3TOVA

The crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
SNAMELDYKRIVVTFLMHLGDVILTTPFLEVLRKAAPHSHITYVIDEKLQQVMEYNPNIDELIVVDKKGRHNSISGLNEVAREINAKGKTDIVINLHPNERTSYLAWKIHAPITTGMSHFLFRPFMTKYTRLDRKTRHAADMYINVLEQLGVTDTSNSGLHIEICEEWRCQAQEFYSSHGLTDTDILIGFNIGSAVPEKRWPAERFAHVADYFGRLGYKTVFFGGPMDLEMVQPVVEQMETKPIVATGKFQLGPLAAAMNRCNLLITNDSGPMHVGISQGVPIVALYGPSNPFFYGPYQAHAIVLETMDSYEIGKSMKKIIKEGNYKGLSVISEEQVIKAAETLLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Glycosyl transferase family 9
publication title The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008
rcsb
source organism Veillonella parvula
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01075 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltransferase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3tovA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3tovA01
2X0FA 1WV0A 1AXRA 2ACWA 3OKAA 3ZCVA 4EJ2A 3GUHA 3CUUA 4GPBA 4L22A 3MT9A 4RELA 1K08A 3NPAA 1BX3A 3MS4A 3ZCQA 1H5UA 1FTWA 3S29A 1YGPA 3T5TA 1XKXA 3OTHA 3G2KA 4N39A 2H1HA 3NAZA 3E3NA 1NLMA 2XCIA 2QN2A 4KQ2A 3UYKA 3HBFA 3FROA 1Y6FA 5IKOA 3BD8A 1P2GA 3BD7A 4GYWA 1JIXA 1FU8A 4RBNA 1NOIA 1Y6GA 4F96A 4RENA 1JG6A 3CEMA 2F3PA 3CEJA 3CUWA 4RIFA 2QRGA 3SYRA 3WADA 4RIEA 1A8IA 1FU4A 2VSYA 3VDNB 3DZCA 2R66A 5DXFA 4MRAA 2FETA 3BCRA 2HY7A 1Z6QA 3RSCA 3NB0A 4RIIA 5TVGA 2XGSA 3OKPA 1VGVA 4KQ1A 3RHZA 4WHMA 1Y8ZA 2BGUA 4CTMA 1NOJA 1E1YA 3D0RA 2GJ4A 1P4HA 3NC4A 8GPBA 2X6QA 2P6PA 4EL0A 3NCHA 2YJNA 3L79A 2G9RA 1YA6A 2XGMA 5DLDA 2ACVA 4GZ3A 3NP9A 1SXPA 3S27A 1FS4A 2QN7A 2X6RA 3IA7A 2OFFA 1WUTA 5D00A 2JZCA 1XL1A 1L5RA 5D01A 2QZSA 2QN1A 4EKYA 1ABBA 2AW3A 2PYDA 4G2TA 3T3IA 2GEJA 1F6DA 2PRIA 1FTQA 3MTAA 2VCEA 3L7AA 3CUVA 3GPBA 3MS7A 2F3SA 3L7BA 4WADA 2QRPA 3BCUA 4NESA 1WV1A 1J39A 2QN3A 1UQUA 2BGTA 1HLFA 1P2BA 2GT1A 1B4DA 4X7RA 4XIFA 1GG8A 4FZRA 3T3HA 5TMDA 3H4TA 2IV3A 4AY6A 4F97A 1XV5A 2FFRA 3OY7A 1FU7A 4CDRA 1L5VA 3D0QA 3PE4A 2C1ZA 3DD1A 4MI6A 3WC4A 3CX4A 2AMVA 5JTTA 3MT7A 3QKWA 2IV7A 3CV3A 4AN4A 1C3JA 2Q6VA 3NP7A 3HBJA 1Z8DA 1JG7A 2IEIA 1NZDA 3PE3A 3MRTA 1L5SA 4BQFA 4N9WA 1PYGA 4MI9A 1EXVA 2AV6A 3RT1A 4YI3A 9GPBA 1FC0A 1PN3A 4LEIA 3E3LA 3G2NA 2IUYA 4N3CA 1EM6A 3Q3IA 2F9FA 1WW2A 2GEKA 1P4GA 3Q3EA 2C9ZA 2PQ6A 4NEQA 1QKJA 3VDMA 3QHPA 2GPBA 3G2JA 3MS2A 2KS6A 2QN8A 4XI9A 3TOVA 1L5WA 2F3UA 4CTOA 2ECPA 2VG8A 2QLNA 2XMPA 4BQIA 3BDAA 2XCUA 1C8KA 1GPBA 3CEHA 3EBOA 3BCSA 2FF5A 1XOIA 2ZB2A 2SKEA 2X0DA 3COPA 5IKPA 4QLBA 3MSCA 1NZFA 4GZ5A 3HBNA 1XC7A 1C50A 1JIUA 4PQGA 1LWNA 4EKEA 3MT8A 1LWOA 3MTBA 1L6IA 2ASVA 3O3CA 5HXAA 1NVKA 4MHSA 2IYFA 4MICA 4YUAA 2BISA 4BFCA 1RZVA 4HLNA 1GFZA 4FKZA 2H1FA 2C4MA 4WACA 4BQEA 1V4VA 2ATIA 2SKCA 5TMBA 2G9VA 3OTGA 1O6CA 1E4OA 2PYIA 4LDPA 3G2IA 1UZUA 3TSAA 2QNBA 1JIVA 1NOKA 2IYAA 4NC9A 3OT5A 5JTUA 3IAAA 3L01A 1RRVA 1XL0A 3MRXA 3TAXA 2R4TA 2G9QA 3L7CA 1PSWA 1JEJA 3OKCA 2R60A 3S28A 2XA1A 1PNVA 5ENZA 2GPAA 2IEGA 4MI3A 3ZCTA 2SKDA 3AMVA 4AMGA 3C4VA 3CUYA 3DDWA 2VSNA 4CTNA 5GPBA 1GGNA 5I45A 5LQDA 2R4UA 1K06A 2QN9A 1M5RA 1L5QA 5TMEA 2QRHA 4M83A 3S2UA 4F9FA 1AHPA 3ZCSA 1GZ5A 1IXYA 4RIHA 1QM5A 4M7PA 3ZCRA 1UQTA 1Z6PA 1RZUA 2XA9A 1L7XA 2C1XA 4Z5XA 5DU2A 3DDSA 2XGOA 4M60A 2AZDA 3E3OA 3OTIA 4GYYA 3Q3HA 1P4JA 2O6LA 4REMA 4HWGA 3MQFA 2QRMA 4W6QA 4MHOA 3MTDA 3T3GA 3CUTA 2XA2A 4AMBA 3ZCPA 3ZCUA 3C4QA 3S0JA 3C48A 2QRQA 1KTIA 3MRVA 3OY2A 5C1DA 3G2LA 4EL5A 1P2DA 3T3DA 4KQMA 3SYMA 2BFWA 1FTYA 3RSZA 2QLMA 7GPBA 4X7MA 4GZ6A 2IW1A 1FA9A 3BEOA 5BNWA 2VCHA 3WAGA 3BD6A 3VUEA 2G9UA 4X6LA 1WW3A 1GPYA 2F3QA 2X0EA 1P29A 3T7DA 1WUYA 2WTXA 3T3EA 4RIGA 2R68A 4X7PA 4N3BA 1IIRA 1SXQA 3HBMA 4YI5A 2QLLA 3L7DA 2GM9A 2GPNA 3G2HA 3VUFA 2JJMA 1Z62A 1C8LA 4AY5A 1GPAA 3EBPA 3H4IA 1F0KA 3MBOA 6GPBA 3UYLA 3D1JA 2JLBA 2PRJA 4N3AA
chains in the Genus database with same CATH superfamily
5EEHA 2H5IA 4F4JA 1LH0A 3OKAA 3BTVA 5JCJA 1U90A 4LF5B 3WL7A 2IS4A 3UGTA 4H18A 2AOVA 1ECPA 2RARA 2M2IA 2V65A 3EC7A 4XIIA 3R7DA 3RWOA 1UFKA 4UHDA 3BQ9A 4ZJUA 1T2DA 1E5DA 3FY4A 3HFRA 3HVJA 3L8ZA 1JTVA 3LL7A 4DBZA 3GO4A 4OJYA 2IYNA 4JYMA 2WSIA 4GRDA 1JHQA 2I8CA 3D7RA 4I8XA 5HF9A 4ZPXA 3VO2A 1O6FA 1I5EA 4WKCA 3NPAA 2QVGA 1VE7A 3DH0A 1IWPB 5KYUA 5CFQA 1Q7RA 4WOJA 4IDCA 4OQYA 2NZWA 3VDRA 4DRXA 1HURA 5F7JA 4PZDA 3D6HA 3D6UA 3VDQA 3C6ZA 2DSTA 2B3TA 2I2BA 1V35A 1ABEA 5LCXA 3L7MA 1HXHA 2R11A 1VL8A 3OPVA 4JHXA 1KVUA 1J9ZA 3DXYA 4MGEA 4N39A 4UUAA 2WP0A 3DEZA 3H5IA 1B93A 2PIAA 4AO6A 3E3NA 4KVFA 4YPFA 2YZKA 4F5YA 3HKBB 4H7JA 1PGJA 4L8WB 2A1TR 4GXTA 3LFTA 1ZAKA 1XNJA 1TIKA 2A3RA 1LI4A 4I66A 5CFLA 5IMSA 3QXHA 1IZ7A 2I71A 1M34A 1IN8A 3DAOA 1QHNA 2FQXA 4EYSA 2OK7A 3K31A 5DF1A 3U4HA 1A7UA 3TLXA 2NGRA 3ZIAD 4EPRA 4GEKA 4MRSA 2GDZA 4BKPA 1WUHS 4Q4DA 2HK6A 3PUZA 4RV4A 4XJVA 1M2FA 4YJHB 3HB0A 3MOIA 4V0NA 3V8RA 4C22A 1ENOA 1IRXA 5B2EA 3HDGA 3C85A 3KEQA 4I1VA 4D3DA 4H35A 2HRZA 3ANXA 4GDMA 3SR0A 2JI7A 5CA1A 2Q07A 2O52A 2E48A 1FNCA 1J8FA 2X7XA 3OZWA 2F2TA 3IDAA 3PQ2A 2D0OB 1C7ZA 2FEMA 2HY7A 2TMDA 4ZRNA 1GLVA 5FBHA 2OFWA 3W5AA 1K27A 4YRJA 2ZJ6A 4CWAA 5HKKA 1LNZA 1MA3A 1RJFA 2CMHA 2XUDA 1AA6A 4D5EA 5M29A 3TD9A 2VRNA 2OCYC 1QF7A 