3TOVA

The crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
SNAMELDYKRIVVTFLMHLGDVILTTPFLEVLRKAAPHSHITYVIDEKLQQVMEYNPNIDELIVVDKKGRHNSISGLNEVAREINAKGKTDIVINLHPNERTSYLAWKIHAPITTGMSHFLFRPFMTKYTRLDRKTRHAADMYINVLEQLGVTDTSNSGLHIEICEEWRCQAQEFYSSHGLTDTDILIGFNIGSAVPEKRWPAERFAHVADYFGRLGYKTVFFGGPMDLEMVQPVVEQMETKPIVATGKFQLGPLAAAMNRCNLLITNDSGPMHVGISQGVPIVALYGPSNPFFYGPYQAHAIVLETMDSYEIGKSMKKIIKEGNYKGLSVISEEQVIKAAETLLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl transferase family 9
publication title The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008
rcsb
source organism Veillonella parvula
molecule tags Transferase
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01075 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltransferase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3tovA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3tovA01
1FU4A 3G2JA 4KQMA 3S0JA 3MS4A 2BFWA 1RRVA 1C50A 1JG6A 1NZFA 2IEGA 1B4DA 3MTDA 1QM5A 1P2BA 1FC0A 4N39A 3RT1A 2XA2A 3GPBA 7GPBA 3OY2A 4LDPA 3G2KA 2G9RA 1V4VA 3CUVA 1AHPA 1JEJA 4RIHA 1GPBA 2ACWA 3D0QA 2GPBA 4RIEA 2X0FA 3L7BA 3CUYA 2C4MA 3EBPA 3T3HA 1PN3A 4M83A 1Z8DA 5BNWA 2R66A 3T3IA 3D0RA 2QLNA 4MHOA 3T7DA 3MT7A 1JG7A 2QRMA 2PYIA 3MQFA 3NP7A 5TVGA 8GPBA 3ZCUA 3MRXA 4RIIA 1FTWA 2QN3A 1WV1A 4CTNA 1XL1A 2IYAA 1H5UA 3S2UA 3ZCPA 4MRAA 5D00A 2AMVA 2AW3A 3PE3A 4X7PA 2IW1A 4GZ5A 3Q3IA 1RZUA 3OT5A 3NC4A 3T5TA 1VGVA 2IYFA 5IKOA 3BD6A 2F3UA 4GPBA 2ATIA 3G2IA 2P6PA 3WC4A 1L6IA 1GPAA 4MI3A 2QN2A 4NESA 5DLDA 1HLFA 5D01A 4AY6A 1WUTA 1GZ5A 4WACA 1XV5A 4GZ3A 1JIVA 1C8LA 1P2DA 3G2LA 1YA6A 2R60A 3MT9A 2XCIA 5GPBA 3FROA 3C4QA 4RBNA 3TOVA 1F0KA 2BGUA 2F3SA 1LWOA 3E3OA 3T3EA 1FU8A 2QLMA 3BEOA 3ZCVA 1EM6A 1QKJA 3VUEA 3BCUA 4GYYA 2IV3A 1F6DA 3VDNB 4GZ6A 1Z6PA 2VCHA 3BCSA 3RHZA 1WUYA 2QNBA 2SKCA 3DD1A 2VSNA 2QRHA 4FKZA 1XKXA 4M7PA 3UYLA 1IIRA 2XGOA 3CEJA 5TMEA 2IEIA 1Y8ZA 3HBFA 2BGTA 2C1ZA 2F3PA 1E4OA 4AN4A 2AV6A 3T3GA 5LQDA 4N3AA 3IAAA 4EL5A 2OFFA 3SYMA 4AMBA 2G9UA 3NB0A 4F96A 2QN8A 1E1YA 3VDMA 4AY5A 1SXPA 5DU2A 3DZCA 3S28A 2F9FA 3CV3A 3CX4A 2F3QA 4RENA 4XI9A 3Q3HA 1NZDA 3OTGA 2GPAA 1NOJA 1GG8A 4MHSA 2GEKA 3IA7A 4CTMA 4EL0A 3COPA 2ZB2A 1WV0A 2PYDA 3D1JA 3EBOA 2IUYA 4REMA 5JTUA 1KTIA 2XMPA 6GPBA 1J39A 3QKWA 1IXYA 4RELA 2QRQA 4EJ2A 1L5RA 2XA9A 1FU7A 4CDRA 4CTOA 4BQEA 2VSYA 4KQ1A 1NOIA 3HBNA 1BX3A 1A8IA 5C1DA 1JIXA 2FETA 4MI6A 2QLLA 2PRIA 3MTAA 1P4JA 1UQTA 4F9FA 4XIFA 1EXVA 3UYKA 2ASVA 3OTIA 4HLNA 3L79A 4YUAA 2GJ4A 1NOKA 3MS2A 1JIUA 3C4VA 2ECPA 2VG8A 2X0DA 4AMGA 4BFCA 1P4GA 2JLBA 2XA1A 4EKEA 3G2HA 1PNVA 2GEJA 2XGMA 4WADA 3MBOA 1Y6GA 2R68A 3CUWA 2PQ6A 1Y6FA 1NVKA 1FTYA 2ACVA 2R4UA 2QN9A 3RSZA 1L5WA 3S27A 1ABBA 4X7RA 2X6QA 2HY7A 3Q3EA 4BQFA 3NAZA 5TMBA 3DDWA 4LEIA 3TAXA 4W6QA 1L5QA 2H1HA 2AZDA 3QHPA 4EKYA 1GPYA 5I45A 1PSWA 3MS7A 3CUTA 2XCUA 3BD8A 1AXRA 4MI9A 2FFRA 2GPNA 4X6LA 3VUFA 1K08A 2X6RA 3SYRA 4KQ2A 3OKAA 3AMVA 2C1XA 5HXAA 5TMDA 1M5RA 2WTXA 3WADA 1Z6QA 1WW2A 4F97A 4QLBA 1RZVA 3ZCSA 3H4IA 3HBMA 3E3NA 3BDAA 1SXQA 4PQGA 3MT8A 2VCEA 3BCRA 4WHMA 3WAGA 3L7DA 4G2TA 2IV7A 3C48A 3CEMA 2G9VA 2SKDA 3NP9A 3OKCA 2JJMA 3L7AA 2R4TA 2QRPA 3OKPA 4YI5A 3S29A 1XOIA 3HBJA 4HWGA 1UQUA 1O6CA 1C3JA 3TSAA 1UZUA 2XGSA 5ENZA 3ZCQA 1C8KA 3E3LA 4NC9A 4Z5XA 2QZSA 1FTQA 4X7MA 3CEHA 2Q6VA 1PYGA 3MSCA 2GT1A 3CUUA 1XC7A 3BD7A 1K06A 1L7XA 4L22A 2SKEA 4NEQA 3O3CA 2GM9A 4N3BA 4GYWA 1LWNA 2QN1A 1GGNA 1FA9A 1WW3A 1YGPA 4MICA 3MRVA 1L5VA 1GFZA 1L5SA 2G9QA 2X0EA 2PRJA 1Z62A 2QRGA 1NLMA 1FS4A 2KS6A 2YJNA 3H4TA 3L01A 3MRTA 3L7CA 1P29A 3DDSA 5JTTA 3ZCTA 3RSCA 2C9ZA 4RIFA 3OY7A 4YI3A 2JZCA 3T3DA 1XL0A 5DXFA 4RIGA 3ZCRA 9GPBA 3G2NA 3OTHA 4M60A 3NPAA 3NCHA 3MTBA 4BQIA 2O6LA 4N9WA 3GUHA 1P2GA 2H1FA 2QN7A 2BISA 3PE4A 4FZRA 5IKPA 4N3CA 2FF5A 1P4HA
chains in the Genus database with same CATH superfamily
1WHSB 1FU4A 2DTXA 4QQ8A 1TKAA 1BTOA 1WXXA 2CFSA 2FI1A 2II6A 1L1RA 2WM2A 4LC1A 3TE6A 4BIIA 5DI9A 1N8TA 3NRCA 4YUVA 2PZBA 2COKA 2R48A 3T7JA 3M1AA 4BASA 3LQRA 3FPEA 3ADPA 4EHNA 1NE2A 2X0IA 1FW6A 3HCWA 3IFSA 1OXVA 2PGAA 3MTDA 1L5OA 3MTIA 4O29A 4N39A 4F6CA 5NLLA 2DHEA 3MWYW 4YJ2A 3RC9A 4TYNA 4TTQA 1KOGA 2B69A 3TUJC 2F48A 1G0OA 4Q21A 3CH6A 4E3ZA 2ZQZA 2ZAYA 1QIHA 1YD7A 3GIDA 3G2MA 2J3HA 4TWAA 4OJMX 4LDZA 3T41A 1C9YA 1NU6A 3SMQA 2OP0A 3Q15C 3VU8A 4G6ZA 3TRIA 3SJAA 3HV0A 3O1IC 5A03A 5MGNA 1L4YA 4UEWA 4MUIA 4Y67A 1SA0A 4EB6B 3F7OA 2VUSA 1QTRA 4M1KA 4EY6A 1L5LA 1AJEA 1JG2A 4J16A 1Z2DA 3QU7A 4BV3A 4N18A 3EFOA 1A0OA 1KO7A 1PN3A 1EWTA 4Z0HO 3VOTA 5DW3A 2Q2WA 5TQ0A 1PD1A 4Q7LA 3LUKA 1R0BA 3BH7A 1R4NA 4KQGA 4NOMA 3KETA 3BXZA 3BAZA 3D3NA 1SU8A 3KB8A 4C4OA 5EHXA 3GGCA 1GL7A 5CB4A 3ESDA 4WX2B 3DMHA 2VZ0A 4G1VA 2WSMA 2YIVX 3SZ3A 4BFTA 1LGYA 1NF8A 1RAFA 2BMDA 1H0SA 1TCBA 2YQ5A 3QUBA 1CC1S 4O4IF 3ZCUA 1GZ4A 2VYND 4FYIA 1CV2A 4D9BA 3L0ZA 5EWLA 4AS2A 7REQA 1JLRA 3MD0A 4CG3A 2QT9A 2JAWA 5ALRA 3WSVA 1Z5UA 4A16A 4CTNA 4XLLA 5DCYA 3GFTA 4MUBA 1PNOA 1DBVO 4BL5A 2WYVA 3GN2A 3HUDA 4HATA 5REQB 4MRAA 4JEIA 2QS9A 3THSA 1P0PA 4LOAA 2NZWA 5SYNA 1SXJD 5AM5A 1VRWA 2FSHA 2LRHA 4BN4A 1PIWA 4GZ5A 3GT3A 3EZ6A 4URZR 3DGEC 