3TOYA

Crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium sp. ors278 with calcium and acetate bound
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
359
Chain Sequence
TTAAITGVTARAVITPMKRPLRNAFGVIDSGPLVLIDVTTDQGVTGHSYLFAYTRLALKPLVHLVEDIGRELAGKALVPVDLMKAMDAKFRLLGWQGLVGMAVSGLDMAFWDALGQLAGKPVVELLGGSARPIPAYDSYGVLDARDDERTLRTACDEHGFRAIKSKGGHGDLATDEAMIKGLRALLGPDIALMLDFNQSLDPAEATRRIARLADYDLTWIEEPVPQENLSGHAAVRERSEIPIQAGENWWFPRGFAEAIAAGASDFIMPDLMKVGGITGWLNVAGQADAASIPMSSHILPEASAHVLPVTPTAHFLEVLDFAGAILTEPLRVIDGKVTAKGPGLGLAWNESAVAKYQVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme family protei
publication title CRYSTAL STRUCTURE OF MANDELATE RACEMASE FROM Bradyrhizobium sp. ORS278
rcsb
source organism Bradyrhizobium sp. ors 278
molecule tags Lyase
total genus 120
structure length 359
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3toyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3toyA01
3UJFA 3MY9A 1KCZA 2GGIA 2HXTA 2ONEA 1TZZA 4ROPA 4HCDA 3CXOA 2XH4A 1SJDA 3U9IA 3CT2A 3MUCA 3DG6A 3Q4DA 3ZVIA 3R1ZA 3OZYA 3RCYA 1WUFA 4X2PA 5BOFA 2OZ8A 1TKKA 1JDFA 4Z17A 3TWAA 1E9IA 1BKHA 4KPLA 3SBFA 5J04A 4GIRA 2PTYA 3SN0A 1EC9A 3QTPA 5FJRA 3V4BA 3DFHA 3OTRA 3UJ2A 3TOYA 2DW7A 2PTWA 3NFUA 3QLDA 2PA6A 1ONEA 3V3WA 4M6UA 4A6GA 2AKMA 4E6MA 1SJBA 5FJPA 3RITA 4HYRA 1ELSA 2P8CA 1OEPA 1JCTA 2P8BA 4H83A 4HPNA 2OVLA 3VDGA 3FJ4A 3BJSA 2AL2B 2ZADA 4H19A 3QKEA 3SQSA 3T9PA 3OZMA 2ZC8A 3UCDA 3SSZA 2OZ3A 3U4FA 2QDEA 3TTEA 3RO6A 4JN7A 1MDRA 4JN8A 3PWGA 4GISA 3EKGA 2XH2A 2AKZA 4ZA0A 4DN1A 1XS2A 2POZA 3MZNA 2PPGA 5FJOA 3TWBA 3VC5A 4IT1A 2QDDA 3ENLA 2QJNA 3DIPA 3BOXA 2PP0A 3NO1A 1P48A 1EBGA 2FYMA 4HCLA 2PGEA 2XH7A 2PU1A 3QPEA 3NXLA 1EC8A 3R0UA 3UXLA 3JW7A 1EBHA 3H70A 1MDLA 1WUEA 4G8TA 2AL1A 2OQHA 2GSHA 2PP1A 2OO6A 2XSXA 4E4FA 2FKPA 3ES8A 3JZUA 3MQTA 4FI4A 4DX3A 1BQGA 3CYJA 3Q45A 3VC6A 2PODA 3T6CA 4ZCWA 4DWDA 2RDXA 1MNSA 3CK5A 2PS2A 3I6TA 3H12A 3QN3A 3R11A 2QGYA 4IL2A 2XH0A 2PCEA 2PTZA 3ZVHB 4K2SA 3P0WA 1P43A 3DG7A 3GC2A 1PDZA 3DDMA 2P88A 1FHVA 3DG3A 5BOEA 1KD0A 4J3ZA 4HNLA 3T8QA 3H7VA 4EWJA 1ECQA 1YEYA 3MSYA 3UGVA 3S47A 3SJNA 3P93A 3KUMA 3I4KA 3MKCA 2HXUA 3UCCA 3IK4A 2P0IA 3VFCA 2OPJA 3DEQA 3D46A 4DYEA 2MUCA 4G7FA 4HCHA 3N6HA 1MUCA 2HNEA 2OQYA 4MKSA 4E5TA 4K8GA 1JPDX 3EEZA 4HNCA 2PTXA 3FV9A 1KKOA 2DW6A 3ZLFA 1TE6A 1IYXA 1JPMA 3R25A 3TJIA 3ZLGA 3H8AA 3TW9A 1MRAA 3ES7A 2PMQA 3UJSA 3P3BA 3FCPA 3TCSA 3IJQA 2OFJA 1DTNA 4A3RA 3DESA 4MGGA 3IJLA 3R10A 4E8GA 3D47A 3SN4A 4GGHA 4IHCA 3PFRA 1R6WA 1L8PA 1SJAA 1F9CA 1R0MA 3OP2A 3RGTA 3HPFA 4IP4A 3TJ4A 2GDQA 4GGBA 4DXKA 3MWCA 4IL0A 3NZGA 4FP1A 4MMWA 3STPA 2PU0A 3R0KA 1SJCA 4M0XA 3VA8A 3GY1A 3OPSA 4GMEA 2QVHA 2PP3A 3PK7A 4KEMA 3GD6A 3CAWA 3IJIA 4DHGA 3B97A 5ENLA 3TQPA 3PWIA 4KWSA 4F4RA 3UXKA 4YWSA 2AL2A 4GFIA 4E4UA 3S5SA 7ENLA 2P3ZA 2XGZA 2QJJA 3UJRA 3DERA 3VCNA 2MNRA 3I6EA 5IDZA 2PGWA 2GGGA 4GYPC 2PSNA 2OLAA 4H2HA 3JVAA 3FYYA 3THUA 3N4FA 4GYPA 2GL5A 2NQLA 3T4WA 6ENLA 4H1ZA 2QQ6A 3DFYA 1NU5A 3N6JA 2HZGA 3K1GA 4KT2A 3V5FA 3V5CA 3RR1A 3N4EA 2CHRA 2QJMA 1EC7A 3ZLHA 2GGEA 2O56A 5FJUA 3BSMA 1RVKA 2OKTA 1NELA 3RRAA 3VCCA 3FVDA 4ENLA 5EU9A 3OW1A 4K1WA 4JHMA 1PDYA 4Z1YA 3UJEA 2I5QA 2OG9A 5FJTA 1W6TA 3SN1A 2OX4A 2OZTA 3FXGA 4IP5A 4IZGA 1KKRA 1XPYA 2GGHA 3ZVHA 2GGJA 4HN8A 4A35A 3CB3A 4J1OA 3GO2A 3DGBA 1FHUA
chains in the Genus database with same CATH superfamily
3MY9A 1XPGA 2DH2A 4XZNX 4EQWA 2HXTA 3GG1A 5ECVA 2GOKA 3CXOA 5A6KA 1AMKA 2VTFA 3UXDA 1SJDA 2YDAA 3VNKA 5LGZA 3MUCA 4AB4A 3CV1A 4Q8OA 1I1XA 5JH1A 1DWAM 3KCOA 1E6XM 4WHBA 2OZ8A 4Z08A 2W3SA 1QPNA 4N9BA 4DF2A 4KERA 3UWZA 2VJXA 4UQBA 4HKPA 3SN0A 2NPXA 1AD4A 1XFCA 3DFHA 3QV9A 4FOUA 5H1WA 2Z2UA 3KP0A 4EAMA 4MPKA 2V6OA 2VUNA 3LBOA 2ZZ4A 2AKMA 1SJBA 1B9BA 4GNKB 2V5BA 2YL8A 4CLMA 1KV8A 1H2IA 1RLCL 4MG4A 4UZUA 3HFYA 5AYBA 3FJ4A 3LSBA 3V75A 3H54A 4UOQA 3UF9A 3QKEA 1XYLA 1XIFA 1JDCA 3VKBA 3U57A 3E49A 7XIMA 5LNSA 4WJEA 4HK6A 3M64A 8CGTA 3W1UA 1VEPA 1FXPA 5DBTA 4Z1DA 3TUUA 3FGCA 3FSTA 3FHQA 3HPSA 4DJDA 4C6IA 5HXMA 1T99A 3MZNA 1HKIA 4IG2B 4GVHA 3TWBA 2CFFA 2ZA2A 1MO0A 1M65A 3UNDA 4IX0A 3WMBA 4LUJA 1P6BA 3VIPA 4O1AA 3WFLA 4UZSA 5AYZA 4AZGA 2YBVA 1EB3A 1H5VA 4O8RA 3H4KA 2ZKMX 2RABA 2C0AA 4M6VA 3BWWA 3HJEA 5FJIA 3W2LA 1MDLA 4BFAA 3LN3A 3W2NA 1OFAA 1UKQA 3BOLA 3UZ5A 2AL1A 2JKAA 4XO6A 2QIWA 1E5NA 2E5AA 2Z1WA 1MUWA 3BQ5A 3VOFA 3UU0A 2FKPA 3P62A 3MQTA 3W9ZA 2XWEA 2XDFA 3CV2A 3RMEA 2IPWA 2VELA 1KBKA 3KFTA 3QLLA 8XIAA 5I07A 2PODA 1BTMA 4IJRA 3WH9A 2REQB 1PX8A 4C5YA 1LG2A 5G1MA 3G1XA 5LIXX 2QGYA 3LTSA 1JAKA 2CYGA 1G1YA 4GI4A 4IP7A 3PTKA 4JKLA 3O6YX 3LXBA 1HZYA 4I9TA 1E0TA 2AMGA 1I45A 3CZLA 4WLCA 3GK0A 1ECQA 5ER0A 4F40A 3N4AA 2IXVA 1UOZA 2BASA 3PZMA 4UFIA 4N7QA 4B5SA 3WLMA 5FF3A 1OVDA 3ARWA 2V8ZA 3IK4A 2I14A 4HTYA 5JCKA 1DJZA 3O63A 1JFHA 3BAXA 4NJHA 5CPQA 2D0HA 2VZUA 1J8VA 2E3TA 2JFEX 4L64A 2MUCA 3KW3A 1GPFA 1GCYA 2WKJA 2AOSA 3ARTA 4IQEA 5G2WA 2GWGA 4UTJA 3W6LA 4YTTA 4H4YA 3VINA 3WMLA 2VOTA 3M44A 3FW6A 1OGBA 3HTWA 2DORA 1QXLA 3B9EA 2YCLB 3VD3A 4M7SA 3DX5A 1JPKA 3ARVA 2YXOA 3M6YA 4AH7A 2G8ZA 4ACYA 3QPZA 1IEQA 4C6KA 4ERGA 4UFJA 3TW9A 