2ZLBA 1GCOA 3LX4A 4RD2A 1Q5PA 5JYCA 4IILA 1AGXA 2XRMA 2Y2UA 4C29A 4EY5A 1UK9A 2RHGB 3KCQA 5M3BA 4CM9D 1N2HA 2OGUA 2TYSB 4K9LA 4AO8A 1B26A 2X0NA 4RMJA 3N87A 3K6SB 3OFVA 3PFBA 1QANA 1XZMA 4P22A 5FOVA 5KS2A 1ZKMA 2I66A 2VK4A 4XUDA 1P4HA 1YBHA 2P4QA 3I8OA 3KVVA 4BDSA 4O25A 3FG9A 1B0AA 4OI1A 1N7GA 4X6XA 4I3GA 3PRJA 4QUBA 1QGED 1QK5A 1R8YA 4FNOA 4LC1A 1GUZA 1PL8A 3GVXA 5CVTA 3L79A 1AKVA 4P3PA 1EWQA 1JKIA 1BWRA 1I51A 5DZSA 3R0XA 4PO1A 1L4LA 1HYHA 1RHKA 3JZDA 1N0UA 1P3DA 2X40A 4KQXA 3U7IA 5LQAA 1QWOA 4LVCA 4J1SA 5D86A 4MROA 1J97A 1XFDA 3P9SA 4UU7A 3QXXA 2ERCA 2RHWA 4EYQA 4X90A 1UP7A 4M36A 1YI8A 3U7QA 5E0KB 5ALQA 1S1CA 3HVRA 2EJTA 3OCYA 3PCRB 1XL1A 5ELXA 4RF5A 1L5RA 2QMOA 1ENZA 1C80A 5L53A 1JHOA 1QXSA 1VL5A 1J5XA 4GGMX 4V0OA 1ZD1A 2WWTA 3IDSA 5LP6F 1IC6A 3K9CA 4W1PA 5F35A 3ESRA 1ABBA 1IL0A 4XJXA 4BFSA 2G9ZA 2PGNA 4ZI7A 2J0UA 2V5VA 1YDMA 2CMGA 1IDOA 2MYUA 3K0BA 3K92A 4Y2JA 4PIMA 3GVHA 3EEFA 3MB5A 3IERA 3PQDA 3K9NA 4GWLA 4ACAA 1GPLA 3B9QA 3FF1A 3PJDA 1CE8B 4JXKA 4OAOA 3H5AA 2P30A 1BRMA 2X13A 1W5AA 5FUWA 2YY5A 3MS7A 3PNLA 4MRNA 3RG8A 3SNHA 3TLYA 1HQYE 1OIVA 4S2EA 3WBKA 5AUOB 2QRPA 3T9DA 4HX2A 4X1YA 4RFSA 3GLFA 3QE4A 4LY0A 4U39A 1EFHA 3CNLA 4Z3DA 2OSBA 2Q3JA 3DCYA 4IHJB 4PQYA 5DBHX 2JGAA 4KAAA 4AKSA 3B8HA 1USIA 4OGKA 1KOLA 3V9AA 1P4RA 4F6CA 1N2EA 1RWXA 2V7QD 3LHFA 3B5JA 2ZFUA 4F5DA 5DP2A 1JE0A 4RA6B 4EW1A 1PT8A 1PQYA 2WC1A 4IKPA 5FTJA 3GLQA 1NR1A 4WASA 2NSHA 1SRQA 2BFEB 5THKA 2PVCA 4BASA 4HDKB 4EBBA 1FFGA 3A4IA 1C3OB 4DDUA 5KCZA 2C97A 3UJ8A 2JHAA 3WWOA 1RBMA 3G3EA 3QEMB 1MCZA 3JCZA 4L8VA 5EC8A 1T0IA 2QPOA 5EP2A 3BQNB 3RUIA 4RV5A 2WD7B 1J56A 1UPFA 2CLMB 3RTGA 4ZEVA 3D4IA 5C18A 4CEHA 3AUJB 1U8XX 2FFRA 3PFWO 1J24A 1BMTA 1IZZA 3FYHA 1FU7A 4X8MA 1EXNA 4XSGA 5FTMA 4PNZA 5YASA 5CK4A 2Y6UA 4D56A 4TRRA 4JEMA 3Q0EA 5JSQA 2ARKA 2PMDA 2P4SA 4RK4A 1IULA 3GROA 2PKEA 2ZRMA 3WGLA 3FFBA 2WTAA 1KQOA 2WFAA 121PA 1U0SY 3SNKA 4DOMA 2Z6VA 2VVTA 2FWPA 3A0UA 4AN4A 1UFOA 5EHXA 4DVGA 5FTNA 2FAXA 4P4UA 2DG2A 5KNBA 3AHIA 1B8OA 3ZU6A 1A98A 1FMLA 5BN5A 3DVSX 1IIBA 1DI0A 1VYTA 2FY8A 3I64A 3LY8A 3NIFB 4QD3A 3WGNA 3QELB 5AKGA 1GL3A 4FD2A 2ZAMA 1E96A 1LPSA 2B6NA 2PMEA 5DNYB 1ONNA 2PKXA 2FDRA 2QVZX 3GJ5A 3L0ZA 3GLGA 1Y7IA 4M1EA 4G01B 1R7RA 4G24A 1PS9A 3W04A 2MSWA 2VO1A 4DABA 1GZVA 2WUGA 4MRMA 2HQ1A 5D1HA 3OFNA 4S1NA 1NRJB 3GGCA 4JV5B 1W1UA 2AG8A 1PYGA 4O4JA 4EUFA 1AJEA 4P58A 4DE5A 4QPPA 1R5JA 3RT1A 3EULA 4BRSA 1U2RA 3I6BA 1EJ0A 4QTTB 1Q1BA 2VJKA 4RPJA 1N9ZA 4LEIA 3WK8A 1Y7LA 2FXVA 1HH4A 2Q5EA 1UM9B 3BHIA 3NV7A 5C81A 5IN4A 3WLNA 5L3SA 3K9FC 4OK5A 3UK0A 4CM4A 3H3XA 4RS3A 2BCGY 2POQX 3THWB 1UBTS 4WZAE 1C7IA 1KAHA 1A2QA 4RXUA 3RI3A 2IUYA 5DKFA 3KQWA 5JNVA 3QWBA 2R7MA 5TQ2B 4AJOA 3ELWA 2GEBA 1P4AA 1J07A 1RP1A 1XSEA 2EWMA 3A14A 2PQ6A 3N2EA 4NK5A 5EXPA 4BJ3A 2NU7B 1KK3A 4OP3A 3PDCA 2QB5A 3HRKA 5CEFA 3WTCA 1W7AA 4IMJB 4AJJA 1A8UA 2A1UB 3CR7A 3NBKA 3TZQA 3T4PA 3PPYA 1MJNA 2AJTA 3IUJA 3LP8A 4RVFA 1R0CA 4Q24A 4B87A 4CM6A 2F59A 2NTVA 5TEWA 2Y8EA 5DT9A 4F4DA 2KJQA 2ZATA 5KQSA 3MWFA 4TL8A 1G98A 1J2TA 3H5OA 3UT0A 4HAXA 2CNKA 5K20A 1FBTA 2RCNA 1AOXA 3LHIA 4MQEB 2WYUA 5FNVF 2XT6A 3MC1A 4CTOA 4GPD1 3ZBPA 5JAQA 4DKXA 1P39A 2B37A 3H9BA 4L6IA 3Q3GE 3QVLA 3DF9A 2VHXA 3TLBA 3ZK8A 2Q41A 4EHNA 3BWBA 1JJ7A 5E4YA 3KXIA 3C7DB 3SPXA 3DBHA 5CCBA 1M0WA 3PB3A 2P9TA 2Q5IA 3DTVB 3OOHA 4FGUA 4FYVA 4KXLA 4UHKA 5CXXA 1XVTA 3ABZA 1RZRA 1NNEA 2JI4A 3B6JA 1CXZA 2JHGA 3NX4A 4PQGA 4FYKA 4R9SA 1V8FA 1GZ4A 1U1IA 3VVLA 4US0R 13PKA 1ORDA 3HXPA 1H4VB 4FZJA 3ZJTA 2SCUB 4ONEA 1D2MA 3AVUA 5C35A 2IUUA 1S9HA 1FFSA 1HR0B 3KUXA 4Q1EA 1ZC4A 5HF5A 3Q4GA 4HGQA 2OO5A 1VE1A 5F2EA 1EGMB 3HDYA 3ITKA 1L1RA 3GZTB 2PO7A 1CR2A 3AERA 4HYEA 4IDHA 3GFVA 4FKZA 2G5GX 1OV6A 3PP8A 4LDAA 4PX3A 3WVNA 4J94A 4XQGA 4QLAA 5BR1A 3OQHA 1FFYA 1R4MA 5JJLA 1H94A 2ATIA 3KR1A 4NMLA 3T1QA 2PE5A 1GFWA 4BATA 3LU1A 2P9FA 1LGYA 3EIQA 3PWZA 2ZUEA 4PFKA 1FDIA 2WIAA 3VVBA 1XCJA 4WT7A 3UMMA 3L4EA 1BMFD 2PU5A 1E9DA 2HA6A 2X3FA 3FWKA 4RYDA 4UVGA 3VFDA 1MQ9A 4W7IA 1N5OX 4FGKA 4X3PA 1Q77A 1QIIA 3OQ6A 1AXEA 2C2ZA 1QOQB 4PQEA 4G0YA 3OE7A 4HVAA 1Z6YA 2O2ZA 2X1VA 3L0BA 1EFVB 1V25A 3C3YA 3EASA 3TAXA 4D41A 3TTUA 1EDEA 2R4TA 2XNSA 2ZE8A 4NOKA 1YKSA 5LJIA 4DBLC 3PA6A 4PGAA 4RDXA 1RMQA 5JAUA 2W93A 2MSLA 2QTLA 2HBRA 4MDFA 1HZZA 1YCGA 1J8QA 3ED5A 3MOGA 3AVYA 4PG4A 1GQSA 4L15A 2FUG1 4MJLA 1OE0A 1DXQA 4FC6A 2XB6A 1D0SA 5AM1A 2W2NA 3AI2A 2F48A 3QKSA 1IZ8A 3F46A 1IXZA 2JIZA 3EUFA 5IAKA 1FBNA 1V9SA 2XB8A 4ID9A 4AMVA 5I7WA 1QP4A 3HU2A 2B8WA 5ALRA 5TQ0B 5KQPA 1M5RA 4C3ZA 2EP7A 1QFYA 4JB8A 3EMBA 1XN4A 4O2BB 2QMUA 1YIAA 1G8MA 5E6UA 1Q83A 1FP7A 1Y3AA 2NN3C 2OZPA 3JQ6A 3ZIDA 4F9FA 2GZMA 4O1IA 4D9HA 5KWIA 2NVOA 3P9QA 2AKEA 4RQAA 4Y98A 3VO1A 1N5MA 3HA3A 1CP3A 2OBYA 2NP7A 1UZAA 1N25A 2A57A 3ZXSA 1KVQA 1SUAA 4C4RA 3ENWA 2F1OA 2VJYA 2V0CA 5DHQA 3VR5A 3ZBQA 4TMXA 4YVFA 3ZWDA 1D2EA 3EG5A 2WINI 4X3OA 4HWTA 1UBEA 4AP9A 3I09A 2TS1A 2JVJA 4W5RA 3HZRA 1PZMA 2JHFA 1XUOA 4IJKA 2FHSA 3W77A 4MPJA 1G5QA 4H7IA 2QAIA 1BDJA 1HNNA 2XA2A 2QL6A 4PF1A 1E1RA 1JIKA 3ZKAA 5I7OA 2XIQA 3VYVA 3RTAA 2AK3A 5AVYA 2R00C 2H1OA 1E61A 2H2HA 4PTZA 5LYJA 2SBTA 4FVTA 