3TOVA

The crystal structure of the glycosyl transferase family 9 from veillonella parvula dsm 2008
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
348
structure length
348
Chain Sequence
SNAMELDYKRIVVTFLMHLGDVILTTPFLEVLRKAAPHSHITYVIDEKLQQVMEYNPNIDELIVVDKKGRHNSISGLNEVAREINAKGKTDIVINLHPNERTSYLAWKIHAPITTGMSHFLFRPFMTKYTRLDRKTRHAADMYINVLEQLGVTDTSNSGLHIEICEEWRCQAQEFYSSHGLTDTDILIGFNIGSAVPEKRWPAERFAHVADYFGRLGYKTVFFGGPMDLEMVQPVVEQMETKPIVATGKFQLGPLAAAMNRCNLLITNDSGPMHVGISQGVPIVALYGPSNPFFYGPYQAHAIVLETMDSYEIGKSMKKIIKEGNYKGLSVISEEQVIKAAETLLLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycosyl transferase family 9
publication title The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008
rcsb
source organism Veillonella parvula
molecule tags Transferase
total genus 103
structure length 348
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01075 Glyco_transf_9 Glycosyltransferase family 9 (heptosyltransferase)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3tovA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3tovA01
5I45A 1NVKA 2QLMA 2XCUA 4CDRA 1SXPA 4BQIA 4AN4A 3BD7A 1WW3A 3S28A 4WHMA 2BISA 1H5UA 2QNBA 4N3BA 3Q3IA 1VGVA 1JG6A 1JIXA 1WUTA 1IXYA 3T3DA 1XL0A 3NPAA 2QRGA 2XGMA 4EKEA 1L5WA 4MI3A 2X0DA 4GYYA 2VG8A 2QN9A 3T3EA 3TOVA 1GPBA 3IA7A 1E4OA 4X7MA 3NC4A 1Z6QA 2XA1A 2QLNA 4YUAA 3CEJA 4N9WA 4LEIA 3G2NA 3CV3A 1WV0A 1J39A 3GUHA 4GZ5A 3RSCA 3L7CA 3MRTA 1XOIA 1L7XA 2YJNA 3BDAA 1K08A 1WW2A 1Z62A 8GPBA 3D0QA 1FU4A 2IV7A 1FTYA 2P6PA 3NP9A 2Q6VA 4N39A 2GEKA 4Z5XA 4FKZA 1FC0A 3CEMA 3UYKA 3BEOA 5LQDA 3ZCPA 2PYIA 3WADA 3QHPA 3ZCQA 3DDWA 1UQUA 1LWOA 3OT5A 4M60A 1C3JA 2F3SA 2ZB2A 3NCHA 4X6LA 1K06A 3S0JA 1YGPA 4X7RA 1LWNA 4L22A 1L6IA 3NP7A 9GPBA 3MBOA 4CTMA 2FFRA 3MRVA 2AZDA 3PE4A 3VDMA 3T3GA 2QN1A 1FS4A 3FROA 2QRQA 1JG7A 2PQ6A 3RT1A 5JTUA 1P2DA 4PQGA 4MI6A 4EJ2A 3EBPA 1PYGA 4M83A 2GPBA 2XMPA 5HXAA 1P4JA 2PYDA 3BCRA 4AMBA 2XGSA 2IW1A 4GYWA 2AW3A 3OTGA 1L5RA 5ENZA 1JIUA 3VDNB 1KTIA 1Y6FA 1GPAA 2F3UA 1WV1A 2HY7A 5IKOA 3H4TA 4M7PA 3DD1A 4XIFA 2FF5A 2BGUA 2C9ZA 4MHSA 4QLBA 4W6QA 5TMBA 2QRPA 4CTNA 3CX4A 2IV3A 2IYFA 1UQTA 3ZCRA 4RIIA 4NEQA 3ZCVA 2BFWA 2F9FA 2H1FA 2QLLA 1XV5A 1ABBA 4HLNA 3OTIA 3VUFA 1PNVA 1JEJA 4FZRA 1P29A 2KS6A 3HBMA 2VSNA 4BFCA 4RIGA 4CTOA 2AV6A 3SYRA 4HWGA 3ZCSA 1NLMA 7GPBA 3G2HA 4RIEA 3IAAA 2WTXA 1FTQA 1GPYA 1F6DA 3TSAA 1P4HA 3MTAA 3ZCUA 4GZ6A 1GG8A 3MRXA 3MTBA 5TMEA 1YA6A 4MICA 2O6LA 2QZSA 3AMVA 3S29A 3E3NA 4LDPA 2ASVA 2ATIA 1Z6PA 4XI9A 3MT8A 4RIFA 2H1HA 5DLDA 2G9UA 3MS7A 1NOIA 4AY6A 5TMDA 1L5QA 3WAGA 2G9RA 4GPBA 2OFFA 2PRJA 2SKCA 3Q3EA 2SKDA 1AXRA 1Y6GA 4F9FA 3BCSA 5BNWA 3OY2A 4NESA 2BGTA 3OKCA 1O6CA 2R68A 3C48A 5D01A 3BCUA 3QKWA 4BQEA 2VSYA 2XA2A 3Q3HA 1V4VA 3G2KA 1FA9A 4N3AA 3RHZA 2GEJA 3NB0A 5C1DA 2QN2A 2JLBA 4KQMA 3ZCTA 1QKJA 3VUEA 2G9QA 2ACVA 3CUYA 1P2GA 3L7AA 4WADA 1B4DA 1P4GA 4NC9A 3MTDA 2SKEA 3L01A 3HBFA 4RBNA 1WUYA 2C4MA 5GPBA 1IIRA 4MHOA 3MS4A 1GGNA 1GZ5A 3OKPA 2IUYA 3SYMA 4KQ1A 3G2LA 1NOJA 2F3QA 1JIVA 3OKAA 2GM9A 4KQ2A 4F97A 3PE3A 2JJMA 3DZCA 2JZCA 1FU7A 2R4TA 3O3CA 3MS2A 3OTHA 1Y8ZA 1FU8A 3CUWA 2AMVA 4AMGA 2GPAA 3UYLA 4RENA 4AY5A 3OY7A 2X6RA 2C1ZA 3T3HA 1NOKA 1BX3A 3MQFA 2VCEA 2XA9A 3S27A 2QN3A 3BD8A 2XGOA 4G2TA 1XKXA 4X7PA 4WACA 1C50A 1P2BA 2X0FA 3CUTA 3T5TA 3MSCA 1GFZA 1M5RA 4MI9A 5DXFA 3G2JA 1XL1A 3L7DA 3TAXA 3COPA 3D1JA 2IEIA 2R60A 5D00A 5JTTA 4EL5A 3C4VA 2R66A 4YI5A 3D0RA 3G2IA 2QRMA 2QN7A 4EKYA 4RELA 1XC7A 4F96A 2PRIA 3GPBA 3C4QA 5IKPA 2QRHA 3E3OA 4RIHA 1UZUA 2ACWA 4YI3A 3HBNA 1EXVA 1NZFA 1RZVA 3BD6A 1C8KA 1A8IA 3E3LA 3CEHA 3T7DA 2VCHA 1Z8DA 2XCIA 1L5VA 3T3IA 4N3CA 1EM6A 6GPBA 4GZ3A 1AHPA 3H4IA 1NZDA 3L7BA 1F0KA 2QN8A 1FTWA 3RSZA 3MT7A 5TVGA 3CUVA 4EL0A 2GJ4A 2FETA 2ECPA 3WC4A 2R4UA 2GT1A 3DDSA 3L79A 3NAZA 3CUUA 1QM5A 2X0EA 1PSWA 4REMA 1RZUA 1C8LA 3EBOA 4MRAA 3HBJA 1SXQA 2IYAA 1E1YA 5DU2A 1HLFA 1PN3A 4BQFA 2X6QA 2GPNA 3S2UA 1L5SA 2IEGA 2C1XA 2G9VA 3MT9A 1RRVA 2F3PA
chains in the Genus database with same CATH superfamily
2PSEA 2IUTA 3DOEA 4DADA 4YMLA 3OP1A 4FDVA 4GXTA 2J48A 3SN6A 1YFZA 1NNLA 2GCPA 2GPJA 5BNIA 5LZ7A 2R1VB 4CF4A 2FWPA 3A4YA 1BD3A 4CM9D 1T29A 1IY0A 2X1HA 3MBKA 4G8DA 4DVJA 3HA2A 3H3JA 1SKAA 1D9XA 2H9AA 4GZLA 4LMAA 3W4KA 4AIIA 2FMXA 2FN7A 3AIOA 3AXTA 4LCBA 4OYLA 5AVTA 1LXCA 4J4BA 5KYKA 3WAJA 5HILA 4M8SA 3ZHCA 3U3DA 3PQEA 4B2YA 2QTWB 5FA6A 2OPBA 4I5DA 4MR9A 1EAYA 3KEGA 4GPEA 1K92A 1ISSA 1NXPA 1Z37A 3TGWA 3WB0A 5AW4A 5C8XA 3OFKA 1RJ9B 5IAKA 3SDZA 3CWQA 3DW3X 4HBZA 1Z36A 4KR9A 3RS5A 1HG0A 2ZJZA 3F3YA 3IBFA 3TPCA 5A9RA 1ZXLA 5A5GA 4BNTA 3GRCA 1L8AA 3ACCA 3FGNA 2GEDA 5EMMA 3EXFA 2BEKA 3ZH9B 2HI0A 2CFRA 3NC4A 1GD1O 1QHFA 2IPXA 1SG6A 2ZI4A 4X1KA 5DYYA 3FYTA 4RV4A 2DGDA 4WK6A 3T7TA 1ULAA 1EPUA 3F4LA 1I2ZA 3ORYA 4N6NA 4UUMA 5BSRA 4L4SA 1X7YB 2VDKB 3PJGA 1CRLA 4FZVA 4MR7A 1HDXA 4NQZA 5IDYA 5KSYA 2DBRA 5BN5A 2GCOA 2QY9A 1IHOA 1T2VA 2O57A 2I8AA 3ITDA 2YJ5A 3WBKA 5BUSA 1L1EA 1HT2E 1XAIA 2C42A 2HO5A 1QTIA 4QOGA 5D8DA 3VKHA 1UMDB 4BGDA 3ZVKA 1PZEA 1PI3A 1Y37A 3TD9A 5CCXA 4FKMA 4B3SB 1YBHA 2DUMA 3K53A 2ODPA 3BHNA 3QQ5A 3BTOA 2PQ2A 3CH7A 2C7BA 1GAXA 1OILA 3L84A 