4EMJA 5A2CA 2NWRA 4RNFA 1FFVC 3MBFA 4UXDA 2VVSA 2E3ZA 4HMEA 4LT9A 4XSMA 2NVCA 2QJIA 3TE9A 4A3RA 2PWDA 3P6LA 5JVLA 4CVWA 3MSRA 2Z1KA 1FFUC 1BTCA 1TMHA 4JTEA 4DUOA 3GC4A 1OFQA 3E6EA 3H2NA 1GQKA 2J78A 3WO8A 4UIOA 2VC9A 1CB2A 4HSOA 1I4NA 1O68A 1OM0A 3EXTA 3N11A 3KBJA 4PMJA 5U4NA 1ZK7A 4XD4A 5HNUA 3RPTA 4ZTYA 1Z89A 1O12A 4NG3A 4KFNA 3LTPA 4X60A 3CTTA 1XGDA 2PP3A 3UBPC 5DFAA 3GD6A 1JR1A 4GHRA 1XDMA 1QNRA 4QAWA 5IBXA 1G4SA 3BLLA 2OQLA 2HMCA 3AS1A 5HINA 3WF4A 2PF8A 4H00A 4ALDA 2YA2A 2J74A 4XBKA 3W7PA 3UQNA 4OHQA 3VX0A 4KCVA 4P5UA 1TJPA 1KTBA 2CC0A 3FSUA 3FX4A 5I2UA 3D3FA 3PB2A 4UCFA 1JL8A 4C1NA 1Y7VA 3THUA 1UBPC 1CI1A 5LNRA 3LD5A 3WDRA 4J3XA 5LIUX 4QG8A 4TVYA 1X98A 3AOFA 5A6LA 1NU5A 4XKYA 1W37A 3T1GA 4IF2A 2CESA 4R34A 1PE1A 4FLQA 3F4DA 4GUIA 2OO0A 1J0ZA 4QAIA 4EX4A 1XW8A 3PZ9A 1EDQA 2QV5A 4DJDD 4XZWA 3RX3A 1MW1A 2P5NA 3G6MA 1NFGA 2A3LA 3W7NA 1XR2A 2OGYA 3CUFA 4ZEPA 1J5SA 4UTTC 3ITXA 1GHSA 1EF3A 4P7NA 3THQA 3DJGX 1HO4A 1Q2RA 2V38A 4IGHA 5BOOA 1OFOA 1JGMA 3PVFA 3D5HA 4XVDA 4Z2HA 4W89A 3CB3A 1V6XA 4LY4A 3CIXA 2EKGA 4LRTA 1LJYA 3SY5A 4AXKA 5I00A 4P8WA 3FFSA 5EGRA 1K8YA 3N2BA 1MYRA 3RHGA 1FWNA 2WCGA 1S5WA 2XHYA 3M16A 1QNSA 4AW7A 3U4AA 4AEOA 2QCEA 2WKGA 2ACQA 4ICNA 1JUEA 4LRSA 1F3WA 4JL2A 5CG7A 4ZO9A 3R1ZA 2CLOA 5DY2A 4XAGA 4W4QA 5CC5A 3LENA 2VGBA 2GQ8A 3AYTA 1YPIA 2A3AA 2TPRA 1A5KC 1VIZA 4QQUA 1E4LA 1VJZA 4AZIA 2C0HA 4HPXA 3LCIA 1EEPA 4UQAA 3UJ2A 4QLLA 3VX1A 2PDQA 3PF3A 1QNQA 3NFUA 1W9DM 3SI9A 5H8PA 1P0NA 1N5XA 1EA9C 2Y7EA 3MJYA 4LCRA 3BL3A 4NP7A 1YPFA 2C15A 2RHGA 5CLTA 4DUVA 5FJPA 4GO9A 3B9NA 3TYCA 4H83A 3UWWA 3MANA 1UUQA 4H8UA 4O52A 2AL2B 3MKKA 3WK0A 1OCBA 5D2XA 3ARRA 5LA2A 4Q8TA 3PHAA 1WDSA 4PUUA 3IPWA 3SCOA 4JDBA 1VYSX 3GXTA 3NVYB 2G37A 3U5YA 1P0EA 1EGMA 4X2RA 4NILA 4J3VA 1E70M 1E9LA 2QCMA 1DXLA 3OG2A 3COTA 4NL1A 1OBAA 3WD2A 1GRFA 3E5PA 4IT1A 2YA1A 4WF7A 3ELFA 2PDIA 4QJ3B 2H8ZA 3IUHA 4HCLA 2XH7A 1XRFA 3CU2A 3WNOA 3ALGA 1LLZA 2GJNA 4RDVA 1IWBA 5T26A 1GNXA 2PDCA 4JIRA 3WQ4A 4FK9A 3W75A 4D8LA 3CJPA 1WXJA 4GPNA 3WZ0E 2DJLA 4GQGA 1JZ6A 1K9TA 1JXKA 5KVIA 4GE8A 1UQYA 3LNPA 3HN3A 1BGAA 2YFNA 1I2PA 2XFRA 2PDKA 3U3HA 1W1B1 4FSAA 3AYVA 5E0KA 3VTRA 2RDUA 4IQDA 1CEOA 5G2HA 2D1ZA 4ERIA 3MCOA 3LHYA 3AMZA 1PZ3A 3GXDA 1G7VA 4DEFA 4GZEA 2V3BA 2B7QA 3TA9A 1JROA 4PUWA 4OBSA 1DXEA 3STEA 2GYIA 3M7SA 3CK5A 1GOOA 2YA0A 2DVTA 4O11A 4IL2A 2V3DA 2DZTA 3L0NA 4DAIA 2J24A 1HKWA 1ADOA 4I7WA 1HJSA 1WZMA 4YL2A 1IWAA 3II1A 2CBJA 1XIBA 6ALDA 3FKKA 2DH3A 5REQA 3W7CA 5HQLA 2FZNA 1Q45A 1XDLA 4IJCA 3C8NA 2F7FA 1ICQA 2XVGA 3EMZA 1VF8A 1NP2A 1XCXA 4O17A 4GACA 3WYZA 3VGBA 3D0CA 1EZWA 1VFFA 5D9OA 1K4GA 1UA3A 3T44A 3QOMA 1E6QM 4WSKA 2X2YA 4I6VA 1TE1A 1AW2A 1NHRA 1QI3A 4IPJA 1OC7A 2WZHA 2CZ5A 4UR7A 1THFD 3E2RA 2VD8A 1YLVA 2Z7KA 1EX1A 4ZQPA 3H21A 4PZVA 1K7FA 1P0BA 3WLSA 3BGAA 1XJBA 2QJHA 1KWKA 2FPTA 3KZPA 4HTBA 5E09A 2GUUA 1CTNA 2R1PA 3ZT6A 1K4HA 3B8UA 1KXVA 4GG9A 3VKAA 5I3JA 1HTIA 1PCWA 1NOWA 2XN0A 2TODA 1IT7A 1AH4A 2HROA 2GK1A 2ZUUA 2VEFA 1YADA 3H22A 3KBVA 1VRXA 2QCFA 2C3CA 3RF9A 2BWGA 1VFOA 1YX1A 3KVKA 1J0HA 4TIMA 2JK2A 4O50A 3DGZA 1DWHM 3E02A 3NQ8A 4IL0A 3STCA 4ECLA 4WSHA 3TN5A 3QC0A 4R9OA 2Z1XA 3UCQA 5D02A 4CCDA 1KM3A 3KWSA 4PB5A 3TTYA 1H7RA 4AAJA 3CLWA 3WX7A 2BCPA 2E68A 4PCPA 3UXKA 2BG5A 4KCWA 2V5KA 4MWAB 2KX9A 1DE6A 4LALA 7ENLA 1Y8BA 4NU7A 4UB9A 1M41A 2BX7A 3EBVA 3UJRA 3DERA 4LH8A 1OGGA 3EXSA 3LXAA 1BSLA 2ZRYA 4JQ4A 3EA2A 2PWEA 4GKTA 1XWYA 2IQ0A 4QGCA 5AC5A 5BMXA 3PZGA 2BC1A 1Q4WA 3CASA 3KOYA 1NSJA 2Q02A 4LV4A 2VX6A 3EOSA 3UZJA 4DJFC 4L9XA 4V33A 1AZ1A 1RPXA 2OLSA 4H1ZA 3C3UA 2V63A 3A9IA 3HGOA 4AY8A 3WEOA 1CLKA 3MSGA 4S3CA 1J79A 1DORA 4Z2JA 3BCDA 2YDQA 1L6WA 4ZZ9A 1ZALA 1SW7A 4PB4A 4X61A 5FJUA 2IKIA 2XINA 2WC7A 1CT5A 2IW0A 3W1PA 1SQ7A 2YLLA 1P7TA 4ZTXA 5TQLA 3RRAA 1TZ7A 1UQZA 2XIJA 2R91A 2NT0A 4DQWA 2ZX8A 4DNMA 3W22A 4C6MA 2A3BA 3GVWA 3OZOA 4R27A 3HURA 4FLSA 1WAUA 1NPXA 1QRQA 4FNRA 1Q6GA 3UJEA 4GXMA 1N8FA 2XN1A 4C1LA 1Q85A 3WLPA 1W1PA 4W86A 1ZZMA 3IWPA 4Y9NA 4J1OA 4NZ4A 3UZZA 3VOHA 2WPEA 3C2VA 1STZA 1EIXA 3AHTA 1T6MA 3HM7A 2QAFA 3C0LA 5H2ZA 1VBJA 1IV8A 2V2CA 2B4GA 4BWLC 4XZLX 2J9XA 3HQ1A 4HNVA 1GORA 4GY0A 4QBXA 2UY5A 3B0YA 3VD9A 1US2A 1XV8A 4WIWA 1ZJHA 3GX9A 1R8LA 1TKKA 4S3AA 3DHUA 3GRTA 4DWSA 4URIA 1SFLA 5HNTA 2EHHA 3TXVA 5FS8A 3SBFA 2DUXA 1JIBA 2VX5A 4KRUA 2GR3A 4Q7NA 5F4SA 3TQKA 3O8AA 4AWSA 3W7IA 1M53A 4KEUA 2PA6A 2WLZA 1EUNA 1A0CA 3KWXA 4A05A 3GNOA 3AXXA 4PYSA 4JZ5A 5CZJA 3LBCA 3L67A 3CQKA 3EPOA 5AVHA 3QYQA 2ZX6A 3RITA 4EM4A 3WLKX 1TR9A 1K6AA 3FOKA 1JCTA 2ICSA 2A2IA 4D6FA 3L2IA 2A1YA 1Z7AA 2BNJA 3T0AA 1XH2A 3S2NA 2EXOA 5CPSA 3B0UX 4X9YA 2BFGA 3BG3A 5FL0A 1YXCA 4DO6A 5BROA 4KCUA 3W7OA 1MDRA 3SY1A 1NFPA 4AZCB 1EJRC 3ATYA 1BAGA 3I3BA 3IAPA 2VT0A 1V4YA 4H8NA 4WY0A 2GLKA 1KBIA 1XS2A 4BF9A 4F79A 4GIYA 4D1IA 3O3RA 2WVTA 1A5OC 1R5YA 2IPFA 4DNAA 2GVJA 4IFOA 3F4VA 6REQA 2R14A 3NXLA 4O1EA 4ORMA 4XTIA 4BI5A 3EZ4A 5IFTA 3JW7A 3ARXA 1YW1A 2RFGA 4RJEA 4FIRA 1K03A 2FZ8A 4A29A 1KFEA 1VCGA 2CERA 3NQBA 3PP7A 4FX9A 4IM4A 2A21A 1PSCA 3GDBA 3N12A 2PBGA 3W1XA 1Q66A 1EJXC 2NV9A 1DJWA 1FQ0A 1I0DA 8A3HA 1F8MA 4JQ1A 2WNNA 3H2CA 2W79A 5CPMA 