5CA1F 1GY8A 2O9JA 2P69A 5DULA 4U9HS 3PLAE 1XEAA 1TUBA 3DL2A 4DSOA 2VEOA 3MYYA 4MV1A 3G5MA 4NAUA 4BBAA 2X0JA 4GYJA 2OYRA 3O8QA 2FFHA 4GC9A 4TLLB 2EWVA 4WUVA 5LB2A 1QVVA 1NI4A 1RYNA 2VPPA 2OO5C 3F98A 5CDSA 4G8DA 1HTBA 3V7YA 2D8MA 1VPVA 5JXIA 3WIUA 5CITA 4C4TA 1VL0A 3AF3A 4TLBA 2NTNA 5DM4A 4BMPB 2WF6A 2R48A 2W8BB 3DQQA 4YK7A 3RVRA 1G3RA 4P3KA 1AHNA 2MINA 3GI1A 3IFSA 3BTSA 1L7PA 2HA5A 1ZVQA 2E4WA 2QX9A 4HMPA 4NI5A 4J76A 5AOAA 4M4SA 4IRXA 3OX1A 5HCUA 3T15A 4E31A 2X14A 4KHPB 1BVYF 2QV0A 2Z4RA 2O3SA 1JKMA 4MAAA 3EZ6A 4D8YA 3AB3A 3B9PA 3CKLA 1TVKA 3EXEB 3T7AA 4QJIA 1DOAA 2ZIXA 4JUCA 4RVNA 5ITZB 1R27A 2WAMA 2ZJ0A 3KV1A 1V0JA 3TL2A 1YVRA 3AESB 4MVJF 4YXWD 1KEKA 3WQHA 2O2DA 1AVTA 4JJAA 1P74A 3I05A 2WTXA 3L40A 5CJ2A 4D9CA 2IWHA 1L7BA 4EIWA 3NWEA 3GX1A 4TYQA 3TLGB 4TTAA 1C30A 5K3EA 4FW8A 1ZH2A 1SO8A 3OCVA 4G0VA 4YCMA 5MFZA 3ZC3A 4FM9A 4ZCTA 1PV4A 5AVUA 1I2DA 5ECWA 3P8ZA 3ISTA 2CCKA 1T4BA 1LVGA 4QFBA 5HZHA 3NXSA 1Z62A 4IUYA 5ENDA 1XZJA 3PC8C 1UXIA 4M86A 5FOUA 5B2FA 8AT1A 1JEQB 3EF3A 4MPTA 2V6GA 2YJ5A 3QNWA 4DY4A 4ZI3A 3U6BA 1SKQA 3IUYA 5GVRA 5JIBA 1V9LA 2PRJA 3JYNA 4RTNA 3KPUA 1DRJA 1Z37A 4GMKA 4MA0A 2YCLA 4Q3KA 1II0A 5ALNA 4B83A 2DWUA 2XE7A 1Y3CE 3DD5A 2VT7A 3G79A 3LQ2A 4DMCA 1O6GA 1UBMS 1H8HA 2N3ZA 3GUHA 3PKIA 5ALLA 3WA7A 1SKYB 5LOVB 2O8BB 2XQKA 3JW8A 4BVKA 3OFSA 2C4NA 3KZVA 5FWYB 1ZN2A 2LR0A 5A04A 1LD3A 3ZWAA 4PZLA 3E5HA 3KU4A 3V3KA 5IVIA 3T7IA 1USVA 2EHJA 4CF3A 3GELA 2QA5A 4JQZA 1ONBA 5BURA 6REQB 1AT1A 1AO3A 1HOTA 3VR4H 1PQPA 3ZJYA 2B1RA 4RABA 3S29A 4CE6A 2NSJA 1O8BA 2GZ1A 1YGPA 4ABTA 2B2XA 4YUVA 2I8AA 4FYJA 5EJFA 1G20A 1OA0A 2KQUA 1EFAA 1M9NA 1NBWB 4DZRA 1I2CA 4D4KA 2WT8A 4NZOA 2E18A 2H4JA 4MUYA 1PZEA 4XJTA 3PXGA 2EYUA 3WK6A 3SF8B 1E0DA 2Q4TA 4DPLA 4NMMA 1I8TA 1R0XA 1MXHA 2PEZA 4KTVE 5KX5A 1QH0A 3Q41A 4G09A 3EJ6A 2HCRA 4INZA 4PM4A 1MAWA 3C14C 4KXNA 2GXUA 4FSDA 4XWAA 1Y6GA 4L3WA 1L7NA 3PI7A 2QTWB 1V7ZA 4G1CA 4X9XA 1EM8B 7REQB 1N34B 3IA2A 3E9ZA 4RENA 1USKA 1K4KA 4KKVA 1YR6A 4FTWA 4QTXA 4X94A 4M1WA 4QOGA 1XJQA 1QHHB 1TZCA 2Z58A 1XVIA 4RIEA 1ZW6A 4RTQA 2O8FB 1OFUX 4E33A 2RK6A 3MJEA 1W4RA 4JLMA 2AHRA 1QO0A 4IINA 4AROA 1X8XA 1N33B 3EFEA 3EUWA 4M99A 4A0GA 2V7XA 1V5FA 3DVAB 3L6CA 1JSRA 2QJTA 5SY9A 4Q9KA 1Z6QA 2E6UX 3H9CA 1TECE 4X0EA 1JZQA 5CM8B 5TPZD 1WAMA 2B2NA 2HLHA 4ENUA 3U4MA 1MR3F 1SUDA 2ZR8A 2B9VA 3EG9A 4GL4A 1R16A 1W2HA 3WLFA 1QH1A 1UXOA 4GR4A 2GHTA 4G5QA 2QU7A 4JVLA 1VGVA 3V4SA 4UM7A 3QMMA 4OXRA 2P9ZA 1ZH6A 3LQRA 3DE3X 3PHJA 1FP2A 3HEAA 1JF8A 1NU6A 2GJ4A 1V1RA 3GJ0A 3LQQA 3Q6IA 1E1QA 2IOHA 2IXFA 5T6MA 3TIVA 4D3SA 2P6PA 3DSRA 2H06A 4ZAXA 4PYQA 5FR1A 2JIBA 3LWDA 4MR9A 2GWRA 3Q8MA 3G5AA 5BMVF 5ALOA 3WLTA 1KNXA 1P9LA 2ISQA 3LXXA 3CCBA 1XD9A 1WJGA 2Z57A 4H27A 4FXPA 4LK3A 4RGBA 4AICA 4F4UA 1GAWA 1XHLA 2CXHA 1CP2A 3GLRA 4CGZA 3E15A 2GGSA 2OV4A 4BP3A 3A3PA 2BN4A 5DNCA 1R10A 1WUTA 1QYXA 3DUFA 3QHQA 3F4LA 3VVCA 3KKZA 3IUPA 2E9SA 4MKIA 4YQZA 4M88A 5KDDA 4W5NA 1AZWA 3B3JA 4Z9AA 2HLDA 3IBTA 1C3EA 3IUQA 4PIPA 3GJ7A 2G82A 3IB3A 4PTYA 2XIJA 3HCEA 3AU9A 4BFLA 3UJAA 1I0IA 3FTQA 4LOLA 4B75A 1EI9A 1K4MA 1ZINA 3EXHB 1GP2A 2QLTA 3WB1A 2ERYA 1SZJG 3V4FA 3MWYW 1TMGE 2PRIA 5IKEA 2WF7A 3OU2A 4KV7A 4TKMA 1FUKA 1C4WA 1NXSA 4JVSB 3S4YA 2RB4A 3GAMA 5LZ4A 2PSJA 2VBCA 5F3DA 1G6Q1 1U0FA 1X2EA 3I6QA 2EZ9A 1W9MA 3EGEA 4NESA 1M2VA 1CD5A 4GSYA 3IT3A 1J39A 1MB4A 4GLLA 1TYDE 4GOXA 4QQKA 3JZFA 2RH8A 3M81A 3PNVA 3INGA 1OOEA 1KP9A 1T2UA 1Y1QA 4PSKA 5SZKB 3ANSA 4LHWA 3NHRA 1ECGA 2NNLD 4R01A 1B41A 2QPTA 2I99A 4C89A 3U80A 2PUBA 1B2RA 1O7JA 1URPA 3KU1A 3PCTA 4NOLA 5DMXA 4HNRA 1QAOA 1N6OA 5FI5A 1ZNZA 2WSYB 2Y0PA 1E2QA 2NUTB 4M53A 4FZ3A 1W4LA 2DZDA 2JH3A 2QTVA 2Y3IA 3H9GA 3QTTA 4L8FA 1H9BA 5A2QA 4K1LA 1JXOA 4CG0A 1IQUA 3G9TA 4KKXB 3O92A 4PW0A 3HB4X 5CDUA 5E2BA 2I1WA 2EKDA 1H2RS 4EUNA 2CBGA 4G26A 4YRRA 3X3HA 2J3HA 2YFQA 4KOEC 3TINA 1MJ5A 4IF4A 5L95A 3CY6A 4IQ0A 1XFAA 1J8VA 4P80A 1UJNA 3WHKA 4PYIA 2DBVO 1G8SA 1F0YA 1YQUA 4TUYF 5E6SA 1OLUA 2FV8A 2QUKA 4YC7A 5IJ0B 4PS1A 3O9VA 3ZLUA 5TT0A 5F5LA 3ZS8A 3DVRX 3OE1A 2VK1A 3CX4A 1X15A 3QF7A 2AXQA 3AVWA 3H65A 5I9BA 1GTMA 3OJFA 3MYRA 4I1IA 4IS2A 4PCUA 2FSUA 4R3WA 3ORRA 4XIGS 5G4KA 4AMUA 3BILA 1FXUA 3U26A 2D1FA 3H0EA 2VHTA 1CR0A 2C8VA 1Z08A 1JBKA 1REQA 1GUBA 1IN4A 2O50A 3A1NA 2P3OA 3S1LA 3T9AA 5K0BA 1DBIA 4IO1A 2PL1A 1KZ1A 1VKRA 4GI5A 1RRMA 4NARA 1Z8DA 4I1RA 1NZDA 4JASB 4RD3A 4LYYA 1KSGA 3FMFA 3RT7A 4DC9A 2GILA 4F3CA 4UVDA 3M5WA 1Z5OA 1VZ2A 3DJYA 3I5AA 3K35A 2OK8A 3C1UA 1GGMA 4EW6A 4LXXA 9GPBA 4DZZA 1QCDA 1FC0A 1KH3A 3KFXA 4GLOA 2J41A 4OHVA 3UPDA 1TCBA 2Y67A 3EHDA 1DC5A 4Z53A 3TRHA 3A6PC 3NJ4A 4M8LA 4NZ9A 1X9GA 2VKQA 3WV5A 5F1KA 5LNK6 2JHCA 3TECE 3N53A 1SKBA 4LSWA 2IOFA 2FOIA 5HGJA 2DB3A 4M1SA 3U4IA 2QX8A 2CJYA 2VH2A 3BS4A 1I7SB 1GTRA 1M83A 2FN4A 3Q3IA 5HR5A 2P77A 3TW4A 1YVPA 3O3MB 1A8QA 4BL5A 1RZ3A 4WIAA 1JDJA 3NHPA 1U8AA 3QPBA 4OQ4A 4ZV4A 4CQMA 4JP2A 3KOWA 1DDGA 4RVUA 1G3IA 1UWCA 1L3CA 2XKBA 1MIHA 1DFGA 1JAZA 2C5HA 2TMGA 4MUHA 4M1MA 3PTZA 4LW8A 5KDOA 4OB8A 1UIRA 3OTWA 1SVIA 1JG3A 4ITVA 1C9DB 4EI8A 2NQ8A 2Z5VA 5C5IA 5BV2P 1WS6A 3WGGA 1YKGA 5I7RA 3OCJA 1QG6A 2WLTA 3F7OA 3FPCA 2HJWA 1II8A 