3PLAE 1T9AA 2QR2A 5ICCA 2POCA 3NC0C 4GOLD 2PX2A 5FYQA 2J32A 1NL3A 5CVEA 2XRZA 2ATIA 2WYWA 3S1LA 1OXKB 3PC8A 3PIDA 1J8YF 4BQOA 3LW8A 4J0EA 1CQZA 1K92A 2GBLA 3MLEA 3CRQA 3WDKA 1VC2A 2VHYA 3A7EA 1H8HA 2AYXA 2J6IA 3H86A 4W8GA 3I72A 3RKSA 5A3JA 5DJ5A 2R8ZA 4YK7A 4IXMA 4AJOA 4LI3X 4C0HA 2XNSA 2VHVA 1NBWB 4ZT7A 2G6TA 4JLDA 4K05A 1IQRA 2Q6OA 5DMHA 1XCGB 1YK1A 2FHPA 4M1OA 3UA3A 5FV4A 4F1WA 4PXSA 3R4CA 2F9MA 3A1CA 2C2GA 3O6VA 1CY4A 3BSFA 1YQEA 4AYWA 3DEHA 5LB4A 4LJ8A 4LGVA 4UM5A 5EUCA 2Z5LA 1IJKA 2A1UB 4B71A 4C0LA 4PNEA 4GUDA 1T36B 2W0MA 5HA5A 1QUFA 5DN6D 1MHTA 4MW4A 2GXUA 2OOKA 1HYQA 1F0KA 1E5XA 2WFZA 2CLOB 3JQ7A 1QIKA 1YRLA 4J0KA 1Y9ZA 4OK6A 5CEEA 2I76A 1NQAO 3L7NA 1KP9A 2DZDA 1XWWA 4CMAA 2GLXA 1UM9A 1TVCA 2M9MA 2MSNA 3FHOA 2VPIA 3I45A 1D2AA 4COOA 4CLOA 1EM6A 2CXPA 4ZAYA 5T4EA 1D03A 4HDNB 4AJLA 4MPDA 3O9ZA 3H1BA 2NU6A 2V6MA 4PIPA 3UAOA 1WOMA 2XOXA 3Q8KA 3GGJA 2H8GA 1M1ZA 3HVHA 5LZ7A 5LU8A 2ETXA 4B84A 3KTAA 2QNBA 4CGYA 4CKCB 5LQRA 4XFKA 2K7FA 4R8KA 5ALIA 2XGGA 3R5JA 1W19A 2QX9A 3DD1A 4PANA 3MTGA 2JJ1A 4C7OA 2I2AA 4FDTA 4N01A 2P2SA 4OK3A 1VFPA 3VR4D 3WMGA 3X1ZA 2CDNA 3VYTB 4FKZA 1NM5C 3R0XA 4DSNA 1DELA 1XI2A 3DFKA 2H4WA 3H6GA 4MOWA 4PO8A 5G1PA 2HU7A 1Z7YA 3F4BA 3FRJA 5A5FA 2ZE8A 2YY7A 2QDXA 4KITB 5MFZA 2GN9A 2X4GA 2IW3A 3H5TA 4QTUB 1UP7A 1V9LA 1W6UA 2GD2A 3S70A 1UKVY 2OBYA 1QQTA 1BA2A 2OLKA 3IOEA 3T3GA 4H7PA 4BDSA 1UUFA 2BFBB 3AETB 4EHKA 2B78A 2NVOA 1Y48E 2QMOA 5BNFA 3BE6A 3SAJA 4D9KA 4FB4A 2PJRA 1U3GA 1B42A 1R0XA 1RAHA 4BNZA 4DA4A 1EBFA 3DBHA 1UBTS 2G4LA 2YFKA 1AKWA 1XTTA 3B3JA 3GAMA 4C6TA 1E6LA 1JEYB 4K3VA 3TTTA 3K6SB 3EEFA 2PS1A 2GAFA 2QTCA 4M1TA 4MGEA 2C88A 5FA8A 4B47A 4ZJZA 1RM5A 1M2FA 3U44B 3F9IA 3FCUB 4UBJA 1WHTB 4NPCA 3LFHA 4AY5A 3IUNA 4N3NA 5KNBD 3W5BA 2ZBPA 1L3IA 3BF8A 2OHHA 3ENQA 3MF4A 5IEBA 5KX5F 1FFXB 4HQLA 2JGJA 2YS6A 2J5BA 2GPAA 3BSWA 3EUWA 3GL9A 4XX0A 2X4IA 4W1PA 1CG6A 3B6EA 1KC3A 1VQ1A 2R1TA 4R81A 4S1VA 4YGYA 4ZQIA 3REOA 1JH9A 1K98A 4FJ2A 4ARBA 1L4KA 1NPYA 2QMZA 2R3SA 1TU4A 2BPOA 3MWJA 3ADDA 4N7RA 4GZMA 4L74A 4KYTA 1EE9A 1XCJA 1UBJS 2RH8A 4HNRA 3FWKA 5BWBA 2BGNA 4QJBA 4ZXFA 4ZP1A 4DA8A 3EY4A 5CG1A 4JLBA 3W5HA 2OV3A 2HN9A 5JJ5A 5F1KA 3CF4A 1YVUA 1AQ6A 3C15C 6GPBA 1WWKA 3KYJB 4P2GA 5FNZA 3EA0A 3G0GA 4KDCA 4O59O 5JDCC 4BX3A 1Q3HA 5LA6F 5C7LO 3HGTA 1FSZA 1KVQA 4UEQA 3X0DA 4MB2A 1MJGM 4HT3B 5ALHA 2WWYA 1G5FA 4UQPA 2G9NA 3UJAA 3RVDA 1M2NA 1PJBA 3STYA 4TZ0A 3S6JA 1EFVB 1JFTA 1B1AA 1C3LA 1FDRA 1G19A 1Z07A 2PT6A 3PXGA 1YS9A 4EW6A 3Q8LA 1M74A 1A9YA 1CULC 3TM4A 3OFJA 4F4FA 2AIRA 2BCGY 1QONA 1Y89A 5FR2A 2O50A 1PJQA 2ZE6A 2G0NA 2KI5A 2ZIUB 1BE1A 3R6TA 2VTEA 1PWYE 1H6CA 1VMDA 2QZ9A 5JQGA 1IY9A 1E6WA 4HSGA 2GBGA 4I5FA 1HWYA 1WMSA 3AZPA 4K9DA 2HRQA 2ON6A 4QUKA 4UREA 5TSDA 2Z8YA 4JC0A 4PPGA 3UYKA 1WU7A 1DNPA 4X1OA 4RPLA 2BKAA 2H7XA 3KT0A 5CT9A 1CLUA 3R9XB 2E3JA 1WKVA 3NHRA 5DIZA 3ICOA 1IBRA 2PBZA 4ESEA 4CYMA 1QJCA 1GGHA 2OHVA 3PUVA 4KC0A 3C8DA 4LZJA 2UYGA 3H13A 3TSZA 3TVYA 1H85A 2P9EA 3LQQA 5K0LA 4IX1A 4BNDB 1VMIA 3ILVA 1OFTA 4J2TA 3E03A 1JKJB 4KQKA 4UPEA 2JEYA 4NU8X 5E6UA 4QHYA 3EF3A 4BXOB 4RD2A 2NAFA 3GT0A 5J43A 4RVSA 4G07A 1Q1ZA 5ECWA 1LRKA 2WY2D 2QHXA 2JKYA 1JWLA 1G5RA 5G3ZA 4RVHA 1F60A 5CDTA 2VJPA 3RS2A 1II0A 2UYQA 3TAUA 1RI3A 4CIBA 3DTVD 4MW1A 1NVKA 1RZRA 4AF6A 1NBHA 1SCJA 2FWNA 1WCYA 1PT9A 2R4UA 1TKCA 3WLSA 4UQLA 3HFGA 3TQOA 3CVUA 4C0KA 2NQTA 4ETIA 5A62A 3KOUA 2JARA 3CRW1 3TNJA 4ZEOA 3IILA 3TBHA 1R66A 5JNLA 4QDJA 1C1XB 4YX9A 3V8EA 1JW9B 2FUNB 4NENB 3F6YA 3VSBA 4CM5A 2C2MA 4LXXA 2PJUA 5AJXA 4PBTA 2ODQA 3AL2A 1PU2A 5IUNC 1A5AB 3OX4A 3RC8A 4LVOA 5TMBA 3DDWA 3FFXA 1SQ6A 2F43B 4PTLA 4V0OA 3C6QA 3BGWA 3H9BA 4QLAA 1L5QA 4I9HA 1ZD3A 4UU0A 4DA6A 2V03A 2Z9BA 3TW8B 5I45A 3ZK9A 5JAUA 4YUYA 1NUSA 1U0GA 5J2TB 3D2CA 3S1AA 1BN7A 1XMVA 4J2OA 1CUGA 1KOJA 1SVUA 4I4TB 4ER5A 1BHO1 2CJWB 3HHEA 3M4ZA 1Q7TA 3LUAA 2IZ6A 1OPRA 4NPAA 2DFNA 1CFJA 2XKAA 4QUDA 1P0CA 5HIJA 1SUAA 3MK31 4ZQCB 4OL9A 2OPBA 1Z75A 4PCAA 1B0UA 4C08A 4TOIA 1PDOA 3EHEA 1CJTC 1H5QA 3IAM1 4BFWA 4DZTA 1RPNA 2CXQA 4P4LA 2OLEA 4E08A 4ZMSA 5KTYA 5EESA 5H59A 5FV7A 3RBVA 1XNHA 4KG7A 3EASA 3G5MA 3BGIA 3DDZX 3LI2A 3B82A 1NXWA 1TZCA 4WZ6A 4KVFA 5ALXA 2NUAA 3B9RA 3CSUA 4O4HB 1E0SA 1QE0A 2OCGA 3QEMB 2FSVC 1V5EA 3B7PA 1T43A 3NHSA 3PPXA 2GWHA 3CRRA 1ABEA 1M33A 3QFFA 1Q15A 2UV8A 5K0BA 2NPOA 4XB6B 4YMLA 2OQVA 4YP5A 1QYWA 2WFMA 4NBSA 1Y4AE 4XEHA 1QFMA 1X86B 4Y9DA 3VR6A 4EMBA 4PQGA 1M2HA 1U3CA 2PZGA 1SQSA 4JBWA 2F1IA 4JI8B 2OB1A 1CRZA 1O6ZA 1UOQA 3OU2A 5JYCA 4PN3A 1KY4A 1SZCA 4DUPA 1I4DD 3OIGA 1CQJB 1GPDG 1VCOA 4MWDA 2SICE 1CP3A 1DBRA 1TQ2A 5J23A 3K32A 3L7DA 1V6AA 2B8JA 4JJ6A 1E3QA 5A4DA 1V0JA 4NHOA 1R4MA 1X6VA 2VLBA 4WZAB 3L82B 3UWMA 4YPVA 1R6TA 2WK1A 1F06A 4TYMA 4E22A 3RWOA 2PNFA 1JTFA 4ESOA 1XTUA 1O6CA 1XTIA 1Y3DE 3PQCA 4LHEA 1EK6A 2JS7A 5CJ2A 3VPXA 3PCRB 3VV2A 2VZ8A 5ALYA 2PMDA 3H16A 1CUSA 1CTQA 2AFVA 5K0NA 3Q6NA 1P1JA 3V00A 1NVXQ 1TVEA 1UMBB 2GRJA 3LBAA 4RMJA 4DZRA 1N9GA 4GEKA 5KPDA 4G56A 5THQA 4KQ9A 5H02A 1QIIA 4TKUA 3ZD6A 4Y2SA 2CV0A 1Z5VA 1ONOA 2I4RA 2OSVA 3ZYZA 1HRDA 1X80A 2XDYA 3ZGZA 3U4HA 1DZ3A 3KVOA 2LW7A 2QTLA 5DBHX 1H1TA 4F06A 2GB4A 