4HNNA 2PDWA 4LBUA 2NUXA 3ZJ8A 3P0WA 3GG7A 3VZZA 1KN0A 3GQYA 4MB4A 2VFGA 4XISA 5EMMA 4ZSTA 3UVAA 2WP5A 3SGGA 4BEUA 3L4UA 4IPPA 4YVPA 3WDIA 1MZHA 1RUSA 3UGVA 5FS9A 1ZXIC 1PBGA 3W76A 3ECQA 1JNEA 2ZQ0A 4L61A 3NQEA 5BXTA 4CNPA 3BAWA 3RU6A 3CPUA 4RV3A 4L80A 2KAUC 5G5GB 3NVTA 3MUXA 3APYA 3RILA 1W91A 2W63A 2OX1A 3A9BA 2ZRZA 4JX4A 3WH5A 3FDGA 5C9WA 1Q1WA 5IM51 1OFPA 1P0KA 3AS3A 5EPDA 3L66A 1UP3A 3E74A 5E93A 2ZICA 1TWSA 3MW7A 1ADSA 4CN1A 1XIJA 4JR5A 2WM1A 1SMAA 4JNZA 3W23A 4B5VA 3I7QA 3B0PA 4AVOA 2DSKA 5C9UA 2I16A 4HA1A 3FHAA 1E4NA 3E2SA 3L4WA 3LLFA 3W1NA 3ES7A 2VL4A 4H04A 4JTTA 1WXYA 3VD5A 1UD3A 1UWQA 4A8RA 3N2XA 3WY1A 3RJXA 4EWND 1SYTA 3SN4A 4AY1A 4LEQA 3VMNA 2F5ZA 4F0SA 1K70A 2ZUMA 3OP2A 4DNHA 4LYKA 3TXZA 3FGCB 2MANA 3OHIA 1LYXA 3HPFA 2X1UA 2ZTJA 1TRDA 2X0SA 1XUUA 3MDWA 5T91A 3MWCA 1W9PA 5I0DA 4FOKA 3NZGA 3HRDC 2DZAA 4X0NA 4MMWA 1XLFA 3TH6A 1XSJA 3HBLA 2E1DA 2V5CA 3OPSA 4K7VA 4MDPA 4PBEA 4OUEA 4N9DA 1NDZA 2P0OA 4PC8A 4F4RA 5DELA 2HV5A 3BOFA 1XDJA 2FLIA 1Q6QA 2E09A 3PULA 4E2VA 1S2TA 4HIBA 1V0KA 2X05A 1JYVA 4CGTA 1GTHA 1ONWA 5A8MA 1ONXA 4DZHA 3M43A 3PBMA 2FHBA 2QDGA 1OFBA 4G2DA 3IJ6A 3I4EA 1IIHA 2ASHA 1UWUA 4PCFA 1Q5MA 2ZYFA 3HG2A 2XSAA 1GVRA 2R9RA 3V18A 2QMKA 4WGHA 1WA3A 1TCMA 1CDGA 2O0TA 3VZYA 1UD4A 1SR9A 1XINA 3P8IA 4N4QA 4D2JA 1DJIA 4WD0A 1V6UA 3V1HA 2CKRA 3CZJA 1W9VA 1US0A 3MPGA 4JBRA 4NZJA 2ZZ6A 4HU8A 3GRIA 2NSXA 1JFXA 1TX0A 5D2VA 4MNKA 4JIEA 3SUSA 2YDSA 4ROQA 2BP1A 4D9PA 4DJEC 1B5TA 1ALDA 4JXCA 4ZBCA 1ME9A 1PXGA 1J11A 1EO7A 3K46A 5BXPA 1D2KA 4Z0SA 2D20A 4IP5A 1F4AA 4IGSA 1M7JA 3WQWA 3ZWSA 4NJKA 3OBAA 4FX8A 4Q22A 3UJFA 1GJUA 1R9XA 3VI2A 4HMNA 3VNJA 5CJ5A 1B54A 4HPGA 1LUCA 4XV0A 3MMDA 4NX5A 1GOMA 3AWOA 1GKPA 2CBIA 4W8LA 4CNNA 3THDA 2GR0A 1IR1A 1IXOA 4JDYA 2RH9A 1OJXA 4BF7A 3NXFA 4B92A 3BGGA 2B31A 3EKLA 4YVXA 1S7MA 4QR6A 3W29A 3DI1A 4LAZA 1TWIA 5CXPA 4NJJA 2RUSA 2XSBA 3LRMA 1KRBC 3BURA 2X42A 4W7UA 3CUJA 3LG3A 4KETA 2GVEA 4EACA 3MO7A 1PHQA 7PTDA 3B8SA 4ML9A 5U25A 1ZAHA 3WD1A 2NLIA 4U2ZA 3R2GA 3KBSA 2VXNA 5HJXA 4XD6A 4LU0A 3EMQA 1XGZA 5T9BG 5EKYA 2XIQA 2ZADA 1PKYA 4C60A 3FYPA 6XIMA 4H50A 3BE7A 1FECA 3TTEA 4E38A 3KTXA 3TMLA 1KNWA 2JK6A 3H53A 1LQ0A 3WQOA 3W72A 2PB1A 4EXAA 3GFZA 3AIRA 4CU6A 4H8VA 2CBUA 4PMNA 3BLIA 3BCFA 4HZMA 4M82A 1JVNA 5JIWA 3OOQA 4HYWA 1XIHA 2YL6A 3AI0A 2JF7A 2P10A 2QCCA 2NX9A 3NL2A 1R3TA 4S38A 5A6AA 4QCFA 3P60A 1IZJA 1G4TA 1TQJA 1XF0A 4M8UA 1LQ2A 3W01A 4XKYB 4MWAC 3KHDA 2OZ0A 3KL3A 3R0UA 2R9ZA 4E3TA 3H70A 1ISXA 5HWMA 1I2NA 3WBXA 1Z44A 1X7IA 5HATA 2PP1A 2C8NA 5SWUA 1F05A 1O7AA 4DX3A 3IAQA 3WLQA 3CYJA 1V0MA 5E5CA 2DIEA 1AODA 3F4WA 1OSEA 1OZMA 5CAKA 3H24A 4ZE5A 1UC4A 4NAFA 3QV8A 3PAOA 4LFYA 1UPMB 1KR0A 4CUCA 3WLNA 2XH0A 5JMUA 4J56A 1GETA 5FEXA 3LCFA 2W3ZA 3AIVA 4IH3A 2X0HA 2PDFA 3QKZA 4ATDA 1OG0A 5FAJA 5I3FA 1DIOA 1CX9A 4GXWA 5CSSA 4JIHA 3W7JA 1XANA 2FVLA 3CQHA 2VURA 2ANUA 4AQLA 5DMYA 1H62A 2NWSA 2Z7GA 3GDLA 3MKCA 4TTGA 2J8TA 3UCCA 3PBVA 2ZVIA 4XAYA 1KB3A 2D23A 1HUVA 5K9DA 4GBDA 3WD4A 3O6CA 2DFAA 4IXHA 3AN1A 1A4LA 1LRNA 2WPGA 5I3DA 1KO0A 1G69A 1XYCA 2Y7FA 1BQCA 5IOBA 3UXAA 2SFPA 1FBAA 2WNWA 3QM3A 3SQLA 4D8ZA 3PUEA 4WX2A 2I56A 2XVLA 2Y5EA 1OC5A 2FZMA 1XLGA 1H2JA 2Y61A 2WQPA 1KKOA 4NUWA 1V0LA 1X7FA 1HO1A 4ZOCA 4NZCA 1EIBA 4BA0A 1TO3A 1NEYA 3WNNA 3VNMA 1GK8A 1T7LA 3DK8A 1MZRA 3T55A 1W54A 3WQDA 1XBVA 2FJKA 3A21A 3M5VA 3M6DA 2I57A 1H1ZA 2P50A 3Q94A 1QJWA 2OFJA 2J6XA 2W3RA 1UBSA 3W1AA 1I2QA 4JCLA 3VIHA 3FA4A 3WDJA 3S9ZA 1ZL1A 3PFRA 1XIDA 3P80A 3F03K 1P4CA 4LUYA 5GRTA 3MTWA 3NL5A 1GYNA 2WBAA 5DLCA 2VZTA 1XBXA 2G41A 2Y62A 4IP4A 4HB7A 3CGTA 5AC4A 5JUVA 2QHAA 4I9AA 4KGJA 2WJZA 4MVAA 4NYYA 3U7VA 4DBEA 4I9MA 4AD5A 2IPGA 2YR1A 3WQ8A 3A3XA 1F6PA 4DM2A 2ZZ1A 3EWBX 3HV9A 1QK2A 1CXKA 1RV8A 1EHAA 1JF5A 4PCNA 4B15A 5LNUA 3AAMA 3GM8A 4CQ8A 2CLIA 1GOWA 1QPKA 4ZMGA 4UC5A 4O54A 1UKTA 1HJQA 3AYSA 1QWKA 1EP1A 5HOSA 4O1FA 1G67A 5LSMA 4Y2WA 4J2PA 2NV1A 3R0DA 3NPVA 3STFA 3CHDA 3L21A 1SGJA 3E38A 2YIHA 1U5HA 3I68A 3PBWA 2G95A 1ZS2A 3HW2A 3XINA 4TQTA 3N3MA 5A5WA 1XIIA 2VR5A 2EQDA 4P2VA 3EPNA 2E9MA 1B4KA 3K1GA 4KWWA 3CBWA 4KT2A 3S1UA 2WSPA 3GBDA 2W66A 1I8JA 2ZXDA 3JUGA 4IICA 1NVMA 3N6QA 1QI5A 3IUIA 3V35A 3ZR6A 1U33A 3WQFA 5KSWA 4A8LA 1KRAC 4OV9A 2J77A 3HPXA 3K13A 1EL3A 3OC4A 1UZ4A 4G1KA 4HA3A 1OINA 3BMWA 5DXXA 2VCCA 1VFUA 3EANA 1JXJA 1QASA 1KGUA 4JHMA 3LPPA 5D8WA 4MJZA 5DRCA 4GH3A 4GI8A 3BTNA 2F2HA 3IGXA 3UW6A 4H3DA 4BQ3A 5HMDA 4R7WA 1TVPA 4NZ1A 3P61A 2AGTA 3M0YA 3UG5A 4J27A 1GPWA 1AD1A 3GU2A 1RQBA 4C6BA 2WV8A 1GESA 3LHTA 1ZNNA 4AIBA 3F1QA 3QQ0A 3DYOA 1TTPA 1VKFA 1GZGA 4JIPA 1XLAA 2YYUA 4O8AA 1ITXA 4QE1A 4RR4A 3DG6A 1HKKA 2I9UA 3Q4DA 3DFPA 3AU6A 1QHPA 3OZYA 3TROA 1WUFA 2GK1B 2PD9A 3AIUA 1WCGA 1JDFA 4JTLA 3AC0A 1REQA 3T0TA 4IIEA 4Q6JA 3CXBA 2E1WA 4UNLA 4WJ8A 2QZRA 3BLDA 4H8HA 1X1ZA 3C0JA 4LIIA 3L12A 3ZT7A 5C2GA 4NJGA 1E40A 3HGRA 3V4BA 4H41A 3NQCA 4PRRA 1EUAA 3ITOA 4AG0A 4L5ZA 2D2JA 2PTWA 2VRKA 3ITLA 4M6UA 3CQIA 1MMFA 3RU8X 1B1YA 2L5HA 3VMOA 4A3QA 3P81A 4Q4SA 3L5LA 4S3DA 2QF7A 1CGVA 4P7OA 5FAGA 1OT2A 1UPPA 4XZMX 3G1RA 1QTWA 3AO0A 3WH6A 3S6DA 1W3KA 2OZ3A 1ENUA 3G2GA 5ABHA 3M9YA 4DJDC 4ZVJA 2X8GA 