9A 3SP1A 3GT4A 1GZVA 1RXEA 4LZZA 2YVLA 3D81A 2E82A 1GGKA 3NJRA 2IHUA 2OD9A 4MUAA 3U5TA 3MS7A 1NV8A 2Z1MA 2ZYDA 3D0QA 1E3QA 4K3VA 4GVLA 3LUJA 3AY7A 2HK7A 3TZBA 3N9IA 3AEKA 1WU7A 3O9MA 2JIOA 1MP0A 5AW1A 1C1XA 2DR0A 3WTCA 5KNBH 5A5VA 1GZUA 5FJJA 1WXWA 3F90A 2B0CA 3FNIA 5AWFC 2J7PA 3UXYA 2I87A 1T36B 3C43A 4EY8A 1PP4A 1RXCA 4AN4A 3CSDA 1PLKA 2OKGA 2VFAA 2ZWPA 3I92A 3ZXUB 1JQKA 521PA 3PX7A 1RJDA 1RHJA 3OEHD 3R4VA 2HQBA 1YB7A 3WGKA 1IPEA 1SB8A 2L69A 1LX6A 3OTQA 4QOEA 2FZ4A 2OHXA 3DP9A 3FBTA 4XTCS 5DFAA 2HCJB 2IODA 4XIYA 3OHPA 1PT9A 3AUTA 5DRTA 4U9UA 1G55A 1WNTA 5HKKD 1NXOA 5K6RA 1FJHA 2C5EA 2VTBB 5LMUB 4DN6A 3NIFB 3TPZA 3AM5A 1CUWA 1TVEA 2FQYA 3A3KA 3H3JA 2YRWA 2H8KA 1NI4B 3FKJA 3IAXA 3EIOA 1ZJZA 2Q2VA 4QOIA 4G2NA 3ORSA 4GSYA 1K6JA 4I55A 1CUVA 1VZ2A 2Z3ZA 1BKSB 1LJUA 3R1IA 4S1OA 1DAPA 4YRDA 4HWOA 3L0YA 1LBIA 3QYJA 1QAMA 1RRMA 1IY2A 1F8UA 1HDCA 3H8WA 4LX8A 3V1NA 2O8FB 1X38A 2BFCA 4N82A 5FT9A 2VP2A 1N32B 1FS6A 3VSEA 1VKOA 4U6SA 3ROKA 2P2LA 1BCRA 2VPWA 3A6EA 4UCXA 4C0BA 4KITB 3MTBA 3WYFA 4YR7A 4F46A 4YYEA 1SHKA 3FMVA 1PFWA 4KTTE 3RIEA 1YIOA 5JYEA 5A0TA 2DCUA 4PG5A 1XCMA 1Q1BA 4HSGA 3STVA 4IHJA 3ZHQA 2WWGA 4UM7A 2XMCA 2I71A 2WF8A 4M2LA 1O97D 1IWOA 1QQTA 4JYCA 1RZ3A 4QM7A 2FXVA 3DHNA 3G0BA 1E66A 4HB0A 4ZC1A 4CM3A 4QATA 1CDDA 2QEQA 1EUQA 1ZD5A 3MG9A 4GG1A 3ZGVA 5I4KA 1UPAA 2C7OA 4R3UC 2VOEA 3A05A 2JJ2A 2O2ZA 2RGEA 2H5IA 2ZUUA 3DZBA 3IVGA 3MFYA 3WY9A 4A2WA 2ZR7A 3NRCA 1GRCA 4RANA 4WK6A 2M9MA 2O2EA 1F38A 2HKIA 2ZB4A 3A58B 2R97A 4E33A 4NXNB 3WGIA 4R31A 1KIMA 1EDEA 1IDN1 2A9PA 1EJ2A 4G5XA 4PG4A 1L5YA 5CTAA 2OFXA 5DH9A 1T8YA 3U31A 2Q45A 3EZ7A 3ZXIA 3M6MD 1L9XA 1HFEL 2SCUA 5DM0A 2L82A 1I4WA 3IBYA 2RGDA 4JBWA 4KPYA 4DDTA 4AJ9A 1T26A 2Q5HA 2WDPA 1LWNA 1GUAA 1PFVA 1SVOA 2ZI4A 3SAJA 1CQJA 4CKXA 2NZJA 1QZUA 3BA1A 5LP6A 3F0TA 3F6SA 2RGRA 2OZPA 3T0FA 1CFZA 4DG9A 5KWEA 1F0YA 4LNUA 4Q21A 1NKTA 3A9RA 2VHYA 2IS4A 4YH1A 1AT1A 1GUFA 2OOKA 4OG2A 4YUVA 1PDVA 2ZI7A 3PGJA 3LSTA 4PO3X 1GZHB 3MUEA 1O95D 2QIOA 3OPNA 4U2KA 2UUCB 1PV1A 3P27A 1WW8A 2MYTA 2BFNA 4TWBA 2BMDA 1NFFA 2PBZA 3L79A 3R7BA 1SBZA 4KL8S 3O4GA 4NCIA 3FH0A 5AXAA 3UOAB 5JO0A 4IMJB 1EEXB 1YRHA 2QRLA 4OQYA 3QELB 5F1YA 2QB5A 5REQA 5BV7A 1ILEA 2ZIUB 2ZWMA 2G9ZA 3P9CA 1IUPA 4NZMA 4F92B 3KALA 3PR3A 4B6EA 1RWQA 4JBHA 5UKDA 4M0KA 1WJGA 1F20A 1VMAA 2C4KA 1GGMA 2G04A 3H4TA 2WNIA 4CT0A 2NQ8A 5DCYA 3WZMA 1O9BA 3C6KA 2WIJA 3PD7A 4IIVA 4MQ5A 5EE9A 4C0KA 2VWPA 4C22A 3JARA 4ENPA 1THGA 2GX6A 3D8RA 1ZZGA 5EZ5A 1ECJA 2XX3A 1AQLA 3LCRA 4OAOA 1UBTS 2UZIR 3JQDA 3NC4A 3DOJA 3T7JA 4I4CA 1I24A 2JFWA 2VSNA 1MXHA 4WBNA 1DTWB 1MLDA 1JTEA 1PJLA 4X0EA 1KY2A 4PG8A 3IVMA 3EVBA 2UZ1A 3QNUA 1KH1A 3BMNA 3R4CA 5BOVA 4BE9A 5KNLA 2AR0A 2XZPA 1SBNE 3RIGA 2P9JA 4IUYA 3L6RA 3WDMA 2JGRA 3CW9A 3DPUA 2KLHA 2Z56A 1U98A 3HO8A 1E6UA 3BVPA 3LQ1A 1YAJA 2XCIA 3TZLA 5DGTA 3ZDXB 5A3SA 2NQ2C 4PANA 1M8GA 3AHDA 5IKPA 1FBNA 4WLNA 2XGSA 3IR5A 4P0QB 4PNEA 4ZQEA 4Z1MA 5JAIA 3OHMA 4KRGA 4UFNA 2A5LA 3W2EA 2MSDB 2ZLBA 3IKTA 2OC4A 3DC2A 5EZQA 2Q8PA 4OMDA 3DM5A 2CE7A 3S7ZA 4O4HB 1XVAA 4US1R 3U16A 3T1YB 3DOIA 3OQJA 3FHLA 3FRHA 2N46A 4HN2A 4HDSB 3VHQA 4TQGA 4EYGA 1V16A 2IZ1A 1TU0A 4NU6A 5EKDA 2JFOA 5T8KA 2F4VB 2HOQA 1MB4A 3GO4A 5TMEA 3DEYX 1O03A 3G82C 4KOEC 4Q3LA 4UCFA 2CV0A 3MB5A 4GPIB 4WUVA 5HQ3A 3EDMA 3OCZA 4B48A 3CV3A 4YJ3A 2VF5X 5BUZA 3HGTA 1YB2A 4N5LA 2GPYA 1KE2A 3LFUA 4BNKA 2ZKIA 2GARA 4F93B 1KI8A 1FYDA 1XOIA 4HEHA 3O8RA 3A4YA 3P0FA 5BMVB 3L6EA 2RAFA 3AHJA 3ZIUA 5TARA 3LSYA 2M98A 3RE1A 1KVUA 1SPBS 3LBHA 4OHFA 4CKEB 1USUA 1KC1A 1YB6A 4ZRDA 4B81A 5FPQA 4DANA 4JJ4A 4TQUS 1UXHA 1G1MA 2WF5A 1F0PA 3IPLA 4DNXA 5EKSA 4TTIA 2FG7C 5IHPA 4FZVA 5BR7A 1ZA2A 1WDMA 5HTKA 3IO3A 3LX6A 2VXBA 1RABA 