2JJ1D 1M8GA 1GJRA 3GLVA 3UOGA 4A03A 3GRVA 3OWOA 3W9BA 3NOXA 4OM8A 6PFKA 2PHZA 3ZE7A 3EARA 4KH1A 1MPTA 4BQIA 5LR6A 1INLA 5HIKA 3FPEA 3ZE6A 2O4CA 2XCUA 4GZMA 3ZWKA 3KKQA 1ZH4A 4M9UA 4WZ6A 1G5HA 1P5FA 4DWWA 2AX4A 4JC4A 1FNDA 4BWGA 2X5JO 4ZMSA 1MB3A 1E3WA 3TRJA 1NJ1A 3IQFA 1DADA 2AOWA 1X8JA 1Y82A 1UJ2A 2OM2A 2OKGA 1VLVA 3W7VA 1PDVA 1UFRA 2H2GA 3CU5A 1H8EA 5BSUA 1W30A 4ENRA 2VJLA 4OJKA 1TK3A 4KIWA 4RLFA 4C43A 1OFHA 2XWQA 4TMKA 4OX9B 3WS7A 1GFIA 4UXHA 2W6JA 3PVSA 2BKUA 4QEZA 3W8EA 1PJ8A 3JQ8B 5DI3A 3DHYA 5A5EA 3GN2A 3NEYA 2WPNA 4CKEA 1OSNA 3P2YA 4MWBA 5AHKA 2ZTHA 5FBRB 2FFJA 4DJ5X 1P6QA 3QZUA 2AJDA 2QYSA 1I9GA 1SFRA 1SULA 1NLUA 2Q6LA 2WK1A 3AVQA 1YQDA 3EE6A 4NBTA 4OHWA 5A71A 4ER7A 5LP1A 2FUKA 3K15A 1MGPA 3F1KA 3E05A 2GCOB 2A4MA 3GT0A 3WGIA 4D97A 3OUTA 2VXBA 1FDVA 4US1R 4E3WA 1GA1A 4B3IA 3AHEA 3ZNNA 4Q9HA 3UOAB 2ZRKA 5CA0B 3N70A 3GMDA 4BAUA 4UULA 2L69A 3DHEA 5CVVA 2HREA 3DHNA 2C04A 3Q9NA 5LUBA 3J80A 3UCEA 3S7TA 2JAUA 5E1BA 4LZOA 1P6XA 4GX5A 5JNLA 1A9PA 1JFVA 2K87A 3ORHA 1KDVA 3PWTA 1OB2A 4JT4A 5B7NA 1J2JA 1XL0A 3BMQB 4WW0A 1FPMA 3INRA 1XRMA 4OXNA 1LW7A 1XT6A 4RF3A 4R1UA 4FZVA 4KSBA 4F2WA 2C4VA 1RI5A 1E1KA 3PNBA 1PD1A 2A14A 5SZHB 1M2WA 3TLCA 2QEQA 5T4FA 3KZMA 1YAHA 3UENA 4C5CA 3UW1A 4B3TB 1LLUA 3QFHA 2QD4A 3RS8A 3OOWA 4HNVA 5AJXA 2E37A 1TDJA 3L8GA 1W25A 2APJA 3JD3A 5EQDA 3Q7EA 4B48A 2C4TA 3KZCA 1BXRA 2CL6X 4P81A 1V11B 4F04A 2D5LA 2YUIA 2V6FA 3HPRA 4CI0B 4BAGA 5BOSB 4JUFA 4KWCA 5AKIA 4IOMA 16PKA 1UC4B 3O83A 5KWEA 1H1TA 3ETLA 4BO3A 3ZDCA 4A6XA 2C2YA 2EFCB 2J59A 4DQUA 1N9KA 2KE5A 2LKCA 1IBCA 5BW5A 3FDXA 4IFTA 2PH3A 5I7VA 4CQLB 3G9XA 2GMWA 3HJUA 2IBSA 2VEDA 3U9TA 4QVIA 2I5PO 3CSDA 4GRAA 4QDZA 4II3A 4HAOA 1HGXA 2BGLA 4NCHA 1KJIA 4QQRA 2J85A 1JV2B 1ODSA 2ZYTX 2IXGA 4CMGA 3K5IA 3W5CA 3WAKA 4C87A 1FW6A 4D57A 4TWZA 3VV3A 2IUEA 1YQWA 1CQWA 1HL7A 3SC4A 3S5JA 1TT5B 4ZZ1A 2PNFA 1JPNA 4YMTA 1DT5A 2Y0DA 1QKIA 2AW5A 2DSNA 2JGEA 1X7YB 3NHWA 1P2TA 2JIQA 5J2TB 4GYYA 4A1OA 4YJ2A 1R88A 1VLHA 3COVA 5F4ZA 4DDTA 1RKBA 1NATA 5H5JA 4Y8VA 4U5QA 5REQA 1FRZA 3ZH2A 2V7WA 5KNBH 1GT6A 4FMCB 5I8PA 3A7DA 5FT9A 5FPSA 1PT9A 1Z26A 4YRIA 2G8NA 3O1IC 3RC7A 1EVIA 4F45A 1XRQA 2FG5A 4I9NA 6ABPA 2Z6AA 4A91A 3CLVA 3CMCO 4KTTE 1ADBA 5D8DA 3C1OA 4P0QB 1GPWB 2YN0A 2H00A 4ZOAA 3V1NA 1JMKC 1GTVA 1CHDA 1XDWA 2G6BA 3HN7A 4LX0A 5IW8A 4EL5A 4P0TA 1QHEA 1GPDG 1VL1A 4RTRA 5IJAA 4PBRA 3D9QX 1NSTA 3RFCA 5ARBA 1KZ9A 2H1IA 1RYFA 4YACA 2ADMA 3TEJA 1A9ZA 2FW8A 3LUPA 1BHJA 1O97C 2H85A 3I2YX 1TNDA 3TFWA 4WL0A 3UHAA 3C5VA 3ESYA 4EVIA 1MO6A 1YRWA 2P68A 4I99A 4PICA 4K86A 1DIRA 2IX9A 1E0JA 1IUKA 3F5DA 3FF4A 3O8NA 1Q11A 2BM8A 3NQ41 2ZIEA 4PPQA 3WKCA 5ESXA 3SBDA 2BH2A 4L5IA 2P79A 2HOQA 1E1NA 4ETMA 3VUEA 4WBXC 2KBFA 5M34A 1FP6A 3CXRA 1JHXA 2ECKA 5EE3A 4PC2A 3OM9A 1Y5RA 4QICA 2GD0A 2W58A 3PX3A 2PL5A 1QLHA 3QXJA 1L8LA 1FP4B 3MERA 4XGNA 1O0CA 1QC5A 3I9JA 1NJFA 3BJEA 4NHEA 4P9NA 1U8CB 2FFAA 4HY3A 4O4IA 1G0NA 1U63A 3KOOA 5JQGF 1V4NA 1N4AA 2I9PA 2IGBA 1C3XA 4FHEA 4I4NA 1V5IA 3UBMA 1P7ZA 3AZOA 3BIXA 1JT9A 3LCCA 3F67A 4OHXA 3LYLA 4RYLA 1AMOA 3S1SA 3ND6A 5J4YA 1FNNA 1CERA 5EWMA 3ZDFA 3UUFA 4X61A 2ZRNA 1LQTA 5FI3A 4X7PA 5D7NA 3HBMA 1UAGA 4HK4A 3SDSA 2OPBA 4JP3A 3QKRA 5AIBA 3OWHA 1ECJA 4FNAA 3C74A 2RIPA 2B1QA 1RBYA 3LRPA 3RRNA 3SU8A 1G2IA 4B5KA 3HCRA 5JROA 1J5EB 4GDFA 4Y0NA 1UBSB 5A5VA 3TX2A 1E92A 1RS0A 3K9QO 3T5BA 4YBZA 1WRBA 2VDVE 3JQFA 8OHMA 1RTTA 2G9NA 2C9OA 3EBPA 2VHQA 2OXRA 1TJPB 5B4TA 2ONZA 2HBQA 4JENA 1IN5A 5AW8A 5GADl 1POXA 2ZETA 1HK7A 4JCCA 4TXNA 5C3MA 3RJTA 3FFTA 4OBEA 5BNZA 5ARDA 4Y6QA 1A76A 1UBKS 4ZV7A 4YREA 1MT3A 5IJZA 1MJFA 4NZYA 1YZHA 1DPFA 4B6RA 4ZO4A 1SHTX 1KQ3A 4WRRA 4CLOA 5IM4A 2ZSFA 2AD1A 3DQZA 4GPBA 1T9ZA 1O9BA 5ADVA 5BMOA 1XEWY 1ICEA 5F5NA 3U62A 1LTHR 4ZT7A 2PX2A 5IJWA 2VYFA 4QEKA 1OMOA 2WAAA 4R05A 1P1BA 3DFIA 3JQ7A 5AO9A 3EC1A 2C29D 3UQYS 4R2LA 3QFTA 1ZWKA 2NACA 3LOQA 1SXJD 4J07A 4NV1A 3O26A 1SZPA 3IHTA 4RVCA 5ALXA 3A2KA 2BKEA 5LA6F 1Y37A 2YN4A 3LZ6A 1ATZA 4LDJA 4AFNA 4TGLA 1BXGB 3NAZA 3FYDA 4RTLA 2C2WA 4IJMA 6CHYA 1YAJA 2ZSJA 1R6DA 2OB1A 3KB2A 2XCIA 3OZXA 3T5AA 4BNVA 3PKJA 3UMVA 2BFAA 1FFWA 3TRKA 6YASA 4KE9A 1V95A 4HJXA 5LZ5A 2Z9DA 4C06A 3PENA 2DWOA 4MVJM 1QDEA 2ZJ5A 3R7FA 1B42A 1FU8A 4LY3A 4U7PB 2XHZA 3EQ9A 5T8KC 4BJHB 4YTEA 1P4SA 2C7GA 3Q2IA 4C5BA 2VAVA 3MT0A 4N3GA 2P2CA 1PLJA 4MR7B 5JH7F 2W43A 5EP1A 5IC4A 3H7IA 3QWHA 5AW2A 1NXOA 2VSQA 4TTTS 1Q1EA 2WKRA 3T4UA 1ZN7A 3TKYA 4ENQA 1JIQA 2H07A 5F98A 4IMPA 5BR7A 1KJ8A 1OCEA 4ND1A 1LC3A 4B79A 1C5KA 5K4GA 5CT6A 4W5OA 2AG0A 3AYXB 1P1IA 5DNUA 1EHYA 3ABSB 4CYMA 2R66A 2VZ0A 5K7SA 4BZQA 3EEOA 2OSVA 3CRVA 4I55B 1AHIA 3TB6A 1G5IA 1ESDA 1CYEA 4EYKA 5LIRA 1GV0A 4AJ9A 1R8QA 4MNTA 2ZRHA 3HYCA 3LLSA 4ZALA 5CCDA 3H1AA 4OL9A 2ZYDA 3EQZA 4OHYA 3R3WA 2X2EA 1WVGA 3LO8A 3KQYA 3UJCA 3RAFC 1Y8ZA 4N4AA 2IBMA 2GHIA 4LAFA 3SICE 4IVRA 4HMQA 4ME6A 5EJ8A 4L4XA 3LUBA 4P3YA 2PCLA 2VTVA 4EI9A 2B0CA 3CZRA 3D4NA 1J7JA 3UT5B 4WGFA 3KTAB 4G65A 1YZGA 4KB5A 5EYPA 4R0MA 4Z7OB 3Q2OA 3LBAA 2XY4A 3EXIA 4QBGB 1FJHA 3P5BA 3D6TB 1TLFA 2A0XA 3G0BA 4RA6A 1DAEA 3RVOA 3CF0A 3T7RA 5DYGA 2XAAA 5A0FA 1JECA 1KRHA 2C78A 1G16A 2KWIA 