3H6OA 4KKXA 4OTKA 1ZDLA 1WO2A 4GISA 4HU3A 2Y70A 2PDUA 3APGA 4N42A 3GKFA 3NR0A 2IS7A 4UOJA 2VFDA 3NM3A 4DN1A 3QTGA 3GTNA 1R3SA 3UWYA 3NIYA 2QDDA 4OECA 3TV8A 5LA0A 2VGIA 4FR1A 3RM8A 3S1WA 5LKYA 2FYMA 5DQPA 2FTYA 1MFUA 1D8CA 3CUIA 5D05A 3NYDA 1UJQA 2PGRA 4JIQA 5A3HA 3QXBA 3G0SA 2O9OA 1HT6A 3UA4A 3WNPA 1X6NA 2XSXA 1UWSA 2INEA 3JZUA 1NQ6A 1B2YA 2J8FA 3H26A 4GUJA 1PPIA 1ZJIA 1ME8A 2XU2A 1NP0A 1UR9A 3ZJKA 4LNCA 1XIGA 4BKNA 1MFVA 3H12A 3SCNA 1DXFA 3QMRA 5EBAA 3CGDA 4J9JA 4EQRA 4K2SA 5FD0A 1F8IA 2BHUA 3ZT5A 1XYBA 3NCOA 5BZAA 4BI7A 1S5NA 3R8HA 2BOEX 3OQEA 2X16A 4J3ZA 1X1OA 4IOTA 1R3QA 1R47A 3WQPA 4PTVA 1W1IE 3W7MA 4PMDA 3S47A 3I3EA 4C6EA 1YQZA 3KUMA 3LRLA 3TJXA 3UR8A 1GVOA 3R13A 1RR2A 4XKMA 2OYLA 3HG3A 3ARUA 4RXFA 2NUYA 3GHRA 1JGIA 3EOOA 1FFRA 3MA8A 5DMLA 3A4AA 3B0XA 5FF2A 4ACZB 1BVWA 4DWSB 4P8XA 2OKOA 2YBUA 3EF6A 4AWEA 1MUCA 1K3UA 3PJXA 4OUIA 4KBXA 2JIEA 1CGYA 4CD4A 1TYPA 1G0CA 1ZX9A 5GJPA 4ZR8A 1E3XA 1P6CA 2J7FA 1GJWA 3F5KA 1L6SA 1C90A 2VENA 1PL9A 4LS2A 2EPLX 5DT5A 4KIEA 3RCNA 1FA2A 1H7WA 1Z3NA 5CPNA 2BVDA 4G1NA 3ATZA 3KOFA 2WWDA 3FEMA 2ISSA 4S3KA 5AC8A 3MB9A 3OB8A 7REQA 3S8HA 4CEUC 3MUAA 3P5YA 4JTQA 1E5JA 3BLFA 3T2QA 2NSOA 2TYSA 3RGTA 1TPH1 5B7ZA 3WK1A 1JG9A 1PKLA 2WK2A 3KLKA 3S1VA 3RFAA 1J6OA 4NXSA 4XX6A 3UEQA 1TPWA 3KL0A 1EJWC 1UOKA 1UKPA 1EGVA 3VK5A 2YW3A 2GQ3A 3W6MA 5F4XA 2OT1A 3ZR4A 3NZ1A 2VX7A 4WRHA 2O4QA 2NZLA 5IBXC 4X63A 1WDPA 4DB7A 3KTSA 6REQB 2OGJA 3QEZA 4ZFCA 5D9MA 2YZ5A 1PCKA 4DHGA 1N62C 2J27A 4S3JA 3LM3A 4QRNA 2QT3A 3MI3A 4WK9A 4ZFMA 4YTSA 3M5ZA 3PSWA 4OQVA 2VFEA 4MYAA 3GNDA 2Q3RA 4MNMA 1SZEA 3TYZA 2AAMA 5EY5A 2CLFA 4RW3A 4MUPA 2J7EA 5DEZA 3UZWA 2DDXA 4ZQMA 1F3PA 1AFSA 4QTGA 2VM8A 4CQDA 4B5WA 2OLAA 4CQBA 2GL5A 5DANA 3GZAA 2QF8A 1ZMCA 3TNOA 1FH9A 2NQHA 4ZOAA 3DFYA 2WQDA 1GTEA 4NJIA 2ISWA 2QV4A 1VC4A 4IMEA 3MMTA 4JX5A 4MFDA 4HN4A 4Q3MA 3PBGA 4CU7A 5FL1A 3A7AA 4GIAA 2Q71A 4L6HA 4PTXA 4QS5A 3QY7A 4H4TA 4LNYA 4DZIA 3OW1A 1UD8A 4Y96A 4LV9A 2ZRUA 3OU8A 3UFYA 3UESA 1QR7A 2PDBA 3FK4A 4H7ZA 2GGHA 4WSJA 3WUBA 5CKSA 3BCJA 1LM1A 1DE5A 1BF6A 3EA3A 1YXYA 1FHUA 4KESA 1O5QA 2ZWYA 3W7LA 4GR1A 1OD8A 3CIWA 1KCZA 3UG4A 4GH1A 5FF0A 3L4VA 1W0MA 3UETA 1GXFA 3TTOA 2FB2A 3IANA 2F38A 4CNOA 2EQ7A 3U9IA 5KVHA 3DHFA 1K8CA 3F2DA 3WMSA 1TPFA 2V6AA 4YTQA 4XO7A 1NDYA 4CNUA 2GQAA 1R2RA 5C8BB 3UWEA 1QMLA 1TPB1 3QJAA 3T7VA 2VCBA 4ONVA 1DOSA 4O13A 1BKHA 1LBFA 1LT7A 1OYBA 1XYFA 1XG3A 3E12A 1XSKA 2OYKA 3HV8A 1XSIA 1WYGA 2P1FA 1KW1A 4IXXA 2VGGA 1VFMA 1H3GA 5CGTA 4AEEA 2GH5A 1FO4A 3BZJA 4A6GA 2BC0A 1MXGA 2ZRXA 1YIXA 1EJVC 1TUFA 3CV6A 3VGDA 1WNOA 1VEMA 2Y8VA 2D0GA 4ICMA 2P8BA 4K37A 1HL8A 3T2PA 4GZIA 3VNYA 5HJLA 4ZOBA 3B04A 1TX2A 3G5EA 2LLEA 3F4NA 4MM1A 4MY8A 5KETA 1DJXA 5DN1A 3VGHA 3U4FA 3TDFA 2Y6ZA 3RO6A 4H9XA 3CNYA 3GNXA 5J5RA 5JBDA 5FA5A 4QEHA 1LOQA 1DQXA 1NARA 4E8CA 3C52A 4NKCA 2HE8A 3GZ3A 4L6OA 1TJRA 1RSCA 1W3IA 1H7XA 1XLJA 3SQPA 3K1DA 1XCWA 3EB2A 3RG6A 3UA3A 2ZZ0A 2RJGA 4F0RA 3FJNA 3UG8A 3QW4B 1WB0A 3LU2A 4TVCA 1SO5A 5LIKX 1EBHA 3MP5A 4S3GA 1V3LA 2J75A 4RKAA 1YNQA 5HULA 1OK4A 1US3A 2RAGA 3RRXA 4I3GA 2WZMA 3LNMA 3GU9A 1OQFA 2CLPA 4H7VA 5U1OA 3PBUA 4S23A 1M01A 4A3UA 3FN9A 3NRZB 1YNYA 2RDXA 1UROA 4W85A 3TX9A 2TSYA 3R8GA 1YTDA 3LCXA 4CD7A 1ICSA 1LWIA 1SM9A 2WBKA 1BWCA 3S2CA 1HW6A 4HZ8A 1P43A 2VWSA 3OLIA 4MNJA 4CQCA 3P7YA 4AWTA 4UQ9A 1GRTA 1Z48A 1JUKA 1XD1A 3DK4A 1XLBA 3SRDA 1F61A 3T8QA 1LUCB 1W9XA 2H3BA 5I3GA 3FAXA 4H9ZA 1EJ7L 3ITVA 1NAL1 3GH7A 1CBGA 5FIPA 5HNRA 3LX9A 4EF9A 3CWNA 4GUGA 1QWGA 1OK6A 1X38A 1E1FA 3GB6A 1U30A 4D6CA 4O14A 2OPJA 4S2BA 5BW6A 4JOMA 1SUXA 2EJAA 1G01A 4Y9MA 1YDVA 1VBUA 1A49A 4G7FA 1TVNA 2QCDA 4OKDA 4HCHA 2OQYA 2VX4A 1W9BM 4U3CA 1TUXA 4IMFA 4UBPC 4B9ZA 5JQ9A 5FACA 2HK1A 1Q63A 3E0FA 4S3BA 4N6FA 3EUB3 4LVAA 1O66A 1ZBVA 2YXGA 3ZLFA 1T3QC 3NSMA 1MQQA 1RY8A 2G4FA 1RBLA 3OVQA 4L1GA 1PX3A 1J18A 3TJIA 1ZQ5A 3ZLGA 3MT1A 4CQAA 1Y0EA 3LY0A 3N1AA 4IQJA 3FAWA 2Y85A 3IJQA 3WLOA 4DELA 4QNWA 1FWTA 3TW7A 5JCMA 4TXEA 4JTCA 4TMCA 3FY1A 8TIMA 5H6HA 4CNTA 2PRHA 1L6FA 4HJFA 4FR6A 3DH9A 1OIMA 5TAOA 1XP3A 4ATWA 4F9DA 3VIKA 2Y1HA 1CXEA 4M29A 1XICA 1XLKA 2X7VA 2GSEA 3TJLA 2DSUA 2PU0A 4AVNA 1H0IA 5F2LA 3GWQA 2X8CA 1LRTA 3TYBA 4NHVA 1AZ2A 4LUSA 5FEZA 4IIHA 5JU6A 3B97A 2C1GA 3GIPA 7CGTA 4YPJA 4B90A 3L0KA 1OFDA 3TEVA 1KGXA 5DCEA 2PDJA 4ERAA 5ECUA 3M07A 1YXDA 2ISFA 2QJJA 5T8GA 3DFTA 3SGZA 3NG3A 3C86A 1XLIA 1PIIA 3EWYA 4UR9A 3VILA 4PMVA 1XHCA 3T0DA 2PGWA 3A22A 2GVLA 3T09A 2WANA 1HKVA 4NAFB 3ZJ6A 2WPBA 3WIJA 4H4PA 1H5YA 3N4FA 4UFMA 3LYEA 4F8XA 7TIMA 4GVIA 4L6DA 3SB0A 3MUZ1 3TN6A 2Y5JA 4QJ1A 4PUEA 1SW0A 1KBJA 1CXHA 3S6OA 3C2YA 3EDDA 3RR1A 3U2EA 3W27A 1KRMA 2X0YA 5CC3A 1JF6A 3E5BA 1J4EA 1OIFA 4ZQCA 5KZ6A 5AB3A 3I7RA 1TFVA 2WOIA 2BB0A 4ENLA 5FEPA 2WJFA 4Z0JA 5AECA 2XM2A 3VIIA 3T0CA 1CGUA 1UR2A 1X2GA 4XZBA 1IXNA 4QJ5B 4FF5A 1XLDA 2BDQA 1A5CA 4R3UA 2VUYA 3WQGA 1RBOB 1GWJA 1JRCA 1W6TA 2G5WA 2E7FA 4QQ3A 1KM2A 1OZQA 5D32A 3GTHA 1O5KA 1IEIA 3W74A 4EPEC 1BZLA 4DIAA 1PO9A 1FHLA 2ON3A 2C19A 4AC1X 2Q09A 1JNDA 2CBVA 3LM7A 3GDRA 5E6ZA 3C2EA 4OFCA 1W9UA 5G1TA 1F3XA 1Q7MA 3CV7A 3LBMA 1YRRA 1KFKA 4E8DA 2J9YA 1MEWA 4OV4A 4DWSC 5C5YA 