1JJ7A 1SK9A 1U2QA 1DAFA 3F1KA 3KPWA 1O87A 4FFRA 3QUBA 2IXAA 4HWKA 4R1LA 5E7QA 3A6GA 3FTFA 2F1OA 2HGSA 4KQGA 4HG2A 3TRIA 3W3AH 1XPOA 1DJNA 1I33A 5FOTA 2ZU6A 4UHDA 4CCSA 4CUKA 3KZKA 4EUEA 3LP8A 3A1TA 2IOFK 4O4HF 1M2KA 3TZHA 2BE7A 4QKQA 1E2EA 3HDVA 1YFJA 4YMGA 2QN8A 1QE3A 2F9LA 5CHYA 5E6RA 2WSIA 3OLVA 5BYJA 4C3OB 1PE0A 4P0TA 4RPHA 4ZQBA 5ECDA 3W5IA 2YV1A 5JG7A 1DKUA 2MR6A 3DAPA 4UCWA 4BVFA 1S2GA 5CT5A 4G1CA 2B4RO 3TMYA 1K3FA 3V1MA 2F64A 3ENWA 3PFCA 3OIFA 2UXCB 2VUUA 4RFVA 1N2XA 1E2GA 2PK3A 2BH9A 1N0VC 2PSJA 2YXBA 4JMLA 4RVFA 1BSVA 2KJQA 4H6VA 2YFQA 1GNQA 2BHNA 1RC0A 2YOFA 5AKGA 2AC7A 5F98A 1XXHE 2YZ2A 5LDHA 1OSNA 2QD2A 3L0OA 3PF8A 1JDPA 2AXPA 2HWWA 3QHAA 3ZE9A 4BB0A 4ZK6A 2MT9A 3GLGB 1KI7A 2QSUA 2WDZA 2QUIA 3NM5A 3QPCA 1CUJA 4QQRA 3SX0A 5IULC 2WTAA 3ANNA 1B3BA 1KFJB 2BI4A 3Q3CA 4RE6A 4WESA 3MGAA 3U4MA 4M54A 4NHOA 4TTTS 2AC4A 2XUJA 5I7AA 1MGPA 3M4YA 1DIAA 4FFDA 3SNKA 4E6EA 2CL5A 1QF6A 2QW0X 2XGJA 4PC6A 1U2SA 4MWEA 3CBGA 2GERA 2BR4A 3CTPA 1IN1A 4ICIA 4M60A 1Q50A 3PDIB 1JXMA 4PQFA 4R2XA 1FMCA 2DE0X 2FQQA 3IDOA 3LVFO 2JK0A 1N1EA 3DHWC 1B23P 1PQWA 3MQFA 4JJ6A 4MUHA 3T3NA 2QAIA 3RT9A 3G7UA 1A9RA 1QPGA 5JNLA 2HQRA 3LOPA 4GLBA 4OXNA 1T24A 5KVCA 3GFFA 1W0CA 4R0VA 1CF4A 2SICE 1ATIA 1T1GA 3SU8A 2ES4A 2VRCD 2ZJAA 2BFCB 3MMPA 3NDJA 4MPTA 1N1GA 2FWRA 1IZZA 2R7AA 4R9NA 1J1IA 1NYQA 4X3PA 3FOBA 1SCJA 2QL9A 3WDKA 2BN4A 4Y0NA 1AO3A 1GNPA 1VHLA 1FRQA 3X1JA 1CUBA 4V0KA 3DOUA 1VG0B 2CYCA 3AHGA 3FTQA 3OEWA 4G81A 4ND5A 4CDMA 4FEAA 4JP2A 2W2XA 3HFGA 3NRBA 2AJCA 1WTAA 3OQVA 4IHJB 4GM4A 5JUWA 1SUIA 3D4NA 1YFLA 1IK4A 3OZUA 1BW9B 3F9IA 4QA9A 2B34A 3IR7A 4LHYA 1KRWA 5LJLA 3X2FA 1YF3A 1JQ5A 4JXJA 4MJ7A 2PWZA 3WB2A 3KD3A 8LDHA 4CIAA 1SU4A 5L8VA 1SBYA 2Y1XA 1T9KA 3CNOA 3ELDA 3I01A 4BKOA 5M29A 3IAS1 3NDBB 1XG5A 2IZZA 1Y3BE 3V8QA 2H3HA 1WTCA 2FE1A 1R0SA 1R9NA 1E4EA 4DXHA 4DKXA 3IMEA 3FLBA 3KOUA 2PZMA 4RS3A 1XRSB 3U44B 4A8JC 3TJMA 4IIXA 1SH7A 1F2VA 2JAPA 1V8PA 3KHUA 4N7JA 4YRJA 4CF3A 4ZCMA 4CM4A 1W4ZA 2QRMA 5HQ3B 1ZK1A 1QCCA 1WQ4A 2BTQA 1ZHOA 1LBQA 3MGCA 5FL7D 3FY4A 3BFKA 3GI1A 5ANRB 5EXXA 5D84A 3T7SA 4QAJA 3WGJA 5HJEA 3QV1A 4YAUA 2VYCA 3LKBA 4Y2PA 2WZBA 3T3GA 1BXZA 1GPAA 2AEEA 4EGCB 3CZAA 1F60A 1ZNWA 1M34A 4B6FA 1PRYA 1TAQA 1NZDA 4NJOA 1NN0A 4DSAA 1HEUA 3JZDA 4QSMA 3T3DA 2HUPA 1MW8X 1W48A 4NBTA 4TLCA 3AEYA 4S3MA 1Q3HA 3IJRA 3LHDA 4EABA 2B4QA 3LCMA 2Q3LA 4F91B 3NOQA 2WIAA 1HE2A 5DMXA 2O8CB 4X85A 3WGGA 2VDLB 2OGWA 3B1ZA 3JQRA 3IUYA 4MLZA 3ZNNA 4EG5A 5FYDA 1N33B 3H7IA 3DLCA 3HSSA 4N6OA 1ZD8A 4GZ5A 4YT5A 3SDZA 2V9PA 3HBFA 4PLPA 3WMRA 4BV8A 1NA5A 2IIQA 3HXPA 4CIXA 1MRZA 1HDIA 2W98A 4AZSA 4HFMA 4CKBA 3CC8A 3WRYA 3ONFA 1JEYB 2QUKA 2VJOA 3O4VA 2IWRA 4Q3DA 2A8YA 3WI7A 5GONA 1PK8A 3IRVA 5KOHA 3DV9A 1RI2A 2I34A 3S55A 4HMOA 4J2HA 4NZNA 2BHTA 3WWDA 2HBQA 2FX5A 2IQ5A 4LOLA 4MV3A 1YSCA 1JFTA 4QVIA 2C98A 4F5EA 4DR4B 4XQGA 5ESWA 3KOWA 4Y7CA 1MVOA 3FIJA 3OE7A 2BE9A 3H8VA 4QGAA 4C0XA 3IP6A 1DTWA 3L8GA 4W7IA 3Q3VA 4WGFA 1KF0A 4J1TC 4U2DA 1SXHA 5DV9A 3M2PA 4W5TA 4HS4A 3MOIA 1J0CA 2ZI6A 2CCGA 3P9KA 7REQB 2EGUA 1AV7A 4EJ2A 4F0JA 1UBLS 4HK4A 1KFEB 4ON9A 2C2KA 3EC1A 2HB6A 4HXGA 3UAOA 3V48A 2XF2A 3ZWYA 3PNKA 2ADOA 3SYNA 4S0ZA 4NC9A 1PGQA 4C0AC 1FNMA 5J43A 3WK9A 2FWMX 4INAA 4LDQA 2LV8A 4RLFA 3GPCA 7MDHA 3MLBA 1JI0A 2BM8A 3KYJB 5C4IA 5F5LA 3S2GA 4HDKB 1B26A 2FEKA 1KDPA 3TR5A 3CYFA 2EIHA 3Q7IA 2I5PO 1I9CA 4BNVA 1LC3A 5IK2A 5AM0A 2ZWOA 3V7FA 1XP8A 4QGSA 5IJ9B 1XLTC 2PLWA 4BUCA 4GX0A 1U2RA 2I65A 2P27A 3V8VA 1XZQA 2OXCA 3CONA 4EG4A 1U6KA 4UOEA 3KJHA 3HFRA 2XB6A 2HF8A 3B7PA 3L1IA 3TLAA 1FFSA 4MTLA 3KC2A 4F7WA 3DZKA 2QV7A 3DGFC 4DSOA 3PUVA 4WEQA 2GJ4A 2W90A 3Q3IA 3WLTA 4HF7A 1QIEA 1R0XA 3R5TA 3E8XA 4X71A 3LOUA 5B7NA 2E49A 