1R00A 2C9CA 3BD7A 5ETJA 1E1NA 4WXYB 5ULLA 2E85A 4NEQA 5LJLA 3HB7A 4NYMR 3U3DA 2AOUA 1VIVA 1E1LA 3WLAA 3IVRA 3WIDA 4A8JC 1WTCA 1XMPA 3HL4A 3OLYA 1FF9A 4C4TA 4EKGA 4M55A 4LDAA 3DO8A 3EZFA 3AKDA 1KZGB 5HZGA 1DBWA 1THZA 2B0CA 3RSHA 3NMUF 4NG4A 3GF4A 1Z0DA 3A9SA 2ZITA 3GWZA 1W9MA 4RC9A 3PGA1 1TAUA 1SVWA 4KBGA 3G9XA 2FSGA 2GNPA 1Z0JA 4NJOA 1UIRA 3ORRA 2H2IA 3F5FA 4HEA1 4LVUA 3G7UA 3CZ4A 4GP6A 4YRKA 3DDSA 3UQYS 4BE7B 3BMOA 5JTTA 4YTEA 4EX7A 2NO1A 2ORED 2HA3A 4C3ZA 1T13A 1T9ZA 3FB4A 2P6RA 4AZ0B 4JP5A 2F00A 2FX2A 4BQSA 4QODA 4D5EA 2WHPB 3D7NA 4F4IA 1AUOA 2R25B 3VAAA 3IT1A 1YVRA 3AEZA 1FY2A 3VJKA 9GPBA 5JYDA 1CUVA 3ACDA 4PHHA 2BMAA 3X1XA 1H2YA 4HNHA 5I9BA 1SXIA 3LFTA 3A4IA 1M66A 2PX8A 1AHIA 4LMRA 4QASA 4RXTA 4ZDJA 2YHIB 2KPOA 4MW7A 4K0KB 1AV6A 1FDOA 4TSRA 3WYBA 2AQ8A 2JZNA 4BLRA 1RFLA 2XE7A 3AY6A 3JVEA 4H1VA 4HDMA 4HFJA 4ES6A 5JZ9A 4F56A 1AX9A 3V55A 1P2GA 1KZ1A 2VF2A 3DHWC 3HCEA 3P52A 3HY6A 3U2QA 5E1OA 1PR6A 2IXFA 2BHTA 2CF5A 1BH6A 2VP2A 4HXYA 4LBWA 2FMFA 2GSDA 4X92A 2DFDA 3WDSA 4DEXA 3ZVNA 1DTSA 3OEHA 4FE4A 4BC0A 2DPGA 4EYEA 1LVGA 2GARA 2HKIA 4HGQA 5AVTA 2QX7A 1G3IA 2O2DA 1Z0AA 3H2ZA 1TIKA 3RSLA 5IT4A 4RDXA 2BEVB 1YB5A 3CE9A 4HDRA 1CX9B 1EVQA 1Q1NA 2B5OA 3DE2X 1E3JA 2Q7DA 1QYIA 4CV2A 2ZRMA 5AHOA 4JJZA 1IUKA 1KI6B 1E63A 3Q40A 2BFDA 5B58T 4JYAB 3GAFA 3UW1A 3F9CA 3Q7SA 1M8PA 2QYOA 4R1MA 3RTAA 2QL5A 3D4IA 4GX2A 4O2BB 1TO6A 3ELUA 1N5OX 4XQGA 5C8ZA 2BYTA 2D6FA 5F1OA 1L8QA 3EXEB 4NMLA 3CUEF 3I04M 4KPUA 2QLFA 3CINA 1MVOA 4I4IA 1WTAA 4B7ZA 4Z4QA 4EFMA 4ZCMA 3KQWA 4R2KA 1RXWA 2CXUA 4R01A 5P21A 2ZSKA 3PEYA 1GPBA 4BVLA 4KVGA 4MVXA 1WVGA 3WK4A 1JLLA 2FG5A 1N1GA 3BB3A 4H77A 1P7PA 3IS3A 2BW0A 3L7BA 2WJPA 3BJRA 3F8TA 3HACA 4PYIA 1AO0A 2NWQA 1UZMA 3NC1C 3P9KA 1I30A 3EBPA 2DJIA 4IGAA 1SUSA 1CS4C 4FN4A 4GWLA 4U6SA 3H0EA 2EOAA 1JRLA 5AI9A 4KQEA 3L7IA 4E21A 3LXMA 2AJDA 4C4SA 3JARB 5SZHB 1W5EA 1QVRA 4G26A 1WUKS 2XYRA 1Z47A 4MHOA 1X1CA 1JYFA 3IQWA 1WXDA 2D1TA 4KN6A 2WZBA 3EGWA 4RCZA 1PEAA 2GRAA 4KLZA 4WERA 5ELLA 5KSWB 2NU9B 1ZGCA 3FPCA 1P9RA 2QTMA 4WZZA 4F85A 3AF2A 5HZMA 2CY0A 2XNHA 1JLKA 4CLRB 1GUAA 3D8SA 4EM6A 2O8EB 3IB6A 1NMZA 3J7AC 1TX4B 1DO0A 2ZBQA 1TM3E 5DLYA 4DANA 1K66A 2I4LA 4X44A 4YIKA 4B40A 4CV0A 5ADHA 4HYQA 5IUJC 5B2FA 1E9VA 1K4MA 3D4NA 2K2QB 3BHNA 2PGJA 4B17A 2D7DA 5EP1A 1VZ2A 1FS5A 1TJ4A 1SCNE 2IOYA 4MWGA 4DRYA 3ND8A 1Z22A 5FO1A 4P83A 3AU9A 2PJDA 3FI0A 3U0VA 3LHDA 1GPJA 4QULA 1FDWA 3OZCA 1ODTC 3TKYA 4BFLA 2PLAA 2XTZA 2V0GA 3FSRA 3NC4A 1JHQA 2FJPA 4HVAA 4CL8A 4GICA 1XQ1A 4R83A 4BMZA 4ITRC 4YJHB 3WX0A 5HW0A 4QVIA 2WPDA 1G63A 1QWSA 1SD5A 5DN9A 1Z5NA 1XTVA 2FWBA 5J4LA 2HSDA 4HN4B 4RADA 2CV2A 1XKQA 5ILOA 1CD5A 1QR6A 3U6BA 2BFEB 1GUDA 4N47A 3WL4A 3WC4A 3MMXA 1KF0A 4OF4A 5EN4A 2NPIA 4QM7A 4MRSA 4ZI5A 1DIRA 3BXFA 5DEOA 5FWNA 3AERB 1ULZA 3H7IA 3OLVA 4DG5A 4MI3A 5CVJA 4JUIA 1TECE 2YDXA 2WWFA 3KQVA 2A5YB 3KG2A 3MHPA 2X0JA 3AVPA 2XBUA 4Q9KA 1HDCA 4ZGBA 1WX1A 4I3HA 1T6ZA 3G13A 2GTHA 4C87A 4M46A 4CN8A 5TGZA 1FE8A 4MULA 4YS6A 3UAXA 4Q3NA 5IJ9B 1YRQA 2H7VA 2ENUA 4AG6A 2RAPA 2YV4A 2FNAA 3M5CA 1K97A 4JC5A 1I3NA 4FX2A 1EXDA 2REBA 1CDDA 4RM3A 4OA5A 4CM7A 4CM8A 3FHTA 2JGFA 1NQWA 3A4LA 5JXGA 1NP3A 3N28A 1LI7A 3HK2A 4NFHA 1JAZA 3NBMA 1NDUA 2FPPA 3O2SB 2XVYA 2GF9A 3A9UA 3BDIA 5E6RB 3D2AA 5EJIA 5FTWA 1KWKA 1S7GA 1RWOA 4XXHA 4MKZA 2XYGA 3NHLA 3W2HA 3G8BA 3PFNA 4FBMA 3TEJA 3QJYA 3GGPA 2A2ZA 1WNFA 3E7PA 5BPFA 3K0CA 1S2MA 2OMEA 5AVYA 1NVBA 3PR3A 5DKFA 3K09A 5IPFA 3FMGA 4FGJA 1F38A 5BSKA 1USKA 5BWOA 1BCSB 3NBZC 3SVLA 1LVHA 5FDFA 5TV2A 2YCLA 3PHBE 2XDAA 2CCJA 4LC0A 1XA3A 1CEXA 2SKCA 3K0HA 4UW9A 3WWYA 4DT1B 3E2IA 1ARZA 2XWSA 4J1QA 3KKNA 3S8EA 2VK4A 2B3TA 1J8DA 2Q3LA 4MLDA 2OC9A 2VYFA 3DDNA 1H9BA 4O8ZA 2HU2A 3FR8A 5FCDA 1ZD5A 1F1JA 3K94A 1BXGB 2O7VA 4P7FA 2O8FA 3O26A 4HZIA 1CUIA 3FTDA 3DTNA 3CG4A 4XM0A 3IAS1 1XPRA 3ROEA 2OV1A 1LXCA 2JANA 2W83A 1I3MA 2H48A 3EE6A 3VPGA 2ZBDA 4OYLA 3WBKA 3ICPA 4UDOA 2O8VA 5JBIA 2JVJA 4AJPA 4DR5B 1XWFA 1LDEA 3ME5A 2YN0A 3IAAA 2CKMA 4BLTA 3GFFA 1QH0A 2Y6UA 1GARA 1M8GA 3NV7A 1F2VA 3I8XA 4Q1EA 4YRFA 3ZHSA 1LZKA 4DJDC 4TWJA 5BWCA 3GLSA 2A0KA 4GMHA 1YBHA 4FD3A 3PXXA 1JQAA 1Y9DA 3QUSA 4YN3A 4LBVA 5AVOA 1QV7A 2MINA 1NFFA 2QN8A 1IOZA 3OT4A 5ALEA 2IVZA 1CUXA 4RD4A 3TMAA 4Z4FA 4PR3A 3PFIA 1RJ9A 1X2BA 1YHNA 2AK2A 1I94B 4NJMA 2C5GA 6ABPA 1ISMA 3GUVA 4JITA 4P81A 4PXYA 1A8SA 1BMFD 5AJVB 5EJ6A 1EFPA 3A27A 3KKQA 2DWPA 3M2PA 4XI9A 3ZHTA 1K0FA 1YK0A 1RJDA 2FQYA 2PT7A 2SNIE 1ANKA 1TM7E 3E8MA 1J06A 1NZDA 2JPDA 4FW8A 4MV6A 1F2TA 2HL6A 3SR0A 4KLAA 3RBZA 1U7XA 1JALA 1GG8A 2GEKA 3ED1A 1A27A 3KOWA 3NKLA 4YCAA 3UMRA 3MJRA 2X8WA 3N74A 3C39A 4PU0A 1GCOA 1KY5A 2CXNA 4BKMA 4B3JA 1GTJ1 5H0IA 3J80A 1JVBA 4DMLA 2Y68A 4IXTA 3F6CA 2PAAA 5JALA 2WYIA 1Z2NX 4C7XA 3B6JA 2ONKA 1TFUA 3O3OB 3PNOA 4NCBA 3KZOA 2I7TA 1C5KA 4BBPA 1MX1A 2IYQA 2CK3D 1XU4A 1MN6A 3AEQA 3CFYA 4ZCQA 4PZCA 4GGMX 3AXSA 1QHGA 3HCCA 3ISJA 4NCJA 4X1YA 1BDIA 1YR7A 1LC0A 3CBGA 1FQKA 2PZEA 3QKWA 2ZJZA 5K3FA 3ZVRA 3E1GA 3SQMA 4A0FA 5BW5A 2AL7A 2VJMB 2FUG1 3IPCA 1NKSA 4LC9A 4OQMA 2O3TA 3AJAA 1WW8A 2G1AA 4Q5IA 3RJ5A 5J2UB 3FPGA 1TE2A 1YA4A 2GZSA 1SUBA 2QEQA 2JI8A 1OA0A 