3TOYA

Crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium sp. ors278 with calcium and acetate bound
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
359
Chain Sequence
TTAAITGVTARAVITPMKRPLRNAFGVIDSGPLVLIDVTTDQGVTGHSYLFAYTRLALKPLVHLVEDIGRELAGKALVPVDLMKAMDAKFRLLGWQGLVGMAVSGLDMAFWDALGQLAGKPVVELLGGSARPIPAYDSYGVLDARDDERTLRTACDEHGFRAIKSKGGHGDLATDEAMIKGLRALLGPDIALMLDFNQSLDPAEATRRIARLADYDLTWIEEPVPQENLSGHAAVRERSEIPIQAGENWWFPRGFAEAIAAGASDFIMPDLMKVGGITGWLNVAGQADAASIPMSSHILPEASAHVLPVTPTAHFLEVLDFAGAILTEPLRVIDGKVTAKGPGLGLAWNESAVAKYQVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme family protei
publication title CRYSTAL STRUCTURE OF MANDELATE RACEMASE FROM Bradyrhizobium sp. ORS278
rcsb
source organism Bradyrhizobium sp. ors 278
molecule tags Lyase
total genus 120
structure length 359
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3toyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3toyA01
1BQGA 3N6HA 2OQHA 2XH2A 2XH0A 1JCTA 1XPYA 3VFCA 3RCYA 3I6TA 3OP2A 2P0IA 2P88A 2OX4A 2HXTA 3NZGA 3CT2A 3RGTA 1EC9A 2HNEA 5FJTA 3D47A 2GGJA 2HXUA 2PODA 4MKSA 2XH4A 3RRAA 2AKMA 1SJCA 3R1ZA 3DDMA 3Q45A 3H70A 3Q4DA 3T8QA 1JPDX 4H1ZA 3EKGA 3DG7A 4J3ZA 3DERA 1R0MA 4A6GA 4K8GA 3VDGA 4DHGA 4IT1A 3K1GA 3R25A 1EBGA 3TQPA 2OPJA 4DXKA 2PA6A 2PU0A 3ES8A 2ZADA 3ZVHA 3H8AA 2ONEA 1KKRA 2GDQA 3RR1A 1TE6A 3DESA 4DWDA 3NFUA 4H19A 3SQSA 4HNCA 2PTXA 3ZVHB 4HCDA 5FJUA 2AKZA 2PU1A 3T9PA 3B97A 3IJIA 1SJDA 4JN8A 3SSZA 4KPLA 4HNLA 3UXKA 2QDEA 3V4BA 5ENLA 3BSMA 3I6EA 4IL0A 3MKCA 2PMQA 4H2HA 1TZZA 3VCNA 2AL1A 4KT2A 2DW6A 3MUCA 1IYXA 4GGHA 3TJIA 3BJSA 3GC2A 2GGEA 2QJNA 4H83A 3RO6A 4ROPA 3IJQA 3R10A 2PGWA 4GYPC 1P43A 3KUMA 4A35A 4DX3A 2DW7A 2OKTA 3CYJA 4M0XA 4G7FA 1XS2A 3PK7A 5BOEA 4K1WA 2GGIA 5FJRA 2QDDA 3QPEA 3TW9A 2GGGA 4JHMA 4HPNA 2OFJA 3UCDA 4FP1A 5EU9A 1MRAA 4DN1A 4E6MA 1NU5A 3DIPA 3UJ2A 4IP5A 3OTRA 3SJNA 