3ZY5A 5DSZA 3H16A 4TLMB 2PV7A 5BMVA 1IYZA 2EVWX 3VKGA 4BO3A 1ZXBA 3N8KA 4HNRA 5TC4A 3UV6A 1Q84A 2CLCX 5EE0A 1WBBA 4HGNA 1SUAA 1GZSA 2OVBA 1GITA 2VQ6A 3D6UA 2PZGA 2WM2A 2GBFA 5E3IA 2FUG6 4TYMA 2PWAA 4WJKB 5DYTA 2P0YA 1N6OA 3GCZA 1YDMA 1M3SA 2QZ9A 1E79D 4M1MA 1O8CA 4CFYA 2BH2A 3GGPA 3NBYC 2PKXA 2OSBA 4HB4A 3P5BA 4PX9A 3H1TA 5FNVB 3A6ZA 3L4KA 5DJ5A 2EP5A 3ASZA 3MRVA 4R40A 3BAZA 4TMWA 1IRIA 5K4GA 5IANA 4JP3A 1D09A 1YZKA 4G1BA 2PMDA 4GBMA 4GMGA 1GPMA 5EYPB 5KBYA 1RNLA 5I7FA 4NRDA 3I42A 2FFBA 2SBTA 1DWOA 1C7EA 2F17A 4P9NA 1GT91 2PU7A 2AXNA 3ZVRA 1KPIA 1XZFA 4GKVA 4HYEA 1VHDA 4ZVMA 4KC0A 3DVSX 1HBJA 2NU6B 1ZM3A 1S2DA 3ABSB 1BQ4A 3CNBA 3F4LA 3EOAI 3O7MA 1DPGA 3ZBUA 1GD1O 5TPZA 1RFGE 1VECA 2WW8A 1FTGA 1ZHHA 2IY7A 1K7SN 3W2TA 2N0SA 4O4JB 4INZA 4DNOA 2F55A 3BZWA 2BGMA 1G8FA 3NRJA 3PYLA 4IDQA 4NONA 1CY0A 2O5RA 4DIEA 3I6IA 1QP7A 2ZPUA 3KQTA 1C3LA 2C0CA 4FYIA 1UIRA 3Q8KA 1XWWA 1G3UA 3QUAA 1L5WA 4TVSA 1U8ZA 1L8OA 2J45A 4P3PA 5JWRA 3OFSA 1QVWA 1NNI1 2PMCA 3GMDA 1W87A 2F90A 2ZDHA 2V4UA 2ZAYA 2R47A 2IITA 4UEKA 1DBQA 1Y3HA 2CFTA 1ADFA 2WJVA 4O2RA 1U8XX 4DJTA 1NBMA 1ZDMA 2ZR0A 4LF9B 3RK0A 1QLWA 4WZAE 1FS5A 3PUYA 5JD4A 2GBCA 1J5XA 3KR0A 4RZIA 5CT9A 4KVAA 1LK5A 1AGRA 3W77A 4D9IA 3OPYB 1BWRA 4KE9A 2YOGA 3DDSA 3A6KA 3DZDA 3LGAA 4RZSA 4WACA 1ZJYA 3OY2A 5KYVA 4YCCA 2GUGA 4DNQA 4RAQA 2NT4A 1KXZA 1RJEA 1L7QA 3MCZA 1IG0A 2CVPA 3FF1A 3HCPA 3QLEA 5F78A 4D3FA 3ABZA 4LYJA 1PZGA 4LW8A 4BZZA 1ZU5A 1EE2A 3G13A 2A5GA 4RM2A 3SI7A 3U48A 2WMDA 4WLOA 3RH0A 5BOSA 4KOAA 4D97A 3BSWA 1QYRA 4M8LA 3F46A 5HUQA 3K96A 2PR7A 4IDEA 1ADGA 1ESZA 2P41A 2QI9F 2BLNA 2R8OA 3BTVA 1OX4B 4G26A 2PL3A 4YECA 2IZ6A 5AW3A 4G0VA 4CNBA 5CA1F 4RQTA 1XNGA 1E4YA 2BFEB 1J23A 4NE2A 3MT0A 4ZOEA 5CURA 4DARA 2Q5QA 2YR0A 1OI7A 1VHJA 1XQ1A 3GRUA 3EDYA 2QTLA 3N7AA 1QR6A 4EATA 3LPCA 2WNHA 3N8DA 4Q1FA 3BD9A 3C70A 2OXRA 2XCQA 5ARBA 1KYZA 3QPVA 1CIJA 1H2FA 3N75A 1DCFA 4JEHA 3TZEA 1CUHA 1W5TA 5FTNA 3D4LA 2L2QA 1WDKA 3KSAC 5M34A 2O48X 1V47A 3ZNPA 1E2LA 1TFRA 2OHVA 1CZHA 1DZ3A 2QGFA 5JD3A 4JJZA 5DTJA 3TRHA 3U0VA 2F62A 5ETJA 4KAJA 1BDJA 4BP9A 4REOA 2VDJA 2W6ID 2QTFA 3PNYA 2DETA 1ODFA 4DLRA 1BW9A 4F38A 4PPQA 3AHHA 1O97C 2Q3JA 4F9GA 4YDQA 4PYOA 1UWKA 2ZZNA 4MVCA 3NHJA 3UJ8A 1C7FA 5EJ6A 3LW8A 4BDTA 3TNYA 1M66A 1PX0A 3HWX1 1DZIA 3DJYA 3HDJA 3HXTA 5A1JA 5DGDA 4BBJA 2AGVA 5B3LA 3C3MA 1ZNQO 1CJCA 2HMYB 2KQUA 3E5NA 4LXTA 1CB0A 3QPAA 2IXBA 4E2ZA 3UWMA 1PR0A 2FZ5A 4QHTA 1IMOA 1G8HA 2I4LA 2XOEA 4MV1A 3IT0A 2R48A 3BCHA 1XNJA 4QDJA 1PQYA 1ZGGA 3I12A 5E8JA 1KAGA 2PT6A 3NT2A 4BMSA 1HETA 2X40A 2YN2A 3BS4A 4A0HA 4C5AA 3VHXA 4D81A 3ZU5A 2H08A 1XD2B 5CVUA 5SYMA 1RM4A 4GGMX 3K92A 3VPHA 1IVYA 2X1HA 1JG6A 2P79A 1T2FA 2NAPA 3CKMA 1PNRA 1H2ZA 1ICEA 1M6WA 1XRLA 1Y48E 1SVSA 1AX9A 1DI0A 4M46A 4IVQA 4EFDA 4OVKA 1CP3A 3OCWA 4Y9RA 5I7RA 2F59A 3NBQA 4Z7JA 1S96A 1R6UA 1KR5A 3JD4A 5HIIA 1YB4A 2BJVA 3MD0A 5CEJA 2ORED 3FNBA 4X20B 5IKMA 4AXBA 3HLTA 3ACCA 4IH1A 1OD6A 2NXJA 3QE0A 4KNWA 1DOHA 4YHBA 3DAHA 1PT8A 1HDEA 3K2IA 1GYQA 1H1DA 3MXOA 3GPLA 5H82A 2NTVA 1M0WA 1X7XB 1J0XO 2GZDA 3KHKA 2BDEA 3NT4A 5CIWA 1OIWA 1JILA 3PX3A 4E09A 4OKSA 5BWBA 5CFNA 4U2EA 5E3JA 3SZUA 4FFOA 5CG1A 3L9XA 2GBLC 1C4XA 1Z62A 5GAJA 1QP4A 5JJ5A 1DMRA 2YBDA 2A7XA 3CE9A 2BZ1A 3IJ5A 1J2TA 4I9NA 5I9TA 4IDNA 4N6NA 1GCUA 4MSUA 3K5IA 2HSZA 4MIYA 1KDVA 2PLAA 3FVWA 5K20A 1CIVA 2YV4A 4AULA 3COPA 5K4HA 5FOUA 1RZRD 2NO6A 2VPQA 4B34A 1NULA 4R9SA 4TS3A 4ADSG 1AK1A 1G20A 4QXQA 2W6JA 3U49A 1G8MA 2NNWB 4NCBA 3ETHA 1LS1A 5HTOA 4ENWA 2XQKA 3RS7A 3NYWA 4GUDA 2WBLC 3E70C 5B5SA 4KREA 5MN4A 3PXBA 5E2AA 4XTRA 4BQQA 1Y3FE 4B3HA 5ERGB 4DBLE 5IAAA 3T95A 1A71A 2P4HX 3EVEA 1E5LA 2D4HA 2HDWA 2OM2A 4L8WB 4CMKA 5GVSA 2X7HA 5JWHA 