3CUGA 3POCA 4X2PA 5BOFA 1JD9A 3BK0A 1BWVA 2ZDSA 1KQYA 4Z17A 2QUVA 1A0DA 1VPYA 3K8LA 5D33A 3U5UA 5M1TA 1DIKA 4UFKA 4ZENA 2FVKA 1U1HA 3MI2A 4M5PA 1EH9A 3L4YA 2O9TA 3RCMA 2VFFA 1S1PA 4DO4A 2BHYA 2EPOA 2INFA 4S3FA 3QLDA 3NM1A 2BY2A 1YNPA 1DP0A 1DHKA 2ZIDA 4AX7A 3LPGA 3LCLA 1ML1A 4GBUA 1WP6A 1NWRA 3L2MA 2RGMA 3DC0A 2G3IA 3UY8A 5M5DA 4BJHA 4KF1A 6A3HA 2FZBA 4E3VA 2XM1A 4HHMA 4CNSA 3SSZA 3QZEA 4HK5A 3REQA 1Z32X 3POHA 1BD0A 3VNIA 2ZUSA 1D3HA 5A6BD 2FHFA 4FLOA 2EF9A 9RUBA 3UT0A 4GRTA 3WDQA 1L6GA 3O0HA 4GC3A 4LEFA 1V6VA 1SW3A 2EG7A 2C71A 3ENLA 1FCVA 1J96A 3BOXA 3G8EA 3WSUA 4IISA 1IGWA 3W1LA 1EBGA 1R3VA 2ADAA 1CLVA 1HX0A 2J8GA 1H09A 2PE4A 2E28A 4YXGA 1J01A 2Y7DA 1NF7A 2BVYA 3UXLA 1ITQA 3IVTA 1OX6A 2J79A 3V7PA 3H55A 4K8EA 3EOLA 2C13A 4PA8A 4R85A 2Z4GA 2VWTA 4PL1A 1ISWA 4LC8A 3GTIA 3OGVA 3N9KA 3UR7A 4WCJA 3FLUA 3LLXA 2PWGA 2D2OA 1WDDA 2I5GA 2DQXA 1HJVA 1VJIA 2CDUA 3IJ8A 1UH3A 4GNJA 1MNSA 1Q3NA 3CHEA 5KZEA 2BHZA 1O5XA 3NQMA 3IV8A 1WKDA 1DIEA 1FWHC 3GC2A 5LXEA 1OYAA 4Q4QA 4GO8A 1FHVA 1DTUA 1EEXA 1Q2SA 3W7GA 4LW7A 3H7VA 3LUTA 2OEMA 4JTAA 2Y0FA 2V0TA 1YEYA 5A8QA 4XZHA 4YMZA 4GD0A 3NVZB 1PUDA 4H4ZA 2W67A 3HQNA 2EKCA 3NSNA 4DRSA 3MUY1 3DFQA 4AD4A 2P0IA 2VCAA 4QLKA 1L2QA 1O60A 1A0EA 4K3ZA 1REQB 1OWQA 1PTAA 3ANUA 4MY9A 1Q6LA 1GJPA 3HPAA 3WELA 2P3EA 3GVVA 6PTDA 3NWRA 4MADA 5K7JA 4M51A 4XIAA 4OU1A 1TWDA 2W92A 1E1CA 4AHPA 4H9MA 3OLEA 3UZXA 2G3MA 2F6KA 2FGLA 2A79A 2Z26A 3PUDA 4B4HA 4CCEA 1M5WA 2E4TA 5LIYX 2O7SA 3BICA 1OX5A 1GVYA 1KC7A 1V6TA 2G0WA 2V69A 1AQHA 3DUGA 3U2CA 1E72M 1R2SA 3UJSA 1MXSA 1GRGA 3C8FA 3IIXA 3PTQA 4FO4A 2OCZA 3M0KA 4K39A 3V1PA 4MGGA 2E6DA 4AD0A 2AQWA 4OZOA 4E8GA 4FXRA 2YGYA 4O10A 4XQ6A 1YHTA 5C7HA 5FS6A 2X41A 2HWGA 4TV5A 3THAA 4LC6A 2ZRVA 5MF5A 2BGSA 3VVGA 2DZBA 3IRSA 3OGRA 4GCAA 1FWAC 1JCMP 1XYAA 4Y8EA 5A6JA 1KLYA 2Z27A 3GIYA 4B3LA 4C6LA 2PCQA 4JAWA 3LHVA 4AF0A 5EYWA 1E0UA 4KWSA 3URNA 1VBHA 4H4XA 3AIBA 3C2FA 5HJYA 1E55A 1UWAA 1C9DA 4C7GA 1NQKA 5C9RA 4S3EA 3K4WA 2J7HA 1GT8A 1R7AA 3N73A 1SSDA 1YTKA 1KM5A 3M0XA 2WAGA 4KFOA 5HDRA 1M1BA 3FJLA 3O16A 4MWAE 3WBYA 1FP8A 2AQOA 3S46A 4Q8WA 5BRBA 3SCTA 2WPCA 2YOCA 2ZXQA 5C71A 3WLJA 3W38A 3D3AA 1R46A 2FMNA 4IMCA 3M5XA 5A8NA 4ZB5A 2G3FA 4J28A 3ITGA 2Z24A 5EMKA 3AIEA 2ZWZA 2FB3A 2W0HA 1GRBA 2ZDRA 3T0BA 1CECA 1A4MA 4WDTA 3DJJA 2OG9A 3NPXA 3CM4A 4WR3A 3W88A 4TU1A 3PWAA 2BGNE 3W70A 3DGBA 3QMTA 3VYLA 3AXKA 3DGRA 4ZB2A 4WOZA 2GGIA 4FX6M 1J5TA 4RK8A 1GKRA 2ONEA 4HCDA 1CPUA 1X8FA 2CHOA 3VUPA 2X1TA 1X8CA 3CT2A 3MKVA 5FCZA 5HWNA 4PCSA 3VMPA 4RE2A 3WJZA 1CZ1A 1DQWA 2JEPA 3SRHA 3RCYA 7REQB 3B8IA 4DPQA 3QFWA 5AZ1A 5I78A 3EDJA 4EF8A 3QZAA 1KFWA 1E9IA 4QDWA 1FFQA 1FWEC 1W32A 4JX6A 1T8QA 1EDGA 1V3KA 1JZ7A 2IQTA 3EXRA 1EC9A 1G94A 4HPJA 3CTLA 3PAJA 4LOCA 3O07A 3LMZA 4FNTA 4NX0A 3QPYA 2HEJA 3E2QA 2YCIX 2WB5A 3KRSA 1QNOA 1PIGA 4FNPA 4IJBA 4B3ZA 1VHNA 4US6A 4Y90A 4HYVA 1AH3A 4IPLA 2XVNA 3WFAA 3B4YA 1ODZA 3WENA 3G1YA 5AOUA 3VDGA 2C18A 4MOZA 4H19A 2EG6A 3T9PA 3B0VC 1ZTVA 3N2MA 1WZLA 3MDUA 1HJUA 4V28A 5U7SA 5JCNA 4PRWA 3CUZA 4EOUA 4NEWA 3CIVA 4O16A 4FA3A 1V0NA 5EBUA 1F76A 3EAUA 3OLGA 3YPIA 3O9NA 1GQNA 5C6MA 4H4QA 1VB9A 2NUWA 3ARSA 3NL3A 1N2VA 4EIVA 4QG9A 5FJOA 3W7KA 4RDWA 3UG3A 1QHZA 1H1YA 2VQUA 3IJ9A 1B3OA 4PEKA 3HFTA 3BV7A 1F73A 1PYFA 3CH0A 3PS7A 3TOPA 4L4PA 5G5IA 3A64A 2ACRA 2DUZA 3IS4A 3LI0A 1SSGA 3N18A 4UNIA 3L5OA 1Q65A 1V3MA 1OG6A 3VM5A 1DJNA 4H9VA 4CQ9A 5LGXA 4H7CA 2OWXA 2VEKA 2UWFA 3VC6A 1FRBA 1FWCC 2CHNA 1AL7A 4B3KA 3GH5A 2A5HA 4Q8PA 1W1VA 3LV5A 2IMRA 4D1JA 1GW1A 4MB1A 2HVMA 2GQ9A 3LADA 4FB7A 3Q58A 4H4IA 3ZWTA 4J40A 2WC4A 2H90A 3U8GA 2QPSA 2P88A 3VAVA 4GI9A 1V3HA 4H6QA 2PFHA 1LP6A 1YQ2A 3TONA 2IKGA 2HPIA 4JKKA 4ZQOA 1XKJA 5I79A 2EQ6A 2PLKA 4HA4A 3QY8A 3UZYA 4US5D 3I4KA 2R1LA 3B3DA 1ZRQA 3CYVA 4HZ7A 3UWVA 3V36A 1K9FA 3LEPA 5GPRA 4MB5A 3NO5A 3D46A 1X39A 3PY2A 4CN4A 1SFTA 1ISYA 3LGDA 1B57A 1QO5A 3PJTA 5E0FA 4W88A 4CKQA 3I7SA 3W0KA 4XZIA 4XUYA 3NQ7A 2WJDA 2YW4A 3NGJA 4OWGA 1DIDA 3NVWB 3RNMA 2BVWA 2XJ7A 5CSRA 4NQ1A 4Q8NA 3WUEA 4O0ZA 4GUFA 3NQ2A 3B9JB 2VZOA 4HZ6A 1UP0A 1BWLA 1LOLA 4J35A 3RM4A 4PMRA 4DI8A 1C8QA 4GINA 3TCSA 3PUOA 4BQ4A 3URHA 1QW9A 4PH6A 3ARQA 3KX6A 3QH2A 3DESA 1AG1O 4J7RA 1GV4A 2Q01A 4AISA 1FWBC 2O55A 3AHYA 1H4PA 5EMUA 5CJMA 4IPIA 3KOWA 1SJAA 4W8AA 2E40A 3A13A 1KR1A 2ZTKA 3GKAA 3N2OA 2DZUA 2CLLA 5FF7A 4JNYA 3GAKA 3QV7A 1GVEA 4OOUA 3DHPA 1C7TA 2YVJA 5BRQA 1RCOB 4RE4A 3G8RA 4HHPA 4MHBA 2A3HA 4JQAA 4R7JA 4LVBA 3I3DA 2VDHA 1UD6A 3W1TA 2BY1A 2YZRA 3DOPA 1KFCA 2V9DA 3CZEA 1LVLA 1J0KA 4IIDA 3ID7A 4NSBA 1K6WA 2OXNA 1OHLA 1NHSA 5LHEA 5LA1A 1YPXA 1UWIA 3I6EA 1WBHA 4G9PA 3RYSA 3UWUA 4HNTA 3TK7A 2RJHA 3HGSA 4DJFD 1Q8AA 1V08A 4UTKA 1QI2A 2GDUA 1ADDA 2NQLA 2W9MA 3T4WA 3LGGA 2Y63A 3O15A 3W1RA 3BVJA 4UTIA 1GUVA 3SCWA 2BXVA 3OBEA 5C55A 3RJYA 5AC7A 1UIPA 3NQ6A 5HUOA 1PKNA 4ES4A 4AFYA 3N13A 3BANA 2V5DA 3AHXA 4HU0A 2Y89A 3EAOA 3OBKA 4B2DD 1R7OA 2Z29A 3H7RA 2V2DA 3MHUA 1RA5A 2Y5SA 2C79A 3MHGA 3N34A 4PL2A 3WF0A 4RNIA 4EPKA 5AFDA 4N6EA 5AZ0A 4KRZA 1OCNA 1W56A 2QCDB 3BSHA 3L5MA 1AQ0A 1TELA 1Q6OA 1DJHA 4DZ5A 1C7SA 2W0UA 1EXPA 2OZTA 3W83A 1DPMA 4CEXC 4EM3A 3BO9A 1RAKA 