3PJRA 1GTZA 3L1JA 3UG6A 3I39X 5BSEA 2VSYA 3FNEA 3D8NA 4KQ1A 2C5AA 1N0VC 2EF1A 3RGGA 4N5DA 3V46A 1EE1A 2FPGA 4H1TA 2KBEA 3SHVA 5C1DA 4TZ6A 1FXWA 3VNQA 3ILHA 2XTAA 1AMOA 4OM7A 5E8JA 1K4KA 5KHLB 1CHNA 3H1TA 1U4OA 3FGZA 4F1JA 4LISA 2Q1SA 3BGSA 2FK8A 3QVXA 4UC0A 4O5OA 2DVMA 4ZO6A 2HIHA 2Q5CA 3BXPA 1QV6A 3KB6A 5F7ZA 4EPTA 3FDJA 3ZXYA 2PU5A 1Q3TA 3EJ6A 4BY9E 3JYHA 3ORSA 3ZHZA 3IOBA 2BBWA 3PFHA 4DTCA 2JLXA 2UUCB 4JL5A 3RUPA 4F21A 2UVQA 4PN7A 1ZXLA 1Y7IA 3ZBPA 3OZAA 5FPYA 3MS2A 1GTG1 1KO1A 1TQ4A 1G6OA 4E5VA 2JGAA 4YCNA 3LX8A 2DHDA 4RA9A 4JENA 2A1TR 3PKZA 1KYIA 5B5SA 1L4MA 1Y1SA 2WD7A 1MT3A 2MYPA 4OATA 4RMNA 1JILA 2R87A 2AG8A 2A94A 1I3CA 2Q46A 4GQIA 4E51A 1PEDA 3BA1A 1KZ9A 1QORA 4OAQA 1SVLA 5DK4A 2QLTA 5IBRA 3WAKA 4DMCA 2FEKA 3NM6B 5ISMA 4DR6B 3I83A 1ZGAA 1IUPA 4KVZA 2OZKA 2DY0A 4U2BA 3TD2A 3ZLJA 1P1KA 3GNSA 3L4SO 1L5ZA 3SU8A 3NEPX 2XLBA 4R84A 3TKAA 2DKNA 5AVKA 2CNBA 2XVAA 3DLAA 5GJCA 4BGIA 4TKMA 1M8JA 3ABOB 5KPJA 2PSEA 3ISTA 3WA6A 2HCRA 3INTA 5LC1A 2J85A 4LFCB 2FEXA 1KRWA 1EUDA 2WF8A 3AHDA 5IMBA 3ILYA 2FSUA 4JX9A 3ITNA 5TJHA 3UICA 2VAWA 1BN6A 3BMNB 4OHCA 5JHHB 3BH0A 2IBTA 4CEIA 4QUBA 4MV7A 4W6QA 2GCOB 4C4RA 4UE2A 3R5SA 2VVTA 4IGEA 2YJ4A 3HDJA 4Q12A 2ZZMA 3SBOA 3IKJA 5BQFA 1U2DC 4TQUS 3EVAA 1P18A 4OQLA 3GLIB 4LJ6A 3PHIA 3AOEC 3BXOA 3N5CA 1D2RA 4FYWA 3WGIA 4DV4B 4XTRA 3IL2A 4L7QA 4JY7A 3FYHA 1BX0A 5GGXA 5GV8A 3UHAA 1WCIB 4S1WA 6PFKA 4JDPA 5TMDA 9MHTA 5L4SA 3WTCA 4C4AA 1ADBA 3PPWA 2REXB 4MQ5A 1WW2A 4U6NA 3LGAA 1FLAA 4BCDA 1KIMA 1ZA2A 4WDQA 1G42A 5BXQC 5F52A 3UOGA 2GZRA 3A6PC 1N3YA 4Q4AA 1ZRMA 4Y2VA 2GFHA 5ES4B 4Y0AA 2G72A 2E0IA 3QNMA 4NH4A 4MGIR 3OHSX 4UVHA 1U9IC 9LDTA 4L0MA 3H4IA 3K6JA 3FPFA 2CXSA 3RDPA 4E5SA 2L69A 1COWA 4DHEA 5LWQA 3RVBA 4EARA 4E1AA 1OPXA 3K0BA 4BZPA 2OGZA 3UMSA 1EFTA 1GNSA 3TTSA 3JQGB 4HWRA 4B9AA 4FHCA 3L7KA 5JPCA 3DZDA 3RUIA 3BSSA 1F5NA 4G2TA 3BL5A 2ZROA 4GPD1 4ZI2A 1FRFS 5GONF 4BCCA 4I1YA 1E7RA 2NVUA 3NHPA 1Y0BA 2CDBA 1KS2A 2CZQA 1HO3A 4GVXA 4IM7A 3SQDA 5K3EA 4LV8B 3VZCA 2XMDA 1EQ2A 4WY5A 3F6SA 1TYAE 4HPXB 1Z5PA 2QQ5A 3ZV5A 1U99A 3CONA 4NBNA 1KMIY 3HP7A 3RODA 5H3HA 3T9AA 5AUPB 1XWIA 4EHLA 3V9AA 1O6BA 5AHXA 5E1MA 3KQMA 4KYUA 4XM1A 3R6DA 4YYEA 3EZGA 2QDKA 1AKQA 1OF1A 1D8TA 2ODNA 3T1OA 4EAQA 2R2GA 3ZNNA 4EKIA 5K5EA 3GP5A 3G0HA 2QJTA 4LWQA 5I47A 1UAAA 3ZCQA 4RA6B 1J22A 1IBCA 3NOOA 3TLEA 1BEZA 1LW6E 3DV0A 4Y2RA 1BFUA 2IYRA 1J00A 2EARA 3Q3JB 3MM4A 4IWXA 3DHNA 3DTTA 5SICE 1KNXA 1KQNA 2PLFA 1XJ5A 3JVVA 4X90A 2AYYA 5EXSA 1PG2A 3SHTA 3RRBA 3P2JA 4ZVRA 5C3UA 4IIGA 4BGEA 2VOJA 3TPFA 4KPEC 1U2QA 5I9LA 1ISIA 1G21E 1Z0SA 3ZIAA 4OD0A 3PHLA 2AUMA 3QY0A 3L7MA 4FTWA 3SSNA 4DQ0A 3ZKWB 1ZK2A 4U2KA 1WKCA 4H6PA 3V1KA 3ETHA 3WWZA 3HYLA 2WNHA 5CDHA 1A88A 1LWNA 3DEIA 1BKYA 5CM2Z 1JDBC 4DLNA 2BHLA 1NQOA 2QAJA 4NCIA 1BC5A 2FFHA 1P45A 2C3UA 3E7WA 4GI2A 2VJAA 4RJIA 1MTZA 3JASA 3MRVA 3TL3A 1AO3A 1KSHA 2DF8A 1XCPA 3ZLUA 3IQHX 4YRBA 1RDFA 1I33A 2E6KA 3CJQA 1CY2A 3SWWA 3CNQS 1OI3A 3IHKA 3DEAA 2Y66A 2HFKA 3RGWS 4MP6A 2V6IA 2JFWA 3MRTA 5FFMA 5IASA 3GEGA 2QYSA 4WECA 3RK0A 4MTCA 1H1DA 5EZSA 5BT8A 2HWWA 2XUPA 1DEAA 2LIPA 1P4RA 1U8FO 2SCUA 4AN1A 2FFJA 2ZWPA 3BWDD 4CIAA 4EECA 1NW7A 2PCLA 3QMPA 3WQSB 2JZCA 4FMDB 4BAGA 3DWFA 4F3NA 4ENVA 5BP7A 1X74A 2N42A 4ZRMA 3CT4A 4FSDA 2JGMA 4TX1A 4UMDA 1GTSA 4RIGA 3DONA 1ECJA 2BJWA 2GZDA 4HSEA 3WNBA 1QFZA 3RVPA 3V6LA 4WXPA 1XAGA 2M1ZA 1R50A 2P1DA 3QVUA 3IQGX 4RORA 4YAJA 2E18A 4HQ0A 5AIBA 4ZMRA 4NDZA 2AFRA 2M6SA 2WVHA 3LYAA 5BNIA 4EHJA 4MR7A 3WE7A 4D0SA 1DGQA 4UHFA 4DQXA 2FCAA 4H4DA 3HZHA 2YW2A 2XMCA 4KXVA 2BFPA 5FWAA 4I50F 3VR1A 2J31A 5AK5A 4KHPB 1XZGA 1AOXA 4JP3A 4MMYB 4I14A 4F2WA 4UM7A 4OYRA 5B55A 3B5JA 4AY4A 4F3CA 3MWGA 4C0WA 3IBFA 1JHYA 2WWHA 4D0GA 4BZXA 1KU0A 2D8AA 1QRTA 3W05A 3RREA 3NO4A 1B8VA 2ZUWA 1M73E 4QU0A 3ZVMA 1QS0B 1DCTA 1H8ED 2I9PA 2VC2B 3WXBA 3THOA 3KPUA 3PXAA 4EG5A 2NO9A 2ROQA 3M6IA 5ICEA 4GOOD 3AKZA 5FTMA 4XUEA 3WK7A 4A0RA 3X1WA 1FZQA 3GVHA 2Q50A 3IP3A 2HREA 4EP1A 2YNMC 1W46A 3T3MB 4I66A 5AVWA 1Q19A 3E9CA 2XDWA 1KMQA 4QARA 1RAAA 2YYAA 3UAGA 1L8OA 3NFYA 5IP5A 1WMFA 2R6ZA 1J23A 1Y8RA 3WYCA 4QEDA 4TLDA 1FX1A 3L8ZA 4EENA 4GGPA 5BMVF 1X7XB 2A3NA 1IFXA 2O2SA 2ZBUA 1Q1EA 4LXGA 1RKXA 4PPFA 1D9XA 3SBEA 1E8NA 4Z86A 5AKJA 1MRZA 4ZD6A 4PM4A 4AL4A 5JG7A 1KI7A 1SEPA 4DQUA 5K20A 2MYTA 3N76A 4J91A 4Y18A 1N2CA 4KE6A 2IS2A 3OOYA 2PGOA 1B76A 2PBLA 2WKPA 3CPSA 1XF9A 2EDAA 2ZOSA 4P4NA 5BNWA 3WYAA 1KZ6A 3PQ5A 4KPGA 5HQJA 1UC9A 3HADA 2ZI4A 1PX0A 5BOVA 1OAOA 1BRTA 3M49A 4LDQA 1OT5A 5DNWA 4ZEXA 4B2PA 4JBYA 4Y30A 4C30A 4P3OA 1EGAA 5HX7A 2DPMA 2G80A 4C05A 2ZTVA 4KFTA 4DWVA 3FF1A 3PPYA 1E58A 1R0SA 4QRHA 3S8YA 3EA4A 5B58C 5FUXA 4C43A 3IDOA 5KYWA 3T1YB 3V32A 1XP8A 4HEQA 1XXHB 2Z1NA 4YV2A 5CEJA 3E9DA 1J8FA 3MQFA 4TV8B 5TVGA 1LLCA 2X5JO 3RRXA 4RE6A 2YV2A 2QM7A 3ND5A 2Q9AA 3MERA 1FTWA 1ZKMA 5JY1A 5B3LA 3UTDA 1JR4A 3N53A 3OP4A 4Z3DA 4R2HA 5BRNA 3OCZA 3X1JA 4QE3A 2FW8A 3LT0A 4AO6A 1RC8A 4RVNA 1RVDA 1VB3A 2WM8A 2PUTA 1A5BB 5DN6A 3E35A 3V1NA 1OZ0A 1N6KA 2H18A 2VF8A 1SKUA 3F96A 4Q1VA 4UDXX 5CX4A 3TZCA 1WZUA 1IHOA 4EGAA 5A3RA 3VV3A 1NQVA 2FZLA 3G9QA 2JVKA 5CVVA 1D09A 2P3OA 4EGFA 