5DP1A 1RIIA 2XSZD 2V7UA 2YHIA 2HF9A 3NWBA 3O8LA 4Y9UA 5L7TA 1GM5A 1TQ4A 3GJYA 1XP5A 4NVRA 3TIGA 4B3TB 3O2QB 3B13B 3ND7A 4OQMA 1QR2A 3QE2A 1K4KA 1NGSA 2A0XA 1G8AA 1Q1EA 5AXCA 3NX4A 4C43A 1WETA 4RVHA 4HS9A 2VQ3A 2H63A 4MB6A 1TE2A 2FUEA 4R1PA 3B3GA 3ZHXA 2XTJA 4ZK2A 2V7BA 1OVMA 3WJ7A 1NXQA 4ZCPA 5LQJA 3MTDA 3ZI0A 4ZWNA 1NMEA 3RJZA 4WK0B 3S27A 4JUFA 3D4IA 3WADA 4HAOA 3O9ZA 3ZWCA 5B36A 1TJPB 2O54A 3ZNOA 1UQRA 3JVIA 5JXHA 2GPBA 1FE8A 3ZWBA 3CKLA 2J3KA 4FFVA 4ZVOA 3RSHA 2KSQA 1KMHA 3D2AA 3GZNA 4RF4A 3UMFA 4F71A 2CEKA 2O14A 1NUPA 3VNSA 2CSUA 3ZIAD 5BSVA 2ZYUX 2HA6A 4JODA 4Q39A 1K4YA 2GRJA 4FNOA 3GEHA 3ZIDA 4BEVA 4FFMA 4YT4A 2W8ZA 1DIBA 4IYJA 1TKCA 3EVTA 1BXRB 2M6KA 3SJBA 1HDGO 4CMEA 2GA9A 1E2FA 4DYVA 1UXIA 3L8CA 3EQZA 1U0GA 2YW9A 4NBUA 3BMOB 1BHSA 1M34E 1UPBA 5GPBA 2AMJA 3KKNA 4ZO6A 4DJAA 2R1ZA 2C88A 5AKHA 4AY6A 4E2YA 1T3LA 2FRXA 3TTVA 5FO0A 3PFFA 3VDNB 5FOWA 3ZYCA 1C8VB 1XTBA 2A5JA 2GF0A 4QHSA 4DIBA 3AU9A 1BAPA 4KWHA 4LPSA 1V8FA 4NH4A 3RS4A 2IHTA 4DRXB 5K01A 2R0QC 2FPUA 1PW5A 2X1MA 2IZ7A 3E0XA 3AUXA 1FZTA 4Q82A 4ZO4A 5F7OA 2GSWA 2ZRMA 1MH9A 2WWFA 1C9MA 4P3KA 4PSVA 3U7RA 3KZVA 2YZMA 1QHEA 2F8LA 1AG9A 2J7PD 3QLTA 2ECPA 5C7OO 4NCNA 1P4GA 2R7NA 3DLBA 2Q49A 2GZSA 4QT0A 1GZ3A 1Y0BA 2RONA 2FVYA 3IC5A 4V3CA 3G6KA 4WUTA 4TZ0A 4GC9A 2FOXA 2BKEA 1H8EA 2FTKE 1D3AA 4IX9A 4Q37A 4DCMA 3RB8A 4YJ2F 1M7GA 4H7DA 2FSSA 4NEGA 3S0JA 4V0LA 1DCTA 2JANA 1JIUA 4RHYA 3VUFA 4OMFG 4F9TA 4IG9A 4JVSB 1L8LA 1SD2A 1WNFA 4I81A 2FSGA 2BGJA 1XXHA 1TOAA 2PQ6A 2V1XA 3OZGA 3AVPA 4E21A 4Z1MD 4Z51A 1FYFA 5MFPA 2IW3A 1P7CA 4GL4A 2PNJA 4LN1A 1K6EA 3RSOA 5ARDA 1ONNA 3F74A 1BDMA 1DU4A 2HK8A 3EZYA 5AJXA 4EUKA 2J3MA 2HIGA 2Z04A 1I7DA 4TPKA 3ERCA 3COJA 1NATA 1EWYA 2VIIA 3CRZA 1P29A 3KBOA 4GFDA 4YQYA 3VJKA 5CDHA 4CN8A 3EIQA 2D74A 3R2JA 3TDMA 3TTWA 3MYYA 2E4WA 3DL7A 3SVZA 5J3JA 1ZXLA 1M1NB 1N6PA 1HE3A 3R3ZA 2ANCA 3BF8A 3DUFA 5T4BA 2I2AA 2PUCA 1NIPA 1Q83A 3OMXA 2N9UA 2PDAA 3DQPA 1ULBA 3MWKA 1JH8A 2XXBA 4KSCA 4PEVA 1J8FA 2H2HA 3AF3A 2YTZA 3ORRA 3BQMB 1IHPA 1RHMA 2I4RA 2Z5LA 3CNEA 3ETJA 1TLTA 3TL6A 5E2IA 3E9ZA 5I5EA 2IS6A 1NUHA 3GFRA 1Y1PA 3IV9A 1GY8A 3PRYA 2WD8A 3NH9A 4LYFA 4BS9A 5KNDH 1GO2A 4DA8A 1FMJA 1I5EA 3O93A 4X7PA 2G76A 3RVBA 4IILA 1SUPA 2YJZA 5K0JA 2PS1A 1GRQA 2IT1A 1YJBA 4KVFA 4BVAA 5TQ2A 1E96A 1XZIA 5FUXA 3FDIA 4FKZA 4G1MB 5D01A 3CZCA 1WHTA 1R6VA 4FJ2A 2BL4A 4LRUA 4W5RA 1QCZA 1X8XA 3DZJA 1CJKC 2XUIA 1Z28A 3AZPA 3RAGA 4DYHA 3TG2A 3WYGA 1IJBA 1EVQA 3FOEC 1XHLA 3E7DA 2QNIA 5KU1A 3RJTA 2XXJA 4ND8B 3SC2A 1H4VB 3HJBA 3I23A 1TT5B 2AMVA 4INPA 2X2FA 4LQLA 3AF6A 1LDEA 3G9XA 5LBTA 4U63A 3CRVA 5BURA 3P0IA 4CF6A 5HXAA 3L8HA 1V4BA 4Q1AA 3NWOA 3M0EA 3A1WA 4KQCA 4WEOA 3WK8A 2WB4A 2XCSB 4N9WA 4UEWA 2VJCA 5IDXA 2QBYB 3C39A 1ADJA 1S8AA 4HNQA 4MWSA 2F1RA 3O3NB 3O75A 1C30B 3EAFA 4FB5A 1STOA 5C8ZA 2O2CA 1GPBA 1Q0HA 4HPJB 4Z9FA 3EZ6A 1DP4A 2QYSA 4PG6A 4TZKA 2D5LA 4ZJUA 2RKWA 2IYWA 3E22A 4ND3A 2C4WA 4N7RA 1N0UA 1D07A 5DWQA 2CHEA 4JR0A 5F7XA 1CR6A 2HR1A 1TJYA 4DCTA 2ZVJA 3WAJA 4LTDA 3RIXA 3QENA 4XUCA 1GKIA 1ZRNA 2Y92A 4ID9A 3DTVA 1Y5NA 1OFTA 1XYYA 1K06A 2ZE7A 2QPLA 2FMFA 3QVUA 1JFLA 5LA6F 1H1TA 3HFJA 4FFWA 4JBLA 1OWLA 2I6GA 2PNFA 1P1HA 4WFIA 4RTMA 4QYMA 4Z4QA 3SSNA 2ZRCA 3JWIA 5DTQA 1GILA 2VRBA 1G7SA 1SK8A 4QYTA 1L7EA 3R3XA 5LB4A 3HA3A 3GJTA 3ENKA 3W06A 6GPBA 2Q46A 3EPJA 3D3WB 4GI2A 4MLPA 4XGKA 2PL5A 2HEGA 5FOXA 3CEMA 2BDTA 3U4CA 1XVUA 3VFDA 4UDXX 5EIHA 2FEXA 4LSWA 3EXEB 1M76A 2GHTA 2QSZA 1L5GB 4CMIA 3RS2A 5J4KA 2OB2A 2BFBB 2K5UA 3NW9A 3EXIA 1O9HA 5IVHA 3HM2A 1M1XB 4JIMA 3V4ZA 3OCVA 3FUCA 4KQHA 4XX1A 4UOZA 4BJ3A 3GJQA 5BNTA 2ZVPX 2V6GA 5KVVA 1N36B 3W5AA 2AD1A 4M1YA 5JCJA 2G36A 3ANXA 4MDFA 3HCOA 1DO2A 4UNPA 4CIWA 4KI7A 5ALRA 