2NXHA 1ZU8A 2Z28A 3ZM8A 3DYMA 3QFBA 4JICA 1YBQA 1CIUA 4K6AA 1IR2A 1HJXA 4IMAA 2V3EA 2FZ9A 1O1HA 2V3GA 1TIMA 3G1DA 1BXNA 1Z8AA 3KBWA 4RCXA 4OVXA 2YAUA 1D7YA 3LI1A 3RN6A 3NYZA 2BXZA 3VIMA 1QCWA 5AHMA 3GVRA 3KM8A 3P84A 2WW5A 1VGAA 3RX2A 1IE7C 3RPDA 4AUBA 5MKGB 1YE4A 1VR6A 3KRZA 3SURA 1E56A 2GJPA 4H4WA 1A47A 4KPLA 1ZCOA 4UTWA 1WAWA 4D72A 1FWIC 3NZRA 3OTRA 4MB3A 4DLMA 2RDWA 4J2MA 1IHIA 4Q8VA 1N5WC 1EHNA 5F2GA 1E6NA 4PRTA 4PFHA 4LUSB 1LG1A 1IZKA 3BW3A 3MI6A 4DBDA 2P8CA 2HVOA 1OEPA 3RLUA 4Q4MA 1KRCC 3WF1A 4MFEA 3GBEA 3T2OA 4QP0A 2JIWA 3OZMA 4GZJA 1UH4A 1IZCA 4MY1A 2BODX 3PN8A 3WQEA 2J13A 3IIZA 2ZUWA 2DVUA 2ZXBA 1QAPA 4N9CA 2YJQA 3G77A 2PD5A 2AKZA 3UP8A 1ZPTA 3IVUA 4AD2A 1A5SA 4MUZA 2POZA 2HPMA 3VKCA 2PPGA 6XIAA 5HANA 2ZCGA 4D6GA 1P5BA 3K8KA 1T40A 2PP0A 3NO1A 3QHNA 4X9SA 5CZ0A 2PGEA 3GDTA 1JYNA 3NS1B 1EJTC 7TAAA 4XD5A 3W82A 4BHYA 1Q6RA 1MW0A 2CZFA 3WJXA 2Z6IA 2NQZA 1F74A 3SCQA 3RMJA 3WNLA 1N8IA 3WJSA 1HIZA 1JCLA 5KZDA 4FI4A 4JYFA 1KV5A 3FYOA 3WMCA 2DZSA 1L6YA 1NY1A 3GIQA 5TIMA 3ONBA 3T4CA 4I5UA 1RCXB 3VE9A 4WY0F 3SJ3A 4JQ3A 1E43A 3JU2A 5GJMA 4POCA 2FIQA 2YX0A 5CG0A 1S1RA 4GJIA 2WCSA 1FKXA 4RZ4A 5A1AA 1VEOA 1R9YA 4LY8A 4G7EA 2NX3A 4XVEA 3H4WA 3VOJA 3BG9A 2J47A 3RLHA 3I65A 3ONCA 2XFFA 3PJWA 4I7VA 3MMWA 3WQCA 3R5EA 4R7OA 4ZL1A 2QCGA 4EKJA 1FP9A 2HNEA 4MKSA 3AUOA 3MP4A 4G56A 4FXFA 2VD9A 2DEPA 3VDBA 1LZOA 2Z6JA 1U83A 3SZ8A 1LOSA 2ZZCA 1FH8A 3SY8A 1Y5WA 3S5YA 1JRPA 1E0XA 1OX4B 2I17A 1GRHA 4Q33A 1L8NA 1V5XA 3RLVA 1CXFA 2F2KA 1GVQA 5CBJA 3XIMA 2IPJA 2NVKX 4CN6A 3FCPA 2WMIB 4JTIA 4GOAA 1UR4A 1VS1A 2A7NA 4M24A 1EWDA 5KITA 1BVNP 3EYPA 5CZTA 2A6NA 2FZDA 3VIOA 3REQB 1S5TA 3BLPX 4BS0A 1F9CA 3S9IA 1BPLB 2AMXA 1PJ9A 4PMYA 5AYIA 3WD0A 2V67A 3QQ1A 4UOZA 3INPA 3UERA 1ITCA 3SAZA 5JBFA 3W7RA 4LB4A 4QLJA 1LBMA 3W25A 5D04C 2ACSA 4KW2A 3DZ1A 5GNYA 2YDRA 1SJCA 3SUWA 4L1WA 1DKWA 1G7UA 3QBUA 4F48A 4QX4A 4R53A 2A7RA 4QSHA 3WG6A 2KZHA 3C56A 3EKZA 3N14A 4V1YA 1U5JA 1HKMA 3P67A 4XK2A 4HHHA 4L4MA 4E4UA 2VC5A 4XAZA 2JQXA 4LVFA 3RO8A 1QBBA 3EWZA 2XIMA 2EG8A 3M5YA 1OADA 2W55A 2Z2AA 4NRSA 3DC8A 1H6VA 3A7UA 4G6CA 4UMBA 4TVWA 3BH4A 1QPRA 3GR7A 3W7EA 5CZKA 4LUTB 3R58A 4JGDA 5D2YA 2C3ZA 3GS6A 4HVXA 2WWCA 3QGKC 3WEZA 2DT0A 1S5MA 1M04A 3FYYA 4NRRA 3S5OA 1FWWA 5TF0A 3PC0A 1VIWA 1UR1A 1HL2A 3DFNA 3WF3A 1IWPA 4LPCA 1KFLA 1H7PA 1X97A 2VOMA 5EMYA 4RPQA 3WKZA 3BSMA 2PRMA 4N4PA 5FSEC 1HGYA 4FF7A 4U33A 3H2EA 1WKEA 4DJED 1W3TA 1OY0A 4Q4RA 1TRIA 1M7PA 1OABA 2WNQA 2I5QA 4JD4A 4PMZA 4R9XA 1XLHA 4ZXOA 4XD3A 1EWEA 4IZGA 4JTUA 4MIMA 1E1CB 3H2AA 2WP6A 1LCOA 3WUFA 4U5IA 6TAAA 3CLMA 3VNLA 2B7NA 4AMCA 4E4PA 2WLYA 1DJQA 4V2XA 3WNKA 4HA0A 1RCQA 2PGFA 5AHNA 4U2YA 2XISA 4H6KA 3C6CA 1U1JA 1QDSA 1HNYA 2W27A 2WVUA 1V97A 2V3FA 3H2MA 4W84A 5HWJA 3ZVIA 3WH7A 3OA5A 2YCEA 1VPQA 4H4SA 4LGXA 3C2OA 3B4UA 2PDNA 3W00A 2VEGA 4JKMA 4JIIX 3AHZA 5T9CE 1GQJA 3ITTA 4K7YA 1E1EA 1EYWA 4O19A 2HK0A 3GFYA 3S2LA 4GIRA 3OYXA 1VQZA 1GVSA 2A4AA 5FJRA 2J62A 5K4ZA 3TOYA 1XLLA 4C91A 4UTMA 4Q32A 4J4KA 2EBNA 3V3WA 3ETRB 4IIBA 2D3LA 5ABTA 1TSIA 4FS9A 1TYGA 4DPPA 3TYAA 4M3PA 2OLHA 3KEHA 3QZ6A 3CB8A 4AF0B 3AJ7A 3MVIA 2PURA 1CLXA 1RD5A 3ABXA 3RLGA 1JCNA 3GDKA 3KZSA 4F0MA 3TFCA 1MQPA 2C3DA 1E6RA 1J2BA 3M1ZA 1AJZA 1FH7A 2GJXA 1JYXA 2ZC8A 2WPFA 2OOFA 2FH8A 4LAKA 4MDOA 4HHLA 1GZJA 3LZ3A 3M41A 5CC7A 2W6RA 5A94A 1ZP3A 4DUWA 2PDLA 4YTUA 5F1UA 2CZVA 3BJFA 3PNUA 3A4JA 1TR1A 4NZ5A 4GCXA 5AHLA 1MO9A 1NWSA 2DZXA 4BURA 5BYWA 1BLIA 3G24A 1W17A 2DGAA 4APNA 2CCRA 4Z2IA 2X09A 3DIPA 1JZ5A 1OCQA 2DIJA 1FEBA 4MWAD 2JKEA 2WCAA 1D7KA 3LHWA 3LOTA 2J9ZA 3M0LA 2IKHA 3VZXA 3W71A 1BHGA 2WYSA 2ALRA 2H6RA 4Q7BA 1SR0A 4MJ4A 2H9AA 5D4YA 1NIUA 3HQOA 2PTDA 4X0VA 2P53A 3AMGA 3R43A 2AQVA 3TQ0A 3WDHA 2J7GA 3AQUA 5JH2A 1BQGA 3Q45A 1UP2A 4PUMA 1U5VA 2YL5A 2XVPA 4PSRA 1LBLA 3BMXA 1EJSC 2AAQA 3KCJA 2GR1A 2D24A 3QW3A 3R11A 1E6PA 1AA1B 3UYIA 5F2IA 4TVDA 1UWTA 4A21A 1A5UA 3ZFHA 3E0IA 2A85A 4IIFA 1Q6DA 1UR0A 3JS3A 2QPUA 4K68A 4NNAA 4O1DA 3W2UA 4EWJA 3TYDA 1HFBA 4L1XA 3EEGA 5K3VA 1KWGA 3GR4A 4Q8QA 3DN5A 4EAYA 5A95A 3ZOAA 3L0GA 4PUNA 1QHOA 3SRKA 4PMOA 1C8YA 5FF4A 1ZHAA 3GE7A 4IX2A 4Z2LA 3SUVA 1J93A 2F6XA 3OHMB 4TUFA 1TWZA 2VGFA 1J6PA 2PBOA 2WSRA 1JEZA 1XGEA 3FNDA 2WHKA 4E5TA 3SUUA 1KBBA 2WC3A 1MUMA 1T5AA 3W7QA 1VDVA 4K8GA 1UW9A 4K38A 3GXFA 2Y88A 2FHCA 5C54A 2ZX5A 1GW9A 3LRKA 1B3XA 4XSLA 1JZ4A 4LS1A 2FTWA 1OF8A 1RJRA 5E9AA 3S1XA 1PX4A 2PMQA 3WJYA 2PUZA 1BGGA 4Q4KA 3G1HA 4B5TA 3DU0A 3JR2A 3EX4A 4XG1A 2DT2A 3L2LA 4QDMA 4HOXA 4GA8A 3NPWA 1ZUAX 3BV4A 3PTMA 4PGLA 1GYLA 1NOUA 3HA1A 2BBFA 1W5QA 3QGVA 4OT7A 5DMNA 2GOUA 2ISDA 3W4RA 1QW8A 1OJTA 2OT0A 2PDGA 4AIUA 1UC5A 2GVYA 4QCEA 3CZ8A 1TMLA 3R79A 3A7RA 1VLWA 3IJIA 3ANVA 2XTKA 3MBDA 1GYMA 3EGJA 1JDEA 2WHMA 4FPSA 4M56A 2FPVA 4I5XA 1AQFA 3A3HA 2OMAA 4MLRA 3S5SA 4DY1A 2P3ZA 1JD7A 2YSWA 3VCNA 1IEXA 3K4AA 3N29A 5KEZA 1XIMA 1F8WA 1W2PA 1I75A 5FSDC 5IDZA 2ODOA 4U4MA 1M68A 3W84A 3H23A 1V93A 3ABSA 3ERPA 4DBWA 2GJRA 1UR3M 3KCLA 4I5RA 2VEMA 2A7PA 2V3AA 3CUHA 2ZOXA 4J3UA 5LHFA 2R1NA 3DI0A 3KVLA 1TV8A 3GSMA 3C61A 4Y6GA 4H6RA 5HMFA 3TC7A 2O7QA 3TLQA 3IIVA 3N4EA 1KFBA 3EX1A 4GC4A 2GGEA 4DUXA 1ZENA 