5LN1A 4QATA 5HIAA 1WPQA 1YOVA 2Z1DA 2QM0A 4EJFA 3RVPA 5T4HA 4ESHA 1EMDA 1M8JA 3OCUA 5L45A 4N47A 3L7OA 4JSTA 4KWIA 2C4NA 2FW0A 2PUTA 3H6GA 5BYJA 4CXMA 3A11A 1ESCA 1ZH8A 5IDXA 1KFKB 3U7EB 1DC4A 3PR1A 2Q6VA 5JH7F 1FUYB 1JQLB 4CJXA 5BVHA 1V5GA 4Q7EA 2P3LA 1OJLA 3KB6A 3ZCPA 1X9GA 4O59O 5TPZA 3OO1A 1CZNA 2VHCA 3FSEA 3PRHA 1Y9ZA 5TIIA 4Y1RB 1LC0A 4M60A 4ZI2A 2HHJA 4D6YA 3JQCA 4XYBA 5F1OA 2X13A 3L8MA 2Y1EA 2ZB2A 1EFRD 2BFAA 3PVZA 3JYLA 3U3KA 4E4YA 2WIAA 1IAQA 3VTFA 1YGPA 1HL3A 5B3JC 3GZTB 3MGKA 1LWNA 1EK6A 1V7ZA 3AYZB 4MWGA 2JI4A 4MEJA 4BYMA 5HUHA 3Q7IA 5EE1A 4CTMA 5JH7B 2FFRA 3WGQA 2KLHA 4NBSA 4GKJB 4ITUA 4ZO9A 3O9ZA 1C0EA 4QXPA 4B6RA 2IXGA 1QFMA 2J5RA 2D1SA 1BVYF 1FFWA 3DTNA 3T3GA 4OLJA 3FNHA 3K3PA 1PS0A 3P9SA 1WSWA 1OFUX 4R8KA 3GEEA 3JWJA 1KZ7B 4MDYA 3ZY3A 5AM0A 3T7EA 5KTSA 1OXMA 1WOYA 1Q7CA 5HDBB 3GCDA 1XD2A 4ARZB 1VA5A 1N78A 1M2FA 1OY1A 2P65A 3LGXA 1CD5A 3AHIA 1FW6A 1C5KA 5DCLA 4AN0A 4Y18A 4Z49A 1P4JA 2J3DA 3BCRA 4QFDA 2GGSA 4NECA 4W7SA 2XRZA 5EIXA 5P8WA 2EG9A 3L4KA 1Q1EA 3DR3A 5DEOA 1E3QA 2VDPB 5IT4A 3I32A 2VBCA 3QE4A 4M1EA 5UKDA 4F04A 5BO5A 1JWAB 1WSDA 4INPA 1ZK0A 5ALRA 4P4GA 3J81A 4L02A 3Q3GE 3SZLA 2ZXUA 1WU8A 3K9WA 1N1GA 3HB0A 4TTQA 3VR2A 3ZKWA 3AQIA 3PC8A 3QRWA 4YLEA 5KNDH 1OIWA 3PHCA 4J29A 4KYIB 3TM4A 4GSYA 2F8SA 3I2IA 1WP9A 4X64B 1CF4A 1G3QA 1CYEA 2QSJA 3RJTA 2XPCA 4EYGA 4URUR 3H0KA 3IR5A 3SR0A 2HIAA 2X41A 1RWXA 2Q5FA 4MIEA 4Y98A 4EGQA 3QG1A 4ZPJA 1DAMA 1R1DA 2BFBB 1E6KA 2W48A 1KFEB 1RCTE 3NS7A 3PBKA 4KN5A 1QHEA 4WXMA 5LUBA 5LIPA 3K6KA 2MSKA 3NWBA 2Y92A 3LHDA 4QQ8A 1SKQA 1MTZA 1GNPA 1TEVA 1F9EA 3O8QB 4EH1A 4IDFA 1W85A 1ZJZA 1WJGA 1ID1A 3QMPA 5KQGA 4K6KA 1KI2A 1ZGZA 1ESEA 2IYFA 1EFPA 4LFCB 3TNYA 2JJQA 4FD3A 4HPWA 3WLIA 4A16A 1F2DA 1A7KA 3QMWA 3UCFA 8ATCA 2PK3A 3NM5A 5KWIA 3FM9A 2FSIA 1HDOA 4PG6A 2ZIGA 3D3JA 4MA5A 1L9KA 5K0SA 3Q7RA 5K0NA 1IOVA 3ES9A 3BUSA 2DEUA 3UMCA 1JEJA 3PG5A 4JYCA 3THYA 1DQZA 4UREA 3EZGA 4UMFA 4P7GA 1J25A 1NY6A 3E7FA 1XQ9A 5JC8A 3CG4A 3LFUA 1Y8QB 3EF3A 3FUUA 1NONA 1TM4E 2VSNA 3IPXA 6PFKA 1R6XA 4ZK6A 4XPIB 2DJIA 1LC3A 2PXAA 3FDFA 1MEJA 1RMQA 3GWGA 5EZYA 3WP0A 2EX1A 4P82A 1GYRA 3TRKA 3RS0A 3MZ0A 1RHQA 2FPIB 4LY0A 4DCOA 4A2PA 4XLTA 5LZ2A 3EVAA 1ACMA 2BWJA 5LU9A 4CG0A 1Q7RA 4LF9B 3HDGA 3MBIA 1I1OA 4KBYA 2IUUA 3G0BA 4HNQA 1A76A 2QU8A 3FNEA 3FRHA 3PC7A 4PHGA 4MVJE 3CZRA 3MFYA 4F06A 1NJ2A 1EA7A 2C8LA 5K0ZA 1WBJB 2X8JA 3GP5A 5CDTA 1MO5A 4BP1A 1NVDA 2XB6A 4S24A 1S89A 3BMXA 5ARBA 1YK0A 4TWRA 2QDXA 1QZXA 5M04A 4B46A 2MR5A 4Z0TA 3DTYA 2OAP1 5FR1A 2QXUA 3MT8A 4RFSA 4YVFA 5ES4B 4OHYA 3O4VA 3QEBZ 1BOFA 1ZINA 1SUWA 2X9GA 4WOBA 3PPIA 3WO1A 1XQ1A 1N7HA 3A6EA 2HREA 4BIIA 4BUCA 4NI5A 4Z4FA 2VNKA 4NU5A 3HFGA 1WXIA 3U7QB 4Q4AB 2VJYA 2JLWA 4Q3LA 1U8YA 3GJ0A 1XZFA 2MSEB 2MSCB 2YVLA 1QRDA 4I1VA 1Q44A 3BREA 2R751 4MO2A 4TWAA 4PZPA 4X91A 1NP7A 4X8OA 1MHPA 3HI4A 1ODTC 5HIIA 4BMVA 4G09A 3OQPA 4J2OA 4R3NA 3K9QO 5D01A 4EHAA 3HXQA 4FLMA 1D2MA 1HDGO 2B4KA 1A97A 1CVIA 1DAKA 2XVYA 3PA8A 4CT5A 4RA9A 4AZWA 2O5EA 5AHXA 2PMFA 1QHHA 4C14A 2MIIA 2ZQ5A 3OC6A 1FYXA 2P8SA 4DLYA 2E4ZA 3WGYA 3CPHA 1CUYA 2B5OA 1XXHB 3WWZA 4N3AA 5CXQA 4G0VA 3IO5A 5E2AA 4Z3KA 1F7UA 4B6PA 3LH5A 2D1YA 1C8VB 3ENQA 3O1LA 4ZAZA 1GPJA 3B9PA 1KVRA 3I53A 3NRCA 4LZLA 4MVJI 2XKAA 3OCZA 1F06A 3F5QA 4Y1EA 5E1BA 3V34A 2NV0A 1RRMA 1YULA 2IA5A 1CR2A 2GD6A 3FNRA 1C3LA 1WMEA 2AQ8A 3UEOA 4MKRA 4X90A 2BHLA 4L6IA 1I7QB 2FN9A 2IJGX 4UM9B 5JMPA 1R74A 4BMOB 1RTKA 2O54A 3I0NA 1PWEA 3HHPA 4DSAA 1BMQA 1YZHA 2BIFA 2ZQYA 3K8ZA 1DRWA 1RIIA 1QDLB 1A0OA 3WWEA 4KXVA 3D59A 4C7OA 5CXUA 4J1NA 3HV2A 1JKIA 1CEQA 1G7TA 1QYCA 4IXDA 3SYMA 1UPCA 5TMPA 1SFRA 2C2GA 1SVSA 3GGSA 3KT6A 4IRMA 4XYMA 2I91A 1MDFA 5TX7A 4D4MA 4M6WB 5JAHA 1RQGA 2IBTA 1XQXA 3CISA 4I99A 4N40A 4FEAA 2PD6A 3B20A 3W5BA 1J5EB 3FKJA 4HK4A 3DXXA 3ZJVA 3I09A 1L7BA 1TEXA 1U7WA 2ZRKA 4S1OA 1DBVO 5TY0A 2IU4A 1Z8NA 3RQSA 5B7GA 1TFRA 4TYWA 2E5FA 1HK7A 2R7AA 2LNDA 2VP0A 4ZVKA 4K26A 1G5FA 1NPYA 4KDEA 2JAHA 3K0FA 1H6CA 3FMPB 3I6ZA 2J87A 4KLNA 1UZLA 1ZD1A 2YWDA 5L3QB 1JI3A 3G9TA 4EO4A 1OXTA 1YQDA 1H1LA 3LI2A 1UFQA 3MNFA 5K3SA 3VHXA 4DGQA 4GHWA 3VYWA 2ZM6B 5HSGA 4CM6A 3J81k 1XVVA 3T7RA 1PEYA 1WQ3A 4MQFB 4TSFD 4A8HA 3MMZA 1GT91 4S1TA 4M98A 3FSJX 2VQEB 1D4AA 1BWRA 2FUG1 3H6KA 4NCHA 1XRQA 2PWZA 4KB5A 4JN6B 3ZYCA 3QPWA 1QC5A 2OD7A 3H97A 3K94A 3WYAA 2I3DA 3ZD7A 2MSLA 2GYYA 1RI3A 5DPMA 3TEJA 7ADHA 2JKYA 1D03A 4AIRA 5BSKA 1YZ3A 2PN1A 4PXYA 2QAJA 1JR3D 4LRYA 4B8YA 4WZAA 3CNOA 4FR2A 1O97D 1UJ5A 4M88A 4H4CA 3EG5A 1LBSA 2YINC 4TMWA 3V9PA 2FPPA 2VTKA 3R4CA 1T8RA 5HBRA 3F49S 5I8WA 4RANA 5C80A 1XEWY 3KQUA 1JMKC 1M6YA 1K7XB 5E1DA 3QVSA 4E5VA 3F73A 2P1RA 1AQNA 1WBBA 4TWZA 3H5AA 1P0PA 3DOHA 3AR4A 3QU2A 1V6CA 3OJFA 1O8BA 1JP7A 3PGMA 2J30A 2BMVA 3SKVA 1S0UA 4M0LA 4IKEA 4KLCA 4L73A 4F4JA 2OCAA 3P9PA 4G5OA 2C9OA 4JGIA 4O63O 1C2YA 1EAMA 5KYUA 3FI0A 3KSRA 4KNWA 3IULA 1L5GB 3ROTA 3COPA 4E5YA 1DC5A 1HOTA 1OLOA 1T4MA 2RGGA 3EZ6A 2GPSA 4KO3S 4CNQA 4WL0A 13PKA 1H0SA 1E5XA 1Z12A 3A31A 3D3QA 4WUTA 5CVJA 4E03A 4EL5A 1RC8A 1T2FA 1N9GA 2QAGA 4HAIA 1QGZA 3RIXA 3D0RA 3MGAA 2I4LA 4M36A 3PUKA 2QN7A 5BNFA 5AVUA 3OJEA 4XM0A 1E9AA 3T9FA 1S2LA 2XTZA 4C6TB 