2IU6A 3EXG1 4JI8B 5DHSA 1I2MA 3THYB 5FLYA 2BISA 5B7PA 1JR4A 2JBWA 3IA2A 3IAUA 2JASA 2PSFA 1KO8A 5B12A 2QD4A 2AA3A 2XMRA 1DQYA 4L9AA 2C9MA 3CISA 2WC1A 4XYBA 3THOA 4E70A 3OPYI 3E5RA 3H2IA 4KLAA 1C1XB 1DQZA 2Y71A 2Q3CA 2ST1A 1YVPA 5AVUA 3CCFA 4RADA 5DNAA 1LSJA 2PGAA 2AEJA 4G0QA 1H4QA 4GWGA 3S7TA 2QT9A 4DOMA 4FC7A 1T4GA 3IOBA 4Z3OA 1IAQA 3P1JA 4IDPA 4ZICA 4CDGA 1PUXA 3OIWA 4EGFA 2Z30A 1G20B 4Z8YA 2H2GA 3ZU3A 5J4HA 4IIJA 1S89A 1VJ1A 1H3EA 1UJMA 4LJRA 4LQCA 4Q4JB 5HM6A 4HNAB 1Y4UA 4AFNA 1V1MB 2WE8A 5CRIA 5K8LA 5AVZA 1YZ3A 3LDAA 3UJ6A 1ZI6A 3B9BA 4OGFA 4CQLA 5GIPE 3K4HA 4Q19A 5E2BA 1JB1A 4W6QA 3CVYA 2PLNA 1D2RA 3VR5D 2C99A 2NP6A 1L1EA 5LOVA 2CJYA 4LYYA 2O1SA 4RK6A 2F43A 4ZDWA 1CDZA 3S5JA 4LOIA 1LSSA 4UVHA 3IKVA 3PITA 2UYGA 4TS4A 3HWRA 5WRFA 1X7GA 2YXEA 5FTWA 1NW8A 2WF7A 3QBJA 3EXAA 1D03A 4H17A 4MROA 3EAQA 3K5HA 1TTPB 4HHEA 1NNEA 1RP1A 2Y1GA 3F67A 3QE3A 2OXIA 3MOGA 3NO4A 4LX0A 4L57A 2PM8A 2VDWB 2YIVX 4IUBS 3M9LA 5TDHA 1EBFA 4EH1A 2H18A 3AONB 5I5GA 4C5CA 1HG1A 2G0TA 1CUYA 4QXRA 3UENA 4IFIA 3AINA 1DKLA 5FP0A 4FMDB 2QYTA 4Q7JB 3UUGA 1A04A 1DDOA 5C51B 5BRAA 3A7EA 5DF1A 4CIYA 2PA3A 4L08A 4PZDA 3ZWKA 3HO1A 3ONEA 1RRFA 2X86A 1S8OA 2VUTA 4Q9DA 2A94A 16PKA 4B46A 3OZXA 5T64A 1I5OA 5EIOA 2C83A 1BEZA 1Y6ZA 1WPRA 4RTQA 3KBBA 1QWOA 3R8FA 4LZOA 1P8JA 3D7NA 3P20A 3WC4A 1G2IA 3NHPA 3ZBQA 4F84A 1JE0A 4KN8A 1AHIA 4B4UA 1PVVA 1RACA 1B8OA 2J7KA 3HKDA 3IILA 4R51A 5FWXA 2IBSA 5TQJA 2X2PA 3G5TA 3W9UA 1X1DA 4KPUA 3WHPA 1AHPA 4WXYB 3ZWNA 4NCHA 1W94A 2JLUA 2Z6QA 3NVDA 1XZKA 4ZT6A 3VR1A 3GVCA 3U6BA 4JI7B 1Z68A 1NAHA 1K7CA 1VIYA 2QD3A 4N9QA 4UVIA 3ZW7A 3OQOA 4RELA 3TZCA 1KI4A 2BELA 4FILA 4RTNA 1ZR4A 1NVAA 3MCTA 4B2IA 3IO5A 3HB4X 3K1JA 1TRKA 2Q29A 2WG2A 5B57C 3A9CA 1MAVA 2DCMA 1DC8A 4J0KA 1W96A 4BN4A 3UANA 2V6FA 3PJRA 3ZKWA 2HLNA 1FNBA 4CKBB 1M6VB 3FPEA 1YL6A 2P7IA 3Q0TA 4HZIA 4Q66C 4XR4A 3VOSA 3WMEA 2PSHA 4G4SP 4OO3A 2YS6A 3OZDA 4ESOA 4RFSA 3W7AA 2UZ4A 3K70D 2Q6KA 1X3SA 2B3DA 4RXTA 1GGJA 2QOEA 4H6XA 3EFOB 3HA7A 2C97A 1VOTA 2UYCA 5ED0A 4IQGA 1E1RA 2Y27A 3CG4A 3I9OA 4I9GA 5BN4B 2J4CA 2NOAA 1VGRA 4BWYA 2NO1A 3HKEB 3PL1A 1GRVA 1UH5A 4PZCA 3EXHB 3PC4A 3KSRA 2K7ZA 1QK4A 2J6IA 4UAVA 3GNTA 2CNWD 3LECA 1UAYA 5J63A 4W5OA 1NBME 3ECCA 5GOTA 1T8RA 1BMQA 1ZMRA 4FT4A 3WYNA 4PBRA 1JAIA 3TEMA 4YY3B 1C7IA 1VLHA 1O5TA 1XZEA 1RVDA 2FHPA 1KWGA 4ERNA 2IYPA 1KTIA 3VGPA 1T0JB 4H18A 2IL1A 2P2GA 5EWLA 5GONF 1C4OA 1BYIA 1XMXA 2ZUSA 2A3NA 4MMYB 4DR3B 4JLDA 2IPMA 2FOIA 2E9SA 4MUXA 3D7MA 4J0EA 1JIIA 4N5NA 3OLYA 1T6NA 2AW3A 4HP8A 4K9KA 3UJ7A 2JHPA 1YKSA 5HNKA 4GT1A 3V2UA 4EG7A 4BGUA 2F3RA 5EQJB 2M6RA 3HCDA 3JX9A 2O57A 5NLLA 3RT7A 2LGJA 5ITZA 1L4BA 4EY6A 5KSOA 3CX7A 3HMKA 4WY2A 3K53A 3K9LA 1Z39A 3ISTA 4PAQA 5B53A 4S12A 2V3VA 5DI9A 4QJIA 5E7JA 3KQUA 4UVEA 5CA1B 1T0HB 2FWNA 1CFJA 1SQ5A 1G2QA 2GAIA 3T9FA 3RFXA 5IMSA 3H2HA 3Q3HA 4IDCA 4PVCA 4WOCA 1O6GA 1I3NA 2BKAA 2ZJ3A 3ICQB 3DCNA 1G7RA 1VKJA 1Z7WA 4WY5A 1XQYA 1NF8A 1AD2A 2RBGA 2Y93A 3V3TA 1A9XB 1K86A 1A9TA 3HZZA 1HWYA 4L76A 2WKRA 5LKAA 3AVTA 4AS1A 3CZRA 3WIOA 3VPBA 5AM4A 1N7IA 4EPVA 3TMKA 4A27A 5J4LA 3N2KA 3AM3A 3LOQA 1AQIA 2BVNA 3RV3A 1P0QA 4LNAA 4PAOA 3ZE8A 1WZ2A 1XU7A 5AXDA 5AESA 1VZ3A 2ATXA 2N1MA 4L85A 4DILA 4BPRA 3CT4A 4DDWA 3PHCA 1K5DA 2JZOA 5A3VA 4DABA 5JC8A 3IIKA 1F0NA 3LWZA 3QOFA 3RTCA 1E9SA 1IHYA 2GILA 1R9MA 2CLKB 2JL1A 2V7PA 2XITA 3BK2A 5E0KB 2ZGVA 2FAXA 2IU0A 3EDQA 4ZOLB 3RS5A 4J0CA 5LZ2A 1RWKA 2YQ4A 3GBVA 1MTZA 4MYSA 1TF5A 2C1XA 2VH2A 1JHAA 1YK1A 2ZI9A 1CY2A 4FQ5A 4RUKA 4RJKA 4O5OA 5AHXA 5JASA 2VK1A 3AJEA 1UC4B 3LM8A 4FIDA 4QRIA 3MBOA 4K9SA 4JU9A 3TI9A 2CMKA 4EHLA 2PUAA 1Z0AA 5ENZA 4HDRB 2VF8A 4F56A 1WPQA 2KPOA 5G3ZA 1TUEA 2ZOSA 2OC9A 1Z7GA 1VI2A 1I32A 