1FS4A 1AGYA 2RHRA 3DEYX 1TM2A 3FOAA 1L7MA 1TMOA 4PRKA 3V1MA 4DR1B 2AQ8A 3V34A 1SM4A 4D99A 3RBXA 3HU3A 3OP1A 4Z7JA 4S05A 1RWKA 1CUIA 1YE5A 1H0SA 1PK8A 5IUKC 3PRKE 2CVZA 4YP5A 2BM9A 2UYQA 4ZU1X 2JZCA 2WD7A 1T25A 2ZAOA 3ANLA 1SVSA 3EZGA 3UEOA 3FI0A 4BFUA 1Z18A 1CZNA 1HKHA 2X42A 4MW5A 1VDMA 2YV5A 1E0KA 3DO5A 1L9XA 2AYXA 1XQWA 1ZLXA 3PC6A 2XCSB 2AW3A 3DV0A 1WUJS 3OZUA 5EWJA 1J1UA 1DHTA 4W5WA 3TEMA 3U7HB 2J87A 4G2TA 2OB2A 3H5LA 4MJ7A 4N7JA 1ZM9A 1FX0B 1N0HA 2VK8A 4JA0A 5L3RA 1J0EA 2E5WA 2UZIR 3ICVA 4KDEA 1JUDA 1W49A 1UKEA 2GCIA 3GPBA 3NHUA 4TS4A 2W70A 4C0LA 2QSJA 2RMKA 1QTNA 2Z3WA 5KDLA 5K9ZA 3T52A 2XI4A 4QRHA 2Q1WA 4MAMA 5KO2A 2BTOA 3TW6A 2AEJA 5ICGA 2PFGA 4ZOBA 3QELA 3ZTYA 5LXTA 3BSFA 1FS5A 3M4JA 2B94A 3C8MA 4X5OA 3ROZA 2F3RA 4G89A 3UH1A 3EWNA 4EB8A 1U3UA 3C3MA 3R2JA 5FWXB 4XIFA 3VTKA 4ZU6X 3BTUA 4IBOA 5FHRA 3THSA 2H5JA 4LJ9A 1F2UA 3PVZA 1PUJA 3WGZA 2I4IA 3FPGA 4PLCA 1FSZA 1GPJA 2Q1XA 2VDPB 3BGOS 3KR2A 4QYSA 5C51B 3RYCA 2KB0A 1QAQA 4L08A 2XMDA 1J0DA 2NV0A 2VDQB 1PNOA 3BXZA 4H6WA 3RS0A 4KPEC 2WYVA 2I4TA 1WG8A 4UEKA 4WVFA 3ZVMA 1SOMA 2ZT6A 3BTOA 2EIXA 4HLCA 5IF9A 3NR2A 1A8PA 1QQ6A 5LC1A 1BFUA 1WHSB 3W8RA 2AS0A 3RYHA 4A2PA 4TKVA 1H1LB 1L9KA 3HUTA 4QVGA 3EIWA 3W1WA 3OY7A 4I50B 1W44A 2AC2A 5IBCA 1RYEA 5JNUA 2QSYA 2QE7D 3AIOA 4JBLA 1KGSA 1Y5LA 2GQ0A 4A7PA 2UKDA 6Q21A 3IRVA 1N0VC 1RRCA 3IIIA 4YY3B 4LWQA 3U60B 1CUEA 2CXXA 3LO5A 2C1ZA 1KQPA 3EZ2A 4C3UA 1T0UA 3L4SO 2PWBA 2XNDD 5I5EA 4HDRA 4FB4A 4QGGA 5K8CA 4H9GA 1KH2A 1NVXQ 1FDUA 4JQOA 4CL2A 1U1CA 4F6LA 4OBBA 3WTBA 3O8OB 2VH1A 4PCLA 2V9PA 2VZ8A 4OI4A 2AOUA 3HXMA 3S55A 1L5GB 2QI9C 1VKOA 3EN0A 4FDVA 1RYBA 4YR7A 5AKYA 1A5SB 5EMHA 3HKCA 3ETCA 4MQEA 1B3BA 1F38A 1NVFA 1YB7A 2AR9A 2FQ1A 4OM7A 3CFYA 4C2BA 3HBJA 2FW9A 3IPCA 1JG7A 1T4CA 1W5BA 3QLUC 1N8NA 3QY9A 3NDPA 5A05A 3ZS9A 4HDNA 3IAHA 5C8YB 1Z25A 3FGZA 4H7PA 4YAWA 2KW5A 3OIWA 4MI9A 3LK7A 5EZ6B 1JG1A 3B7GA 4MS3A 3L1HA 4LDZA 1Z7EA 5J4VA 2EBWA 1K5DA 1DZ3A 2LE0A 3AQ4A 4RSGA 3R9IA 3WLPA 1L1EA 1NYLA 3E3LA 4P5PA 1PP4A 4CCYB 1THMA 4ERXA 1LDYA 2QYOA 4QBIA 1KFEB 1NJ5A 1BHO1 4OF4A 3ZBTA 1RFLA 4BN0A 1E2GA 2SCUA 3GGDA 1NULA 2JL1A 5ILOA 4EF5A 3R3VA 4IIJA 4JX8A 1E2PA 4M8IA 3CEPB 2P91A 4BCDA 1XJ0A 2F9FA 1PT5A 2P6OA 1Q1ZA 4KFTA 3OMXA 3R6GA 2Q8NA 2DPLA 1K98A 2GSDA 2VA9A 3W1EA 3TTYA 4LE0A 2PBZA 4JT2A 5DWQA 3WZLA 4MCIA 5A0VA 4QX6A 2PFKA 3QHPA 3WGMA 2IXTA 1QWSA 5JSZA 5LP6C 3WGYA 4YROA 5BSGA 3WQRA 4AZ3B 1KFJB 2DERA 5AKXA 2VYCA 1SOVA 2ZTMA 4AKIA 5HPYB 3USCS 5CG1A 4E4RA 2YW9A 3KYBA 3NXKA 5HK9A 1JPUA 5HS4A 4XD2A 1TA0A 1N8SA 3TLZA 1R0SA 2WVAA 1Q1GA 3AUFA 1XRNA 3KJEA 2PRKA 3LKDA 1CW2B 4FLMA 2F00A 1RRKA 3KPYA 4HLDA 4P92A 1JDNA 1PZFA 5FUMA 1SC6A 1X7XA 5K3BA 2FF5A 1EFVA 4TVBA 6ADHA 4RFLA 1CQJB 1NTOA 4IZIA 2ZB2A 3WRYC 2D1QA 2BWJA 3U0VA 3TPCA 1P73A 3VBEA 2ENWA 2P65A 2EF0A 2UVDA 1CR6A 2HCBA 2G72A 4JVOA 5IKPA 2VRCA 2WHEA 3QJYA 4LZPA 3QEBZ 3IP8A 2GETA 2H9IA 4P86A 1MOQA 2DFTA 3U4DA 3RUCA 3WHLA 5A4MS 5EZSA 4K9KA 1KWKA 3A1WA 1X3SA 2DM6A 4TN5A 1KHHA 3MOSA 3QIAA 4OB7A 1XYVA 2P1RA 2Y93A 2OLKA 2L0XA 3GRRA 5TQ0A 3NRBA 2E6KA 2ODTX 2QAJA 1AK2A 4E2FA 1CNFA 4O2BA 3G59A 2O5RA 1ZUWA 1RT9A 5HFJA 3TUJC 3K5PA 2QMZA 5E7JA 5FTKA 4DFDA 1E2UA 3GEPA 4IXDA 4DLKA 1BROA 4BMXA 2VLIA 4YUAA 4ZYZA 3I0MA 2G6TA 4PFJA 3RVPA 1MVOA 4KQJA 4EH1A 2WTMA 1FTGA 2QHXA 2H1FA 1JR3A 3AU8A 5FO0A 3PQ4A 2C2HA 1IM5A 3HA7A 1MTOA 3U1TA 4MKRA 4R9UC 4TTJA 4UTPA 5FPKA 1AU9A 3JZIA 2KM1A 3EJWA 1XXHB 3OTGA 4A2WA 1O6CA 5EHZA 3W7BA 2PYIA 5HF8A 5P21A 1N2JA 1JHAA 3Q72A 2NU8B 1B76A 1NBEA 4HH4A 1OX4B 4UAVA 1T8TA 3CIFA 3OT5A 5LL6P 1B6GA 3HACA 1A2OA 1WHTB 3LP5A 3I1JA 3NW9A 1SU6A 1TB4A 4II7A 4OFXA 5DGIA 1NUUA 2FH5B 3PPXA 4AWAA 5A2GA 2XGJA 4IWXA 3CWZA 1PSWA 4FE4A 5ITWA 2QMQA 5J5CA 3WY9A 2FG6C 2RONA 3OKCA 4ZRDA 3VR0A 5JFTA 3AEQA 1Y3IA 1PWEA 1FF9A 2QTFA 4MMZB 4XSHA 3TRFA 4CDGA 4D9GA 1KR5A 1WR8A 4TT3A 1QHYA 4M0LA 5JS7A 1FJXA 4ZQIA 5LKRA 1AHHA 4I9UA 4PLFA 1IQPA 4X95A 4AMGA 1FSGA 2ZROA 1CC1S 3IMGA 1T9GS 1U2EA 4GOJA 3M2PA 1Z74A 4GM4A 4UHHA 5FPTA 5K3DA 4C88A 2DCMA 4FMDF 5BXQC 1U8YA 3H2ZA 4F2PA 621PA 5SYMA 2J5BA 2XRYA 3AF0A 1LLQA 2EX4A 2QR2A 2CXSA 3P19A 4R31A 4B80A 5KSYA 4WCFA 3COJA 4Q93A 1US8B 2BBWA 3ETGA 2OHIA 2ONCA 2D13A 2AXNA 4CKWB 3RVJA 4HFMA 1CLUA 4HAIA 3L8DA 3LQKA 1B1AA 1QIJA 3LQ4A 1SJ9A 2W8BA 3ID6C 4NICA 4CF5A 4KU4A 2ZS9A 1OLXA 3OAAA 5T4BA 2DQYA 3D5EA 4AB1A 3ZQ6A 2H4WA 2GM5A 1VSQA 2PSFA 2Z0MA 1CUDA 3DMGA 4UPDA 1OI3A 4Q1AA 5EP4A 1LRLA 5GGYA 1BDIA 1P2VA 2J32A 1YONA 1FFAA 3Q40A 4KLNA 5JBIA 3WHIA 3WL6A 2XGOA 1NDQA 3T9BA 1C2YA 5EKSA 4MIOA 1S01A 3OTIA 5G3ZA 2E4VA 4KK3A 4B4UA 1D8TA 1JKXA 3JPYA 1MX5A 4PYMA 1T1RA 1IVNA 3MRSA 3SLRA 1BKDR 4X1KA 3ER8A 4B3JA 2HMSA 3CLHA 2AI2A 3L0CA 4HRYA 3BUSA 2A78A 4INAA 4PONA 4ZQHA 3HKEB 4W6QA 2FVYA 5K2MA 4UCXA 1NKVA 3JWPA 1JQKA 2VBIA 2ZTLA 1TF7A 3HUDA 3OG9A 3C4QA 4LSZA 1IJKA 2PPLA 4WY8A 4UD6A 3S0JA 3TM5A 5AD1A 5BSKA 1BOOA 1G6KA 2Q5OA 3DB2A 3DZFA 4H0FA 4PZCA 5EINA 1DAPA 3DLBA 2VAXA 1SXGA 4WX2B 1G18A 1BQEA 1ZJZA 1P9OA 3QWAA 3T3DA 1SU7A 3EISA 2C9BA 3EUAA 1UJMA 3R7NA 3IL2A 5CIWA 4MP6A 2BFWA 3I52A 1N92A 3EFHA 4Z1MA 4BGDA 3DEKA 2O7RA 1KXZA 3W8DA 5JMPA 4R83A 2WZCA 