3C6QA 4XUDA 3ZXYA 4B6GA 9ATCA 2WM3A 1QG0A 2VQ6A 4KRGA 4YV2A 1G2QA 4KMOA 1ZVJA 3OETA 1UH5A 1WNTA 4FGUA 5L6MB 1GFIA 2Q6TA 3LVQE 3OAAD 3QEKA 4R8MA 4V02A 4XSHA 3U3OA 1C1XA 2QRKA 4LCJA 4L0DA 4C4XA 1KK2A 3V00A 1VGQA 5EOVA 3HO1A 4WRRA 4GP7A 4GKKB 3AUAA 1TD9A 3VOBA 1Q0ZA 3UN1A 2JLZA 4MSUA 2BFMA 4BP8A 2Z6QA 1GTRA 2GOYA 4G65A 1CUVA 1Z5OA 3GGGA 4R2MA 3VPHA 3EXHA 5I4IA 3SAJA 2V98A 5K0JA 4M54A 5H3CA 3PC4A 4UTPA 3I3OA 1ISJA 3ZBUA 4MUHA 3P9KA 2VCHA 4FDTA 1YCHA 5JV5A 1C41A 1HQKA 1RAIA 2XCIA 3HR4A 4EVSA 5PGMA 5HFNA 3ZHXA 4BX9A 3BOSA 3CINA 2DWQA 4EW6A 1CY8A 3DOFA 5ETJA 4YHBA 5JSKA 3GPDG 2FWBA 4D9GA 4JLOA 3GLHE 1F0KA 1SIWA 4BQQA 4JT4A 3GD7A 2AEMA 4U2DA 2BFNA 1EK5A 3RVDA 4JKOA 3WL4A 4UBIA 3CCCA 2C7OA 1G5QA 3A05A 4EEZA 4X71A 5JVDA 4ZYLA 2I66A 3ZH2A 2I2BA 5DX1A 1JBKA 3BH7A 2J6CA 2BOVA 3LO8A 3M8KA 4E51A 5HF6A 3TQTA 1WUJS 1XQWA 2FSHA 3MWJA 5DT2A 4ENSA 3EPLA 5CLGA 3UT6A 2HF2A 1ZVQA 5KX5A 3LDAA 1YE8A 1O4VA 5IN5A 2FSVC 1RWOA 2B69A 3L7JA 2NSYA 1PQ4A 2RHGB 2ZBVA 4I4CA 3T41A 1G9TA 3B2QA 4EPRA 4F5EA 1L8LA 2G9NA 3BAZA 3BM5A 1N5JA 3O8CA 3H84A 5JSQA 2K5UA 2QEQA 2LE0A 3GBPA 1RPTA 4EUNA 1BJKA 5F7XA 3C5HA 4XFDA 3M89A 3W78A 4JOCA 1MR3F 3OPVA 1O94A 4BMCA 1IUOA 1YIOA 5JWHA 1M8FA 2YWFA 2RJOA 3L07A 5JLJA 1K8YB 2C31A 2ZVPX 1EWKA 2RHHA 5A0TA 4Q82A 2CWWA 2UU9B 5CK4A 1A4UA 3S28A 3TLGA 5TQ0B 3W5IA 4HNHA 4PZLA 1DJLA 1MGOA 3RFCA 3VPDA 1TVEA 1YBVA 2VJNA 3A6JA 2UKDA 2MYTA 4FX2A 5FI3A 1W46A 3SC3A 5BW4A 1CEXA 2GN8A 4Q7MB 4R01A 3SM3A 1Y9DA 3SZRA 5H02A 4D8VA 2AIRA 4DCGA 5IHPA 2P6OA 1WUTA 1IXYA 5AXCA 1GV0A 1X80B 1E6UA 2NYRA 5BV8A 1RT9A 3RTAA 4DQXA 2HMVA 1GTL1 3TLKA 2IBSA 1VMAA 2XVXA 1FRVA 3VJKA 3F0TA 2I6QA 2FP4B 2JVKA 2NU7B 1BNCA 2R8EA 2W93A 4YRLA 2LWIA 1IOZA 4UHCA 1KK0A 2G5TA 2OD2A 3G85A 4JROA 4TRRA 4WBSA 4CIAA 2WW8A 3EEYA 2CUKA 2YQ4A 4P5DA 3UK6A 2WYUA 1E4OA 1O03A 2Q99A 1QPBA 2WF9A 3O7MA 3SLRA 2GD2A 3PQ2A 1XZNA 3OT1B 2FW8A 1M2HA 1G59A 3DE5X 3O9MA 2JIZA 2R1TA 1OXVA 2Y1GA 3CEJA 3JYQA 2AR7A 1Y8RB 2PRSA 4MWDA 1U1FA 3C16C 1H2AS 1FYDA 1WXHA 3IS3A 2I87A 4PGGA 1ABEA 2XDQA 4WBNB 4UEWA 5CVTA 4M7RA 5LM3A 1DRJA 1Y9EA 3EG9A 4ZK2A 2P9FA 3CZMA 3V1YA 4EITA 4PG8A 3PNQA 2QD2A 4JT2A 3HKCB 4UASA 2PL9A 1QO7A 1WZNA 3DMYA 4RHFA 3GLFE 3I0ZA 4WK2B 1T8TA 2D5CA 3PHBE 2YJNA 4XCVA 3QFTA 2R96A 2GNAA 5JMTA 3F2VA 1IH8A 2ZATA 3AFNA 1KEUA 1B3RA 3IQZA 3C39A 3EMBA 2O2IA 4RK4A 3V4FA 2IIQA 4UNRA 4WN9B 4D3DA 1AG9A 5BN3B 4DLUA 2IV7A 1W2HA 3QUBA 4TMVA 3KQYA 1ZM4A 5HKKA 1SCUA 3IIIA 2JCXA 2XXBA 1FC0A 4JVSB 4QNNA 4E0BA 1DKLA 1FTGA 2XDYA 3IAS6 5LQDA 1KRXA 3IHWA 1GG9A 3Q87B 4H3KB 1GKYA 2XGGA 1OXSC 2OLKA 1JQEA 2OE2A 4J0JA 2JI7A 3FZQA 1NR7A 4YRBA 1Y82A 3IOCA 1P4RA 2LBPA 3STTA 1CWUA 3IJPA 3ETHA 4O2LA 3DONA 2BFDA 2CJYA 3TYXA 4ZO6A 4YRNA 2YFHA 4E7PA 4YWHA 4BVLA 1TC1A 3ABQB 3LSTA 3DLHA 2RK4A 3BWXA 3KWFA 1FZQA 5AR1A 1C0KA 1FUEA 1WA5A 2JFGA 4L27A 2CE2X 2ZJ4A 1PX0A 4DR3B 2GJSA 1QNLA 1ZOPA 2Q28A 4PS1A 2PR2A 3VPSA 4DMFA 4ZANA 1RSZA 1X19A 3M0EA 2VBIA 5CFLA 4IQGA 2H5JA 1Y8AA 2IYXA 3QUSA 1RQXA 4GECA 4GX0A 1CB7A 2BF7A 2FUNB 4MWEA 5FI0B 4D1YA 3QKTA 3REGA 1KJNA 1ZNXA 3ZGZA 1RLOA 2WOJA 3BL5A 3V2HA 2NT3A 1PFGA 2JVJA 3CKKA 1NYLA 1E79A 3MJTA 4GPD1 3TL2A 4C9BA 3C3BA 5CA1A 1U3WA 2NU6A 4U0JA 4XEUA 3EN0A 3UAZA 2H59A 4OQ4A 3MERA 5LLSA 1KI1A 3M34A 3ZK9A 5JAUA 4IIDA 2A9VA 3RFVA 5JJIA 3DZGA 3F90A 2ZAIA 2EV9A 4EW2A 821PA 3BIJA 4U8GA 5SY4A 4YXWA 4ZYWA 5HUQA 4W9MC 3K70D 1XZJA 4GMFA 2G7ZA 1W29A 4MROA 1OWOA 4FN4A 2CVPA 3HLYA 1STOA 5C8YA 4CMIA 1OH6A 3P94A 5LLDA 4EX6A 3D6UA 3OLZA 3SKYA 1GYQA 2ORVA 3D5EA 1J23A 1W4AA 4FI3F 3KTOA 1MN6A 4LE1A 5CFZA 2DECA 5JJLA 3OFNA 3PLRA 3STYA 1PLKA 1ZOOA 1F7VA 3PNPA 2EW2A 2FQ1A 1E2MA 2A9FA 3AR8A 3M1LA 5IJAA 1QMPA 2BEWA 3H5RA 4IDOA 4EQZA 1OBOA 4YAUA 4CG1A 1K0UA 2Z2IA 4M55A 3KAQA 2Y05A 2FOLA 3LY7A 4FFDA 2F6RA 1YCGA 5CVCA 1JPNA 1T0BA 1N32B 1Y4UA 1HH4A 2BGUA 1Y1SA 3QBJA 4H27A 1VJ1A 3SXJA 1QE0A 4RHTA 4TQ9A 4LVUA 1TM1E 3GLVA 4JU8A 1TM2A 2JGKA 4UUNA 4K9RA 3VI3B 1CHNA 3E3MA 1HZJA 1E1QA 3GAFA 4HDQB 4UOEA 3F1LA 1BEEA 3GI1A 3JARB 5IVIA 4FHEA 3UA3A 1EUYA 3GCXA 5ALOA 3UGKA 1M8GA 1P1JA 2JFPA 3PT9A 4HUQB 4LTNA 4RKWA 1YT5A 5FBHA 1Y3AA 2D59A 1P1HA 1QO0A 4ILEA 4ZI7A 1YA8A 1QGUB 2PUVA 1RZ3A 3EC7A 2QX8A 4QYIA 4KYUA 3BZBA 5HIMA 2I1LA 1JDVA 1T36A 3ANYB 3DE3X 1TCUA 3QF7A 4G56A 3F3KA 4B09A 3R8XA 2DQYA 2OV2A 3BL6A 2QJWA 1NAIA 1Q91A 1XU7A 2DC1A 3KZNA 4I66A 4DDTA 1Z82A 2IYUA 3TKYA 1WPGA 2YZGA 3ADDA 1LKZA 4CV0A 5I4KA 2Z43A 1L8OA 3PX2A 1KNQA 1LK7A 1DB3A 1VP9A 3GJYA 1XZDA 4ZVPA 2UYOA 3FJOA 1IYZA 2J0UA 3LZDA 3PQ3A 1XA4A 2XHEA 5B1HA 5B55A 4D5EA 2X76A 5EGNA 3EMVA 3QMMA 3PJEA 1IMJA 2WUVA 2DHDA 1N2CA 2ZB7A 3A36A 2XMGA 3L1VA 3P9XA 1JEQB 3D7KA 2BW0A 4ZT7A 3RYHA 4Z2YA 3G2HA 4TVBA 1H1DA 3SE7A 3ME5A 4V0MA 7GPBA 1K4MA 1PD0A 2J4CA 2Q5HA 2L42A 4FWBA 2R2GA 3L8FA 1A50B 1VIYA 4YBRA 2FYTA 1CUXA 5IYZF 1XRNA 3BRCA 4QPZA 1V16A 4YS6A 3NHMA 3KLNA 2Q2NA 2QQ0A 4HZGA 4GZ6A 3AB3A 3FDIA 2NU9A 4E7OA 2NXJA 4AD8A 2IU3A 4MICA 1JEAA 4LGVA 3IURA 1RYBA 1NRWA 4DIKA 1IXKA 2Z8ZA 3C5CA 5KUTA 1O8CA 2QZSA 3F4BA 3HPRA 3N7TA 4G0MA 4M86A 1JB1A 4GIBA 4R1QA 4YCAA 3WZMA 3OLXA 1PJ8A 4O4HF 3QP9A 4YEDA 3L8DA 2WSLA 4P98A 3HQ4O 3PYMA 1JV2B 2CUNA 4NV1A 4PGFA 5JCJD 1JR4A 