2WVAA 2YWJA 4Y8VA 4E30A 5I8WA 3SKXA 1F1BA 5SZIA 4BUZA 1XTPA 1K88A 2HTFA 3BUSA 1X77A 4GUAA 1F2UA 4XGNA 1CYDA 2X23A 1VLVA 1RE0A 5DT9A 3SQMA 3GDHA 4YN3A 5DM1A 4R2HA 4F3NA 1XJ0A 2CHGA 4KSYA 4NYMQ 5JHGB 1VKNA 2NV6A 2PGDA 1AUPA 2I3AA 2IYUA 1RXYA 3JQQA 4HRYA 3UWPA 5A0FA 3VKFA 3EQ2A 2O0KA 5FLKA 3JWHA 1LY1A 2HA2A 2NSJA 1DCKA 1MVLA 3GJSA 4RJJA 2VYND 1XNQB 2BFBA 4Y0AA 4FMBB 4TQ9A 3BRQA 1TK3A 1HL3A 1NI3A 2B7CA 2X8JB 2A4KA 5GV8A 2OMKA 1JSLA 2DTXA 1PVDA 1R4NA 1U1GA 2O1WA 4IRXA 2DH5A 4NOMA 4PSAA 5JPIA 2QLJA 3PUXA 4N5HX 5LLSA 4G8JA 3TXAA 3FPFA 5HKAA 5ITWA 2PG3A 2OHIA 1SUWA 3QVSA 2RI0A 2XWSA 3L92A 1X7DA 1D6SA 1OT3A 5JNRA 2V9ZA 3OQBA 3M1AA 5T4FA 6NULA 5IDWA 4PHGA 5M04A 4MVJF 3P2KA 1ZX1A 4RA9A 3BL6A 3THYA 1ESEA 4HVAA 4IR7A 4QASA 5AJHA 5LMZA 4GYWA 3R7DA 2Q1TA 1C9EA 1LNSA 3BMXA 2QGNA 4WESB 2Q0SA 2VPIA 3PF9A 4NBLA 5FWNA 2JI8A 4FEGA 5KNDD 5E6SA 2ARKA 2C2OA 5JROA 4RTKA 4DREA 3WA7A 4DPMA 1LK7A 4QUAA 5LN1A 2K7FA 3EIHA 3ZHOA 4PLYA 2C61A 3REQB 5D7NA 4ZDIA 2ETXA 2QX7A 3DBRA 4B76A 3EUEA 4EHIA 1RYFA 4EKNB 5AHWA 5FJIA 5A6VA 4OB6A 3L7BA 2X8AA 3Q9UA 1YD7A 3CF0A 1JWAB 4QU9A 1GGHA 5I8ZA 3QKSA 4AECA 2AUTA 2JGMA 4LJ4A 1FB5A 3SZOA 1K98A 5DDIP 2ZJ0A 4CODB 4D3XA 3I45A 5LFAA 1L7MA 3WRYC 3L3BA 2RG1A 2HFKA 1FSGA 3VR3A 4NCKA 1IBMB 4JI2B 4MTCA 4RZXA 3FI0A 2PUEA 3FPHA 3NYIA 3H9EO 5JDCC 2DT5A 3RLIA 1YMUA 4RIHA 4DJFC 3K70C 1U9ZA 5LC1A 4LVCA 5BVGA 5FCDA 3DMTC 4LOKA 2UUOA 4QDZA 1ZQ9A 2N47A 3JPWA 1Y3IA 4B8ZA 5KX5F 3NTQA 3E2PA 1QF9A 1A3CA 2LBPA 1PUJA 3VSAA 1DB3A 1SOMA 3JALA 1W47A 4JGGA 1T5HX 1XD8A 1GTG1 2J9YB 2WICA 1OOEA 4K46A 4B83A 2X5JO 2ACEA 1YQXA 2V54A 2WUEA 5BPFA 3QV2A 4YP5A 3GGJA 3SKYA 3OUZA 2CNLA 3W1VA 1EFRD 2WJ4A 2RHLA 3FNEA 5EKTA 4R8RA 3FNQA 4MVJM 4MH0R 1L7AA 2C20A 3C87A 3PE6A 3OEHA 3U13A 4DC9A 4ZYZA 4F3CA 1ZVVA 3ADDA 3WK5A 4FDMA 5G2OA 4FDLA 4N8DA 3SYKA 4OREX 3RUPA 1RLIA 4PO8A 4X7MA 2ASVA 5FWXB 4KTVE 1T15A 2FNAA 2PAFA 3LKVA 4UJ5A 1KQNA 2H1OA 2AFRA 3TSCA 5AK5A 1D9ZA 1E32A 4LXYA 3DVRX 2UXDB 3M89A 1U0JA 3TBFA 1FFXA 2HPHA 1DAIA 4KE8A 3D8TA 1QVAA 1DC4A 4JOSA 1N2EA 3AFHA 4X90A 3RKSA 4Y2VA 5JANA 1L8AA 2AJBA 4M0PA 4NY1A 1G17A 1UC9A 1KZ1A 1H94A 1E58A 2ATVA 4K3UA 2MMCA 2BGKA 4EHKA 3OVMA 1LQTA 2EHDA 2GZHA 5BSWA 1DX6A 2YYSA 3JATB 1CETA 3ZKWB 2QDXA 4RSHA 2ICAA 2VZEA 3K8QA 2VWQA 2W2LA 5AI5A 2PZFA 2NP7A 3BG5A 2BEVB 2B92A 3ID6C 3F3MA 4HOYA 4ZP1A 4B3JA 5SZJA 3V1YA 5KYWA 5HF6A 1IBSA 4Y6PA 3Q2KA 5BN4A 3RSQA 1NY5A 2C2YA 3KKPA 4UUNA 3ZVKA 2P3SA 2XZLA 1MO3A 3AUKA 3WYCA 2WP0A 4YRFA 2XECA 1M2HA 1KYVA 1SHZA 5TVGA 1OUMA 2E1RA 3SC3A 3SMVA 3Q72A 1XMQB 4UARA 3TSAA 2Z9BA 1JJFA 4AJ4A 2JLYA 3D9QX 2WOJA 5CJ2A 1ZNYA 3OKAA 5JZSA 1VL2A 4U2FA 3GXBA 4UMVA 4BNWA 4IJVA 1HZJA 1T13A 1JVSA 5JTTA 1OAAA 3B5IA 5CB6A 1EDDA 1J9EA 2CNKA 3ZJ4A 1ST3A 3U61B 1R50A 1UFKA 1V43A 5F4ZA 1B3RA 4LG1A 4MKXA 4W9RA 3TOCA 3WLNA 2O2HA 3HFSA 4ALIA 1NG9A 2HFJA 3EODA 3ZUPA 2P30A 3A27A 1NVFA 3QVMA 1EFUA 1V96A 1XVTA 1H6AA 4MRRA 3TINA 4DDMA 1FUYB 4I1IA 3NI2A 1VE1A 3RUAA 1P4JA 2X77A 4HJXA 3K70B 2JD2A 2WT8A 4UM9B 4L8FA 1NVEA 3ESAA 1E8NA 4WKCA 1II0A 4RY2A 4WNYA 2ZWIA 3TOXA 2OCXA 1IE3A 2O8FA 3UKDA 2CC2A 3TPCA 5JAOA 3PHBE 4ZT4A 3RRMA 1CVIA 1OR8A 5DEOA 2G82A 4PTLA 1E9RA 2HQ1A 2X4LA 3C2QA 4EB6B 1CY6A 1FXSA 4L7QA 4B3CA 2VUIB 1BG6A 4AF7A 1KSHA 4RCZA 8GPBA 1GTVA 1U2EA 3TLZA 2ZSHA 3V4VB 3M70A 3ZTWA 5T41A 3K15A 5GJCA 2ZRDA 4AY2A 4UVDA 5JADA 1W59A 4Q4DA 3N2KB 2IEIA 4PO9A 2AFHA 2DR3A 1SPXA 2VP3A 3KJQA 2I22A 4A8JB 3PWKA 3K0SA 2OORA 4EBBA 3HJGA 3CFYA 5I9SA 4Y2XA 3LYHA 4F6RA 5FO1A 4AC9A 1MF7A 2YINC 3AM1A 1V95A 3V33A 4D0LB 1HT1E 1J0BA 2ATIA 3UMCA 4P7GA 5DNCA 4HPWA 3BC1A 4HUQB 3LBAA 4TYNA 2DKOA 3VDQA 4PNZA 2DFLA 2QQ0A 1OIXA 2BP7B 4MUBA 2RCYA 3KQYA 4RVSA 5CG2A 2A30A 2EFJA 2MSCB 2Q27A 