3TQHA 2V7EA 2QM0A 4TPKA 1V2HE 4B4VA 4OHZA 1DCTA 3HN2A 4Y6OA 2CBZA 4CU5A 3OZDA 1DQNA 1VG9B 3IV7A 4P2BA 3RHTA 3V1LA 3RFXA 4F3NA 2OY0A 3EGIA 5ADHA 1C1YA 1YE8A 2R96A 3EEQA 4G0OA 5FADA 4C0SA 3GDOA 2Q5LA 4XGIA 4B3XA 4Q3AA 2NZUG 5GIOE 3DEHA 3LQYA 5AI4A 5AM2A 5FWYA 1C1DA 2Q4RA 1VIVA 4Y0VA 3TSYA 5KYTA 5JDCC 3LCVB 4BEJA 1UJ5A 4C4PA 3KG2A 5JPCA 3KQMA 2AGVA 1VIYA 4OFZA 4C05A 4RZ3A 5LLDA 4P33A 4D4HA 4ARZB 2ICAA 1P29A 1R15A 3JTMA 4EG3A 2BMWA 3DBIA 1IY9A 4AZSA 3I2IA 3K0HA 3L8HA 4ZC1A 4P38A 1PL6A 1T43A 4GXNA 2ZBQA 2PLFA 3FOZA 1A9XA 2AQIA 4FKMA 3TOCA 1E4EB 2WSSD 3DB1A 5DSZA 3WLHA 4DUYB 4MVJA 1G6OA 3HC7A 4UHFA 3GDHA 3KFLA 1U2SA 1IVYA 3IOMA 3NT5A 3RS5A 1TAGA 1GDDA 3II6X 4MKXA 3I2GA 2YOFA 4BO0A 1MNQA 1E7YA 3FWNA 3CNOA 4OPMA 2OV1A 4QYMA 4TMZA 4YDQA 2ZKIA 1NBMA 5L40A 2F67A 1T5OA 2OMEA 4MW9A 4IDGA 3USZA 1UMDA 1Z7GA 2HJHA 5B3LA 1I4WA 3BFXA 2ZWMA 2R5NA 3ECCA 2JLBA 1PJRA 7ABPA 1VJCA 2C42A 1MZVA 1E3IA 2HSWA 2O8FA 5E95A 1NNI1 1FMTA 1JSCA 1CRLA 1ZL0A 4QIHA 3AINA 2G3YA 4YMIA 1KI6B 1OJ7A 1CJUC 2C7BA 3I9OA 3KWMA 3CW8X 4JLUA 3LHKA 1Z5ZA 3TIXB 2X8LA 2J09A 4MGHA 3LPMA 3AFOA 1SIWA 2W2QA 3F7NA 2B8NA 4ZMRA 3OLZA 1X7ZA 4RPLA 1NVMB 3D2AA 3LT1A 1ZOOA 4W82A 5G41A 5IT9A 3WFZA 3NALA 2FEPA 3IRUA 2GEUA 1SC9A 3TNFA 4OQDA 3VPXA 1KAQA 2FWAA 1XDSA 3L6BA 5H0IA 2FW1A 1Y9ZA 1EK6A 3KAKA 5DRYA 1E89A 3AI3A 1DQRA 1TJ4A 4ASUD 2RGUA 1JKJB 5KVQA 2D2FA 4EO4A 3BERA 1WTAA 1D2RA 2IH2A 1I5OA 5DHPA 4GKKB 2RHCA 3GC6A 4K9PA 1FFDA 3W2TA 2XTZA 3WE7A 1ESEA 3HM2A 4W8OA 2ETVA 2W2VA 1RQLA 2KBEA 5L4SA 2ZYAA 2XNKA 3D64A 4D43A 4Y2YA 4RULA 4EJ2A 3F2IA 2EX0A 1C3LA 2W6MA 3GJQA 1T9CA 4AJ1A 4OHKA 3M83A 4KITB 4DCSA 2PD6A 3U16A 2MSCB 1IB6A 2XUIA 1YI0A 2O2EA 1EG2A 1PR3A 3RQIA 1C0IA 3OZBA 2FQQA 2XKAA 4BLPA 5BQFA 2I22A 4I9GA 4NH0A 4ZOLB 4HYYA 3NBUA 3CEMA 3U3ZA 5BVGB 1JH8A 4GOLD 3IPLA 4TL9A 4ZTBA 4QJ3A 3DDOA 5AVZA 2H9AA 2RK4A 4ZVQA 5TE9A 2B7BA 2GB4A 1VHDA 3WADA 1GU7A 3A11A 4YYEA 4FHZA 3AR9A 4N0EA 4KUHA 2R1VB 3JVEA 1UINA 4P7FA 1XWWA 2V8OA 4DIBA 1W34A 5JMWA 4FFBA 5JOQA 2W4MA 3UAZA 3R6TA 2JCXA 3MEQA 4IEIA 4JELA 5ER9A 4POOA 2ON6A 1U31A 4E5DA 4DCNA 3O21A 1ZU4A 3FAKA 3GJZA 5A9SA 2HHCA 2RKOA 3W9YA 3IAS6 4XB6B 4HC4A 4XCVA 3VO9A 3ZJVA 3FJOA 4P7GA 1QIFA 3OKPA 3RHZA 4NDZA 3WV4A 1JFFB 1QG4A 4QT4A 3RAEC 2VSXA 1BU5A 1QBGA 1OH5A 4YWJA 1KMHB 4QPJC 2WHPB 3AY3A 1KR2A 3ICPA 5GY7A 1UBJS 2X3YA 3KWFA 4WY5A 5BSMA 4PVDA 1JDUA 1ODCA 3KYIB 3CR3C 2B34A 4HGPA 1GNQA 5DI9A 3WXBA 3KXDA 1K89A 1K68A 3I9MA 4IJ6A 3ZV7A 3C7KA 3RFUA 4EL0A 1XTZA 3KWLA 1R1DA 2F4NA 1XE3A 1NVDA 4MWCA 2A2ZA 1V8ZA 5SZJA 3ZQ4A 1M6NA 5MHTA 3ONNA 4ZZIA 1RLIA 1Z2EA 1QH8A 3E7DA 5JARA 3KLNA 3E7FA 3I5UA 3N2YA 4IQ8A 4P4GA 1UBRS 2HV8A 4L9SA 1EFKA 5BMVA 1KS9A 4GVLA 2VJMB 1X1TA 5MN5A 3VR3A 1V37A 3H84A 2Q5HA 4HWKA 4DV5B 4V0ME 1K6JA 4NX2A 1UZMA 1TLLA 2JEOA 1CRZA 1Z8FA 1B0ZA 3A70A 4FDUA 2FE4A 3CPJB 4UMVA 5E0OA 5IM5A 3V3TA 4RZ2A 2OXEA 1SVNA 4MGYR 4NJMB 3A4MA 3RG2A 3K70B 4B3RB 2W2KB 4ISBA 4OU5A 3DDCA 2FPGA 3M5DA 1F6DA 4LC0A 4Q4LA 1YB1A 2I2DA 4KFSA 3ZWYA 1L3IA 1CUWA 4HR7A 4BVAA 3MTAA 1HDYA 4I8DA 3I0NA 4Y18A 4MCJA 3E82A 1U94A 4ARCA 1H42A 3WYNA 3OQIA 4ZCPA 4RSHA 3RDPA 5LD2B 4KRFA 1X80B 1TVMA 1VB5A 3ZI4A 4BX2A 2EFHB 3F73A 4FCWA 1Q0ZA 1RPTA 1L5NA 1KZGB 3JATA 1UQUA 3DZJA 4YGYA 4B4WA 2DP4E 2F17A 4UNRA 2NUAB 3LA8A 1SBCA 1LW6E 4YUWA 4WQMA 1B3RA 2FFQA 2YC4C 4KNYA 2P35A 4QDKA 1KDZA 3ZHBA 4O4HA 4W1RA 4R84A 1H9CA 3O5AA 2YOHA 4HXGA 2GD1O 1EEHA 2R8OA 1IK4A 3D6VA 3U7FB 1WF3A 4I1UA 1XIVA 3O1JC 4IH4A 1N2XA 3BRWA 4Z7QB 2HF2A 5AUNB 3A6GA 4BNGA 2J4CA 1SKMA 2ZI7A 1ETUA 4F97A 1Z6GA 4OXQA 2V0GA 1VE3A 4ZANA 2ONJA 4LHXA 4B6PA 1C7EA 4I14A 4K5QA 1B1CA 1VGRA 1KO5A 2QRNA 4PX5A 4N5DA 4FHCA 3SFVA 1SEVA 2WG0A 4HRAA 4WOBA 1QK4A 2JD1A 3UT6A 3ZV6A 5GINE 1Y6RA 1RXYA 1W0CA 5CH8A 4EABA 3O2JA 4G5HA 4LRXA 2N0SA 2O8VA 1W6UA 1VLJA 3P2OA 4PR0A 4QGAA 1JYFA 5HDBB 3WJ2A 4LXIA 4CIBA 1OBFO 4N5HX 5KYYB 4UUOA 5CB0A 2CFRA 4ER3A 1E7MA 1PJSA 3JU3A 3M4ZA 5HKBA 4JCOA 4ZVVA 3JWEA 1OPXA 4L2IB 5CT8A 3RGWS 4RHCA 2ZT7A 2ZE7A 3HWRA 1F5SA 1ODKA 1OYWA 1SR8A 5LN1A 5CD1A 4MV3A 5B64A 3L84A 1ULZA 1TU3A 2DU8A 2WLSA 1KAGA 1PX0A 3DKKA 2XTAA 3SX0A 4PC7A 3IPRA 4DTCA 3FTCA 1YFJA 4XGQA 4I5IA 3WWYA 1P1JA 3B6EA 3RADC 3WMEA 5KTMA 3VNAA 1YZVA 1PX2A 4DSZA 1CUUA 1JHUA 1T1IA 1CRQA 2AUTA 2GN9A 3B48A 3ZZ1A 1M5UA 2JD2A 4K9DA 4ZKDA 2HYIC 1IN6A 2FN7A 1IEQA 4IJ5A 5PGMA 1DZIA 3K1YA 5ALWA 4ZAGA 4NU5A 3FB4A 3KTFA 4ZT2A 1HNWB 2W6OA 3U3KA 2OESA 3QA9A 1EXWA 1JJAA 4BX9A 1MHTA 1I7LA 3VSEA 3G13A 2JBHA 5JZMA 2RE8A 2WKWA 4TX1A 3T06B 1EFRA 4FOPA 1AKMA 3FUWA 3NTVA 4J2TA 5SYAA 3UGQA 3R3YA 4YCNA 2Q3CA 4P7JA 1AGNA 4N3CA 3QK7A 3DOHA 5DLPA 1MRNA 1WXEA 2YUTA 4BB5A 3TSOA 4XQEA 4NKRA 1WPGA 3L1UA 3RBAA 1Z6TA 1OU0A 3JWGA 1QKJA 1CUYA 2MIIA 4OQPA 4CG2A 1BCRA 3ENZA 2XB2A 1PQ4A 4K9OA 1ZEMA 4UXJA 4RJTA 4ZYLA 3KYCA 3E84A 2CE7A 2X3UA 4MW1A 1M0TA 3QEJA 3VV2A 4A1FA 4BMNA 1ZM3A 1NBIA 3Q2KA 3TQIA 2C96A 3EGDA 3KO8A 1FUUA 3FN4A 1IUOA 3ENVA 5CG2A 3L8FA 5AVKA 1T5TA 3GFPA 3O8BA 4S0ZA 4ER5A 2PT5A 1RIFA 1ACJA 1MO4A 1SBIA 2HSGA 1FVHA 4WLUA 2XYPA 3OJLA 2CNBA 5DP1A 3PUHA 2DQKA 3AGQA 1H0KA 2A5JA 2C7PA 4G0WA 3CEHA 3KHSA 1AUVA 3E35A 2CLLB 2BMDA 3ZJUA 5DLYA 