4AY2A 2PR7A 4LHWA 5B3AA 1YDWA 5CA0F 1T6YA 1DAOA 2GN4A 1GZ6A 2IZZA 3Q12A 2UVPA 2KW5A 4N6GA 3X2FA 3SIRA 1N34B 1JKMA 4OIFA 2W43A 2BFMA 3ADOA 3JZDA 1BS1A 1O97D 1V1RA 5KJCA 4UUOA 2BH2A 2XNDD 1NPDA 3D5QA 3SHOA 3TQSA 2ILVA 5BO5A 1BQ3A 4ZMBA 1U9JA 2O23A 3H9GA 5DLDA 4AY6A 4D4LA 3ZD7A 2PQ2A 4M21A 5E4YA 4A15A 4ZYLA 2C07A 1SKYB 2OVBA 1YBMA 3B78A 3EVCA 2C9BA 2CXXA 1QHEA 3KPJA 1A9PA 3PNVA 5IM4A 2JI4A 2VQFB 3UAYA 1ZOLA 1M76A 2WJJA 4OUDB 1CRLA 1Q22A 1U31A 3QOXA 3GI1A 4UDYX 4ZJUA 1YA6A 1YHYA 2VSXA 4RHTA 2NG1A 3U81A 5C52B 3M89A 1T91A 3SZRA 4RBNA 3UJ3X 3SQXA 1B23P 2AUTA 2Y27A 4EIWA 1KIFA 1LWOA 3OE7D 5AD1A 2BSAA 5LB2A 3IIMA 2XDQA 3CMCO 4JOQA 3HCDA 2G67A 1SOUA 4LX0A 2PXAA 3HS3A 3ESQA 4R8RA 4TQAA 1OIVA 4XKJA 4XPIA 5ILGA 4CBVA 1CZHA 1XTBA 3E22B 3WLKX 2JK1A 4OBEA 1F48A 4GP7A 1Q50A 3IAXA 4UATA 1N2ZA 1SO8A 3BCUA 3A1UA 4S2UA 2QNRA 2Y0BA 3HCPA 4HVLA 1USVA 3T95A 1F6BA 3HO8A 1AB6A 1P75A 1VI6A 5H16A 3RHZA 5KNBA 1YJCA 1RWXA 3A1NA 1R4AA 4N3GA 1L7PA 2V1XA 2Y4NA 1QVAA 4PE5B 5J9FA 2TSYB 4U3JA 1U3FA 1PDVA 3SEZA 3AXTA 1K1EA 1L7MA 3MJEA 1Z6TA 3VO1A 2AKEA 1YS4A 5FFFA 4IHJA 4MCIA 1MJ5A 1XD2B 5ITWA 3N0WA 1E0AA 1SBYA 4P98A 3GQVA 4BLSA 3K0FA 2HXYA 1EYZA 1VGQA 2ZBGA 4MPTA 1W48A 2BGTA 5AM4A 5JECA 2HLNA 3GMDA 4MR8A 5GMOA 2O8DA 2WICA 4V0QA 4TMYA 3JALA 3KYIB 1J2TA 2Z2JA 2OYSA 1UJ4A 3NHWA 4TM7A 3I6QA 3A1VA 1W4AA 4YMIA 1DC6A 1E59A 1NYLA 4W8HA 1QGYA 3K1ZA 1RWWA 1KFBB 1DWUA 1IB0A 2W4MA 4MPJA 4DY6A 4CCAA 3U16A 4AX4A 5F7OA 2JW5A 4L15A 1ZG3A 3IH5A 2ZT8A 4YRGA 4H7FA 2RC5A 1ZRNA 4HNSA 4XYEA 4BFUA 3O8LA 2YJ6A 1NMXA 4PLPA 5EPEA 1BVRA 4BB9A 1XRNA 4JS0A 4OB7A 3RS8A 4ECAA 3AJ8A 1N0UA 3HKBB 3EMVA 2WD9A 5CFZA 1PGQA 1ORVA 4OHRA 1PGPA 4R1NA 3ZIDA 3JCZA 4CU2A 3B2NA 1GKYA 4JSYA 4D45A 4MX8A 4CDGA 4RJJA 2H2FA 2CNLA 3H5VA 3ZV3A 1LSUA 3AO0B 3A6KA 1DKOA 1KKUA 2CLKB 1SQ5A 2C5EA 1KGSA 2X13A 2X86A 3ECSA 1I1NA 1DTWB 2YMQA 5TGTA 1W36C 2WWGA 5DNDA 3A37A 3H5LA 4BVEA 3Q0EA 3M7IA 4OMDA 2NU7A 1U28A 4EL0A 5AUNB 4B0PA 3GDFA 4GLLA 5I4BA 1NT2A 1MC5A 1QQAA 3P9YA 3QKRA 3L84A 4PNHA 5AW2A 1DQPA 4A91A 1GLVA 3G8YA 3H99A 3HWWA 3IQIX 4OX9Y 1TT5B 4BJHB 1L5KA 3K92A 4BNUA 2P0AA 4B9EA 3R4VA 2Y0CA 1DFGA 4RFLA 4ZOCA 5FBVB 5FOQA 3VKGA 2IYUA 3PDJA 4ON9A 4WN9A 3AONB 2E49A 2JCVA 1MF7A 1J2RA 1LDMA 4JFRA 4RPKA 3WNVA 2JLWA 2VHCA 3A10A 4M1ZA 2ZYDA 2H2WA 2HDNB 2J5KA 2CE2X 3KQPA 3OIWA 2XXBA 3QM1A 4LYDA 4M1SA 1FU7A 1FDTA 1SCAA 2FN3A 5LP1A 5UKDA 2PY6A 3O75A 3QKSA 4GPTA 1XFDA 3A3OA 1B73A 1TOAA 2CHQA 2B1QA 1BDJA 1XVAA 2C7VA 4FGZA 4B3TB 1PQYA 3V1TC 1BX3A 3WRWA 3FNBA 2BIFA 4HLDA 3QU5A 4DM7A 3BJMA 4LA4A 4YRCA 1CLEA 4ZVQA 3UH0A 4O2LA 2W2KA 4MIYA 2JATA 3UCFA 3AUJB 3R7LA 4XTCS 2GK3A 3HDGA 3MTAA 3T9DA 1IZ9A 1FXUA 1P4JA 2PZLA 1QYXA 2C4TA 2EJUA 2QRLA 1GIAA 3QXGA 4XDZA 4F7WA 2B8WA 3VNAA 4J7CA 1TW2A 5CPFA 2VI5A 1S4MA 2ZBRA 4F2PA 1T9KA 4HLNA 1U8EA 3FJYA 6AT1A 4G01B 3K9QO 3Q3CA 1NOKA 4HN2A 1U3UA 5G41A 3UKOA 2GJ8A 4YJ2B 2ECPA 1IQUA 2X14A 3PCXA 2FUCA 2VFAA 4PPQA 3NYIA 3MWEA 3RT9A 5JLJA 4PZDA 1M7GA 4HB4A 4R1QA 2VP9A 2IX9A 2J41A 5G0WA 1GZ7A 1RE0A 2YJ5A 4WOCA 4WADA 1Q91A 3PLRA 4EATA 4R2MA 3IAUA 4KR7A 3SFZA 3OZXA 2FRDC 1QIDA 4IILA 2IZ1A 2VK8A 3A11A 3I9V6 2BZGA 4KXMA 1UEXC 3DDOA 4XDGA 1E4EA 2FMTA 5I5EA 2VAVA 3AX6A 2GBFA 2Q49A 2Y77A 5IKMA 3EFOB 3IBCA 2TECE 2NUPA 2ISSD 4CLXA 3QXCA 3R6WA 5D3ZA 2VWPA 4J6EA 4TKLA 4JBNA 5TQ0B 3FUCA 2FR8A 3OO0A 3TWOA 2PUGA 1VOTA 3P5BA 4U2GA 2ATXA 4LSMA 3WLLA 3SQNA 3TR5A 1U0SY 3STTA 5CB4B 3TEFA 1FFBA 3KJZA 4KXLA 3GFBA 3P27A 1WXFA 4N1AA 1N77A 4DWOA 3OCUA 2JG3A 4EKYA 1WZ2A 1HFWA 4C3UA 4QXOA 1OASA 4D8VA 2RKBA 1MTOA 2AZTA 1KSGA 5BWNA 4EHIA 1MENA 5EWLB 4Q16A 5BN4A 1TQDA 2VNHA 4NE7A 1DIAA 1TO1E 5C46F 4I1OA 1Z4PX 1GVHA 2YXDA 4YJGA 5A4AA 3HMKA 3R3VA 1MAWA 1CR0A 4LV6A 3E9MA 2DAPA 3C7DB 1EJ2A 4F8JA 3S5JA 2QL9A 1A2QA 3PGVA 1VB5A 4BMPB 2H00A 4Z1OA 2C0QA 2XE4A 3PDWA 2FRXA 4G1CA 3AKCA 5LUAA 2QRNA 3SS8A 4UHKA 4X91A 3ZGLA 2WVGA 3D81A 3DOJA 1H2ZA 3ABSB 3OQBA 5KYUB 3E18A 3EFEA 4LSGA 1L7OA 2PX6A 1RXIA 1R9JA 3QUTA 2CLMB 3PIRA 2YXNA 4WCVA 1F9AA 5IK2D 1HT3A 1YQXA 3RC3A 4NMHA 2ZATA 3OU6A 1QP4A 2FPIB 1OLSA 1EUCA 4QREA 3UHFA 1I5RA 2WYOA 4MMZB 3LC7O 2XB9A 4FQ8A 1QQ6A 2ARKA 2H17A 3PZRA 2FPRA 3L8HA 4Q9JA 1IWBB 5IC5A 2GETA 1XZKA 3BCRA 3N05A 4L75A 5C32A 4OAOA 1ICIA 2X3UA 1GKLA 1WPGA 1IAVA 4AB1A 2QTAA 3ZWWA 3RTDA 3CVYA 2Z5VA 3RB8A 4OOFA 4X3OA 4AROA 4R8VA 3GGGA 3NHJA 4EO7A 3OPNA 1CSEE 1UBNA 2ACEA 1N5IA 2X41A 1VKHA 4XVHA 2BFOA 3E82A 2BELA 4JI4B 5LOVF 2EF0A 2OO3A 3FAKA 1TIBA 1V25A 3WLEA 3NVAA 1PS0A 1UFRA 4JROA 3ZE6A 4Q39A 3ZWYA 4CM3A 4W9RA 4P53A 4A36A 3AR4A 3HJBA 1CRPA 4MARA 3LYUA 1E2FA 4B76A 1QTIA 1QCZA 4KGXA 3JQ7B 1UZUA 3HJTA 3B2QA 3M3HA 3ECAA 4WXHA 5CH8A 3UCEA 1H6DA 2FXVA 2WIAA 3FTCA 3HWSA 5ENZA 1N6LA 4M8KA 1UM9B 3IIEA 5BYJA 4ZPJA 3GH3A 1X39A 2HDHA 4Q34A 5PNTA 4CLOB 2BM8A 2XUFA 1E3WA 2ZRCA 3GG9A 5G0SA 4O2AF 3SP1A 5SY4A 3C6XA 4ETMA 2NU6B 5LU9A 1YZHA 4X7MA 1C3OB 2NTVA 1MQ8B 1XRQA 2V7QA 3NX4A 3FWNA 3HM9A 1OYWA 2R65A 5IHPA 2M98A 2VHXA 3ZE7A 1C0KA 1J2UA 3DAGA 5LYYA 3KTAB 3GARA 2GM9A 2WF6A 1E9FA 3ZH2A 2ES4A 2R8BA 1ESEA 4I8IA 4ZEMA 1NT4A 1G3MA 1CDOA 4TMWA 4C7OB 3VTFA 2ZSIA 1Z82A 2VNKA 4WOKA 1T6NA 3WGTA 1NN3A 4JA0A 