5A2GA 3WBKA 5EJIA 1Q0TA 5FIUA 2J9GA 4BKQA 2COEA 3LRXA 1FTQA 1G5HA 1J24A 4JHXA 5BNWA 4DR1B 3THWB 3T3OA 1QFXA 2DEUA 1AKNA 1NHWA 5LP1A 2DWOA 3KZCA 3SJ7A 1QIFA 4C08A 2R2GA 1Z29A 4R9RA 5K3FB 2A1TR 1XDZA 3UB3A 3WX0A 2F8MA 1UWLA 4A36A 1L4EA 2J0EA 4CEIB 1L5KA 2CMHA 4NJEB 5E9AA 3QM1A 4XJXA 2P6RA 1G6Q1 1UK6A 2QV0A 4YJKA 2VDRB 4Y9DA 2AFHE 2O2XA 4ZJZA 2ZRBA 4G97A 4URFA 1GPUA 1ZKDA 1BHJA 1H0HA 4II3A 2WWIA 4Q3BA 4RK1A 4EGAA 4LC1A 4J9VA 3IMGA 4OMCA 1GAJA 4OHVA 3VDMA 5A5DA 1A5ZA 1JAXA 1KDRA 2GWRA 3OOYA 1SBCA 4W8HA 2NU6A 2Q6LA 1I2AA 2BGRA 5EEGA 3ZCSA 4CG1A 3E7FA 3RYCA 3TDKA 4CUJA 3E0QA 1O0BA 1ZSNA 7REQA 2BGUA 4EZIA 3O83A 3QTBA 3OLQA 4LJ5A 4ZZ2A 5LIPA 1E18A 4YX9A 1SKQA 1YONA 1N8SA 2BWJA 4NBWA 1KJ8A 4R69A 3DGEC 2NTNA 1FTYA 2HRQA 1E3JA 2E21A 4E2FA 4Q3KA 1OTXA 5DM4A 2WUGA 3WA6A 2C29D 2QGZA 3ZQUA 1E4VA 2QR3A 4TXJA 3STYA 1IRXA 4XDYA 1J8VA 4L6AA 3HVJA 2CBGA 1CUXA 2CBXA 3ANLA 3RLFA 1KBOA 3IBGA 3EWNA 4QTYA 2ZIGA 5IJ9A 2RK6A 4BO8A 4JJ7A 1Z7BA 2YY7A 1G2PA 5IM4F 4ZT3A 3VR2D 1CR0A 1J97A 3I0NA 4Q12A 4QUKA 3AG6A 4LXXA 2R7LA 4JXKA 1XZDA 2E5FA 4BJHB 1UBJS 3OM1A 3LCUA 2IYFA 5TEVA 3O3MB 3VR4A 1KQOA 3TSOA 3Q8WA 4MK4A 4TRNA 2ZWAA 1IMJA 1DT5A 4MAAA 4YRNA 4BC0A 3ZJUA 4HGRA 4JOCA 2JLCA 3EF0A 4PG7A 4AJEA 3VKHA 1I30A 2REOA 4G9GA 5GVRA 4EIWA 2C0QA 3BDIA 3WAGA 2AOTA 3TLCA 4JUBA 2EJBA 3FYUC 3ZQ6A 4BBAA 3KQLA 4MVJA 5A6SA 2C5BA 2Z2YA 2D1TA 3AJRA 3RWOA 1U0FA 2BZGA 4BO2A 2POQX 1Y5LA 1ZW6A 3LLVA 3ROXA 4D0SA 3WFIA 5A05A 5GZ1A 4LV5B 2VNJA 4YMUA 2JCVA 5C1BA 1Z16A 1V16B 3IFSA 3T5TA 1SZDA 3TQIA 2F3TA 3EZ9A 4R2LA 5C4MA 5ED4A 4N76A 8MHTA 1FZQA 2C9OA 1D1PA 2BT4A 1S2LA 3EYAA 3KT3A 3TLBA 4PX3A 5FNVA 3UWDA 4DUPA 1JHXA 5HIMA 2C3OA 3HCNA 4MV7A 1Q12A 2QN9A 4PFJA 1U1DA 4Q1DA 2YJ3A 3DAYA 3R7WA 5I9BA 1H22A 1W76A 2NUTB 3HDQA 2ZRAA 4ZAGA 2IOFA 1QF7A 1V1RB 2EATA 2DLNA 1OYOA 4DUGA 5D7BA 2I6SA 1B6TA 3EGOA 3GQBB 2X58A 1KK2A 4HAYA 1ZY2A 4ITRC 4KIGA 2B8EA 4DPKA 2HXYA 3IOEA 1G60A 3MTQA 4JYMA 1AKMA 3GA0A 2FFJA 1QHIA 1ZL2A 1M73E 4JL5A 4IFTA 3DLPX 4RH0A 1UFQA 4ZAVA 5BW8A 5DCUA 3NEYA 2ZIEA 1GQOA 2A14A 1A7KA 2WAYA 3EIXA 4FC6A 3RRJA 4PGMA 4FHDA 4XQ0A 5KHLB 1OWMA 2RHOA 1CLUA 3CF4A 3LHSA 4G23A 3QXSA 3W2IA 2DC1A 2RGUA 4HMPA 1KDZA 4DUGD 2ZJ7A 3PUJA 2LUOA 1G21E 1VE3A 2PGXA 3H7AA 3ND6A 2YY6A 4A0SA 4TLEA 2DWQA 4J9UE 4GYYA 4X97A 3OTHA 3IPXA 4FW8A 4A8PA 2CL6X 1GIAA 3EHDA 3R8CA 3CPHA 1AUOA 2X4DA 4M0DA 1FW8A 3SS9X 4P2BA 1AY0A 1N6IA 4F6CA 4D4LA 5BPHA 1NF2A 3FFTA 1LH0A 5A4DA 3W04A 3LQYA 2Y99A 4UU1A 5TT1A 2XAAA 3WLOA 2BFDB 4OQXA 4TN1A 3SF8A 3ICOA 4TT3A 4G4SO 5K8CA 1JN0A 4B09A 1LCIA 3TE7A 1RM3A 4LV8B 2VTKA 5K8UA 2VYQA 2E18A 5K3AA 1CRLA 1TF7A 1YZVA 5P8WA 5JPDA 3PFWO 3FPAA 3UG6A 2WYIA 1LW7A 2QN3A 5CXSA 4KMSA 3CR7A 2QYOA 1QQAA 5BOSB 4YLEA 1WVGA 1WMFA 3NAZA 1MOQA 2GZ1A 3BMQA 1B8VA 2ZJOA 4MB0A 4RE5A 3DE3X 4M4SA 3FUTA 4AY5A 3UMRA 3V6LA 1IONA 4DLZA 4JWTA 3HB5X 2EDAA 3DBOB 1Z6PA 3LT4A 3K9FC 1MOPA 2W22A 5J59A 3VU9A 1EM6A 5IXJA 1Z56C 2CMDA 1KO5A 1RMTA 1XWIA 3J7TA 4H6PA 2OXTA 3WKAA 1KMIY 2A78A 4HFNA 4JZYA 5TEWA 4O8ZA 1SG9A 4HXFB 2FU5C 1TCUA 4L5BA 5FBZA 2LNDA 4BTLA 1QIHA 4H4DA 1A9YA 4RM3A 1OLXA 1T9ZA 4NK5A 4RPCA 3VR6D 1KSGA 3JQFA 2F3PA 2X9GA 1KAHA 1UWVA 3F47A 3FOCA 3P4UA 4V1CA 4C7BA 4DQLA 2IHNA 2CJFA 3LLCA 3QFCA 3GQVA 3PDUA 2OPBA 3I1FA 1VHQA 4KBFA 4H9GA 4HBGA 4MEAA 5F52A 4L4YA 4W4TA 1WMAA 2M6LA 2GZ2A 4RACA 1B2RA 1U3TA 4YI3A 4DIKA 1I0ZA 3PQDA 1K89A 3PNSA 3QIAA 3T1HB 1P31A 3D8HA 1BGVA 1NT4A 1SU6A 1YUBA 2ZYTX 3EE6A 1W93A 3PQ3A 4TM7A 1YQGA 5HF9A 1FDUA 5B4TA 2HAEA 1TJ4A 4JR2A 4Z54A 4LF8B 1WPGA 3TRKA 4EZEA 1AC5A 2D00A 2WM8A 4DZRA 3O95A 3S40A 1KJ9A 1AKTA 1SQ0A 5TVKA 2O7SA 4ZEOA 2RK3A 2AJDA 3WIBA 4CL0A 4KXFB 4PX5A 1FFWA 1YS9A 1XD2A 2QE7A 1LPOA 5G4KA 4IXNA 821PA 