1KKOA 3D46A 3DG6A 1DTNA 3PWGA 3NXLA 3MZNA 4HCLA 1JDFA 3R11A 4GYPA 3T4WA 3U4FA 5IDZA 3I4KA 2QVHA 1ECQA 3GD6A 2HZGA 3MSYA 3R0UA 1SJBA 3H12A 3DG3A 2PP1A 2QQ6A 1PDZA 2I5QA 2PTWA 3P3BA 4IL2A 3V5CA 1EC7A 5FJPA 1BKHA 2PPGA 3ZLHA 1L8PA 3JVAA 3UJFA 4GMEA 2XGZA 4HN8A 3DFYA 2QGYA 4F4RA 2RDXA 3CK5A 2PGEA 1EC8A 3TTEA 3GO2A 3FVDA 3OW1A 4X2PA 4J1OA 1P48A 2AL2A 1YEYA 2OG9A 3UJEA 3N6JA 3FV9A 1W6TA 3PWIA 1FHVA 7ENLA 1FHUA 4EWJA 3FJ4A 3OZYA 3MQTA 3V5FA 3OZMA 2PCEA 4HYRA 2FYMA 3P0WA 3UJRA 2OZTA 3IJLA 4A3RA 2OO6A 2MUCA 2PP0A 2ZC8A 4KWSA 3TWBA 3U9IA 2MNRA 3N4FA 1ONEA 3TWAA 6ENLA 2XSXA 3ENLA 3ZLGA 3VA8A 4Z17A 2QJMA 1MUCA 2PTZA 3MWCA 3T6CA 4Z1YA 3SN4A 1SJAA 3HPFA 4ZCWA 1ELSA 4MMWA 1MDRA 4FI4A 5BOFA 1WUFA 3VC5A 3JZUA 4E5TA 3P93A 3S47A 2P8BA 3UXLA 2NQLA 4YWSA 4E4UA 3TCSA 2FKPA 3N4EA 3FXGA 2XH7A 3FCPA 1NELA 4MGGA 3QLDA 2PTYA 2P8CA 1JPMA 3SN1A 4ENLA 5J04A 2PSNA 2GL5A 4G8TA 1EBHA 3DEQA 3ZLFA 2OVLA 4GISA 4JN7A 3VCCA 1F9CA 3THUA 3CXOA 1OEPA 3DFHA 3CAWA 1R6WA 1TKKA 2QJJA 1KD0A 4KEMA 2OZ3A 2O56A 3UGVA 3TJ4A 2P3ZA 3UCCA 4E4FA 3NO1A 3FYYA 1RVKA 4K2SA 3SN0A 2OQYA 4DYEA 3S5SA 3QKEA 3VC6A 3STPA 3DGBA 3CB3A 1WUEA 3UJSA 2GSHA 3RITA 3GY1A 3QN3A 2AL2B 3IK4A 4IP4A 5FJOA 4IZGA 3MY9A 3OPSA 3JW7A 3V3WA 3QTPA 3ZVIA 4HCHA 3EEZA 4GIRA 4E8GA 3PFRA 4GFIA 2POZA 2PS2A 1KCZA 3H7VA 1E9IA 3R0KA 4M6UA 3BOXA 2GGHA 2CHRA 2PP3A 4IHCA 2OLAA 3SBFA 4GGBA 4ZA0A 1MDLA 1PDYA 3ES7A 3TOYA 1MNSA 2OZ8A
chains in the Genus database with same CATH superfamily
1TRDA 1G94A 1SUXA 4GY0A 4PN2A 5I24A 4DI9A 4UUIA 5HNNA 2ZX6A 3TR2A 4EOUA 4UMCA 5AC4A 3FX4A 1BFNA 5JBEA 1CT5A 4MJZA 1W0MA 4D8ZA 1CCWB 1V97A 3F4WA 1VAHA 2HNEA 3VIOA 3W7IA 4HU8A 3BLIA 3SRDA 3TYBA 3WLNA 4KGLA 1DXIA 3TQKA 4YL2A 4JIIX 2Y5SA 1UD8A 5T26A 5TNVA 1E40A 4FXSA 4LS1A 4D6FA 3GDRA 4P5UA 2BXVA 3VNYA 1LPFA 1MWOA 1KRCC 2YVGA 2WVSA 1AH3A 3OVQA 5A6SA 3LM7A 3P14A 1FWHC 2P3EA 4EIVA 3GSMA 1M68A 4KCTA 4C90A 4H8VA 