2O56A 3EMCA 2PDPA 4AZ7A 1PTGA 1R85A 2XPKA 4JS3A 1TPVA 1P0DA 3VCCA 3IEBA 3TN3A 5EU9A 5C70A 5HPCA 3P82A 1C8XA 3CEUA 3CC1A 4F3HA 1EFZA 4Z2KA 4C1NB 3L4ZA 3KL5A 1QVBA 4K8DA 1IXPA 1IIGA 3R94A 3FXGA 1YDOA 1XPYA 4D8AA 3EB3A 1UHVA 5GQBA 1ZKQA 3UPBA 4GQBA 1W8SA 4RPPA 4FNUA 3HPZA 3IACA 4LBRA 4LCSA 3LERA 2ZFAA 1UZDA 3URBA 2XH4A 1DNCA 1H7NA 3ABOA 3TKFA 2DJXA 2CLEA 1KXQA 2Y2WA 3GYEA 1DYSA 4LAOA 1SU5A 4F0LA 3B06A 2EJ1A 3SIMA 2Q8ZA 3LCHA 4XBSA 4TV6A 1VJSA 2DU2A 4M19A 4PFMA 4WZHA 5FMHA 4GYJA 4YU1A 4G5DA 3QHOA 3NJ3A 2BGQA 2DQWA 1H1NA 4AMAA 1BFNA 1ONEA 1ZAIA 4LANA 5D37A 1MVYA 4H2CA 2EO7A 3RAOA 3U0HA 2WSQA 3B05A 1TPDA 5I6SA 5C0QA 3GHTA 3L4TA 1X1NA 1RZMA 4IGMA 4KWOA 2OVLA 4C5ZA 1FXQA 3LS9A 1XG4A 4JFVA 3EWXA 1GEUA 1E71M 1LWHA 4LB3A 1S46A 3WLRA 2JF6A 3OGSA 2QDEA 2QAPA 3IC9A 1PZ2A 3QVQA 4HMCA 2D0FA 2EGZA 2FQIA 5CQ1A 4DO7A 4RZ5A 4WVXA 3N3TA 1JZ8A 3SECA 2NXIA 1MI3A 2PLCA 5DCBA 1GVFA 5EBKA 3MP3A 4RDYA 2GUBA 5E70A 4RDZA 3TTSA 1B3VA 3WN6A 3KAOA 1QI4A 2DSVA 2G96A 1GVIA 5BU9A 1X2HA 3SRFA 2BY3A 2PU1A 1TMQA 1KGWA 3BW2A 2Z25A 2WZTA 4KFPA 1LRQA 1QOXA 4BV6A 3VABA 1V79A 1XHGA 1TPUA 3DCPA 4WXZA 1RQEA 1I6NA 4G8TA 4CD6A 2OO6A 3KXQA 2ABAA 1XL9A 3VGEA 5BXRA 1XH1A 5E0CA 4E4FA 4HNOA 4I8DA 3CMFA 4TVUA 5BWAA 1UZHA 5FKYA 1VFSA 3E0VA 3QGAC 3TYEA 2CIPA 1EOMA 1OFRA 3LA4A 3H7UA 1TZ9A 1N7KA 2ATMA 2Z1BA 3O1NA 3WCZA 1ZMDA 1F6KA 4JTGA 4BEQA 1V03A 4AZ6A 1VLIA 3DFOA 1CENA 1OYCA 2PWUA 4M6PA 3O05A 2DPEA 2XUCA 2QGHA 2PCEA 5LIWX 3GD4A 1PWLA 1KLZA 4UR8A 3HQPA 1YDNA 2QUTA 1N63C 1XUZA 3CAQA 2QJGA 1YBQB 1Q7ZA 5K4XA 2EPHA 1NHQA 5F7UA 3EX2A 3M0JA 4LYPA 3U2ZA 5AHIA 1UJPA 2WJEA 1K8XA 4GVFA 1W3NA 2DP3A 4QM1A 5G4HC 1NOFA 2VVNA 3ARZA 2WHLA 4IQLA 4QHRA 5PTDA 3VFCA 1F7BA 4IGNA 1AW5A 1W5MA 4E2OA 2HRWA 1JPHA 1UG6A 4PN2A 4TTUA 2PLJA 3DK9A 1EO5A 4H4RA 4D6JA 4B5NA 2E5DA 5CAHA 3QV6A 2QXWA 4MAVA 1BVZA 5FOOA 3VCRA 1I2RA 4C6DA 4V27A 1B0IA 2GFTA 3VOGA 1KCXA 1UZ1A 2VC7A 5REQB 4PBFA 1LT8A 1WXZA 2ZUNA 4GKLA 4J3WA 4GY7A 1QNPA 2OYMA 3CS2A 3DKLA 3RK8A 3P3BA 3HMCA 4O0KA 4FDCB 3VGGA 1SZGA 2HBVA 3UWQA 4EVZA 3G1VA 3GUWA 3W07A 1W5PA 3HG5A 3EPMA 3IJLA 3HZ3A 1Z42A 2RDTA 1ZAJA 2ISVA 4IHCA 3AXMA 1VYRA 5FEWA 1RK5A 2FDSA 4PBGA 1G6CA 3NEVA 1E51A 4Y9AA 4RNJA 3G1SA 4N2YA 4MLJA 5HK4A 2R8WA 3TJ4A 4U3AA 1DV7A 4JHOA 4LXFA 4XWUA 2TAAA 3UYCA 4JDRA 4Q4PA 1LWJA 3VNZA 1C9WA 4HSHA 3R0KA 3LK6A 1W3JA 1EBDA 2CNCA 3PG9A 2OB3A 1CNVA 2W62A 3PK7A 3VKDA 2G97A 4ZE4A 5LNVA 3QR3A 3U7BA 4C6PA 5I3IA 1E9ZB 4PR4A 3E1F1 4C7FA 2X2GA 3GH4A 4W5UA 2NQ9A 2AGKA 4Y9OA 4RE3A 2PI6A 1SFSA 4AD3A 3B9OA 1QOPA 2WBGA 2GGGA 4CD8A 4WDWA 2FH6A 1A53A 1KM0A 3FXYA 4L56A 4P7LA 2PSNA 2V30A 1M9HA 5GVJA 1BEUA 4PE8A 3O6DA 4IFKA 4UMAA 4XBJA 2VEIA 3S3GA 1PB0A 3W2JA 2WOWA 4BQ2A 2CPUA 2JGYA 2ZA3A 3FA3A 1TWWA 5GNZA 3R6IA 3N6JA 1WOAA 3LXCA 2YKKA 1YTEA 2CKSA 4JFTA 2XFWA 3WQ6A 3NDZA 4Z42C 4CCCA 3MUIA 3WL0A 2OWWA 4ZO6A 4FLRA 5B7YA 3AZRA 4G7EB 2D3NA 5DRIA 2HTMA 1E4IA 1IXQA 3WD3A 5AVNA 3WLTA 1H60A 1Q6FA 2TPSA 5C2XA 1TTIA 5XIMA 2NW0A 4Z2GA 2GGJA 2XIBA 1FHDA 3LMYA 2YCKX 4H6EA 4WKFA 3WLIA 1XLMA 3EDFA 1C8VA 3T40A 1IEWA 1D3CA 1AH0A 2D2GA 2GSJA 1R2TA 3BAIA 1WYIA 4ROPA 1TZZA 2WZEA 4RV8A 1S5VA 1P7TB 3T08A 2NVDA 4GK8A 3SCPA 3IRDA 1DHPA 4HOZA 3C4UA 5BCAA 3GVQA 1XQKA 1A5AA 5LNWA 4WEVX 4JTRA 2CXGA 1ZP4A 2OOGA 4N02A 3WEMA 1FDYA 4GIEA 2NLYA 3CPGA 3FJ6A 2EPMX 2X30A 3NZPA 5E9XA 4KH2A 2BSLA 3A4WA 4HNUA 4PULA 5J04A 1O6IA 3ZS4A 3KLLA 1D8WA 3N15A 2B7PA 2V5LA 1DVJA 1Q4NX 4RLIA 1WX0A 1EQPA 3VU2A 4B4FA 3EWWA 3CWHA 4GJ1A 2R94A 4J57A 3R07C 1N8WA 1QO2A 2IXUA 1HGWA 3CAVA 3M47A 4I6KA 1VYPX 3PG6A 3CAKA 1V59A 3QFAA 4AYGA 3SEPA 1ICPA 1M7XA 4GQRA 1HJWA 1WKFA 5G1YA 1GQLA 4UQCA 5AHFA 3QHMA 3CPRA 4NASA 2E5CA 5AY7A 1RA0A 3T05A 4K1GA 3QMSA 4YWOA 4PTNA 5CLWA 2ZRWA 1V7AA 4AZHA 1R86A 2CETA 5KTLA 4P7RA 4UFLA 1BG4A 1B30A 3ZR5A 1A5NC 1EXBA 4QE4A 4PMXA 1RQHA 5CGQA 3A4XA 3FVMA 3BJTA 5HAOA 1R87A 2X1IA 4LF1A 5ABFA 1JDAA 3QC3A 3BC9A 3WLHA 1TB3A 1VRDA 2Q3OA 3AMDA 4JTJA 4PUJA 4CD5A 4HK7A 2ZX9A 1JAEA 2J6VA 4ZXLA 3W7DA 1VBGA 4C6NA 4WDUA 2ZZ3A 2ZZ7A 3LPOA 4WY0B 3W6YA 4DF1A 2WVSA 3F5LA 3TN4A 5F2MA 1QFEA 2GWNA 1S2CA 3CL6A 5I02A 2Z1VA 2F84A 3MSDA 5IHRA 2DVXA 1ZY9A 3VD7A 3PZIA 4RUBA 4ACZA 2ZE0A 3PPCA 2DT1A 4QIUA 1TV7A 2VRJA 3BAKA 3KBNA 3DG7A 3EDEA 1M6IA 3HU7A 1BRLA 1DBTA 4JTHA 4PODA 1HF6A 3GAYA 3BPWA 4ADWA 3DG3A 4ZQRA 1W1TA 1KD0A 4JY9A 5E1QA 3DAQA 3GXNA 3LCWA 3P74A 1GOXA 1SZFA 1M03A 1JQXA 4UCGA 5HNNA 1FWGC 3HGJA 1HP4A 2CLKA 4F9JA 4KEVA 4GUHA 3E96A 4B5UA 3VE7A 2GUYA 4PUKA 3FA5A 4GABA 1GEQA 1LROA 3USBA 2XZ9A 1E0WA 2HNHA 2XFYA 4DYEA 3R89A 4O18A 2ZUTA 2QUMA 3TNBA 5HQMA 3XISA 4ADTA 4GJJA 2GR2A 2PWFA 1RK6A 4J3SA 4ZO7A 4BF5A 4R33A 4JTDA 4JNMA 1POJA 2GRTA 1K02A 1DJYA 3CQ0A 1J0YA 1TPEA 1TE6A 3C5QA 5DY3A 3PZOA 3QSTA 2A0NA 4OE7A 4GNVA 3GDMA 3LV6A 3CUXA 2FPYA 3UPWA 1NM9A 1UCWA 3NQVA 1KXHA 1VH7A 3O6AA 3TU9A 1VENA 1XCFA 2QLYA 2G4JA 5D9PA 3BZGA 4DLFA 2EPKX 4W7VA 2GJXB 2HISA 3N2CA 4IIGA 4WOQA 2YQUA 1LDCA 5M3WA 4H9YA 1TCDA 1V51A 1T8XA 2A3EA 3NDOA 4GYKA 3NDYA 5HUPA 1RXOB 1DWGM 2HVNA 2F6UA 3ALFA 2GDQA 1AJ2A 1P1XA 3MC5A 4YHGA 3LHUA 4O4WA 1JCXA 2V81A 4OOZA 4M0XA 4ATLA 2QVNA 2ZZBA 1KA9F 1KM4A 5C2CA 3GY1A 1RH9A 