5HIKA 2YY6A 2EFJA 5IVIA 4OI2A 1XD9A 2PK3A 4A3SA 4PZYA 4AJJA 2IIBA 1RQGA 2J67A 5A9RA 5I7RA 4LHVA 4F38A 4B82A 621PA 4UUNA 2Z6UA 1LLQA 4KKXB 5CA1A 2W5UA 2V7EA 1U81A 4R2JA 3S40A 3U9LA 4B5LA 3E9YA 3R8XA 5KOHA 2E37A 1XK7A 3LL7A 1WE2A 4L6AA 2QD3A 3UT0A 1KY2A 1N3IA 3G0IA 4NSNA 4TTJA 1P29A 4RPHA 4YRAA 4CKWA 1YTLA 2CMHA 2OQRA 2X5OA 3DWGA 3RS0A 3HC7A 1OLXA 3DWEX 3DBHB 4JC8A 4I3FA 4DY4A 3HY4A 1XZNA 4RTMA 4ALLA 2VK1A 3M6FA 4ASUD 4CQJA 3OEWA 4A26A 5IT5A 1JECA 3FWZA 2W6MA 3CSSA 1HQKA 2ECFA 4Q82A 4WLEA 4G5YA 1K7SN 2VHZA 5A9TA 4NCNA 4L1KA 4BNKA 3JQAD 5CVUA 5BSMA 5CLHA 4BRUA 1EVYA 5J2TF 3DWIA 4GDMA 4FGLA 3GRAA 5CR9A 2VNJA 5JCXA 4I4TF 4FJ1A 2EQ5A 1THMA 1VG9B 2A67A 3ZNPA 4FOTA 5HKKD 1F3OA 1QK3A 2R6HA 2VHQA 1Z13A 3IOMA 3LH5A 4XX0B 4LNUA 4NOLA 2P6MA 4B2LA 1MAUA 2OM6A 2VPWA 2DHQA 4YRTA 4A2PA 4D41A 2HJGA 2UYYA 2C04A 3C98A 3ELDA 2ORWA 3RIEA 3RK4A 3SEAA 4AZWA 3CLHA 2DBVO 3AUSA 4RQUA 3CLTC 2ICAA 3HG7A 1ZCJA 2OO5C 4JVOA 3FVQA 1L4FA 4NNPA 2JA2A 2XUIA 4O4HF 2E1RA 2F4VB 1LS6A 2ZRQA 3RC1A 4CIXA 2MU1A 3BTUA 4R6WA 2QROA 3AR2A 4YCBA 4E33A 1FFEA 4RZIA 3V5NA 3RAEC 2V54A 1KVTA 5CXXA 1R5BA 1PVOA 4O4JA 1Z2EA 4JVLA 2H1SA 1NZFA 5CURA 2IEGA 1O5TA 2FPLA 4G4JA 1LA2A 3CVWA 2WU3A 3DL0A 4AXXA 4WZBA 4S0ZA 3PEEA 1OAAA 4R6XA 1U0RA 2V3WA 3K8QA 4QXPA 2HLDD 4ZCLA 1D1QA 4IVQA 5JEDA 3PS9A 4FGWA 3CUVA 3ND9A 1JG4A 4FOPA 4PR0A 1AHPA 4W5OA 2YOGA 5C0OE 5JZOA 3DYIA 5EUBA 2BSXA 3E4CA 4RIHA 4C7VA 3D0KA 1TMYA 1TKRA 5KOIA 3K05A 5AW0A 4DIDA 4DLPA 1U3VA 3LAWA 2Q2QA 1TZJA 5AUQA 4C03A 3KHSA 2WT8A 1Z26A 4IIEA 1P74A 5EMMA 1U0NA 2HZ7A 4RTNA 3UKJA 1P31A 3OCWA 2YRXA 1D2NA 5ERYA 4EDFA 1CFZA 3AP2A 1JJFA 1HZZA 1NI4A 2XE6A 1SIOA 3WGLA 4EI7A 5JQGB 1U6IA 3EMDA 4R54A 4W9MC 1ZRHA 4NONA 3DOFA 2W2NA 1EI9A 2WC1A 2BFCA 4G4SP 4HDAA 1H1LA 1Z0KA 2GWRA 3SQLA 3H75A 1ZONA 1RPJA 1UQRA 4BFVA 1FPQA 3AP1A 4CL3A 4M7OA 4FGUA 3HLYA 1D04A 1BA3A 2HU5A 3Q9SA 1AXEA 2I6SA 2C42A 4ZQEA 4XYMA 3W9BA 1D07A 1TLLA 1XHLA 2QOEA 4PC1A 4U2FA 1PK9A 1YIDA 2FQXA 4LSWA 4RJKA 2C5FA 1L7DA 3JTEA 4DGSA 1A4IA 2Q3CA 2WG0A 1QKIA 5BRJA 3MMPA 2AB0A 3H18A 5EJ5A 1DUIA 1XRMA 4AF8A 1A76A 1L5FA 2GZ2A 2YFYA 1G0NA 2WJVA 5EHZA 2YJ3A 1SVIA 2L82A 2XSZD 3RLFA 3FOWA 3IP8A 3HV2A 2HHHB 4RF4A 1MG0A 3BX1A 1E5DA 3T5TA 4D8WA 2PWYA 3W78A 5BV8A 4RGQA 2IYFA 4IVPA 4DCSA 4EABA 5I7HA 3R6LA 1IUOA 2W6OA 1IN4A 3ZY3A 4WGGA 1NI5A 4LZWA 3SJ7A 5LL6P 1VP3A 4PZLA 3Q1LA 5DYTA 1UFVA 1PZGA 5CHEA 5LMNB 2DLCX 3G02A 2E21A 3AF3A 2W2XA 3ORFA 1W4BA 2WTAA 2GHQA 1LUAA 3KC2A 2JLVA 4FFDA 1CZKA 3PHHA 5K3DA 5C9ZA 5JO0A 2HIMA 3FOBA 5EYPA 4E5PA 5EE9A 4YJKA 1GZSA 1LPOA 1GCAA 2DM6A 4NQRA 2QWXA 3KZ1E 2IVFA 1YMQA 5HQTA 1E9DA 3PD7A 3ABIA 5EY5B 1WZEA 3AESA 3DPUA 1UBEA 2PS9A 5JYEA 2BL4A 5THXA 3UC9A 1KR2A 4A4DA 1PTJA 2IOQA 1SQ0A 4Q6WA 2BF7A 3H42B 2O14A 3P2MA 1IEQA 4KO8A 1SZPA 3NYRA 3QG1A 2R60A 1QHSA 3A2NA 2ZZKA 3AIOA 3MT9A 4FP9A 4MIKA 3ZY6A 3NHZA 4AQYB 2DQ4A 1T2UA 1Z88A 1PBNA 3BS4A 2C0PA 1XFAA 3BWCA 1E0KA 3LFUA 4IZHA 3HR8A 5JCJA 5CYPA 1JR3E 1XJCA 3H6KA 2NUAB 2OSBA 3DVQX 3RG2A 1GQ2A 2QY6A 5FOTA 1D2HA 3EH1A 4IHQA 1QV9A 5IM5A 4Y7DA 2V9ZA 5AW7A 5I4IA 1S2DA 1F8UA 4FZVA 5JAIA 1VBFA 3U4MA 2B5WA 4Q9AA 3LWBA 3N86A 4GYYA 3WL6A 4CF3A 3AG5A 4RD3A 4C29A 1IHDA 3OSZA 4CF5A 1I4EB 3LTNC 1SD2A 1XYGA 5F7XA 5CNMA 4RTQA 1ZN7A 1Z6PA 4Y1FA 4NEHB 3WK8A 2NGRA 2XF2A 3L8GA 4PICA 1BMFA 1YQQA 4O2BF 5B57C 1KGDA 3CTMA 1Y98A 6Q21A 1R4MB 4DB4A 1U0EA 3TGWA 4MSUA 5K6RA 1H66A 2JCYA 4Y9UA 5DEIA 2QRHA 2FY8A 4RPIA 2WOJA 1MV5A 3HB4X 3UYLA 1IIRA 4YFYA 1KQGA 3U31A 1VCMA 4OI4A 5TMEA 4P54A 2PRZA 3H19A 3TZBA 1W85A 4OHOA 1U0OC 4GLJA 1KRXA 2CZCA 2R00C 4KWTA 4NWIA 3L8DA 3HQ4O 1H6BA 1RVV1 5DSTA 1P3Y1 1UJ6A 1U80A 3OZBA 3K2IA 2O2YA 4KP7A 1NR7A 4I9GA 2ZB4A 3A25A 3FPAA 4L5IA 3RC2A 1WBDA 1N9GB 3VKFA 5C1OA 1YAHA 2D5LA 2B20A 1AQNA 1E79D 2PZFA 4TKUB 1WXHA 2B0JA 1HE5A 1KBZA 4IDEA 3AWIA 3RFCA 4B44A 1U8ZA 3OH8A 3VOBA 4KNYA 3W5AA 10MHA 2O7RA 3TOXA 4MJXA 1O03A 1X0XA 3R24A 4OU4A 1IJFA 4LRQA 3GJRA 4OSOA 4DM3A 2H9IA 3UN1A 2G88A 4KX3A 2JKVA 5D1HA 2AOUB 3TG8A 4U2EA 1ZIXA 1DEHA 2JIRA 2J9XB 1ENPA 3DV2A 4LXHA 4UHJA 3CX4A 5IJ0A 3PR1A 3REGA 3WKEA 2UZ1A 3KCQA 2QTGA 2PA3A 1Q5PA 5ARCA 2YV1A 3TW0A 4EB3A 2D7CA 2YRFA 4CF4A 4ZK2A 3OTGA 5B30A 5KHAA 5IXJA 2C3OA 2X1VA 2HEIA 3AKEA 4TMTA 2G71A 3AUYA 3OQJA 3IA7A 4WLFA 2YMPA 1SUWA 2QUBA 3O0DA 2AXNA 3I6YA 4QPCA 4ZAVA 3ZOZA 1WIWA 2FDRA 2ZI9A 3C14C 2AF3C 4HQKA 4NLLA 1RNLA 4B74A 1W5FA 3U62A 2QTHA 3SZGA 5JJBA 1RKQA 2NYAA 4EQZA 3GGOA 3AL0C 4RS4A 3UNXA 3B1ZA 3PXDA 2BGRA 4RVDA 3DFMA 2FFQA 4II2A 1X7WB 2BWJA 3IYLW 4B6GA 3O4RA 1YT5A 2ZB7A 1N75A 5DNYB 2Y0PA 4ENQA 4POAA 3K1AA 3PKIA 4NATA 4NH0A 2OFPA 1PUJA 3PNKA 1N4DA 5FPHA 4QG3A 1E89A 4OXIA 3VH1A 3DMFA 4CR7A 5INTA 1JXAA 3T99A 2RGNA 3RVQA 2X0RA 1TVMA 3ESYA 2XOEA 4N65A 3UQZA 3FLEA 3HYTA 1Q84A 3WLPA 4F8EA 1AGRA 2PZKA 4ZV9A 4BQEA 2X8JA 3RFTA 4G0OA 2Q3FA 3ZWDA 2EL9A 3OIFA 1J70A 1NPTO 4DTIA 2WB2A 3BDVA 1SK8A 1T4CA 1BIFA 1MQ9A 2O0KA 2XYVA 2Q21A 2RK4A 1H5NA 4IICA 1IHPA 2H4JA 1Q57A 3EYWA 2VRCA 4OHKA 5HZKA 1P9WA 2VDPB 4XGRA 2E87A 1O95D 2HK8A 1YJAA 2IOFA 2OK8A 5FWXA 3WGJA 1TLFA 3F3KA 1FOEB 5EA2A 1O6GA 4HDRB 2V4MA 1CY7A 4FIDA 4DKXA 4FYXA 3ONVA 4EVSA 3L79A 2O0JA 