1MU0A 2AEFA 3DV2A 3H87A 3E9YA 1OILA 3HQ4O 2X0DA 1D8AA 3OOJA 1YS2X 3M9LA 2XD9A 3DMDA 4E08A 3DL7A 1ZOLA 2ZJ8A 3P0RA 1UMCA 3MLEA 3KLBA 4EW2A 2QTBA 1LJUA 2QLBA 2YICA 2HCFA 4JIMA 3D4PA 2P6MA 4LRUA 4RKFA 3U9SA 4DHWA 1QZTA 2JH9A 4FQ7A 4X45A 4WXEA 4EKEA 5IAOA 5BOSA 1EZ4A 3C1TA 1JEYB 1AKUA 3IQIX 3D8NA 2WR8A 3ZWOA 4EVSA 3HK2A 4JMPA 1M74A 3LSYA 4O02B 3CVYA 4M3NA 3KHUA 4D26A 1K3FA 4RTOA 2FUEA 1Y8AA 4IGIA 3Q8WA 4TTSA 4CQLA 3ANMA 5CDYA 2BYTA 4YRFA 5EUQB 3LECA 4TQ9A 4B40A 4XD7A 1DP4A 1Z2AA 4YRCA 4WNIA 2YXDA 4PG5A 2HNKA 3LW8A 4RPGA 4FDAA 2ATEA 2FOLA 4JEHA 2FSHA 4NBKA 3OEWA 3HJTA 2PNJA 5EN4A 5F73A 3UWMA 2IEDA 4E1BA 2GN8A 3LVRE 4FQ5A 5BQ5A 2RG7A 4TKZA 2P2YA 4IUDS 3GLHB 5KJ1A 5TIIA 4E03A 1DEOA 4DARA 5LUAA 2QNBA 1WXDA 5TPWA 5J2TA 1JW9B 2ZRIA 2LWIA 2H8KA 4CQJA 3H13A 3LK6A 5J3JA 4Y2SA 5BOVA 3L4JA 3FSGD 2GJ9A 2CNWA 3N07A 4B9EA 4Q4HB 4GI2A 1TOAA 3GCDA 3HDQA 4KREA 3RK1A 2FSPA 1E3LA 1BKYA 1OROA 5K4AA 3ZIUA 5DM0A 2QJRA 4D02A 2XA1A 1M54A 2Y1EA 4K6OA 3AZPA 2WU0A 1WP9A 2YMQA 1RQ7A 2RIRA 3G2OA 4MI3A 5FD8A 3SZMA 4A92A 5KPDA 2ZWVA 3MINB 3OQNA 1UBOS 2GJSA 1EX9A 4B0OA 3N8DA 5DCYA 1O6ZA 1XCOA 4JLOA 4QVKA 4YLGA 5E7IA 3EGXA 5GPBA 1SURA 4HI0E 2ZZKA 4HATA 1EIWA 2ZJ2A 4W9RA 3FDIA 5HJ5A 1PW7A 5ALDA 3TW8B 2QX4A 1U99A 1Z16A 3L77A 4IW3B 3RHSA 4AK9A 5TMEA 4G0XA 5BQXA 4OGLA 1B23P 4LCEA 4N0PA 2Y4NA 5CHEA 4OQLA 3S2UA 3WYEA 3I32A 3Q7QA 4HL6A 1T5BA 1UMBB 1J9EA 3LCUA 1CB7A 4G8CA 2R1TA 2B36A 4G85A 4L7VA 4BDTA 2VC2B 2Y1DA 3ZCSA 3EQ7A 1GZ5A 3CF4G 2E5FA 3EVAA 5E3IA 3KEFA 2PL3A 3ONWA 2JHPA 1UFVA 2N1MA 2ZSAA 3HV0A 4NPAA 5SY6A 4QDOA 3GFFA 1P61B 4Z4IA 1UOEA 4YUXA 2PUEA 1TJ5A 1Q7BA 1RRPA 1KERA 1XTKA 2J3LA 1MDFA 5KNCA 4YBRA 3D1VA 5AM5A 2FK8A 4URWR 3HJAA 5HOEA 1DBPA 1I7PA 4D0NA 5JJBA 4XVHA 1DVRA 4NLLA 4YMUA 3IQGX 1QRRA 3MQFA 1XZAA 2FP4A 4GOND 4X8LA 4XUEA 4B7XA 4C7VA 3TGLA 2X8BA 4H3KB 3T3GA 4OH1A 5HKAA 1D04A 2OBFA 3I2FA 4U6NA 3VU3A 1VKHA 3WYGA 4PO3X 5AR1A 1NW5A 4RGQA 1BTOA 1VMDA 1G38A 4MVYA 3V46A 5M7EA 3TFOA 2CNLA 3NOVA 1Z5GA 4JL6A 2AXEA 5THXA 1UANA 1Y1LA 3SYMA 1EX1A 3WMRA 1FMFA 1OW3B 3NEJA 1AB5A 1OASA 1Z6XA 2RH9B 3D8RA 3GJXC 3RD5A 3URMA 3CG0A 5FUVA 1RQXA 1YQQA 4G9BA 4AD8A 2P9JA 2X41A 2Z4TA 3N2ZB 4PYRA 1SUBA 2I2FA 1YS9A 3CONA 3B36A 2REXB 2VCHA 2BFPA 4WXMA 4E5PA 2H57A 3VPAA 2G76A 3E9NA 3T9EA 2VPWA 4KR6A 4CCAA 1C7JA 4Z9XA 3PPVA 3IP7A 5EFOA 1XRPA 1S8OA 5CCXA 1JA9A 2FWRA 3FHOA 1VLLA 2VJNA 3W5UA 2FFBA 2E4AA 1P2UA 2O0LA 2QX6A 2X9VA 3B8EA 4IOLA 5GGXA 3S2IA 4DMHA 1BVHA 5H7XA 1UODA 3N2IA 1RWNA 1Y8QA 2HMTA 2QL5A 2HWWA 2Q4OA 4IHAA 4M8KA 4UFPA 2VDWB 1J2UA 4F8YA 1QX4A 5F2OA 3PEWA 4RPKA 1NV8A 4I7EA 4TVOA 3CLUC 2PR7A 2D54A 1ST3A 3RBZA 5JNWA 4FEGA 2K7ZA 4QTZA 3BZWA 4ICIA 4CVNA 2WB2A 2PUAA 2YVKA 1E9EA 2LIPA 5DDIP 1BJTA 4PLGA 3IVRA 5HWSA 3WWEA 2BKLA 1JLLA 2QM8A 5KHAA 2OTCA 1TE2A 1QTIA 1WUIS 2REQB 1YK1A 3EIOA 3GEEA 3IO3A 4JUBA 4JBYA 3DHWC 1Q0TA 1VJTA 3L41A 1M1XB 3AR8A 3NOQA 4UM9D 3WJAA 4MV9A 1UKBA 4OUKX 3S7ZA 4YQEA 2RGGA 4II2A 3FYUA 1UR5A 5DK4A 2JFWA 4J7AA 4BVGA 5CLLA 4K9RA 5EXSA 5EKUA 4AY5A 3JAKB 2N9UA 3WWDA 5FL7A 4MEJA 5GVSA 1ZXBA 4UEWA 3L1KA 2H48A 2FEXA 3D2LA 3TDMA 4JP1A 3W3AD 2BZ0A 3ISJA 4QBFA 3Q7SA 1PFGA 1JI3A 3BGIA 5TJ9A 1MGOA 1JAHA 4YRPA 5CVDA 1PGOA 5G4LA 4IKEA 2CDAA 1HC7A 3B13B 3I6ZA 2IZ1A 3S5UA 1H2FA 4J6EA 1OIXA 3ZE0B 1G8FA 3AETA 5LQKA 4XDZA 3HCNA 1MJHA 1M1UA 3JZAA 2B4RO 3NHAA 5DBGA 1SZDA 5AW4A 2V5UA 1ZITA 4AQDA 3WBBA 3GP8A 2AL7A 2ZG6A 1JQAA 2X58A 2ZUCA 3GLSA 3PFFA 3Q85A 3ZXUB 3WSTA 3TYXA 1M2OB 5M2QA 1RSZA 4XFJA 3SHVA 1P75A 1W85A 4LECA 5CVEA 1P1KA 3REQA 1TVEA 1PR1A 2HA3A 3WA6A 5GJCA 1EINA 1AZSC 2LUOA 2QQEA 2R97A 3GBVA 3SIPA 1ISIA 2I4OA 3W6UA 4XX0A 9LDTA 1XKXA 2PX8A 3NTLA 1FQKA 4PLZA 1PW5A 3I4FA 2VDLB 2ZM6B 4UHCA 4EUSA 3UT5A 3KTAA 1F8XA 3EGVA 4XIYA 4Y9SA 4ZV9A 1N5LA 3OWXA 3Q0TA 4HDCA 3FTEA 3D3QA 3E7PA 4KPUB 5FRDA 5IKOA 4EOGA 1NPDA 2IYZA 2CSXA 2NO9A 4C7MA 5LA6A 3O8RA 3D2BA 2OCBA 1P2GA 2W6QA 3OLWA 4EPVA 4OO3A 5JD6A 1COZA 2QAGC 4HEHA 3BIWA 3C7CB 1DG1G 3GIWA 4E94A 4F71A 3R0QA 3PUVA 3TZKA 4K8OA 3OFKA 1RHMA 5BT9A 1J8DA 4BMZA 1SHZA 2JFOA 4ZVMA 4ZD6A 3QKUA 4LJSA 4RIFA 4YJDA 3P9PA 2B7CA 1G4UR 2FQWA 3H1FA 3SR4A 3UHFA 1GGHA 4HSGA 1O0SA 5JRZA 1E7RA 3D8BA 2NO6A 1I9CA 1HDEA 3NB0A 3KL4A 4GX1A 4W7SA 4IIVA 2ZVDA 3KX2A 2RBGA 2GZDA 1SKAA 2H3HA 3RVQA 4UBNA 3R41A 1PUXA 2J46A 5JQWA 2LDXA 3GRFA 1XXHE 2D0DA 4L0QA 2TECE 2W4QA 2VDRB 4ZODA 4WBNB 5SY4A 3IOCA 4WZBA 3VPHA 3SY8A 3FOCA 5JAIA 1N57A 3MMZA 1BS2A 4FCVA 2A59A 4JB0A 4DLWA 3GT4A 4KIJA 2B1IA 4EO7A 2R85A 5JALA 2QKYA 1N36B 4XB2A 2BC9A 3KQUA 3JQGB 3QYJA 2J4FA 2VF7A 1BCSB 2G04A 4BNXA 4U9IS 4EZEA 3A25A 2PRSA 4LJKA 1J8YF 1RPNA 2XCRB 2V9ZA 5DBFA 1JG4A 2WW8A 2H5LA 3CVJA 2P0AA 1H9AA 3DKPA 4FUTA 1M0SA 4DKJA 2BFNA 1U4OA 4B3CA 5ICMA 1HTTA 5IRCD 2FOXA 3JALA 2YJNA 1GNSA 1P0FA 2HSDA 1NYTA 4ZVTA 2G5CA 1KMMA 4M76B 3OCWA 1U1DA 1HORA 1X6VA 4DCPA 4E11A 3MCWA 4A8JA 5CB4A 1G6HA 1JS1X 3KSMA 3NTRA 3NP9A 4JP5A 4Z9FA 4BS9A 1QIGA 4J1TA 5IVKA 2BTQA 5E2AA 5TQVA 3CVVA 3RIHA 3VZCA 1K6EA 2I4MA 3SEQA 2G17A 3UMRA 5IXJA 1O1YA 1PFVA 4OY3A 4M0UA 1K6MA 2Q3LA 3BKXA 3ZVNA 3WL3A 4C0AC 3QUAA 2GBPA 2M32A 3B6IA 3BMCA 5AJWA 4IAOA 3JQRA 4LXUA 4BIIA 5ICCA 1AUPA 