4JCLA 1Q6GA 4JTLA 3GNDA 3SGGA 3T9PA 3NVWB 3CXBA 3NS1B 4PB5A 3LDVA 1JF6A 5EMLA 3SSZA 1V0LA 1XSIA 1BVNP 2Z1BA 3LK6A 1KN0A 3APTA 2NT1A 1D9EA 1ZENA 3NZQA 1ADOA 1IEWA 3J7HA 3L0NA 2FTPA 3I6EA 4EPBC 1WXJA 4K7YA 2QJIA 1TZZA 4S3BA 3GAKA 1S46A 1UWSA 2VEMA 1YX1A 4WJ8A 1B4EA 3LPOA 3WK3A 1ZNNA 4K8EA 2DZUA 4K6AA 4C6LA 2DSZA 1TTIA 2PTDA 4L6OA 3RO6A 1PCKA 3W7PA 4A35A 4M0XA 2FVKA 4NL1A 1XS2A 1JPHA 2JIWA 1PHQA 1G4TA 3QSTA 5E9AA 5EY5A 2BVDA 2DT3A 4QIUA 1GGOA 3JU2A 4LVBA 1FWWA 4YS1A 5C0QA 1JJKA 1N55A 2WMIB 4J3VA 3GVQA 4GOAA 1TX2A 2A3AA 3PB2A 3QM3A 1KGXA 1WZAA 1Q6CA 3VCRA 4JNMA 1K9FA 1DV7A 4H9UA 1DTNA 3EANA 2QF7A 4CN4A 1BTMA 3IVUA 2CPUA 4GINA 2O0TA 4MUPA 4JTSA 5D2YA 4EPKA 3HFTA 3M7WA 2GVJA 2WP5A 4N2YA 3WH9A 5I7GA 2XVKA 4D6JA 5U1OA 1XKJA 3VZZA 1AQHA 4CCCA 1RP8A 1PDZA 3KHDA 3A64A 4A8LA 2BXYA 1QATA 3URAA 2J3NA 3OB8A 1SPQA 1EC7A 1ZMCA 1NDZA 3EWXA 4RDZA 1QPRA 1RHCA 3T1GA 3W1AA 4Q4SA 3LG3A 3FLUA 3ITOA 5J8LA 4HA3A 4GUGA 4EF8A 1G6CA 2X05A 4GX8A 1JDDA 2QGYA 3BZGA 1OC5A 3AN1A 2CERA 4F4RA 5XINA 4CEXC 4E4PA 1EC8A 1O68A 3ZFHA 3K8KA 4U5KA 5BWAA 1UROA 4IP7A 1AD4A 3IVTA 4CQCA 2IQ0A 4FNQA 2UY4A 2CLKA 3HJZA 2UZ9A 1NOUA 5AVNA 1UR1A 2YOCA 5E70A 3NQDA 1KGUA 3A13A 4JTRA 4UTWC 4QLJA 2ZOXA 2CXEA 3ARPA 3W1TA 5H1WA 3CYVA 1H0IA 4MB1A 1TUFA 1IWPA 2PCEA 1RBLA 2ISDA 3H2OA 3AHTA 4BQ5A 3P67A 4E8CA 1YLVA 4WJXA 4N9CA 1ZPTA 5I78A 1PBGA 2CLIA 1OBAA 2J47A 4ZQMA 1RY0A 4AFYA 3BOLA 5AC7A 2V3EA 3LLXA 1VPXA 3LERA 3TH6A 4OVXA 3GH4A 5DMYA 3GU2A 4LRSA 1ZUAX 3I3DA 4RW5A 1PYFA 3NXFA 1BAGA 2JFEX 2P8BA 1V77A 1US3A 2NQLA 2YZRA 4YWSA 2HK0A 2VYOA 2FKPA 1RALA 3W1MA 2CW6A 3W0KA 4B91A 3VOJA 1PX8A 3W7JA 4O53A 3HM7A 1MSSA 5G2HA 2F8QA 5LIYX 1NDWA 1J9YA 1VJZA 3VNDA 1V6YA 2BXZA 5FAGA 4YWOA 1EJXC 1AJZA 4KFNA 4ZSUA 3LB8A 5C70A 1PO9A 3TV8A 3UFYA 1GPFA 2PFHA 1KFBA 2E40A 2BY1A 2CDUA 3NO5A 3CBWA 1X2GA 2P3ZA 3EUB3 2TAAA 4LY4A 4AZCB 3B9EA 2G4FA 2PDIA 1A5AA 1VFFA 1NWSA 