3SEFA 2ZZMA 4A15A 5HCIA 5IYZB 2HDNB 3FSGA 3AHFA 3BXZA 3ZS8A 3T3OA 3C8DA 1SXJE 4XWWA 2GI4A 4RM2A 1Q77A 4GPBA 2QQFA 2FOIA 4OTZA 7REQB 5C9ZA 5FT9A 3O5AA 1IBRA 4KE8A 5BV2P 3B89A 4AFNA 1SMKA 4QU9A 4ZQHA 1H4TA 1JQBA 4WXYB 4F9FA 4RPIA 4DR6B 2P3SA 5FNVA 4BNWA 2R68A 3VJLA 4O4HB 3ONVA 4M1MA 2YCLA 4YCBA 4A3SA 3C0KA 3NTQA 2XZLA 1BA2A 5L6LB 2F1KA 4JODA 1EGMB 5ELXA 2OT3B 2PS0A 3F7TA 2C2KA 1A3CA 1O87A 1L7NA 1ZK4A 2FLVA 4LOJA 3ONFA 3GIWA 5EP1A 3W7AA 4M0KA 5TC4A 3WMFA 2BMWA 3PPWA 4C4RA 1XA0A 4CKEA 2QN2A 4DTIA 2IH4A 2CLLB 4TYMA 2C57A 2Y1KA 4I2NA 4U2GA 2XNDD 4KQMA 4ZGGA 3C7DB 3ZG6A 1SHKA 3OEEA 2VNAA 1FQJA 3VGJA 3O4HA 1T1JA 2AOUB 1S8AA 2C5SA 4NEHB 2VC2B 3NBXX 4OHBA 4CL3A 1KMIY 5JRZA 4QU0A 3GLGA 1P2GA 4ER0A 2MDTA 1EFDN 4R84A 4GWLA 1O57A 3KR9A 3OEWA 4KIUA 4UE2A 4HGQA 1RXUA 3KHKA 1X38A 2WIJA 1H66A 3DE2X 3DWEX 3HBFA 3MWFA 1QCZA 2JASA 4JVMA 4DSOA 4BO5A 1ZP6A 4C7MA 5DJ5A 1SURA 2VP2A 2C84A 4JVOA 5FKJA 3V42A 4B73A 5IXYA 1X13A 4C29A 1GZ5A 2YMMA 2AGVA 2NZXA 1NL3A 3WIVA 4F7DA 2IUYA 3D4IA 3FWHA 3VAAA 2OHHA 3BIWA 1L8QA 4MQEB 1TCAA 3E15A 3OKAA 1KOGA 4XKJA 5F12A 1YI1A 4M9CA 3M5CA 4EA7A 5EWMB 2FX2A 3SXPA 3LUGA 2W11A 1KK1A 2LW7A 3TZKA 4K8OA 3F2IA 4NIMA 2H3HA 1GG2A 3K92A 4HRAA 3OZIA 1YXMA 3S68A 4WK4B 5SYMA 2BR3A 4Y0NA 2EFDB 3KCNA 2FWAA 2E3JA 4GC9A 2AK3A 1N3IA 3ITKA 1JIJA 3O2SB 4TUYF 4Y6OA 5CB0A 5C51B 1P7ZA 1HETA 1QANA 3EUFA 3G7SA 3ML1A 4XJVA 1LU9A 4OMUA 3I72A 1R4ZA 4GMGA 3E9YA 1R0SA 4YAOA 4HS9A 1KMHA 4BJ1A 4D9NA 2ZTHA 3UJ7A 3KYIB 1FFGA 1PJAA 1WETA 1EGQA 3JAKB 3QNMA 2PXXA 4F45A 2WTNA 3BMQA 4J3JA 3FAKA 1UMKA 2PU7A 2WWHA 2W6JD 1DZIA 2O20A 2WYHA 3HUEA 2H08A 3LP8A 3LWZA 4RPLA 1W44A 4UTOA 2C1ZA 3I45A 2NGRA 2VNJA 1KBZA 3Q8WA 3ZWBA 1BX3A 1G8HA 2AFRA 1X39A 1ZNQO 2Q3EA 2XUDA 3ELWA 1RBYA 2VCEA 4TUYB 2Q6LA 3GJTA 5DNYB 4AKHA 2WUDA 1M5TA 3UK2A 1EUCB 2QRVB 4MWTA 3PFBA 4Z9AA 2ZUBA 4JC4A 1XZHA 2BCEA 4OHXA 4IQFA 2DTXA 3HWRA 4RY0A 3ZTTA 1ONNA 2V4UA 3KD3A 2ZIXA 4W8OA 1AZTA 1EQ2A 3R3YA 4N1AA 3RABA 1HKUA 2YNMD 3KKNA 4OHZA 3TTUA 1IVYA 3OPYA 1BDMA 4DOMA 4KN8A 1C9JA 3HSSA 3PQFA 2PZMA 3C3KA 2F8MA 2COKA 4WFIA 3T06B 4UXJA 4ARIA 2X9LA 1XL1A 1M75A 4RKYA 1YK1A 2FPUA 4CUKA 4HGYA 5FUMA 4E2WA 5HA5A 2ISSD 3INTA 5EKXA 3KOWA 1G18A 5D00A 4R98A 2EKDA 4BXOA 1UC9A 1YKFA 4HAYA 5CMLA 4WXEA 2VH2A 3MWDB 5JXGA 5A3JA 3PEWA 3GLIA 1YR8A 4YI5A 1TK2A 2YV3A 1Z47A 4D57A 2CCJA 3N9IA 4OSPA 5HFJA 2VYFA 2XB4A 1AF7A 1QYVA 1X1SA 3AOEA 5J2TA 3E3OA 3G8AA 2FQQA 5MFZA 4DW8A 4NENB 4RIHA 4N41A 4EWLA 3L4BC 2ACWA 1DU4A 4WW0A 3BYZA 3FPAA 5EE3A 1FVHA 1P72A 3LFTA 5CVVA 1C7JA 3HLTA 4UCQA 4OM8A 2IC5A 2Y2UA 5LCXA 4OHFA 4B4DA 3P5SA 4IXWA 3G7NA 3M2TA 4PHTA 1KBOA 4JB3A 3FRJA 1YE3A 5K8TA 2PVCA 5F7ZA 2X19A 2QD1A 3C6KA 4ZCTA 3OIFA 2VWPA 3B8EA 4WNIA 5DHFA 6GPBA 4G0NA 4RJIA 2D00A 2EATA 1U99A 3ZHRA 1G63A 3DMPA 3PYLA 4F8YA 3TL6A 1EZ1A 2ZJ6A 4N49A 4X44A 3UMYA 1EIWA 1SG9A 4TTSA 2QN8A 3KTDA 1Z9BA 4NG5A 5EKTA 1FTWA 3KT8A 1SVIA 3OESA 3QM1A 4KX5A 2AH5A 2FZWA 3GNQA 2PA0A 5D3MA 3A1SA 3GJ7A 2VP9A 2CVZA 4U6SA 1AXEA 1KO1A 2EP7A 1Z0JA 2HRCA 2P9BA 3IAFA 4IDDA 1YQUA 3RLIA 5JNUA 3A4LA 1EUDB 4JR0A 2CMGA 4B84A 3DAFA 3LT4A 8OHMA 3RVLA 3FDZB 2CZCA 4B43A 2GJKA 1BHO1 1R27A 1KC3A 1Q0RA 2H2GA 2QMUA 3ENVA 3A4IA 3K09A 3A9RA 1BS1A 3IKVA 3WLMA 5ALXA 2PLFA 2BE9A 5T57A 1E7YA 5KMGA 3O8LA 2DPYA 3PHIA 1KJ8A 4X7BA 3LLVA 1PN3A 3T95A 4I1PA 2V5VA 3G5UA 3N58A 4AQYB 2IYZA 2PZJA 4BQFA 3N0RA 3F9IA 3Q72A 1LSUA 4Q3EA 4W5OA 3IUSA 1MQ9A 1Z39A 3AHJA 3SYTA 3R6DA 2C9MA 5FAXA 1W93A 1KSJA 1DHRA 2BDUA 2WZCA 1CUJA 2Q3DA 1M1NA 4M8IA 2CVQA 4HGPA 1SVKA 3E7PA 1N8SA 2FPKA 1F6WA 2F3PA 3MEQA 3G9XA 2ZJ3A 2X0DA 5BR1A 2YHIB 4RF3A 2JLXA 4HMPA 1CNEA 4BQIA 4JYAB 5EJEA 3DL4A 1N2GA 2CFIA 2PV0A 3PDWA 1N6OA 5EUQB 1M1YB 1SQGA 3GOQA 4RY2A 2Z3ZA 2EERA 3BXHA 3CF4A 4OGKA 1K5PA 1UWLA 2C3UA 1BVRA 4MUNA 1BE6A 4V0KA 1MO4A 5K4HA 1L4NA 5H3LA 1KWKA 3I9NA 2D1TA 2QNBA 2QRNA 4NE7A 3MRSA 2ZITA 2XZDA 5JNRA 4WZZA 2VI5A 2YOGA 1YRQA 5GGYA 4EECA 1ISHA 4UD2A 2ODWA 3HXPA 3VR4D 3IODA 4RK1A 5BR4A 4DCUA 4MQBA 3ZDFA 4FYWA 4XRGA 1XZCA 2QZ9A 1H2XA 1M34A 4J0KA 1I0IA 2GM5A 4EKEA 2I4OA 4JJFA 2O2EA 1L5WA 3ICWA 4N6GA 2XRYA 1DTWB 1MT0A 5KKAA 3ZV6A 4DSUA 2V3CC 1EFVA 3MMXA 3OJLA 1QDEA 3QVGB 2HSDA 2UYHA 3NT5A 4WFQA 1WHTA 3FCOA 4RA6A 3KLBA 1TCVA 4M53A 3D02A 5REQB 2LP4Y 2LVBA 3MAJA 2RH4A 4B4OA 6ABPA 1KP3A 3ED5A 3NHAA 4HXFB 1A69A 2XKKA 1KI7A 5HOQA 2AMFA 1CCWA 3GV0A 4LHXA 5B3JA 2QLNA 3NHJA 2GNPA 4IJMA 3KXLA 4M9UA 4N9WA 4RGVA 2O8NA 2IZ5A 3K70C 1T26A 4REQB 3E27A 4JLJA 3JQ7B 5ER6A 3TUJC 5JBNA 1L7DA 1WV0A 1JDPA 1MT3A 2XTMA 3WNVA 3GUHA 4LRSB 3BXXA 5FUXA 1HM5A 2W2KB 2ZSJA 4EB3A 2REXB 4HQOA 4EDFA 3WLRA 1Z7EA 4N82A 1L7XA 1ZK1A 2A9OA 4RKEA 3P52A 4ZEXA 5TPWB 5EI5A 1PDWA 1DLIA 1MEEA 4DV6B 1ONPA 1ZGJA 1HA3A 4GQAA 2GK7A 2SCUA 4I1OA 1MCZA 3W06A 2I67A 4LJSA 5KYNA 1DP4A 5DCWA 1WW2A 2NQ8A 3EZYA 2R9VA 4QOJA 1WMBA 3S5JA 5JZBA 4NABA 2BSQA 4JBIA 1RE1A 3D0QA 1UMCB 5CYPA 1IM2A 2P67A 1PJ3A 3N75A 1E7WA 2DH5A 3W4JA 2P6PA 4GX1A 1W1WA 1YBMA 2R44A 4N39A 2W70A 3D5QA 4QFBA 3V1NA 4Z5XA 2OKCA 4FKZA 5FQNA 2B5WA 5THKA 2V74B 3R0QA 1DDIA 2GJ9A 4DCJA 4RABA 2HHCA 2VUIB 5KVSA 3I2GA 3AFMA 2FPOA 2ZW9A 2J0VA 4ROSA 3NCHA 3MJHA 4DJEC 1USUA 3LQKA 4FJ0A 2PCLA 