3GVGA 1VP5A 3USZA 3A6OA 1PKMA 3CO4A 5DBUA 3G3MA 1QI0A 5ENLA 4XUGA 5D9NA 3TQPA 4GX8A 5BWFA 1PYMA 3GLCA 3AXIA 2NV2A 2H9AB 4GFIA 4LVDA 1VPXA 1CYGA 4OGZA 4AU0A 2F9RA 4ADSA 4Q6XA 1I1WA 1XC4A 5FI8A 2CITA 3R4IA 3AIWA 4IMDA 3GHUA 4REQA 2QMJA 4ML4A 3NUKA 2WVVA 3M7WA 3WQ5A 2DZVA 4X22A 1M3UA 4GYPA 3T8LA 2VC6A 6CGTA 1TA3A 3H2FA 5CH9A 4NIRA 3TYUA 1AW1A 2FTPA 3NNTA 4FHAA 3IVSA 1MWOA 2HZGA 2UV8G 5HPOA 5A6MA 3IGSA 3TTQA 3BMVA 1VD6A 2GJLA 1K1DA 5D09A 5EFFA 1S2WA 3EOEA 1VHCA 2G3JA 1V7YA 1JEHA 5G4WA 4DXXA 2WNZA 3ZIZA 2QYGA 2FJUB 2ZZ2A 4CCZA 3ZSTA 4AC7C 4K1WA 2DY3A 4F2UA 4GQQA 4Z1YA 4AX6A 2J7BA 3SSJA 4O4VA 1YYAA 5AKQA 3ZZ1A 3N2TA 3SN1A 3IV3A 1O95A 1DWJM 4LS0A 3ZVHA 1BYCA 5XINA 4BZYA 1WV2A 4AZBA 2VFIA 1R3WA 4PTWA 3W73A 3OO2A 3CQJA 3V0TA 3S0CA 4TX6A 3Q2DA 4FOJA 3TAOA 3AJXA 4HJWA 3GXPA 3VO0A 2CXEA 1S2AA 3C3NA 5CPLA 4WQ6A 3G3DA 4MZYA 3QOKA 4DWSD 5A8PA 3BG5A 2VDIA 1CXLA 1A50A 1MEHA 2R1KA 3WL1A 4C1KA 3KHJA 4UTWC 4GLEA 3SW6A 4BI6A 2PZNA 1A3XA 3NGFA 5AC6A 4C6QA 5HQEA 3R7MA 1LF1A 2ZUVA 4H9TA 3ZO9A 4UFHA 1MW3A 2W61A 1ESWA 4NZFA 3QTPA 1LL6A 1ZJBA 3HIJA 3QF0A 5A6TC 3OVGA 4EXBA 1F3EA 4C7DA 3CEPA 1HVXA 2HDJA 2VZSA 5D2WA 4J3TA 2X1RA 3G1FA 2E0PA 3AS0A 1QATA 4KS0A 2ATSA 4HYRA 4E0CA 2I7GA 2FGZA 2OEKA 5A6SA 2INZA 4P61A 5EA9A 2JKPA 3NA8A 4TMBA 1E9YB 5KINA 1KQZA 1HVQA 3AROA 3SCUA 3UCDA 1M6JA 3ABRA 3P8JA 5L9FA 4FXSA 5CPOA 2OTDA 3BUVA 4CU8A 2QUNA 4MNLA 2BTMA 3CHFA 1WZAA 4GWEA 2PWHA 3NOEA 4L4LA 3TIMA 1XH0A 3EKGA 3L68A 1JZ2A 2QDHA 2YLAA 3BAYA 4QJ4B 2YXXA 3A3WA 4XIMA 4UWMA 1SZNA 5A6BA 2PWVA 5JCIA 3PTDA 3GHSA 3KBMA 4O28A 4GZ7A 3PZTA 1EPVA 4KEZA 5I23A 1Q13A 1MSSA 1LL4A 3OODA 2DZWA 3QPEA 1EC8A 5JRBA 3IGUA 3SFWA 3SR6B 3QQWA 1FWJC 4ICCX 3WH8A 4UTUA 3JZEA 1JQVA 1DL3A 4RZ6A 2WO5A 3H4XA 4MZ8A 4EMIA 3TR9A 3BAJA 3FS2A 4NAEA 1PZ1A 1XM3A 3B9DA 3ES8A 1AK5A 4F0KA 4P8UA 3AM9A 3O2LA 4TX9A 1K9DA 1TV2A 4NXKA 4C6CA 3SADA 3DBPA 5DX7A 1J0IA 3EA1A 4ZCWA 1VBRA 4DWDA 1TQXA 3CMGA 1QUMA 1ONFA 5CBBA 1WE5A 1EQCA 1WBJA 4K36A 3N19B 4MF4A 3QFEA 2E67A 3WQVA 4PEEA 3TSDA 1F2JA 1JCJA 5K2ZA 1XD0A 3NEHA 4L9ZA 1LTDA 1TTJA 1RY0A 3NZQA 4F2BA 2BV9A 4DBSA 1B4EA 1UKOA 4LYRA 3VUSA 3DYPA 3PSVA 4K7ZA 3S1GA 3GNPA 3DBNA 3FEQA 1A5LC 1DEDA 1W1ZA 5BMWA 4EP8C 4Z1BA 3Q65A 3E2VA 4DF0A 2Q6ZA 1NH6A 4C6FA 1TPC1 2WMGA 1W3HA 1HKJA 4WGXA 5A8GA 4JTSA 3K8MA 3GD3A 2R82A 4C65A 3F2BA 5I24A 3S2MA 5CPTA 3B9AA 3WBAA 2DV0A 3ORWA 2UY2A 3NTYA 1JPDX 4A3HA 1PAMA 1OC6A 2PTXA 3TSBA 1ODUA 1OF6A 2X40A 1FOBA 4MPQA 4UTFA 1JPMA 1FTXA 1T96A 1UD5A 4P7QA 2NXGA 3R25A 1PEZA 3AS2A 1KTNA 1V3JA 4DBUA 4ZO8A 4TO8A 1PIFA 2WMJA 2D73A 1JYWA 1NFBA 4NVTA 2CEQA 3W1QA 3G18A 1W1YA 4UTHA 2IKJA 1VFHA 1XDIA 1PVNA 4JYDA 2PDXA 4LX4A 3D47A 3GXIA 3CWOX 1DWFM 1XYMA 3P14A 4ZGYA 3RUBL 3DFSA 2TMDA 2X1SA 1EKOA 3ICJA 4IUOA 4D6IA 1XC6A 3A47A 2HQAA 1PHWA 1ZB5A 4N9EA 3BXWA 2GDVA 5HR7A 2QCLA 1XYZA 2YYTA 5AHEA 1FCQA 3SR7A 5CC6A 4FNQA 3W86A 4NI8A 2F8QA 2HJPA 3G1AA 3IARA 4PMUA 2YB1A 4AXNA 4XB3A 1WDRA 2E8YA 1UUOA 1QPQA 5I5RA 3CGCA 1I0BA 3W85A 2WOQA 3KVJA 3NVDA 3F5JA 1EOKA 4PMQA 1VZWA 3MYOA 4RNHA 1A80A 4JFUA 3II4A 1F4HA 2XYLA 2FVMA 2WKLA 3ITYA 3GG8A 3B8VA 1VCVA 1V02E 3OLDA 3TC6A 1H63A 1S2VA 4H2HA 4EXQA 1JZ3A 4Z1AA 3W7HA 3WLLA 4KGLA 3DECA 4R88A 2NVAA 4GI6A 4JYEA 4P8VA 2UY4A 3Q37A 1XQLA 3HB9A 2UY3A 1Q1RA 1SB3B 4NI3A 2WMFA 1S38A 1TJ2A 3RNDA 4JTKA 3AICA 4EANA 5G2IA 2VZVA 4AZ5A 1TVLA 1XISA 3UNTA 5GJNA 1BF2A 2Y7GA 3LSCA 2GZXA 4LBSA 3ZLHA 2WZIA 2G3NA 5H8UA 1RVKA 4LQ1A 2OKTA 3ABQA 4L65A 3APTA 3FG2P 1WKYA 2GQWA 2W5FA 1NELA 1V8EA 4EQXA 4LUIA 4YCOA 4B16A 2EQ8A 3DKJA 3TFXA 3CL7A 4DYJA 3S2JA 3O0KA 4YVVA 3KLJA 4D6DA 3TA6A 2RKXA 1V6WA 4KMQA 3S4TA 4ORIA 1W3LA 2QUUA 2PLMA 1KM6A 3C0SA 4U31A 1TJ1A 2V68A 5FJTA 1KFJA 4M1RA 4NY2A 4O0QA 1C91A 3GNRA 4W8BA 4LCQA 3EDKA 1K7XA 3BW4A 5HMEA 1KKRA 3J7HA 4UTTA 4PB3A 3WDPP 1B31A 1RBAA 4NEVA 4HN8A 1MXDA 2DZPA 3GO2A 1BYDA 3WK2A 2RGLA 1E6ZA 1RPKA 5K9CA 5TD4A 4H01A 3I10A 2DIKA 1MRQA 3VIGA 2WSYA 1W1A1 4XTDA 1U22A 4AYSA 1FY6A 1XLCA 2R1MA 1L9WA 1X6UA 2ZX7A 2OSXA 4Y9PA 2QIIA 1H0GA 3CMJA 3AWNA 3QYSA 2ZC1A 3Q67A 1F07A 1K77A 4F0HA 4EK7A 3M0VA 3OZPA 1UD2A 4O1BA 3TWAA 3LPFA 1EZ2A 2BLEA 1D9EA 3VKJA 2FMOA 1MOKA 3OIXA 1JI1A 2HS6A 4M80A 3VXGA 3W2MA 1NDAA 1FWSA 3CO8A 4Y8FA 1N60C 3IUDA 4H9UA 2BMBA 4MKNA 2JEQA 2OODA 3PUGA 3FKRA 2H3DA 2W91A 5AYYA 2EAWA 1LPFA 4WUIA 3W02A 3WF2A 1GOQA 2PC8A 1GRAA 3CHCA 3TP4A 1R30A 5IFPA 5BU6A 2XGBA 1JJKA 3BQ6A 4YS1A 3ABZA 2VP8A 1XRTA 1ZBWA 4JN8A 4N0RA 4RL3A 3KP1A 3ANYA 1MW2A 4RZBA 2WSKA 4IPNB 1AVAA 2NT1A 1UIOA 1UR8A 3AZTA 4ZA0A 2X8RA 4RXGA 4IFKB 3K30A 5C9XA 2HQMA 1PZ0A 3GRSA 1P6WA 3KS5A 2PF0A 1EP2A 3SUTA 1KCLA 5IRPA 1FKWA 3ZMRA 3KOXA 4JHZA 5ABEA 4XAFA 3VNDA 4YYFA 1ECEA 1QNVA 3V0UA 5J5DA 2OSYA 2XG9A 3DXIA 4RE0A 2CW6A 3RPMA 1JULA 5CEWA 2O9PA 2JE8A 1GONA 1AMYA 2VR4A 3DH7A 2X99A 1AUSL 2E9BA 5A8OA 1HN1A 4KIRA 5DXYA 3PJUA 1K7EA 4NYUA 1B9ZA 4EPDC 1H61A 2EQ9A 3TCEA 2ZE3A 3T6CA 1RJQA 3PPHA 4QSFA 1ISZA 2VR2A 4A22A 4M6QA 3WBEA 4AIOA 4M81A 1EGZA 1EX5A 2PS2A 3SCVA 3AUJA 1Z9AA 3I6TA 3QN3A 1S3TC 1N61C 1AJ0A 1XIEA 2PTZA 1Z69A 2ZVRA 1RALA 3QSRA 3STGA 4DVOA 1H7OA 3S5NA 3IK2A 2HSAA 4HQVA 2QPXA 1BXCA 3WNMA 3LQLA 5D38A 3P93A