1P9OA 2YVUA 1GM5A 2BFDB 1O57A 1IZ7A 5FPKA 2QRVB 3C4VA 1H69A 4MK4A 3I9MA 1NW3A 4IG9A 1UPAA 4M8LA 2C98A 2VPYA 3EBLA 1OR8A 2BI8A 2IHBA 3PGLA 1RLOA 4KPUB 4IEIA 4EHAA 5EG5A 3VKWA 3BK7A 3WL3A 1OYVA 1PNVA 2CLIB 4GF5A 3VVLA 4G5FA 3LRPA 1T24A 2VP5A 3O93A 3ZS9A 1JLLB 3E84A 3KD2A 3KLNA 2GDJA 5LQAA 1FJHA 1WMAA 3SX4A 1E32A 1Y3CE 5A6SA 1PEKE 1DSSG 1M5TA 3HN7A 4D3ZA 3AVVA 3DUWA 2ZRIA 5H83A 3OQOA 1OXTA 1MDFA 1N7IA 3IAHA 2AC2A 2X1HA 4S1OA 5COAA 1Z68A 3FSGD 4PFJA 3YASA 1RI1A 2ZT7A 1E62A 4DSAA 1LC3A 1RM4A 3G5LA 4OK5A 1AGPA 3SEFA 3F1LA 5FTNA 3HCRA 4RESA 1UKEA 2APJA 3KSZO 3GVPA 3DVSX 5DYWA 3VI3B 1JXMA 2EZUA 2Y6VA 2C78A 3TAXA 1QLHA 3PBKA 4XB2A 3ZY4A 3J81A 1UFQA 3IDAA 2PL9A 1NRWA 2YQZA 4HHEA 1HL7A 3SJZA 5AKGA 3RV3A 1PSWA 4A2CA 4EJ6A 2CVQA 2VDNB 1UKBA 1W581 1AXRA 3K4HA 2G63A 4JB2A 2XV1A 2Y4OA 1MB3A 2NV2B 3E7DA 2EGGA 5FNVA 5LUBA 2BGLA 2C31A 2BDTA 1K08A 2WSBA 1NF9A 3DTYA 5C4GB 2QVBA 3SG0A 5KDLA 5BWMA 2WBLC 5JPIA 5THKA 1MORA 1JPUA 3QTLA 1TL7C 5ESDA 2DJ5A 2FRVA 1GNTA 1YB1A 1RTKA 1D6MA 4JT4A 2GEBA 1M1XB 2ZSFA 4RTOA 1XMXA 4QOGA 5A71A 4FXOA 1OWLA 4AMUA 4IIBA 5A7HA 2CF6A 3FNIA 4RACA 3E0QA 2H9AA 3QPVA 2YWGA 4INOA 3VR3D 2PX4A 3WOVA 2QTVA 2SHKA 1U1DA 2HBYA 4J9VA 4UNIA 5IAJA 4ESHA 2VR1A 1ULAA 4EBBA 5H1YA 3VXKA 4QXMA 1IN8A 1PWZA 1DO8A 3L49A 5KTNA 1EP3B 4H1HA 2A88A 4TL6A 1ZNZA 1ZC4A 2QE7A 5BUCA 1F8FA 5JVDB 3K0AA 1SCDA 5HG0A 1MC8A 3KXPA 3MNFA 1DG1G 4FYJA 4IFEA 2ORYA 3RRZA 1ZJ6A 3OKCA 4L28A 4PX9A 2OM2A 3RIHA 2NOAA 4HB3A 5JMPA 3ETGA 4BGVA 4N7MA 1QC5A 2AD1A 3AHGA 3OZTA 2RHOA 2NUTA 4GRDA 5BV2P 1XOIA 2OFXA 3PHGA 4FHGA 2PX3A 3NYQA 3R6GA 5JJKA 2ZCUA 3CRZA 3N7UA 4TRNA 5DV9A 4NBVA 4G4GA 1K88A 4JZKA 2FPPB 1YI0A 1KSJA 5K05A 5DHTA 4IXDA 4C78A 4NNOA 1A96A 1OXMA 1N2XA 1T9HA 4M87A 2ZUEA 2BLNA 3H5AA 4L5CA 2XMQA 3FRIA 5AOCA 3URKA 4B80A 4RZQA 1JUDA 5B4TA 5TQJA 3A4TA 3L6RA 1VL2A 4AT1A 1C7QA 4F3YA 2V7VA 5BXYA 2O0LA 2EZ9A 1S8AA 1ZIYA 4AQ7A 1Q16A 3E15A 1UJ5A 2JAHA 3AJEA 3VZQA 1X3SA 2FH5B 4FE7A 3VZSA 1X7ZA 2YXLA 3ROMA 2H2AA 1A8HA 5CIYA 3THXA 1Z38A 2SKEA 1BDHA 1ULSA 3PXBA 3I5MA 1R6VA 1XBTA 1J33A 1WPXA 1BKSB 4D57A 3HYRA 2ZBVA 5CT6A 1FA9A 3JYNA 1KK0A 2ZJAA 3LPAA 1Y80A 1TC1A 1UPUA 2VHEA 3GK3A 1GGKA 3NM5A 4GE0A 4BNJA 2A4KA 3DS8A 5T7BA 3AL3A 2X0EA 3U7EB 3VH3A 2PXCA 3IJRA 4GXNA 3FW1A 3HSYA 4S3MA 1XEFA 1YZNA 4KRYA 2J46A 3WQRA 1KYZA 1ZJ4A 2WI8A 4UHBA 2ZJ7A 3GQBB 2Q4TA 2CCGA 4Q3KA 4AYXA 4ZCTA 3BXEA 3FMFA 3H4TA 3IEIA 1YZLA 2ZRFA 3CH5A 1IZ8A 4F0JA 4IVRA 4ZRDA 3VHLB 3N58A 3PJEA 4I6JA 1P80A 3AM4A 2Y1CA 1RBYA 3I1JA 2ZWAA 4PFSA 3RABA 4WY8A 4TTVA 2AEMA 4FIZA 4G09A 4J0HA 5AOVA 4B6RA 4X1KA 5EXDA 1GOTA 3KZVA 2MINB 1J97A 4FMPA 3U4AA 3H2IA 4OFWA 3QE9Y 2QG4A 4HN9A 1YQDA 1J8VA 3URMA 4BJ1A 4GX0A 1UBCA 1FDUA 2JJ2D 4YUWA 3NI2A 2A35A 3G2NA 4NJMB 4U9UA 4E5YA 2VYVD 2PNJA 3BREA 1INLA 1DWQA 3LO8A 3OLXA 5ADVA 5LSAA 5AT1A 3OPQA 5K51A 4RHYA 1KTVA 3KQHA 2GERA 2NZ8A 2R8OA 1P7ZA 4N0QA 1R6XA 4NV1A 2IA5A 3MTQA 1F2TB 1NN0A 4QX6A 3P9XA 1XDUA 3FYUC 1GCGA 1SM4A 1CIJA 3NHYA 4GMFA 4L5YA 3W4KA 5FWYA 1RRFA 2PTHA 3EEBA 3ENVA 4OHZA 4D4GA 2Z04A 3IIIA 3TSOA 3UT5A 2W70A 2GXQA 3T5GA 1PFKA 5H7XA 4D9GA 7AT1A 4G9EA 2FF5A 2RGGA 3FYCA 1SHLA 2NO6A 1QO0A 4FCVA 2A9KA 3AG6A 3CKLA 1XZLA 4KN9S 3VNBA 4MITA 1FNBA 1UMKA 1SXHA 2VS1A 4H4EA 3FCSB 5E9AA 1M1YE 2P91A 4LNAA 4ZANA 3S2ZA 3OA0A 3AEQB 3DW3X 4L57A 1ZIPA 2B82A 4U7JA 3MBIA 3WXMA 4HPWA 4EYSA 2PVPA 1YJXA 3MLAA 3PEFA 1BJKA 4BOYA 2CNKA 1ZL0A 2H4XA 1QM5A 4WKNA 3RT1A 3IOCA 1HLPA 1VLJA 5DOVA 4HAOA 5DHFA 4DA0A 1EGMB 2FEWB 1K7FB 5JS8A 1P33A 5AM3A 4H7KA 3SC6A 5CD1A 3V4OA 4Z99A 3KUCA 4CETA 1V9CA 3IKTA 4BEVA 2OZLA 3FLBA 3HYCA 3PWTA 1KMCA 4O6VA 1IB6A 5JH7F 1E7SA 4F5EA 4U2DA 2DYKA 3QOYA 5EIBD 1P2SA 2FPGB 4JOSA 2X0FA 3TAHA 2XUKA 3RJZA 3P96A 3LGXA 5CK4A 3P32A 3A0RB 5GVSA 3EGXA 4KMMA 4MP3A 3ETDA 3HJFA 2BVNA 2QV0A 3AJ9A 4QJ3A 2I2WA 4NBRA 1GADO 3D0RA 2UYCA 1LNQA 2BZ1A 3S2GA 4EVIA 2ZIGA 1YS6A 2L42A 4ZU3A 5B36A 5BSWA 3MT7A 5EJEA 4B3BA 1KEWA 2JKZA 2X76A 3FFWA 2VJYA 4BX2A 4AKHA 3I9JA 3K5WA 4FEYA 1ID1A 4LYEA 2IYEA 1A8PA 4JB8A 3PGKA 2MMCA 2OBFA 2YUTA 3RW9A 3OLCX 1NM5A 2HYDA 2LP4Y 1QKKA 3CB2A 2XNJA 2L19A 4RA9B 4RWEA 5F12A 8GPBA 5KNDH 2V7GA 2ZM5A 1LQUA 2AG6A 1TU3A 2WD7B 3KR0A 2MTBA 1I01A 4KAXA 3O8CA 3TTXA 3W5CA 5H8WA 4M0EA 2JNWA 5AXAA 1DZIA 2ZIAA 4K9RA 1IEXA 2I7CA 4WXMA 4HQFA 3BWMA 2KE5A 5D2CA 4ARCA 5FLEX 2VA9A 1CQIA 1ORIA 3HJGA 2HF8A 4UAUA 5L3QA 9ABPA 5EHQA 3VU3A 3IBYA 3GJ8A 4MMXB 3E27A 3TPCA 4RDIA 5A3SA 2Y92A 3EIWA 3NAMA 3AW8A 5KWSA 1JE0A 2WWTA 1IQPA 4D0LB 4HYYA 5JSHA 3GFOA 1PE0A 2AN5A 3BD6A 221PA 3L0PA 3R44A 1UC4B 4OFBA 2HHJA 4PWZA 3HI4A 2YWCA 5F2KA 3TDNA 3O4JA 1D7AA 1SC9A 2VDKB 1EUDB 3CLSD 1DLJA 3G2IA 4NCKA 1VHQA 1RLMA 3UJ9A 1X13A 1TU0A 3VHQA 1NJFA 1GV0A 1V8PA 1C9KA 1V8ZA 2XXAA 4H7JA 3SXUA 4CEIB 3PI6A 2GUGA 4FMDF 5EJAA 3LPNA 3LCRA 1Z28A 1TT7A 4UJ3A 4GWGA 3SDBA 2DKOA 3N0XA 2HHLA 4JQZA 4MV8A 2QN2A 1LK5A 2FN7A 3CZQA 4PFQA 3TD9A 3OAAD 4Y2GA 3ZYCA 2IYNA 4OX9B 3C8UA 4KW7A 1U63A 2P2ZA 5FJJA 5BVGA 5P8WA 1PWHA 1FYEA 4YRLA 2GPJA 5FPTA 4PRYA 2B94A 5HJ2A 3G2LA 1HH4A 1ZOPA 4YROA 1SQFA 2Q5QA 3L6CA 4QA9A 3JQCA 1PJAA 3VKVA 3BKWA 3EC1A 5JZMA 1D6NA 4ENSA 1EX7A 1RRMA 2PKXA 2ZB3A 