3UC5A 4IS2A 1K3UB 1Y5IA 4DPKA 4V1CA 3OHMA 3OT4A 1VE5A 1WDKA 2IP1A 1L7MA 3NP7A 5E9QA 3TUIC 1Z26A 1IFXA 1MORA 2REBA 4P0TA 4QUJA 1ZIOA 3V1KA 4R16A 3A2NA 1OI7A 3JTEA 4K6FA 1I1HA 1L4KA 4LRQA 3GARA 4LHYA 1CLEA 3UBTA 1ZMOA 2WD9A 4HYYA 5FWYA 1J06A 1EWYA 1WDMA 4RDIA 5JNTA 2P4HX 3QOXA 3I1YA 3P9QA 3HH8A 2MJLA 3ELDA 5JFOA 1RP1A 2XXJA 2DLNA 4V0NA 5K0LA 221PA 1T8YA 3R3JA 3O1HB 4FOLA 4EJ0A 3AL0C 3T5DA 1JG7A 1ZHFA 3GDWA 1SQ6A 4KAFA 3ST7A 2HMTA 1IOLA 1EHCA 2PH7A 1U90A 5FF9A 2P9TA 1A4IA 3JD1A 4FR0A 4LRTB 1HE8B 4EZEA 3I37X 2A0XA 1LTHR 2A30A 2BM1A 2ZULA 3ASVA 3EDRA 4QOHA 3OKFA 5KSWB 1A9QA 4X20A 3IUEA 2XMPA 3QENA 1U8AA 5GV8A 1TCBA 3NH6A 4LZPA 3NTLA 4PAGA 1GAQA 3QLVA 4C2UA 1NIPA 1L4HA 2RGCA 4B32A 3V7FA 1K68A 3G3EA 4Q4LA 1PR6A 3SHTA 1DIOB 4MCIA 3TVTA 4L3OA 3GUUA 4BMDA 1YFLA 4CM1A 3SDSA 2IHKA 1I30A 2R6JA 2FF7A 3PWZA 4C05A 1JIUA 1N57A 1YQGA 4J3FA 3UW1A 3D5TA 2O9JA 3ZYZA 4OK5A 2Y1XA 4ARAA 2YZNA 1OH8A 2KSQA 1U8UA 1E9VA 3CONA 4H1UA 4C0LA 3I2YX 1KOFA 2LV8A 1WV1A 2EQAA 3QEOA 4MVJD 3OZXA 3W2HA 5IWCA 3FR7A 4FFNA 1ZICA 3VOTA 2DQSA 1GG5A 4F71A 1B8UA 3C45A 1SA0B 4ZKDA 2Z5LA 3U60B 3IP6A 5FHQA 4ZT6A 3E35A 4PQYA 5BQ3A 2OR3A 1LBQA 3H04A 3UG7A 1R3UA 4FFWA 5TB5A 4YJKA 1HTWA 4MYHA 1DIRA 5G3ZA 3ZDDA 2W2QA 1OAKA 2C9ZA 2H1VA 3AUJB 4RNCA 5IN4A 4K88A 3B7WA 3NXSA 3BF8A 4YFYA 4N5MA 4RPHA 1WB4A 3CLKA 4U9IS 1ZUNA 3V4PB 1QG6A 2H16A 4HNAA 4MLDA 2V0NA 1IQ0A 3QBDA 1X14A 2IV3A 2D8AA 4G5QA 2DR2A 3E2IA 3AKEA 1BW9A 4IXNA 2G5CA 4R9RA 1CR0A 4FNAA 5I5GA 3TG8A 2EVWX 5JZVA 2HHHB 4L4XA 1KE2A 2D2VA 5IANA 2Z6AA 4NZZA 1KH1A 4KOAA 2H4HA 3UKOA 4CMEC 1JNXX 3MAGA 2WVAA 3PGXA 1C3XA 4HMQA 5DLPA 3BA1A 3EH1A 4CW7A 1V7CA 2ZRAA 5JS7A 4TWBA 3VUFA 1GUBA 1WSAA 2IQIA 4K9NA 4GBMA 2O8FB 4HBGA 3SJUA 2YWJA 3LZCA 5G0TA 1BXZA 4WI1A 1PR5A 2H52A 2VWGA 4WT7A 4BVKA 1VC2A 1AHPA 3VKGA 4FGKA 1R8XA 2Q2WA 4Z1MD 5DBEX 5C5EA 1ZIPA 3IVXA 2RFLA 1MX5A 2A92A 4UU0A 4ZU3A 5KQPA 1V48A 4FB4A 4C03A 2ZJ5A 2IEBA 3HB5X 2ZJOA 4ND8A 3RVSA 4ON9A 2OQRA 3NC1C 1YVRA 3T3MB 5B1YA 4LDRA 4IW3B 4R7ZA 1ZITA 2C2BA 3K7EA 3WGKA 4JJKA 3CA8A 4IVQA 3I0MA 4KQFA 1S7GA 2Q4DA 3OZWA 4ZAGA 5B1EA 1SIBE 3HNOA 3O1IC 3QE3A 2YXDA 3MTAA 2C61A 1JDJA 4FDLA 4JBXA 1RPJA 3MRXA 3FMVA 1V26A 2QZZA 3MCWA 1NVMB 4NDZA 1C1DB 4JB0A 5K3AA 4REOA 1OXUA 4C08A 4CEIA 2H0QA 4PE5B 1CIPA 2YFKA 3W9BA 1UJCA 4BO0A 4JBLA 4FIDA 1BIFA 2OQVA 5BOSB 1I9GA 2WD8A 3DOIA 1K7SN 2Q1YA 4G0WA 3IR7A 2FWRA 3QVJA 1G41A 5FBLB 5THQA 2G9UA 4P0PB 1DFGA 2I54A 1ZVMA 2REQA 1GNQA 4D56A 2GEFA 2BKVA 5ABPA 4LE2A 4UQPA 3L4EA 1RYZA 2JANA 2P9JA 1W73A 1V8BA 2W58A 4OGLA 2YY5A 5AW2A 1NW3A 4UAUA 3ZY2A 2XSZA 4G81A 5EZ6B 3V8NA 5LQRA 3A1VA 4F38A 5A1JA 2X5KO 4US2R 3UUGA 3RU9A 5A4AA 4KLAA 2Y76A 2V59A 3KZMA 2XZPA 2YN2A 2QUZA 2A5FA 2XW6A 4IV8A 3OKCA 4R2IA 3EYWA 3HYLA 4PLGA 4UZSA 3MUEA 1XELA 1LX7A 5AI6A 2H7YA 1B0ZA 2QG6A 3U4QA 4CV1A 4FMDF 4BMYA 3MWYW 1Z6GA 4MP6A 1Z74A 1U3UA 4YMIA 2X3YA 1LPBB 3WY9A 3ZNPA 4F8EA 1EK2A 1DC6A 2JJ1D 3E7DA 4P6VF 5E6UA 4CL2A 1GOTA 1SKBA 3HG7A 4BE7B 1MA0A 4OXYA 4OH1A 4IJ6A 5LYYA 2JFBA 1YS9A 4MA0A 5DULA 1YZLA 1Z0FA 4IIJF 1YVUA 2ZTLA 2JGDA 4UBOA 3VJRA 1PVOA 2YNMC 1PRYA 3WX0A 1P4SA 2FV8A 4P83A 1LBTA 3NYWA 3EVEA 2PSDA 3L7AA 4QICA 4XA8A 1KDTA 4LBYA 5CH5A 2AFHA 4WY5A 2CDRA 2YW2A 1QUFA 4LKRA 2F67A 4UJ5A 5ALYA 4FMDB 2Y77A 3U9TA 1CKEA 2R6R1 3KE9A 4AS1A 3VO9A 1Z0ZA 5CYGA 4ZVVA 3R5FA 5SY9A 3RNLA 1UBSB 1ND5A 1GAEO 1XHEA 2O3UA 4JKYA 4MUKA 4O02B 4OOEA 4D4GA 3NWEA 4Y0VA 3I9KA 1O5TA 3MS4A 1KERA 1YJ5A 1Q83A 3INRA 3ISTA 1OC4A 2GN2A 3DFZA 1DCMA 2P75A 1MXFA 3EAGA 2W2LA 4AF8A 1X7WA 1FS5A 3FVQA 3WFZA 3RWMB 3LRXA 1SUBA 3JQAA 4DG8A 4URXR 1RXSA 2QXYA 1N7JA 2ZTSA 1B8NA 4ZHSA 3IQFA 3NBZC 3P0HA 4JL8A 3T5AA 4EG5A 1KIMA 2JZCA 1QORA 3EGXB 1XMSA 2DHRA 1ES9A 1EVZA 2C4KA 2VK4A 3D4PA 3O3CA 4R54A 5B4UA 5B58C 1VCIA 1YB7A 2Y0BA 3K4HA 4FONA 4OL0A 3OF2A 4KR0A 3CMMA 2ABWA 3ZBQA 2QTFA 5CX1A 5ECYA 2DT8A 2ZK7A 2VHVA 5I7SA 4ER6A 4QUKA 3KJNA 2Q3JA 2VDQB 2MINA 1JX6A 4LHSA 3HNPA 1H69A 4R3WA 2B37A 5CURA 3X2FA 5BR7A 2FOXA 5HM6A 3QFHA 4QFMA 4A0SA 1CHDA 4PX9A 3K9FC 4U7PB 3T7AA 1G17A 3EFHA 1UZAA 4W99A 4RFVA 5AI4A 4JI2B 2D54A 2YJGA 4H2DA 1CQIA 2RD2A 4XZ3A 4JC8A 4B6FA 3UXMA 1KAEA 3LKVA 3IQHX 4UHBA 4AMUA 1Q0TA 1QV7A 2YS6A 1CJUC 3LC0A 4JJEA 2JRCA 1MXHA 3N2KA 3OU7A 5I7AA 1ULHA 4DVGA 3WMWA 2WJWA 5NLLA 4YIHA 2X4DA 4AQDA 4F2DA 3DT9A 1J0AA 3AVWA 3G0DA 5JCZA 4NH4A 4UM8B 2OBXA 3NATA 3X0DA 2CLKB 3ZQ4A 3QTLA 4TTRA 2D4HA 1UOOA 2LDXA 2ZZNA 4NP6A 1MOZA 2OAEA 2WDPA 5CYOA 3N0WA 3SJAA 1KI9A 1HYQA 2ZBFA 1A1SA 2BKEA 3HJNA 3LX4A 4R81A 1RYYA 3GZNB 3HKDA 3IBCA 5IDVA 4DDUA 2I2DA 1GDHA 4BNXA 1GA4A 5HGXA 3M81A 2E89A 4U2KA 4FWIB 5FPKA 4OL9A 3SNKA 3UCXA 4CEHB 4HNTA 2GZ1A 2HV8A 1N6KA 2IOFA 4BNDB 1IZZA 4PHHA 3Q7TA 3U1VA 3B1VA 4HQNA 2KM1A 5FULA 4B7ZA 2HLDD 1P75A 1GV1A 4QTUB 2RKWA 1NMYA 4HOYA 1Q84A 1KU6A 1LZKA 4JBHA 4EKNB 1TQDA 4WE3A 1K3TA 1XU4A 4ZAWA 1P1IA 1MMFB 2NYUA 1C30A 2NXCA 1HDZA 4W9NA 4RXMA 2B25A 4X00A 1KDVA 4LQLA 3DKIA 3O83A 1T5TA 2G6BA 1WUKS 2O2SA 1VKNA 3PUYA 3EIFA 3VDXA 4DN6A 4UKDA 1ECJA 4H6XA 1H2BA 4HQ6A 5IWAB 4DHEA 3THWA 4N0PA 1RWVA 3RUCA 3VXKA 2IY7A 3W79A 2AOTA 5AD1A 6REQA 2ZYWX 4LS3A 2PH5A 2HGZA 4JVLA 1W9MA 1MQ8B 3IP8A 4YMTA 4K5QA 5G0SA 