1B3VA 2A6LA 1BWLA 5IFPA 3V7PA 1Q7QA 3DGBA 2D2HA 2OTDA 1YPXA 3ZSSA 3M9YA 1FXQA 4NNCA 1EDQA 1FCVA 1W5QA 1P5BA 3IK4A 4QJ4B 4G6CA 4QNWA 5HMEA 3TN4A 4F2BA 4L9YA 2WK2A 1ZMDA 3EOLA 3LCLA 4ADWA 4UFLA 4IFOA 3OC4A 3QHMA 4AY1A 2PLCA 4ZOHB 1I9CB 4C1NB 4X2RA 2DPEA 4ES4A 2POZA 2QXWA 3KDOA 3PS7A 3BVJA 5I3FA 4O57A 1FWBC 1L9WA 4NSBA 4BF5A 5AB3A 3C56A 3BLDA 1E0WA 2C0HA 4PRWA 4BEQA 3GFYA 4GE8A 1YPFA 4N7QA 1T5AA 3K1DA 4K7VA 3FKKA 2NWSA 2XH0A 4CU7A 2NXGA 2WPBA 1N61C 3C8NA 2XVGA 5A6MA 3M0ZA 1E4MM 3KBWA 3OGSA 3NZGA 5T9BG 2W55A 3QV6A 3W23A 2DZAA 4AZIA 4V1YA 3D47A 5JRBA 3ZJ7A 2J9YA 1CECA 1XCFA 4IPJA 3Q4DA 4O17A 2DUAA 1JAKA 4J3ZA 3M0IA 4K8GA 4OBTA 2PDGA 4XWUA 4LVFA 1MXSA 2W3ZA 1TV3A 4FOJA 3B8DA 5JBFA 4XK2A 1I45A 3IK2A 3OBKA 3CPRA 5E1QA 3M5VA 4LS2A 3DENA 3H4XA 4FIQA 3KBNA 5M1TA 3VMPA 3LLDA 5C9RA 1ZS2A 3ERPA 4LJ3A 4IPNB 2DSWA 5EMYA 3SFKA 4MAZA 2OSWA 4MLRA 1SFSA 3S5OA 4RDVA 1X1NA 4FX7A 2XN1A 6CGTA 3TFCA 2CKSA 3A3HA 3LB0A 4Q3MA 3CC1A 1MQPA 4MJ4A 3WCZA 4U33A 1V8EA 1YHTA 4H9VA 3GYEA 4TMBA 4KT2A 2J25A 3AO0A 4GHRA 2WPCA 3PNUA 3VNJA 1K02A 3LYEA 1RBOB 4YWIA 4XISA 3PBWA 2EG6A 3O1NA 2MANA 4MDOA 2JIEA 1TG7A 3S1GA 3ITLA 4UTIA 4HTBA 2C3ZA 1UUQA 4J57A 1N62C 3A47A 1FDZA 4IGNA 1MVYA 3ZR4A 3W7KA 1DJXA 2QDDA 4WDTA 2ZICA 2R1LA 1OFQA 2O4MA 1UQZA 2E28A 4JHMA 1L8NA 1GRHA 4G2DA 3CGBA 4CN6A 1YXCA 4R85A 1DQWA 1NU5A 2IXUA 3CJPA 1L2UA 5ER0A 1GT8A 4X0VA 2TRSA 2ZUMA 1LRQA 3S1WA 5A8GA 3RF9A 3SJNA 3QGAC 4LB3A 1FWGC 1KM1A 2P5NA 4KWUA 2CCRA 3V0SA 1E6ZA 3IUIA 1WKDA 1KFEA 4HK7A 2PE4A 3TX9A 1XBVA 3T0AA 2QEZA 1ISVA 1ME9A 2D2OA 4XAZA 2Z2UA 5AYXA 4AWTA 3VK5A 3AYTA 4URIA 1E6SM 1PZ1A 1XIFA 3WH6A 3K2GA 4JFUA 2GJXB 4LAKA 3QRHA 1E6XM 4GNVA 3QOKA 3QY7A 2O92A 3PG9A 5BU9A 2CLMA 1QRQA 3PUDA 1EJWC 2VGFA 4AW7A 2I57A 2BFGA 5D32A 3LBCA 1OFPA 1UG6A 2XZ9A 3M5XA 3NGFA 2QCEA 2XSAA 2DU2A 2PDYA 1THFD 1Y5XA 4OBRA 3F5LA 2DP3A 4JYDA 1XWYA 3QFEA 1JXJA 1F6PA 2CLEA 2Y8VA 3PJUA 