4X5OA 1ZIOA 3PHJA 4B3IA 1UJCA 4QGBA 1JDVA 2ZRBA 3GVXA 3ETCA 3U17A 1M5UA 3PJFA 5ARBA 6NULA 4BIMA 2QD1A 4Q4AB 4G25A 4KL8S 4UHDA 3AU8A 3W7BA 4RLQA 4YRSA 2BP7A 4HYTA 4FDAA 1JPVA 2QLMA 3ABRB 1XRLA 2IHTA 4M49A 1IU9A 4U8GA 3TKLA 3ZI7A 3QF4A 4PONA 3R76A 3KRTA 4BJ5A 2CL0X 3VVCA 2GN0A 4NQZA 4R9VA 3QLEA 5T8KC 5DRYA 2QW1A 5I7EA 5BW4A 4P31A 2LD4A 2F1RA 3SFTA 4CIWA 3QX7A 2H4FA 3TTUA 2HW8A 1SIUA 1PR3A 5IS2A 5CLGA 5LZ8A 1KMNA 3IO3A 2FP4A 1KK2A 1TQ6A 4CQLA 2E4XA 5H4HA 4OKSA 2NVUB 3GJSA 3WLNA 4V0NA 3EXFA 3FKJA 1LPAB 2W93A 1XT6A 3NQ41 2P9YA 1TF5A 3IVCA 3T5AA 4G1FA 4ZT3A 1N2SA 2D1SA 5FP0A 2ZYGA 4YB8A 5DGTA 2IYPA 3C6BA 3RT7A 4RTJA 4K9KA 3WLFA 1XZPA 2RGYA 1FRNA 1FFHA 3MILA 3C3EA 4E07A 3C5EA 2AV6A 5F3RA 5LFAA 2JCGA 4RKQA 4OTZA 4DMKA 1F1BA 1XQWA 3O8OA 1JDNA 4BV9A 2BZ0A 4TV9A 3ESCA 3N9IA 3EXHA 2W7TA 5CLQA 2FWJA 1DKPA 3I1IA 3IALA 5FULA 2YMLA 4RANA 1QHFA 3T6KA 3IVXA 1N5LA 2FSPA 2ADFA 3EAFA 4NU0A 1POWA 3QENA 4WKPA 3JW8A 3LSTA 1Y9EA 1SHKA 3PFKA 5C53B 1JHDA 2PMEA 5DHSA 4KNVA 3N0RA 3HVJA 3DZGA 3QVKA 1A97A 1OFGA 2IIQA 2NO7A 2M2IA 3TNYA 2AJTA 2OCBA 2Q0XA 4TV8F 4UEKA 5CRIA 5BPHA 1PF7E 3WNZA 2ZW9A 5JRZA 5DBFA 3DZCA 2IWHA 1NP7A 4KRXA 4CM6A 4NJEB 1L0BA 2VXOA 3HYSA 5B6PA 4UTRA 2AN1A 2RFLA 5FA6A 1TTPB 3QE4A 1PVVA 2NSLA 1OH8A 2PSHA 2LCFA 5MF6A 2BRUA 1X8JA 2R4QA 2BM0A 3IAEA 3JASB 1T26A 3IODA 5FI3A 5KB3A 5G3YA 2FPXA 2JI6A 2QZ4A 2YUIA 4R0NA 1R6AA 3OICA 1S2IA 3BZUA 3WHIA 4TT3D 1HKHA 4AZ3A 3KXDA 4ND5A 3NHBA 5HJ5A 1C4XA 1FVFA 4KUEA 3WLMA 1W87A 5F98A 3NETA 4B3HA 4DR4B 2I34A 4BFYA 2XIQA 4QNNA 3PTLA 1ETHA 1M8KA 3EBOA 4KAJA 3FAZA 1SU4A 5DGIA 2PUDA 2NLOA 3EC2A 4NS4A 3UUGA 3V1UA 4KE8A 4ZHQF 2BD0A 3E2PA 3G5TA 4I1IA 2NSDA 3TVTA 3TYXA 1NR5A 1X8XA 2XMSA 2Y76A 4YDSA 2GF2A 1NUUA 1ODCA 3QLJA 2QRZA 4UOQA 3TXYA 1O9GA 5K0SA 1G60A 2KBFA 5EFZA 1IN6A 2FG6C 2VL7A 4NE9A 4L51A 4IMPA 3COYA 2FA9A 1N6HA 4P82A 1IRIA 3VA7A 2ZRNA 4MR7B 2QP3A 5G4LA 4B46A 1PR4A 1CUJA 1E66A 1DRJA 1UPFA 1ORTA 1ZD4A 3U3JA 3CNNA 2L17A 3HBNA 4XGKA 4DLLA 1L1EA 2GVNA 4QJ4A 2JJYA 1QQBA 4BAUA 1JIXA 3N2NA 3OPMA 5JXJA 2GAJA 3WNQA 5FD8A 4ZT5A 4JUFA 1JJ7A 1A82A 3MA0A 4B4OA 4LKOA 1X14A 4Y2HA 5SY6A 4JU9A 4XIFA 1ADCA 3COZA 3FETA 2WQ6A 2F1OA 1SHUX 1EXVA 3KKOA 1FBTA 1RLJA 1WUIS 2BMJA 3SIPA 1GNRA 3IUEA 5JNUA 4LCBA 4XQCA 3B1WA 2J1LA 4WJLA 1G20A 1L7NA 1KDOA 4M54A 2J9GA 3B1VA 4N8SA 4ZA2A 5BT9A 4QJ5A 3BFKA 3HFSA 1R8SA 3FVRA 2H3HA 4BB5A 2CVHA 2PAFA 1P1IA 1PR9A 4Q66C 1Q74A 3VJRA 3W8RA 2NXWA 4UFPA 3GWGA 2PHZA 3F5DA 1UMDA 3QXXA 1JFVA 1EU1A 3PQ3A 3NHKA 4CR8A 3C1AA 1X9HA 1Y8RB 3KOOA 3QWFA 5ALVA 5DGDA 2FQWA 5JRJA 4K2HA 1QJ4A 3W1VA 5B6IA 1VTKA 5F2EA 3QVGB 2WHXA 2R9VA 2ZJ5A 4B3FX 1KH2A 3IIJA 4DIBA 4AX8A 1Z5GA 1FFDA 4YJ3F 1CRWG 4DQLA 4PLHA 2YV3A 1F2UA 1N2CB 4OEHA 5IK2A 1L5WA 1KEKA 2R47A 5H3LA 3E7XA 4HWPA 5JWRA 3OJOA 2H0AA 4WLUA 1GKKA 4DMMA 3AYXB 4KQXA 3VVMA 5IH3A 4NYMQ 1ZUHA 1UDBA 4TLBA 4G0NA 3AEYA 2OK7A 3Q9NA 1ZUD1 4U5QA 4M9ZA 4CR6A 1NJ2A 2RHTA 4XWKA 4QBHA 1TZBA 4QTYA 4N49A 1M72A 1T8TA 5KYWB 4IGKA 3HBAA 3W4JA 2YHUA 4XVCA 4I55A 2IUTA 4FT4A 2VDVE 5HJEA 5BR8B 3AI7A 4P34A 2EIHA 5I9SA 5EERA 3V8NA 2QGNA 3ZIUA 3SX2A 4YNBA 4GOKA 4RK1A 1NSYA 1FYWA 2SBTA 3GLGA 5F5LA 1Y1RA 4TS9A 2GPNA 3UGTA 4J0DA 2V45A 5BV7A 4BNIA 4Y9SA 2ERCA 1IN1A 2DUUA 4I5DA 4EVQA 5I9IA 3WA7A 4OH7A 5F1PA 3VPBA 5HXAA 4O1HA 3W2TA 3U3XA 2CNDA 1W52X 3SNKA 1CEYA 2PRKA 1DC3A 2YIJA 2CB9A 5FHQA 2EKLA 3E58A 1E6CA 1U3DA 3MINB 4OIMA 1E2DA 4UTXA 3PQ7A 5CDFE 3A6GA 2Z6AA 4FOSA 2IOHA 1A71A 2C4WA 2REQA 3QFSA 4IV5A 4URXR 1RW4A 5L6LB 1GN8A 1U7ZA 2OEPA 1R5NA 3KEFA 2PJZA 4PSVA 2Z8YM 3DCJA 3BSYA 4HKTA 3DE5X 5E4JA 1V1RB 2AXEA 3CIFA 3VSAA 5DF1A 5DZSA 1Q0SA 3UC5A 3OA2A 5IBCA 2AKYA 5K3OA 4U1RA 3ZWXA 3ETJA 2QSYA 2SECE 2UVDA 4PLFA 2PUBA 2WJ4A 3WAGA 3GJ3A 2G9VA 3DAFA 4AKGA 2QG9A 2QU7A 3KJQA 4GPEA 3WZ2A 5ICSA 2IS1A 1HKUA 2JGKA 3KM0A 1IEWA 3FZQA 2IP4A 2WZDA 4JLUA 4CM9D 2WABA 3OOWA 4E5DA 1FNSA 3S29A 3ZZUA 4CCSA 1BWQA 2X15A 1T3GA 3HVUA 2KQUA 4XYLA 1BKDR 3AHIA 2GCPA 1AE1A 4Q3OA 5D5HA 1Z6ZA 3N39C 4HUJA 4HXEB 1MO3A 4H16A 1NLZA 2Q41A 2ZUTA 1ST3A 4MLPA 3ZDQA 3AW9A 4DS3A 1A4RA 5J1SB 1WO8A 2C83A 4NARA 3JWEA 4LTMA 3JQFC 5KCZA 1M2GA 4ZGWA 2XDQB 2IOFK 2KYRA 3W8DA 3QVSA 2X8AA 3CF4G 1FEZA 3CUSA 1QIGA 3D3QA 4GI7A 4XPIB 5CB8A 5FLXA 1T35A 2PZJA 1Y1KE 4GH5A 2FR0A 2XEDA 3LRTA 2WKWA 2JCXA 1C7JA 4K6MA 2RB4A 4GMDA 5LP6A 4CG2A 5BMOA 2CNWD 4OGKA 4X8OA 1Z4LA 2J6CA 1YQ9A 3WRXC 3NDBB 1T6BY 5TY0A 3CEHA 3JQAA 3K1YA 3OMLA 3G6KA 5GY7A 3R0IA 5TPZD 4MA0A 4MO2A 2YV5A 1XC7A 3NLLA 4Y0VA 3SBXA 3BICA 5AI6A 2CJXA 3FNFA 3QRWA 4D9IA 4X3CA 4P5EA 3SLGA 3FG9A 1GCIA 4D56A 3Q7RA 5AJWA 4C9BA 3GRKA 3VYRB 2RHGB 2QN1A 1G8HA 4M0KA 2TMGA 4YMWA 2OCDA 1DFIA 1X70A 1OFHA 1TYEB 3LIIA 4IHJB 1XVUA 1D2GA 3AK4A 3HXPA 4V2UA 3WSTA 1OI2A 4YCSA 1WPQA 3ZJUA 3K0FB 3GEBA 3MCTA 1U2RA 2O8DB 1HYHA 1OBFO 2VYQA 4F86A 1PBTA 2OBLA 3DE1X 3ANTA 3AF5A 3IPRA 1KAOA 3JALB 4JLVA 1M54A 4D8YA 4QQFA 1H4VB 1O0BA 2Q3BA 1NULA 3E61A 2HEGA 1QGUB 3PL5A 2EJVA 3K70D 2FJUA 4TRRA 1G8SA 2EKQA 1VE3A 2X2PA 2EHJA 3C74A 4O4LB 1C0IA 2IUSA 3L6BA 4R98A 1SBCA 1Z18A 1ZWLA 3KNZA 1HE3A 4PYNA 4IQ0A 5KMGB 5DFAA 3N7TA 3OURA 5IAOA 3FTQA 2R8YA 4JVMA 2DWQA 3I3SR 5HRUA 3CZ5A