3G0CA 3V42A 1CR1A 4ER3A 1LVUA 4PWZA 4Q5IA 3T4EA 3KYCA 1JDJA 3IS3A 5EZYA 1P73A 2YX1A 4LBYA 1WQ1R 5IF9A 2R11A 4Y1RA 5I9MA 5T8KC 4DCOA 2FEPA 4UNRA 1J07A 3E3MA 2K87A 3TIIA 2QRHA 2O50A 1FDTA 3NLLA 1TLFA 4JX9A 3O8DA 3DAGA 5K3BA 1N7JA 3WGLA 4H7JA 1SVNA 2RGBA 3HBJA 5SY9A 2GJ9A 1YKGA 2Z58A 4I4IA 3VRHA 2IV2X 1ZFNA 5FKJA 4D9CA 2OTCA 1QV7A 4M53A 3SGLA 3VPGA 3L6BA 1W5BA 2YVAA 2QRGA 2Q8NA 1PEDA 5ECWA 4XDGA 5EXTA 4K9OA 4QYXA 1BKDR 3IP3A 3ROZA 1DEOA 2XE8A 4FHGA 4N0DA 3SMQA 3IEXA 5FPPA 2ZBUA 3U4GA 9LDTA 2DGDA 1ODKA 4A0GA 5DOVA 5KQGA 5JS7A 3PYXA 4NCAA 3TDNA 2H1IA 3EGWA 3L7NA 5KDLA 1JJIA 3FFBA 2BEKA 5E4JA 1JEQA 1OV4A 2VDPB 3DTYA 3OCJA 3DVAA 4GP9A 4M83A 4DMRA 2VQDA 4OJTA 4L72A 1SC9A 2GCEA 1JU4A 1QXSA 2VT3A 1F8XA 3PS9A 4YC7A 2B6NA 2VL7A 2WU4A 2IH2A 1VB5A 1Z4LA 4JHLA 4IG4A 4RSRA 3HRKA 1GA4A 2GSDA 4U7WA 3EEOA 3RIMA 4KKVA 2FR8C 1I14A 1S9HA 13PKA 3I9V1 4QPNA 4AS3A 4DQUA 1MNAA 1SFRA 4N65A 1TKBA 3KXIA 3LS2A 3QEAZ 1M7BA 4AQYB 2OXFA 1FJXA 1EFTA 1W0KA 2IP2A 1R4ZA 1QONA 4MYCA 1W4CA 2P2YA 4GM1A 5JO9A 1T9DA 3MRXA 3N74A 3NTRA 4BEWA 2C5AA 5LOVF 1K08A 2HLPA 3KT0A 1SU7A 3OT4A 3UNXA 5LXTA 5DHAA 1ABBA 1RAHA 1XNHA 4NV0A 3T5CA 3UCXA 4EW3A 2GHQA 5DN6A 3ZD7A 3INTA 2HO5A 3T41A 5CT6A 1W6RA 4JC4A 2MU1A 2HWXA 4FE3A 3SVTA 1YB1A 4RULA 3LKDA 1X3LA 2YJ6A 3FTCA 2B30A 1KTVA 1ZN8A 3KNZA 4U3JA 5D6OA 3I8OA 2V55B 4J4HA 2UU9B 3BCSA 4QUHA 3M6AA 4MS3A 1AKUA 3M6VA 4BHTA 4F1KA 4QC2A 1QRRA 1PT6A 1YOVA 4J2OA 5CB4A 3PD1A 3DEZA 5L7YA 1WSBA 1AJEA 3STWA 1TCAA 3D3KA 2J46A 3GLRA 3VV2A 1DFHA 3N3AC 1K9VF 1SIUA 2H1RA 2HX1A 1GNLA 1S2NA 3D8UA 3JD3A 3LQ4A 1U2GA 1U90A 5MDHA 4FFBB 3FDZB 2B4KA 3NDRA 4WN9B 4XIFA 2PKQO 4DGQA 4FWBA 3QH4A 1DEHA 2JGNA 1YJAA 2YJNA 2F67A 2W5UA 5DX1A 4IIGA 3T1TA 2X8LA 3NYQA 1QAOA 5DX8A 3B70A 4YUZA 3V34A 2F4NA 2FZKA 3A9TA 4TMYA 3MAAC 2WOOA 5AVSA 3ZY4A 2WSSA 3RFVA 1QMGA 4CKCB 2WB2A 1Y5MA 2PFGA 1SD1A 1QDLB 2OHOA 2IELA 4YRGA 3F49S 5GWXA 1DHTA 4I36A 1UMBB 4PV7A 4ZV9A 1RXSA 3KTFA 4NH0A 1WW3A 4WDQA 5GP1A 3TCNA 2AVDA 2DFTA 3A2LA 2WJPA 3B1JA 2O3JA 4LZNA 5DYYA 5TV2A 5BSUA 1XEXB 1I3CA 3M33A 4XLTA 4BVJA 1U2ZA 3TVDA 4ESEA 5KC9A 2OV6A 4IUCS 2ZBEA 5C5IA 2HMTA 1CNMA 5DYNA 3L7IA 4L0DA 2ZT8A 1HMYA 3D7RA 3K4QA 3QMWA 1P4AA 1C9DB 2AQKA 3CPJB 1JPUA 4KQ1A 1YJQA 5CYFA 2ZS7A 3IQFA 3FYTA 4TZ6A 3FYUB 2YRXA 3LZ6A 5F21A 1A76A 1PNVA 5ALHA 3VYWA 2C9CA 1ECBA 3W3AD 2WJGA 2R6CA 4X1KA 4K9QA 3CKYA 3ZWOA 1B00A 2VP9A 1I6MA 3CUSA 4JITA 5FUQA 1SUEA 2CCKA 2PH3A 3BH7A 2UVQA 3TNDA 2HJSA 4QUBA 1Q0ZA 5ESRA 4CW7A 2VUHB 2OR3A 2W6PA 4TLLB 1C7ZA 1X39A 2ERXA 1KPGA 1VLQA 4J0IA 4ARZB 4DV0B 2BEUA 4IGAA 1B16A 3AX6A 3ONDA 1J7KA 1WMEA 4J0HA 3X1XA 2PH7A 1D2MA 5KS2A 2GXQA 1DV1A 3N8HA 4IJWA 3QYAA 4WJZA 1C8BA 2H16A 2WE7A 2R1UA 4YRTA 2AR7A 4E08A 3F78A 4Z4FA 3LTEA 4YBRA 4MR9A 1UBCA 2P0EA 1BTOA 3QLUA 5CFMA 2GBPA 4XB2A 3SXUA 1EWQA 2GR9A 4AKTA 1NVGA 4S2EA 1SIWA 3EF1A 3V2HA 1YR1A 2HL6A 4MWZA 3N0VA 3WWOA 4DVJA 3ROMA 5AUOB 5EWMB 3E4DA 5IF3A 5J2UF 3WWPA 1U2DA 3MQ4A 3OC0A 4K6CA 4MQBA 2Q41A 4MWGA 1Z0FA 1BFKA 2FQWA 3IHLA 2O8BA 4J4TA 4XFDA 4I2NA 4PC2A 3VSCA 2H31A 3NG1A 3HQ4O 3O4RA 4KLRA 5TR9A 1I3KA 3W4JA 1QUEA 4C6TB 2WI8A 4QTUB 1OY1A 3OZ7A 4H3KB 1NKVA 4JQYA 1JS1X 5LIRA 3GH3A 3S6JA 4E1AA 2CUZA 4ALLA 2HQOA 3FR7A 4LHVA 1DEAA 4MW9A 1ZOPA 4Y1GA 3VSDA 5BW4A 5J1SB 1HTTA 4TWIA 1EUCA 1DBPA 5D3ZA 3JASB 1NBMD 1BEEA 4MRNA 4GF5A 3JQAD 2Q9CA 1U7UA 3TTUA 3MHTA 4PHHA 2WP8J 1R8XA 1E2DA 4N0QA 3TLMA 1PBTA 1U02A 3WVNA 4KYVA 1K75A 1ZOOA 2PXAA 4DIOA 1H9BA 1WS6A 3FJYA 4LSGA 4D1YA 1ZPDA 2XUDA 1OPXA 1ZG3A 3IHTA 1IUNA 4JQZA 3H1EA 4ABYA 4EJSA 4K9MA 4W1RA 1PG0A 1ACJA 4IHQA 1UK7A 5KTMA 3GAZA 3CUUA 2PBFA 4FOOA 1LTQA 5SICE 621PA 3TFOA 3R6WA 5JAQA 4AYTA 1OI2A 3FWHA 4P22A 4D9JA 5FOQA 5JY1A 5LQKA 2DF8A 1Z63A