5C8BB 3AJXA 1QOXA 1LRTA 4KFOA 2C71A 1GXFA 3ANVA 3AXXA 4MNLA 3FYOA 3OZPA 3B0UX 4LANA 1B31A 2PUZA 1Z7AA 2BNJA 3DCPA 3REQA 4AWSA 4I9TA 1DJYA 4IQJA 3NYDA 3NL6A 4AHOA 4E38A 3B0PA 1E70M 3TN6A 2Z7KA 1R85A 1CXEA 3OZMA 1TPDA 1VBHA 1C90A 1QPOA 3N2BA 1UZHA 4HNUA 1E5NA 4ONVA 4FNRA 1ZDLA 3UJRA 4AUBA 2XIOA 1NPXA 3BW3A 1WPCA 4N6FA 4BZYA 3AYSA 3CLWA 5U7SA 4Q8NA 4CEUC 3DOPA 2ZC8A 1HKJA 1ONEA 2GQ9A 1YW1A 2WOVA 5HR6A 4XSLA 1IR1A 5BU6A 5LIXX 1ONXA 2VZUA 3E2QA 4PUDA 3GZ3A 2OYKA 2V5LA 1DYSA 4PSRA 3GVVA 1TREA 4WUIA 4L4MA 3AU6A 1RLCL 1XF0A 3BWWA 1S2TA 1L6FA 3E6EA 3JZUA 2J77A 5XIAA 3OQ8A 2I16A 2P76A 2Y89A 4E4UA 1Q4WA 4DQWA 7REQA 2INFA 4YTSA 4NG3A 1LDCA 4LCQA 4L6DA 2D2GA 2W5FA 2BSLA 4G8TA 1DWHM 5HOSA 3OJGA 3VCCA 3QPZA 3O6YX 3T7VA 1VPYA 1V0KA 3DHUA 1HZYA 3O9NA 4HHLA 5KZMA 2CZ5A 4JTIA 5LKYA 1R6WA 4NX0A 1A0CA 2VEFA 1LBMA 3I7RA 3MPGA 2IQDA 5D9PA 4LS0A 1HX0A 3N15A 3L0GA 4JTTA 3XINA 1FWDC 1MW3A 3SN0A 6XIMA 1TWDA 4QLKA 2XIBA 1I2PA 3PZUA 4PEEA 3ZJ8A 4DJDA 3CZLA 3BQ6A 5LNVA 1QPQA 1SYTA 3GTXA 4M6VA 3CM4A 1KLZA 3MI2A 1S2VA 3U48A 4JDYA 3BGJA 1CGXA 3GNNA 3VZYA 4DUXA 3OU8A 4HHMA 4KH2A 3EB3A 4RE2A 3JRKA 4UZSA 1EGVA 1LWHA 3BSHA 3IJ6A 4OZOA 1RPKA 1J6PA 4UNLA 5I77A 1LQ0A 4DO5A 3NM3A 1FO4A 1H49A 2Y8UA 3UR2A 3GDMA 5KTLA 2NX9A 4XZMX 5CBIA 4W7UA 1I4NA 3FA3A 4X9SA 2Z2AA 4GVGA 3UZYA 3G8EA 4UOZA 4HOZA 2CHRA 4TVCA 1F2JA 3P80A 3SBFA 1FEBA 5A6BD 5AKQA 2W3RA 1MDLA 2YVJA 4JDRA 3W73A 1JI1A 1U33A 3ZWTA 1R5YA 4PBGA 3T07A 3TFXA 5EFDA 4QGCA 3HW2A 3G6LA 3HG5A 1E3XA 1GOQA 4IMFA 2TPRA 1IWAA 3GM8A 2CHNA 1EO7A 2P88A 3UA3A 2BV9A 4EXQA 2DZPA 4J35A 1HL2A 3YPIA 2VTFA 4QLLA 4KF1A 5K3VA 2XVLA 5M03A 1JFHA 3S6TA 1I2RA 4TX8A 2FLIA 1GETA 7CGTA 3NCOA 1GRAA 3D6NA 1FDJA 8A3HA 1CLVA 2EJAA 1Z48A 3CS2A 3GXMA 2RJGA 1AMKA 1VEPA 3F2BA 2WHJA 1VFOA 1O5KA 5C9UA 2XVNA 1C8XA 2C15A 3AYRA 3CQHA 3SQSA 4PC8A 1QTWA 1VS1A 1X7FA 4FNTA 1R3RA 5FJUA 4GUIA 3W72A 3O2LA 1V3KA 3KVKA 1D8CA 