4OQZA 2X8AA 4C87A 1L3IA 3VHRA 4KPFC 2FSVA 3IIKA 4WZAE 5HX7A 3L0DA 2BEUB 4ERNA 1WCIA 1X8KA 4TYQA 3HUDA 3RF6A 3EVZA 3BBLA 2VUUA 2IYTA 1X86B 5ES3A 5KSPA 1CRPA 4NFLA 4XEHA 3HRIA 4DYHA 3K1TA 2HSEA 4FE4A 1YDEA 1EFTA 2MSDB 4OB7A 3LYHA 3UUFA 3FD8A 2ZU6A 3ROMA 1OT5A 2A1TS 2Q4EA 3JQPA 3LNTA 1WKVA 4NF2A 1NULA 3C5VA 4O2AA 3HS3A 4Y2RA 5CW2A 1NZDA 3G8YA 3VX3A 2NUAB 4P86A 4PYRA 4DLBA 1T15A 3D3EA 3G2QA 2VH5R 2BKXA 2D2IA 3GQBB 5JAQA 2BP7B 2JFUA 4LE0A 4WESA 4K9MA 4BFXA 5AIBA 3WDLA 3A3PA 2ODAA 3WL7A 1P2TA 2M6RA 3KX2A 2RG7A 3VPGA 3IGFA 4QG3A 4J94A 1FNSA 4P38A 4AJIA 3WC4A 3RC8A 4R69A 2CHQA 2XWSA 3FOAA 1YBFA 2G3YA 3DAHA 2VTVA 1A71A 3AFGA 4OXNA 2JF0A 3NAZA 3NJ4A 1KY5A 1N0HA 2R8YA 1AKEA 1MV5A 2Z2XA 3D2LA 4MB0A 2QD3A 3WRYA 3QSYA 5E4JA 4YC7A 4RWZA 4ZQGA 3U3XA 1P3DA 1TYBE 1W19A 3EBOA 3AF2A 2NUPB 3UH0A 1JLHA 1MAHA 1QO9A 2IXEA 1ICEA 4MV1A 2J9FA 3IEVA 1XZKA 3KALA 1A2OA 5DHTA 3A7DA 1U2DA 1JLSA 3M70A 4HB2A 4KZKA 3B78A 2PNFA 1BFUA 2X6QA 1ECGA 1ORVA 1U98A 3NRBA 4H7HA 4RADA 1XCMA 2IYVA 1Q0SA 2WJGA 4PNZA 4LVNA 4LWPA 3ZI4A 4BVHA 1P2FA 1C80A 1JG3A 3L18A 1HRKA 3WYDA 4E2ZA 1GVNB 5KEIA 3HTXA 3VH2A 1IUKA 1JYFA 1ISFA 3G79A 4MITA 1KKMA 2J32A 1P6QA 3OH8A 3LTNC 1UM8A 4GI5A 1DUSA 1S02A 2O4UX 3BD7A 4NL4H 3MC1A 2AG1A 5GONA 3UUWA 1P7PA 2B0JA 2OV8A 4DDVA 1J8MF 5TRTA 3H86A 1J2RA 3PKJA 1QHGA 5BV7A 5EFOA 3KOMA 1SOMA 1FFXB 3IEXA 1E6CA 1KIFA 5DI3B 2WQ6A 2AX3A 2V7QD 2X0RA 4G8CA 1GN8A 4LZOA 5HIJA 1BZYA 1XL0A 2NM0A 2OUIA 3DQZA 4R8RA 4TTAA 1M7BA 1XBTA 3JQRA 5A5FA 5JSUA 2BBOA 3DO6A 1Y81A 1QNFA 4H7EA 4QBIA 1G8MA 2UZ1B 4RACA 3EPRA 3G02A 2PZFA 3CVVA 3EQ9A 4G5SA 3WNCA 4BFWA 4QTYA 4N0EA 4OQLA 3ZR4B 4NBTA 1U7ZA 3LRTA 2OENG 3FIUA 4PTZA 2OZEA 1THTA 1T9DA 3C1OA 3OIYA 2DF8A 4E08A 1DADA 3QKIA 4KIFA 3ZE8A 2ZI3A 4EKGA 3UJ3X 1SAYA 1KKUA 1CRZA 4EA9A 1VPDA 1YKGA 3T0IA 3U62A 4BFLA 2D2FA 1QGED 1U7HA 4IFBA 4QELA 4OHKA 5KJ6A 5KVVA 2POQX 1IM5A 2PGDA 3LL7A 3OX2A 4GZ5A 5HKLA 1DX9A 2W2PA 4LAFA 3UHPA 4C4ZA 5FUQA 2VHQA 2FXVA 3PLNA 2GZHA 3T4UA 5CA0F 4OQPA 4JUAA 4FS8A 1TJ3A 2Q4OA 4URFA 1PHPA 4CQMD 1G3RA 5KKCA 1UBRS 5MGBA 5IZCA 4DV1B 1OFGA 5AVYA 5HKBA 4RTLA 3A14A 3DZIA 3T9AA 1G8KA 4BS9A 3W3AA 2O5CA 2RI1A 5FP0A 2X1VA 1WXGA 3NP9A 2OHVA 4HDOB 2GEKA 4JJZA 3NW9A 1JE1A 5GJVC 2VT7A 3EY9A 1E0DA 3HC7A 3NTUA 5CD9A 5JZSA 3G49A 2IX3A 2I4IA 2NSHA 3CXUA 4OBBA 1LWOA 4KAAA 4PLVA 5B2ZA 4DYDA 5J43A 2JGFA 2EZUA 4KNYA 4EHHA 5CA0B 3NO4A 1CLUA 1C3JA 4TXMA 4YWJA 4BNIA 3A6ZA 5IBRA 5DN6A 1KJ9A 4OP2A 3E9NA 1BHJA 3JAWA 3ULKA 1NC1A 4FFBB 1ZH0A 3R6WA 5LU8A 4MQLA 2NADA 1JA0A 3W77A 1B0AA 2GFHA 3FYUC 3AEKB 1XWFA 3HN6A 2BGMA 2BVNA 2N1BA 3MLBA 4Z9YA 4I4TF 5SY6A 4X8MA 4OQEA 1LQ2A 1DIGA 1ORRA 4UUQA 2HM7A 3F98A 1IHPA 4E11A 5A06A 3KYCB 4QDJA 2AQHA 1I6MA 3WJ2A 4B0PA 2JLRA 2Q5LA 4LCEA 3DPIA 2TMKA 4ZARA 2ZB4A 1F4VA 4R4JA 1QS0B 1K7FB 2MSWA 3HJGA 4V0SA 1ZL0A 4EM6A 2HRZA 2QRQA 3EGDB 2JI8A 4GBGA 1Z5PA 1WXXA 2EHJA 3JASA 1D6MA 3LUCA 2O8CA 5F1PA 3AM5A 3LBIA 3IQDB 5BQOA 2IHBA 3KUKA 1NMSA 2UUOA 4H08A 4D3YA 4PQGA 4EUKA 2C5AA 3G1TA 4Y2GA 4HDMA 2WP8J 5LA6F 1RRFA 4BDTA 1GA1A 1GHTA 4WNCA 4C3VA 1UBEA 3I04A 1IY2A 4AMBA 1DIAA 2HDHA 4AY4A 1HEIA 1VKHA 3FLBA 3TJMA 5F23A 3HGTA 2JLUA 2BKAA 1QAQA 3EVTA 1JKJA 1U9JA 4BLQA 4UUAA 5LXTF 1TJPB 1HX7A 4G0XA 2A33A 3IAXA 3RNOA 3ZS9A 5LYJF 4YRJA 4A27A 1YF3A 2J9XB 3CBGA 3IR6A 2RHTA 5LD2C 3H2JA 1SG0A 3A6HA 3IQIX 4U2CA 1ZRMA 1KJZA 2A4KA 5K1ZA 1IN5A 2P68A 3GA5A 1WOMA 2ISQA 5DM2A 2VWQA 5FYDA 5KS2A 2GXSA 1VCOA 2JVIA 3EXIA 2OCYC 3A1CA 4P58A 4R2WA 4TL7A 1WB5A 5DASA 1JEDA 5BUCA 4S04A 1ZHOA 5LA6B 2FLWA 4CTJA 1R0ZA 1Q0PA 3ELYA 2Y99A 1MW8X 3ZY4A 2Z2KA 1KXZA 4YJFA 5J9FA 4PANA 5IKOA 1I2DA 4JJ4A 3A4TA 4HNRA 3Q2OA 1BYUA 4XGIA 3AI3A 4GQIA 3QFCA 3BWBA 1SK9A 4MH0R 3VSDA 1IRIA 3C85A 3JALB 3H9EO 3PNSA 3C4JA 3PEUA 3U81A 4B9AA 5LYJB 4CEJB 2P7HA 1KYTA 2XCQA 5KTOA 3ETNA 1J4AA 1EYZA 1Q92A 1YHNA 2O48X 3UAWA 1G1AA 4GRAA 2ZU0C 1PHRA 3UV7A 4BPRA 1EVQA 4W6QA 5IRCD 1AQUA 3HXKA 3Q4GA 2Z8XA 4CI0B 2PVSA 1NP6A 5IVHA 4HAWA 4X95A 5CPBA 5FTJA 1BU8A 1Y4AE 3RANA 4H7JA 5IBPA 3K5WA 1IQRA 1XMXA 2B1QA 2I65A 4K03A 4YJGB 3SBEA 2HQSA 1LI7A 2BFWA 2NZ8A 4HY3A 4ZU1X 3UWSA 4AULA 2XR1A 5DIFA 3ZTYA 4EPVA 4YJHB 5B4TA 5IUNC 5EJ7A 1XRJA 4HQ0A 3S2YA 3VR5D 1ZOLA 1ZD5A 3T99A 2IQ5A 3K2BA 5J40A 3AEXA 4HLCA 2ZT7A 3EB9A 1ZD8A 4ZZIA 2VAMA 1C1HA 4TQGA 3PTLA 3K15A 4DIBA 1JHOA 4G5RA 3E0XA 2OCXA 1XJCA 4LN1A 4TSFA 3KLPX 3ESZA 3FGPA 3LUPA 1GLNA 2VPTA 1W4RA 2YTZA 4PX2A 3F7NA 4Z53A 5AHKA 2AV6A 4UVHA 1NLMA 3CEPB 3TM5A 3KQVA 5FADA 3LPMA 2ZUVA 3WBJA 4CKCB 4Z7JA 4N48A 1H4QA 2R6HA 1ESNA 1SOAA 3QA3E 4G5GA 4RS4A 4FDAA 4M0CA 4UQLA 2G0TA 2CDNA 1Q7EA 4JX9A 2BFEB 1IN4A 2CJXA 2FJUA 2C8VA 2IOQA 3OICA 2KQUA 4YQEA 3CX3A 1DEHA 2G17A 1U0GA 4TSRA 2QT0A 2OBMA 3DFMA 5A6SA 2WK1A 1N1MA 2O6LA 3GFGA 3HP4A 2KB0A 3DXZA 4HEA6 3TKAA 1K7EB 4AZ3B 4TN1A 1YB2A 2NV6A 5AI8A 3RUEA 1DO2A 3ZGLA 4IH4A 3U7JA 5HQ3B 1N1DA 3AJRA 3NWPA 4GGOA 5I4BA 1JQKA 1QHYA 4JITA 2YYAA 2JD1A 2V7VA 2EL7A 3Q88A 1U28C 2AVNA 3T7SA 4EHBA 1LF0A 2SECE 1Z0IA 3THOA 2VDOB 3ANSA 4G8JA 2A3NA 3GWZA 4MA4A 1QH8A 4YH1A 1TYCA 4IEEA 3O38A 3AH8A 1H6DA 3P4UA 3CVXA 1FYEA 4TRMA 2Z8YM 4QYMA 5B3LA 1MFZA 1VRCA 4QAJA 1K89A 1TNDA 3N74A 3R20A 3ACBA 1N2CE 