1CJVC 1QF9A 2WM2A 3LDHA 5AUQA 3UHOA 4BQNA 4D9NA 3W3AH 4KNWA 1M67A 1T6NA 4NQRA 1NPTO 4ZT6A 2ZCJA 2IYYA 3DZHA 2GPTA 1SA0B 3QA3E 5AW1A 1EGHA 5P8WA 4QREA 3K73O 4IDPA 3TLEA 4AL4A 1T5SA 3FNQA 3AILA 1PTJA 1ORRA 2OGTA 1T1GA 2NZ8A 1JNXX 5G1PA 3RIGA 4N18A 5IHPA 4CEJA 3PGKA 4NNPA 4HH3C 4P35A 2Y05A 3JWHA 1WF6A 1QCCA 1BN6A 4FMBB 2NM0A 2JEZA 5E9WA 5KYWB 4JDPA 1R5OA 2FR1A 4FEYA 3LLVA 4NDAA 3VSAA 4OJNA 3OZEA 3C2QA 3ZCXA 1TLTA 4MWOA 3NAMA 5LKAA 1H3NA 2CN1A 4NS1A 1MFZA 2I6SA 4OJQA 3UOWA 1I94B 2QJFA 1OF1A 2HLPA 2ONKA 1CY8A 4TLDA 5C1IA 4N41A 3W2IA 3CBGA 1WLYA 2JAWA 4Q9IA 5DTJA 3RJMA 3VU9B 4A82A 3BXOA 2AKYA 3OJEA 4Q3NA 3IHWA 5K45A 2RHOA 1PNTA 5AKEA 3U37A 1E8NA 5KUTA 5DN6A 3KDPA 4JLBA 2ACEA 2H18A 4GO1A 4YR9A 1XEFA 1MC8A 5SV2A 4BKMA 4YAKA 3K9LA 1VSTA 3SBOA 3PFNA 1PRYA 4MVJH 5IT5A 5B4VA 2JCSA 2GLUA 1M7BA 1ZOSA 5BRNA 1YRQA 1F8FA 3A6LA 5GONB 3A0RB 1ZUNA 1SOAA 4J75A 3PC7A 2AQKA 1IY0A 2EVWX 2RHBA 3KAJA 3WQQA 3M3HA 5BW6B 1E58A 2O1WA 1V3QE 2W42A 1RE1A 4OAQA 1TGYA 3FHCB 1Z13A 3P26A 3WNCA 1NIJA 4Q3DA 5ARCA 2D3WA 2IYWA 3N58A 3U3MA 2IH5A 2P0YA 3N8HA 1Q0HA 4ZVKA 1V9CA 2AMYA 2YIMA 5EP3A 4Q0MA 3MA0A 5IYZF 1XLVA 3QI2A 4I4TA 1XELA 2JLRA 1TC2A 1ZM4A 5I8ZA 1K8YB 2BRUA 4CV0A 1T9GR 2Q1UA 4FNGA 2Z98A 2IRWA 1KMQA 1T1SA 1RC8A 2H1SA 2X5OA 4P4TA 5HX7A 4KDCA 4NK4A 2PZLA 4F6RB 4EYGA 4MTLA 1N6NA 3ELDA 3C3BA 3IT0A 3JS5A 4ISCA 3LKVA 1QO9A 1XMJA 2NZXA 3JQAD 4TRJA 2WHRA 2WT9A 2EERA 5JRJA 3IMFA 4LG1A 1R5NA 2NMVA 2FRDA 1CQJA 1W1WA 2BFCB 2EZ8A 1XRLA 3MJSA 3MRTA 1B0PA 4BE4A 1XZIA 2OXCA 4ZXFA 3FNGA 3UB4A 4J1TC 1EXVA 3WWZA 4JI5B 2F8LA 5DHSA 4DYDA 4G3XA 1U3VA 2J6BA 1NPYA 1U6KA 4B2PA 1ZXXA 2PZFA 2GYUA 1E79A 5CFNA 1T0BA 4OYLA 2OILA 3A58B 1CUXA 2HU8A 1Q21A 2WJ4A 2UVPA 4OK3A 3UUWA 5B1DA 3ZBUA 4A73A 4DG9A 4JU9A 3QNMA 1LPPA 1GDTA 4FWIB 5DX1A 2IDJA 1XRSB 2HKIA 4EHFA 2JEYA 1FZTA 1UBHS 4OHUA 4IEEA 4LOKA 4GZLA 3UWDA 4KO4S 1ZM7A 1RJ9B 1RYDA 3S8YA 3AEYA 3QE9Y 1JA1A 3DNMA 3R8XA 2W2PA 1N77A 1E3TA 2XDAA 1XTRA 3PRYA 4IIHA 2PMKA 5COBA 3WHPA 5KB3A 1J7KA 2YXEA 5AUPB 3U4QA 2VP2A 2XWJI 2BMJA 2AWNA 2X2PA 4MDHA 1MQAA 2AFIB 1AGRA 2J6IA 4Z2AA 2NU6A 5ICEA 1PZHA 2A0YA 4A5SA 4AZWA 4EPXA 3R3JA 1LRJA 1QMPA 3HJRA 1ORVA 1GZ6A 4GEGA 1OX4A 2Q3EA 4B6GA 2C5GA 3L5OA 1JHYA 1RJWA 3VR5D 4C14A 1YBFA 1K66A 4P2GA 5AXDA 1WPRA 3OETA 5C5CA 3BCSA 1P33A 1PLLA 1NQTA 2PT6A 1XAGA 1SXJE 1AS2A 3NH9A 2YXBA 5TF0A 3NO4A 1SMKA 3HDJA 2JGKA 1F14A 3Q7RA 1HKUA 1DIHA 2BI4A 2K4MA 3SDZA 4D0GA 4E2YA 2FLVA 2FQYA 5KYGA 3AL0C 3CF6R 4TTQA 4L4SA 5EUCA 1U7DA 1EVLA 5EXXA 1XTBA 3T34A 2LW7A 3WNDA 1KEEB 4RC9A 3DEJA 3AHDA 1ZMRA 3H05A 4MIKA 4MUFA 4A9AA 3ABQB 1CS0B 2DUNA 1R4NB 2BI7A 4YJFA 1KI1A 2FPLA 4RK0A 4Q01A 1Z0ZA 2A5DA 5G0VA 2C95A 5L6MB 1R0BA 1KY2A 1U9JA 1WQ1R 3A05A 4BNTA 2PUGA 1VG8A 4G4SO 4EGQA 3E8MA 4QFDA 1H5QA 4MXDA 2O8NA 3V8QA 1OWOA 3T3PB 4O0MA 1LV7A 3VI4B 1QU3A 2AKAB 3ZWXA 4IX9A 3UAWA 3PEUA 4DJAA 1IPFA 1JHDA 4EG7A 2X4GA 2OHXA 2JARA 3T38A 1RM0A 1U0HC 1XZDA 1DTWA 4MLCA 3AR4A 4QO7A 2Q50A 1G8HA 4J7XA 2D1RA 4M8NE 2BVNA 3T95A 2HD4A 3VC1A 3WYDA 5K0CA 3TSAA 3K0CA 3GB9A 2FRVA 3E70C 3H83A 1MX9A 3QXSA 2J5QA 3R5SA 1W29A 3HO1A 3ZVLA 3WRXC 1ZUD1 4AJEA 1FRVA 1VLMA 2P11A 2ZSUA 4RD0A 2C7OA 1S2MA 3F6RA 3IAAA 4BOYA 4EEXA 1G3QA 4YHBA 3RVDA 1YRLA 1XTTA 3KHKA 3MRXA 2FRDC 4Y6GB 2IOFK 1G4HA 4NYIR 1FYFA 2QD2A 3HKEA 4NYMR 3RRJA 2DFKB 4D4GA 2JKYA 3JZMA 1RQNA 4XWKA 4ZPJA 5J4LA 3VC7A 1Z33A 4HUJA 3EIFA 1E64A 3KSUA 1DJMA 1ISHA 1PWXA 3MCVA 3W6ZA 4BC1A 3KT6A 4F72A 1BHSA 4MKFA 2OM6A 1T4MA 3BSSA 4FUQA 3RUAA 1YQGA 3FCOA 3JQDA 4FOOA 1YRAA 3KUUA 1N3IA 5C9ZA 5I4CA 5AVRA 2I6QA 1RWBA 3OMWA 2AH5A 5AK0A 4FYXA 4TSFD 4X85A 3MIZA 3CISA 3QBTA 4GLFA 3NKVA 4RUKA 4XUGB 1RU3A 3M89A 2CHVA 1XD2B 1GTJ1 1YZUA 3NPMA 2NU9B 1NBOA 3VC3A 2MMCA 3GGPA 1YNSA 4G5OA 3ZTTA 2NLOA 1QYWA 3PTAA 2J48A 3GLFB 3TQFA 2VCYA 2YC2C 2B4QA 3MMXA 3QUSA 1OAOA 4AY3A 3HU5A 1HV8A 3AB7A 1U0OC 1TQHA 2BHTA 2IT1A 1QQ5A 3GHYA 4NBNA 3H86A 2VN8A 2HT6A 3AJEA 1JAIA 5TS3A 3LGAA 2YNMA 2VP6A 3H1BA 3M0EA 4P7KA 1A50B 4D9BA 3RVKA 2JA1A 1ESCA 4XM2A 1YGYA 4RQBA 3B9RA 4XA8A 2JGIA 3HGMA 3E3OA 1MH9A 3O84A 1OXMA 4L51A 3BG5A 4P5EA 3IYLW 4FSHA 1I7NA 1COWA 2W6ZA 3GL9A 3H2BA 1Q6YA 4IX1A 1H2XA 4Y2RA 2IUFA 3AY7A 1AUXA 2VT2A 1WCWA 3MBKA 2I4RA 4HGZA 3CTMA 4KQGA 3WAJA 5EIEA 3CUTA 1R6UA 4DIDA 4J3NA 2IY8A 3QVJA 3ZVKA 1EFUA 2WVHA 2B8JA 2HPZA 3R0VA 2QRQA 1WZIA 1R64A 3O7WA 4MV5A 3A1UA 2CJXA 4C4SA 4CMEA 1U8UA 5CB8A 4CTJA 3UGKA 4CCSA 4O2AB 4KQMA 5IMBA 3EZYA 4R68A 5IU6A 5AXCA 1YS4A 4JSTA 4G67A 3BGWA 1M6EX 4Q1BA 5TJHA 1TFUA 2QLMA 3FMVA 4U1RA 3FNRA 4D5GA 1USUA 3OQVA 1OH7A 1RC0A 3RE1A 3VGJA 1XMPA 5KAMA 1FTSA 3AM5A 5CLGA 3SIXA 4FFSA 1IE3A 2YWCA 4QJBA 4RESA 5EZYB 4YAGA 3I8SA 1PV1A 1LF0A 1AQYA 2OP1A 2QTHA 2VDJA 3BWEA 3JQ9C 3QE3A 4OV6B 4IDQA 4PHHA 3WYAA 1SCAA 3MUFA 4IG4A 5AKJA 3W79A 5C7IO 1DC7A 1KY3A 2G9UA 3LNTA 4LVNA 4YAUA 4JBNA 3T1VA 3QFFA 1E0AA 1M34B 3PLNA 3NVDA 4M2LA 3H9JA 1HETA 4G9EA 4UVHA 3AF5A 2XUZA 1PUIA 5ILGA 3K0CC 3U1BA 3GY0A 3K8YA 2DHEA 2IP2A 2ZVJA 3GYGA 4KN5A 3T1OA 1BDBA 2KI5A 2P2LA 3Q10A 3U31A 1PSZA 3B1YA 4H7KA 3M49A 5AVXA 3OZRA 2CUNA 3A1DA 3DGEC 4URFA 3L8CA 1BG6A 2BF4A 4HDSB 4K0KB 3HPQA 5C8YF 1U9IC 1EFDN