1JYNA 4LYKA 1SJDA 4JN8A 4NEWA 4YCPA 4M8UA 1BYAA 2YXXA 4PRTA 3UXKA 3T78A 2Y85A 3ANYA 3EMCA 3OG2A 1EPVA 5CZKA 4NP7A 4TX6A 1PTGA 3BSMA 6REQA 3C52A 2GR2A 2G95A 3NDOA 3SAZA 2OR2A 1R7AA 3DFOA 1D3GA 4REQA 1IYXA 2FMOA 1V0MA 4ALDA 4HJFA 1HIZA 1PTAA 1PB0A 4R27A 1O5QA 4XBKA 1G0CA 3SCVA 1VBJA 5G2WA 1MUWA 2NVKX 2V8ZA 3QH2A 1B54A 1ZJHA 1GTHA 4LPCA 3VO0A 3L2IA 3GNOA 1DXEA 4R7JA 3SUTA 4IOTA 2G37A 3FJ6A 5AC5A 3WQFA 4B4FA 1QHPA 3FYPA 1XIEA 2VDGA 3FS2A 5G1MA 2X1RA 3CAQA 4RL3A 4HCLA 4ZOBA 3CUGA 1E9LA 4DZHA 1UOZA 3AISA 3LS9A 5K9DA 3L5LA 1W3KA 3W2MA 3CIWA 2V6AA 1JUEA 4AZHA 2CLPA 1TZ9A 3QHNA 4BQ2A 2DY3A 4E2VA 3PZMA 1W56A 4PE8A 4FF5A 3NZRA 4IUOA 1QHOA 2Y5EA 5FJPA 3VABA 2ZZ6A 3KTXA 4UQEA 2Q3OA 1FRBA 2EPMX 2FVMA 3SCUA 4RV3A 5JCKA 1GSNA 4RZ5A 3W7CA 4OOUA 3RN6A 2PDMA 2RH9A 2J79A 1V93A 4NI8A 3G1VA 2WJDA 5TIMA 4CQ9A 5FF7A 5LIWX 4NJHA 4U31A 1QNOA 1LBFA 3O0FA 4O1CA 4F0KA 5BW6A 1XXXA 3K4AA 2G8ZA 2YKKA 4ZXOA 3FKRA 4QQUA 5J5DA 1YEYA 1KCLA 5C54A 4YTRA 5T9CE 3TLLA 2PGFA 1J12A 4M56A 4QE4A 4Q22A 4Q7NA 3IJ8A 3SO7A 1VBRA 2DV0A 4Y9NA 3CUHA 1HXJA 2FYMA 3E5PA 1CB2A 3GUGA 1SFJA 2OZTA 4O14A 1SQ7A 4ZFCA 3M6YA 5HJXA 4XSMA 4NZ1A 3WMSA 3HU7A 1FKWA 3R0DA 1QW7A 3VA8A 2D24A 3O0KA 2VRQA 2J7CA 5G2IA 4CVUA 4E8DA 5REQA 3RM4A 4UQ9A 1TWIA 1OIMA 3VNLA 3EEGA 1SJAA 4JIEA 3HPFA 4F66A 4ZCWA 1JVNA 5G5GB 4J2PA 4F9DA 2PZ0A 3FDKA 2H8ZA 3UBPC 4D1IA 1O1HA 4EWND 2YYUA 2QCDA 5ECUA 1QDSA 3VKAA 3PY2A 4Y6GA 3WK2A 3K4WA 4WSHA 4M1RA 3MP4A 4MLJA 1W91A 4H2CA 4JTUA 3UWVA 4XIAA 3MCOA 2NLIA 4HA1A 3E5BA 1F9CA 4ZOAA 5JCIA 1PEZA 2J6XA 3MI6A 4XQ6A 1GG0A 2WNQA 1U83A 1JZ5A 1LLOA 2OCZA 3BV7A 3LPPA 4YU1A 3PTDA 2EKGA 2NQZA 4YXGA 1PSCA 4P7NA 1FHDA 3MBFA 1NHPA 3WBXA 1TUXA 2A79A 3S2JA 1VBGA 2YCIX 2PCQA 4PUEA 2C3DA 3E0LA 1YPIA 2FQIA 4DYEA 1R3VA 1W32A 4LWWA 1U22A 3OZOA 2H9AB 3N17A 4ICMA 1A53A 2BY3A 5G5HB 4AYSA 1H7XA 1L6YA 3ZR6A 2GSHA 2ZX9A 4F79A 1UZDA 2Z27A 4DI8A 2IMRA 4B3KA 