4I1YA 3TE6A 2DY1A 3RFXA 1Z08A 3JATB 4GO1A 4TPKA 1QYDA 4IIEA 1AMUA 1NNSA 1FW8A 2W5UA 1VPWA 4K46A 5HMMA 4DDKA 4GRDA 4L2IA 3HCEA 4JH0A 3G2KA 4KO1S 5I8ZA 4U6NA 5TT0A 1AV7A 2B6HA 3EGEA 1MF7A 2R6ZA 3G8BA 1JBQA 2YICA 4PZ9A 5AKXA 1IG0A 1VL1A 1WLSA 4EI9A 3WLAA 2FK7A 2YXLA 2ZPUA 2M6SA 1Q3TA 3H65A 5E3JA 3ZU4A 4DLAA 4ABTA 1NLFA 1BD4A 4O4LA 3LP6A 2GM4A 1UPXA 3LUJA 5FR2A 4EG4A 5JAPA 4WADA 4F8JA 1P4GA 2V6FA 1C81A 2Z4RA 2OWEA 4X5OA 2OD9A 2WPNA 4TYYA 4J0CA 4QOIA 4MIOA 2APJA 1XVAA 3OOWA 5E8RA 2GS9A 1RWPA 2DY0A 3AHCA 3FIJA 3HCBA 4FZ3A 4ER3A 1NJ1A 4NZNA 4RC9A 4IQ4A 1G5TA 2Q4RA 2V8OA 5AESA 4DV5B 5IAEA 1SHZA 2A0FA 4P22A 4X8HA 3SD7A 1THZA 4ENWA 5J47A 1NJ8A 2XIJA 1QIMA 3K20A 3CC8A 3THXA 2YV1A 4D0RA 4OK6A 4QJ3A 3FOEC 1LDGA 3UBMA 3A2KA 3EPPA 3O84A 3E3AA 5T41A 1JLKA 3JVIA 2DB3A 4RVNA 1SVNA 2IX9A 2PV7A 3TTTA 1HDIA 1UBMS 2UZIR 1E4EA 3ZXSA 1FSSA 2J1LA 2WKPA 4I50F 3O31A 2V54A 3BQNB 3AZQA 4ZVSA 3I73A 5J2UA 4RQUA 5AKYA 2NVUA 4JP3A 1X3LA 1II8A 1FU8A 1UFRA 3CUWA 4FHFA 2TMYA 1VCHA 2O7SA 1EG7A 3GH1A 4X1IA 5DISB 4CTKA 2HQBA 4Q3KA 5DBHX 4DCCA 2PL1A 1DBSA 2ZYDA 3KJFA 2NO4A 3GLGE 4PHFA 4QO8A 1CUCA 2QRJA 3OJCA 1ST3A 3UJBA 2XXAA 4XD7A 5BW5A 3KTFA 4CI9A 2DPGA 1RVV1 1T5LA 2GEVA 4I4IA 4P81A 3R7LA 4EPWA 1W4LA 4YR7A 5CFRA 4MMZB 2QTVA 1H3FA 2RBEA 4JY7A 2QOEA 5ALZA 4NQRA 2E48A 1LPSA 2PMEA 4NMWA 3QKSA 3L4BA 1WF3A 3R9WA 2XH8A 3A1EA 2BZSA 2A1TR 4OMCA 2HNAA 1QMGA 2F2TA 3ZWCA 4E1AA 1JZSA 2HWUA 1I5RA 4L4UA 2NMVA 1VMEA 1QBKC 1VLLA 1GPUA 3H8JA 1S4QA 3RG8A 3RKUA 4DQUA 4CIDA 3MF4A 2FB9A 3AUYA 4KH1A 3WL6A 4JP8A 2O8DB 2ZWOA 1YUNA 3NI2A 4A0QA 4BU0A 1KNXA 1RLTA 1T13A 2Y6UA 1XMVA 2FEPA 2WINI 4PSDA 3PRKE 5F64A 3BXOA 1NF3A 3O9VA 4MRMA 4OKSA 4A6XA 5BQ5A 1IWPB 3M7IA 5EHNA 2NNLD 2EIHA 1D5CA 4PPFA 1LX6A 4BKRA 4BO7A 4E32A 4ZOBA 2ROQA 3BTSA 1T5IA 4I1UA 4K1XA 4OKIA 2HGSA 3QVUA 1HDEA 2H1CA 3D4LA 5KOIA 1AQYA 1TMGE 4ND2A 3FTEA 2NO0A 2V55B 2QU7A 5KNBH 2JG3A 3AIKA 3GK3A 4FSXA 4FI3C 3NOVA 2QRMA 3D6NB 3ZJ4A 4K0KB 3BMOB 3HGMA 4EY3A 2B34A 1QRRA 5KYWB 1ZR4A 2YV5A 2PRIA 4BJHB 3DEJA 4AU1A 4ZZ3A 5ALLA 5IKPA 1G20A 1QQBA 1OX6A 1TDJA 4R1OA 1H2FA 2P7IA 3O73A 1SXGA 3KVRA 4OFXA 4PAOA 1DPGA 2A5JA 3KRTA 1NASA 1SJ9A 3X44A 3OWXA 4U6QA 1EH5A 2A2ZA 3M6IA 2NOAA 1ZJ6A 1R9JA 1J21A 4XASA 4ENTA 2XBUA 3DZ8A 3IVCA 4NICA 4NBRA 1VG0B 2QM8A 2XRFA 4AWXA 4GI7A 4KXNA 4C0BA 3C41J 1CU1A 1T3ZA 4DZTA 1I8TA 1PKEA 4ZICA 1I7SB 2ZM5A 1CE8A 1YS2X 4H7IA 2NLOA 5IAJA 2XODA 4CU2A 1KAMA 3NORA 3V97A 1A77A 2IHYA 4PSCA 3K32A 2GHRA 2C5BA 4LSWA 4TXHA 1PGJA 3IKJA 1MRZA 1WEHA 2JFZA 4QEKA 2CLCX 4H6VA 3DOOA 3OQOA 1G7SA 1XEXA 2E18A 3PC3A 1TA4A 3QHAA 4HFMA 2O6HA 2WMYA 5FL7D 1JEOA 1BS9A 2QTZA 5GWXA 3NWJA 2ERCA 3BHIA 3QOFA 3RS2A 3CUVA 5A2GA 3F47A 1NM5C 3GRRA 3FTPA 4DM7A 3LHSA 3KETA 5JBIA 5KQLA 1K7YA 1ZGBA 2WABA 4RLQA 3U0VA 3GLIE 2PJRA 5K0BA 3AONB 2Z1MA 1UP6A 2OGUA 3PQCA 1DOAA 5LQKA 3TCXB 1B0PA 3BTUA 4N5HX 1QDUA 4LXUA 3BKXA 4HZUB 4I2VA 2ZJBA 3EEQA 1CQJB 4JI6B 4BNZA 3CF0A 1XTTA 521PA 1RZUA 4KQ6A 3K05A 1T6ZA 1BO6A 1P0IA 3B2EA 4RVOA 5E3HA 2GBIA 1ZMXA 1VPVA 5J58A 2IELA 2QVLA 4QPCA 1OXBB 1QFYA 2ZE5A 5CXXA 4JEHA 2XHZA 2ZXEA 3BH0A 1YJQA 2D2XA 2WYIA 4WCFB 3SMVA 1J2JA 2ID7A 3OHPA 4XQEA 2GUWA 4N4AA 2FW1A 3JQ9C 4R0VA 1HUQA 1A88A 1IWBB 2JC3A 4ZO7A 3RSOA 4BO4A 5AXAA 4OA5A 5I5EA 1M6NA 2XTAA 4ZHQF 4OB6A 1RRVA 2Y67A 3DTVB 3FMIA 1B42A 4O5AA 2DHQA 3TLBA 3DYBA 4AG5A 1QH1A 1PBTA 3PQ5A 1DXHA 4GVLA 4X94A 2YZMA 5AKHA 1POWA 4Y2YA 4C7JA 1ZW6A 3TFOA 4L57A 4P84A 1TAHA 3UMBA 1G2OA 2R7NA 1NKTA 2NVOA 1IHDA 1Q15A 1OWNA 2DR0A 2PBRA 4OJQA 3Q3IA 3QEJA 3MN1A 3GHYA 3BILA 4YLYA 1ENZA 1JIXA 1P1BA 3ESBA 3KVYA 1I3KA 1UJMA 3QF4B 3QPVA 4JT9A 5A3SA 3DW1X 1Z8HA 2HK8A 1N5OX 3IBYA 5HJ2A 4TLCA 3UANA 4DIEA 2O2XA 3WXBA 4D41A 2VA8A 4BZZA 3CJRA 3UJPA 4Q7QA 2VPPA 1A96A 4MS3A 2PVPA 4MI3A 3GP8A 3MJSA 3AINA 1G2IA 4G5HA 2EZ9A 5ALKA 4CCWA 5U9CA 3R9XA 3LIIA 4A36A 3G5AA 4I7EA 3IBTA 4UNNA 4DRXB 3DMNA 3WWOA 2DTDA 1NLZA 2O0JA 2QN9A 3OLWA 1U0TA 2ZR0A 4G0QA 5EUBA 3EXG1 4QTXA 3K6SA 4JLVA 4XQCA 3OD1A 4A26A 3ZD6A 4TTTS 7YASA 4N0MA 1U4OA 3EZ2A 4OVKA 4UNQA 5AJUA 3H2HA 4KOEC 3RUIA 4ZT5A 5IJ0A 4OXRA 5COAA 3CZCA 2XCOA 3U7GA 4FK8A 3UUEA 2C00A 2N75A 4YECA 3K1ZA 2BI8A 2P2ZA 1W5BA 2X58A 1KDZA 3S40A 3EE6A 1U6KA 3UATA 1E9FA 1M0TA 1PK8A 3OX1A 4GS5A 4PTYA 4BO8A 3GGDA 5KYVA 3RYCB 3WYEA 1TVCA 1XD9A 2F4VB 5MFPA 3ZV5A 1HXHA 1RAAA 2QVBA 5FWDA 3Q11A 1FP4B 3HZHA 2LXNA 4QKQA 4MW2A 2JD0A 3DYVA 2OHXA 4F3TA 1FX0B 5ITZA 3SQNA 4YAGA 2B1IA 3QNWA 1G6HA 1WG8A 4HDKB 1YUBA 1Q6ZA 2EBUA 1YWGO 3GEIA 4QTZA 1HE2A 3V9AA 3ZDYB 2OVFA 3BB1A 3FBTA 3PFFA 3HEAA 1N2IA 2G04A 3BMCA 2AI1A 3M5DA 1M34E 1OPRA 2VATA 4DV7B 1S2IA 2I6FA 3G1UA 3NCTA 3DBHB 4PLHA 1M2NA 3FOCA 3WADA 1BDJA 2VUHB 2WWRA 4EY4A 4K3UA 1RYMA 1WHSB 4RTNA 1CR6A 4MLZA 5IAAA 1BKDR 1GEEA 3BEDA 4MYSA 5CLLA 1WEKA 4TRNA 3IVAA 2AG5A 4R2HA 4D97A 3WQQA 3GXBA 1XZGA 1DRUA 4DDMA 1MNQA 2C5HA 3F67A 4P36A 9MHTA 4F1WA 5FD8A 3NDRA 5U4QA 1S9HA 2OBYA 4U7TB 1WKCA 3ROEA 1OH7A 5AVXA 5G1OA 4MDFA 1HLGA 2WBLC 4CDMA 1TI7A 2X9NA 4FCCA 2O1XA 1G3UA 2ZBRA 5E38A 2QYTA 4NULA 2GD0A 4OF4A 2ZIUB 3UPTA 2PMBA 3BK2A 2AXNA 3FF4A 3OLVA 4IOLA 4EJ6A 1CDDA 4M0DA 1Y1QA 4ENPA 3K6RA 2CF6A 3PUIA 4BQOA 4TQUS 2OC4A 1XN4A 3AC0A 