1BYDA 2GR3A 2ODOA 2E8YA 1TV5A 3TTQA 4O19A 3BUVA 3FA4A 2GWNA 4BI7A 4TV6A 3NQVA 2CZDA 4JDBA 1E1CA 4GJ1A 4EQXA 1CYGA 2NQJA 1JCMP 1G01A 2CITA 2X42A 4QAIA 4AMCA 4YIWA 1Q13A 2QULA 5JCNA 1R3YA 3GDTA 5XIMA 4JFWA 4PCTA 3U5YA 4IPLA 3HGJA 3DGHA 2ZE0A 4QS5A 4XX6A 4S3JA 3SM0A 3R94A 1X39A 2XH2A 5B7YA 4QX4A 3ARXA 4LH8A 2Y7FA 4UTWA 5DLCA 4BR1A 1UKPA 1A80A 3KL0A 4GQGA 3OOQA 1DVJA 4RZ4A 3VX1A 4MNJA 4FX6M 5DY3A 3W1QA 5C7HA 1JULA 4O0ZA 4PL2A 1TCMA 1OF8A 3VGBA 1Q1WA 1Z32X 4X60A 3MHFA 2L5HA 2R14A 5CBBA 1JZ8A 1E43A 1GPWA 2EKCA 2ZXDA 4HPXA 1J2BA 3T44A 3TU9A 4MWAC 1ENUA 3DDMA 3H70A 1Z89A 4Q4PA 3UZ5A 4F9JA 3IRDA 1AJ2A 1VIZA 2DQWA 2D2JA 1CENA 3TQPA 3UY7A 3MC5A 4KWOA 7A3HA 1G9HA 5CZSA 5IXEA 4XKMA 1W5MA 1W1A1 4N6EA 4P8XA 1FDYA 5BMWA 4DWSC 5D8ZA 4ZR8A 1F8IA 2QPSA 4IXXA 5CC7A 3N73A 1DQUA 1J0ZA 2GOUA 3CUIA 1NM9A 2P1FA 4I5UA 4PUUA 2VZVA 1C9WA 4HNLA 4ZB0A 1XRVA 3ARSA 1JROA 2BC0A 1W9PA 3EXRA 3EAUA 3IIZA 3O16A 2VFIA 1ZBWA 4L56A 4JQ2A 1ZBVA 4NZ4A 2PWHA 4DJEA 1F07A 2NSXA 2QZRA 2P53A 4O16A 1LWJA 1KFKA 3WDHA 4DXXA 3ARUA 4H8UA 3BXWA 3UEQA 3SFWA 4JOMA 2XVPA 3OODA 5DT7A 3OHMB 1UA3A 1MO0A 3TQVA 2WC7A 1B57A 4DAIA 1XIDA 5CKSA 1XG3A 3PK7A 2IQTA 2E6YA 3ZSTA 3VD5A 3NPWA 2ESCA 2V68A 3HURA 3LN3A 3EPMA 1OGSA 3QBUA 2R82A 3WFZA 5MKGA 2ZX7A 2IPFA 3HGRA 3W88A 2OFJA 5EU9A 4ZE5A 1HG3A 1D2KA 2G3FA 4G1NA 4Y90A 2C8NA 3W02A 4WGXA 1Z69A 4H4YA 1LWIA 1AMYA 3TSMA 1TV7A 1JAEA 4ACYA 5DQPA 2VD8A 1H09A 4K1GA 1F8MA 2R6OA 2KAUC 2JALA 1L6SA 1R30A 1LQ2A 4GYPA 4IMCA 2VFGA 3GD6A 2ASHA 2WQDA 3B4UA 3COTA 4WXZA 3GG8A 3WEZA 3R0UA 3ALGA 1IGSA 3GNRA 3DG3A 2E25A 2PC4A 3LXBA 1U1UA 3P3BA 2DZWA 3EA2A 4QE5A 2ZQ0A 2VWTA 3MUXA 1FWTA 2JEQA 3ARWA 3WQPA 3VIIA 1OT2A 5D2WA 4WLCA 3MWAA 1LT8A 1AG1O 3CGTA 4BY3A 1PVNA 2NPXA 1KBJA 3RIKA 1UHVA 3OVRA 1FWJC 5A8PA 4NKCA 4OWGA 2ZVRA 3HQOA 1XYLA 3UXDA 1J79A 1E6QM 3EWBX 3KS6A 3TSDA 1F7BA 1F8WA 8XIMA 1NF0A 2WZIA 3CAVA 4F0LA 5LNWA 4JIHA 3PWIA 