3SCZA 2E4AA 2QN1A 1LF5A 1RWWA 4AKSA 2JHPA 2X14A 3VQTA 5ALHA 5SZHB 1ZMRA 3PP8A 5CAEB 3LA8A 4QPJC 5DGTA 1ZGCA 2H00A 1DUVG 4OJKA 2G80A 3V4ZA 2RONA 4DE5A 2PL3A 1I5EA 4HYQA 3FWZA 4TWIA 1G19A 3BWDD 1DAEA 1SBYA 2AJBA 2XYVA 2NU8A 3NIFB 4MUJA 2NZUG 4ISBA 3GIDA 1PYGA 1YDGA 3BXPA 1MIOA 4M83A 3VR2D 5HXAA 4ESEA 4ND3A 2HKIA 5D6NA 3PYXA 2WHPB 2J7KA 1Y3DE 1MRSA 3AEQA 3ORHA 4KK4A 3ZWWA 4IUBS 4DMLA 1DEOA 2J7PA 4CMEA 2KLBA 2YCBA 2FDRA 2BT4A 3NHUA 4NMMA 4S1NA 1IZ8A 3QUQA 1V2GA 2ZSDA 3SZUA 3TB6A 5BV0A 1ADJA 1NMEA 2XNDA 2OYRA 1Z25A 4I4NA 3TWOA 3X3HA 4DEVA 1JZQA 1MTOA 3S5UA 4UNIA 1KSHA 1W4CA 1DZ3A 3LO5A 4J3NA 3R7FA 3W9YA 4RZXA 3EDQA 4GDMA 1T4GA 4JP2A 3VTAA 2DUNA 2ZYAA 3GEGA 4H15A 1GP2A 4Q1AA 3RRNA 4TV9A 2PM8A 5BXYA 3H4TA 3WIBA 1JXQA 1DBPA 2W6ZA 1MKYA 2AXEA 2CGEA 4KQJA 4NPCA 5EJ2A 1YQEA 1SUCA 4KI7A 1CJSA 3MCUA 3SJZA 3HYSA 5JHHB 1FRFS 3GNLA 2GESA 2AQIA 1SXJB 2VQ3A 5AUPB 2AKYA 1H6BA 2JLAA 3VR3A 1QCDA 4M9ZA 2VUSA 4N5IX 3ZHBA 1EVKA 3LQ2A 4YP6A 1OVGA 1C4XA 2R1VA 2JCVA 2E37A 3NTRA 2G8LA 3PFWO 1B43A 4GE3A 1QGOA 3LHKA 4ZEWA 2HF8A 5GAJA 1M2WA 3ZCRA 3LF2A 1VBFA 1Z8FA 1O54A 3JY6A 3GLKA 2IY8A 4UU1A 3TVYA 1VIVA 3E7XA 3E70C 1VI5A 2G63A 5IH7A 3IESA 4Y9SA 4BFSA 2HB6A 3FMOB 2PPLA 2XB9A 4AUNA 2WMDA 3BDIA 3T1HB 1JYSA 1UP4A 4MRVA 5KJFA 4M21A 2VAWA 1RJ9A 3FPFA 4FGJA 5J4YA 2MT9A 4X66B 2RGBA 3I39X 5HF9A 3NKLA 4S1WA 1FFBA 4ES6A 1EE1A 1UDWA 4V1CI 1I7DA 4X65B 1L7RA 2HA7A 3IOEA 4HWGA 3UFBA 4JQZA 1ULZA 2B83A 3A3YA 3TMAA 3PVCA 3HM2A 1AT1A 4BYGA 3MJVA 2D6FA 1T4CB 2G4VA 5F4BA 3RRMA 4GOND 3TI7A 1ECPA 2D4AA 2HU2A 5AVRA 1TU3A 2WFLB 3FFAA 1X7YA 4AK9A 3EQ7A 3W2TA 3DZJA 3PLAE 1VHQA 1WVMA 3EOAI 5ILQA 3PNYA 5FBWB 1N92A 2R5NA 3LDGA 3H3FA 3OQ1A 1AGNA 3PC2A 1UMDA 2RAFA 3AF5A 2EC5A 1GZ6A 4PPGA 5CTJA 4RKFA 5F4ZA 1JEEA 3MTIA 1RAGA 4G4JA 5FOQA 2A9PA 1U2GC 2YNMA 4IJ5A 2ZCVA 1C7IA 1C4OA 4IAOA 3NKFA 2H1HA 3EWNA 1GUFA 1GDDA 5AWFC 5AJXA 1XTVA 3V5NA 4RLHA 3MCZA 2F3RA 2QTAA 1AA6A 3EODA 3IT3A 1K6EA 3ODGA 1TECE 3PNOA 4P80A 4ALKA 2HLNA 1XZIA 2I22A 3U37A 2WLSA 4FMPA 3AF1A 2OFFA 5KYTA 4EGAA 3FB4A 1M8PA 2BGRA 1TU4A 2AE2A 2W2MA 2XY4A 1M67A 4BAGA 5CG2A 1ZI6A 4FOPA 1U3TA 2XQJA 1CG6A 1VJCA 4JDUA 4K9DA 4U0KA 1NMZA 1NF2A 4YK7A 3BCSA 3B9RA 3R7WB 2YKGA 2C8KA 3ERCA 2E2WA 1Q0QA 3SSAA 1JFSA 1N5RA 4NDNE 2IPAB 1EG2A 2MHCA 4PG7A 1SVOA 5DT9A 4EBBA 1B0UA 2E4WA 2YOHA 4Q4JB 3SZMA 3KP1A 3R0IA 5AK4A 4JLBA 5JS2A 4DNOA 3P9CA 1LLDA 4FGWA 3R3HA 4M9SA 5B1SA 3NB0A 5EXSA 1TTTA 3GJ6A 1T34A 5DE3A 2DHEA 5BYKA 1C7EA 3AF0A 1ZIYA 1OAAA 1YNSA 2OFPA 1NBMA 3KPYA 4D9EA 1NV8A 1OC2A 1T0IA 2Z95A 4IYRA 1Z38A 4XGNA 6NULA 4QHSA 1Z83A 2G9QA 1KAGA 3V8VA 1UPFA 1MAAA 1R3DA 1G60A 1VKJA 2EFEB 2UYYA 3D8UA 1EFUA 4KE6A 4RVDA 4EYEA 5CYFA 5ALPA 4M1WA 1JTFA 2H7XA 3DDCA 1C0PA 1G7CA 3QJGA 1Z0UA 3KU4A 4OHWA 3AVTA 2HA2A 3UAGA 4UEOA 3KEQA 2PH1A 2P9QA 2C4MA 4OMFG 2C9DA 3A1FA 4RK0A 5KYXB 3DEKA 3VNUA 4BN5A 1YTLA 3DBRB 1W6UA 5EUCA 3FRIA 3S7TA 2RE8A 1DX6A 4WZBB 3IILA 5AKZA 3TOCA 1AKNA 3GA0A 3FKQA 4Y2SA 3VH3A 1S6YA 3HA7A 1KRWA 5J63A 2V9CA 3CW2A 1A04A 2PDAA 3MOSA 2FMKA 2ID9A 3ZK7A 1REQA 1E1CA 4ME6A 1GSIA 1S2NA 1U0JA 3RYFB 1C9MA 4KQ2A 5CW1A 2RCYA 4KO8A 1IE3A 1FSGA 2FEKA 3IAEA 5HMLA 3WTBA 5JYBA 1ECLA 3B6ZA 4NX2A 1KMMA 3VBCA 5KNCA 3CLRD 5AHOA 1W1UA 4EAQA 4F3YA 2ZBGA 1UK7A 3U39A 2C7RA 2ZKLA 4A1FA 2NZYA 1ML4A 3OTHA 5G02A 4ENQA 3GT4A 3KAJA 4G1FA 1CRWG 4P3PA 4ERXA 5FBZA 5BRNA 4XYEA 4MWCA 3T6KA 4ZMRA 1PUJA 1QJ4A 5FLXA 1GUZA 4DJFC 2WYVA 5KKNB 4EW1A 3ZE7A 5CT9A 4BY9E 3IKLA 1SC3A 2AFHE 2CZQA 2P9EA 1ZLXA 4S05A 3T1YB 1RPAA 1AK2A 2VJCA 2YWXA 3LT0A 1KBQA 2D7JA 1MB3A 2OG2A 1WMSA 2ZANA 3CGWA 4NBKA 4C4AA 3ZQUA 1JFFB 3O8QA 1VFNA 2ZRQA 3COSA 3EF0A 1D2GA 3NRJA 4KQ9A 4EX7A 2OFWA 3BD8A 3EGOA 3NANA 5AQ1A 1AVTA 4PLZA 4MX8A 2O7VA 4GEGA 2I4TA 1GKLA 2P77A 2QX9A 2PFGA 1XU9A 3CLTC 3BWMA 3C7CB 1I6KA 3E5NA 4FFRA 4P7BA 4B5KA 4PSKA 5JD6A 3OIGA 4CUJA 2XYRA 4WACA 4LTMA 1L2TA 2IU6A 4HNSA 1U2RA 3U6KA 1HFWA 1ZUHA 2NTEA 3I9LA 4PCAA 4NWIA 5ERGB 1RQRA 4KQXA 2VA9A 1TZ2A 4L8FA 1LJLA 4JP1A 4AZVA 1NI3A 1Y8QA 3INYA 3JVDA 4G37A 4GVPA 4AS2A 1O3YA 3M1AA 4QL3A 4M1ZA 1K5HA 3I2HA 3LW7A 4ZEVA 3DNMA 4B79A 1ULSA 5K8IA 4G4SO 1Z4MA 1NI4B 4COOA 4XYLA 4M8KA 1ZXBA 3G89A 4IFTA 1UBCA 1YRAA 2FZ4A 5DGHA 4YUWA 5LOVA 2FPIA 2CT8A 3DDHA 5JJKA 2C07A 3VTKA 3Q9LA 1M2JA 3U17A 1OYYA 4O2BF 2B3TA 3HABA 4NCBA 1DEXA 2BBWA 3MLAA 5DM0A 4EKYA 4ETMA 4IDGA 2OMKA 3GPBA 2C04A 4DQDA 2P6NA 1VCNA 3LLCA 2J5XA 2VK2A 2QLBA 2I7XA 3UC9A 4Q1BA 3L6OO 3OFJA 4F0JA 1Y1RA 2EJWA 2AZTA 5FI1B 4BU1A 4JQOA 4YCCA 1YCFA 1SZCA 2HZ7A 4WFJA 1FB5A 1PR2A 2B8WA 2R97A 1X7XA 3KC2A 2YJ4A 3EZFA 4N18A 1SU6A 1RQ2A 4R7GA 1DBRA 3I58A 4O2BB 2KWIA 2ZAOA 4E88A 4RHUA 5IUJC 4CV3A 3EEFA 5DZSA 3BVPA 4BNYA 4E4RA 4O3MA 2HEIA 2HNKA 3G59A 3ROZA 4H3HB 1Z4OA 1PZNA 1U7UA 1QB7A 3H17A 4Q4AA 4TKLA 5FOWA 2PD4A 1L7QA 1ENPA 4C21A 3AW8A 4UOZA 1TEZA 3OTWA 4BVBA 4L5IA 3FR8A 1IEVA 2FSPA 5FFMA 1Y33E 4GE0A 5EZ5A 1OD6A 1PX2A 3FPHA 5D5PA 5ARDA 2F64A 3L7BA 3KT3A 4B8WA 4PQFA 5KU1A 1BAPA 3WK8A 1OV6A 2ALJA 3NHSA 3GMSA 3AVOA 2P30A 4IL5A 4KW7A 1TKCA 3WJAA 4MVYA 4PBSA 1K8ZB 1TMKA 1E3LA 4HN4B 2H7VA 3KT0A 1G66A 1BCRA 2OK7A 1OUMA 1XXHA 4BDSA 3H2ZA 5C81A 4I5FA 4ZOAA 3HKBB 1USGA 2HJ9A 1U5AA