4HNOA 1TQXA 4OV9A 4RXGA 3EXSA 4MY8A 4M82A 3VAVA 2X2YA 1J6OA 3QSRA 1ONFA 3H4KA 4WDWA 4P8VA 5F1VA 2J4GA 4DBWA 4XTDA 7XIMA 3ALFA 2DUXA 1EHNA 3M5ZA 3DYPA 4KQNA 2B7QA 3REQB 3W84A 3EPOA 4KCVA 2X1SA 5FEXA 5GQBA 4FAMA 4JTFA 2FGZA 1XIJA 4GX9A 2YCJA 1TX0A 1GHSA 2X8HA 1HJXA 1XDIA 3WJWA 1B30A 3NSNA 3IJLA 5I3KA 3H23A 4C1LA 4HMDA 3TP4A 4IJCA 1D3HA 3GRSA 3GC5A 2G4JA 1ZJAA 1V7YA 1A50A 5DBTA 4FPSA 2X1TA 3WJYA 4AU0A 1JOAA 4OV4A 3C2EA 4IGSA 1M3UA 4WHBA 4C6QA 3G1SA 2WWCA 3WKZA 4TVDA 3O15A 2OSYA 4HZ6A 5FL1A 5KVIA 4H3DA 2GK1A 1SZNA 5BOFA 2Z6IA 4YMZA 4E5TA 4LUTA 2BODX 3WMBA 2FZDA 2Z25A 1J18A 3H2NA 1VEOA 2C7FA 3PULA 4DJDD 4U5IA 5FSDC 4BV6A 1XI3A 3BMXA 3SN1A 2QPXA 5FKYA 2XUCA 3PZGA 2NX1A 4DBSA 4Z42C 1S5WA 3DEQA 1P1MA 3ABQA 4OFCA 1CXHA 1RCXB 4OKDA 2A21A 4N4PA 1H7NA 1EJ7L 1C8QA 4KGJA 3DH7A 4UTUA 3MUAA 3GR8A 1DHPA 4ZODA 2DVTA 3TYCA 3HJEA 4DYJA 1UWTA 1UH3A 3BJTA 2ZE3A 1U5VA 1E4LA 4W7WA 3NR0A 3R8GA 4OOZA 1HUVA 4U28A 1I60A 4W88A 2P50A 2QCMA 1T7LA 3GR4A 5TAOA 1J2WA 4Z2HA 1KBIA 1CGYA 3A12A 1EYWA 1SVDA 2V5JA 3MANA 4BWLC 5JU6A 1RBAA 2NV1A 3QN3A 3RMJA 3BMWA 4IZGA 4WOQA 3TR9A 2R1PA 4O4VA 1EXPA 3UR8A 4E8GA 3V1PA 4UFHA 1CNVA 3G0SA 3A24A 3LEPA 1OIFA 4NXKA 4RX0A 1V59A 1IXNA 1VBUA 4JQ1A 2VOTA 2GJLA 1K9TA 1MO9A 4ZVJA 4OGZA 1JRCA 4M6UA 1O5RA 1U1JA 2IUZA 1KNWA 3RM9A 2HPIA 3KHJA 1N82A 3EOEA 4GGBA 1REQB 3CIVA 1RM6B 4RPQA 4GO9A 3VIGA 2BHUA 3LV6A 4GQRA 1EJUC 2QCHA 5ABHA 3SUSA 1V03A 4QRNA 1EBDA 2Q09A 1NVMA 3HPSA 4JKKA 4HNTA 1IR2A 1E55A 3QKZA 3QFAA 3NJ3A 4KEVA 1ICPA 1WDRA 1KXQA 3OA3A 3G1FA 4IIFA 5JMUA 2XWEA 1ME8A 3PFMA 5FSEC 3G1DA 4IQDA 3M64A 3KLJA 4HSNA 4ML4A 2VFEA 3TOPA 1XIMA 3UPWA 3GS6A 3RPTA 4ATLA 2VEIA 3SRHA 1OGBA 3RU6A 2WZMA 4DHGA 2QR6A 3Q37A 4HYVA 2ZADA 4HIBA 1XC4A 1KKRA 4P8WA 3WBWA 4LT9A 2WM0A 3BSGA 1GRFA 3GDLA 1OX5A 3MKKA 5C2CA 3BMVA 4S3DA 1Q6FA 1LOQA 5DCBA 4UTFA 3UVIA 3GIPA 4MWAE 1GVFA 3TXVA 3WF2A 4D6DA 2IKJA 2C18A 2H3BA 3AIVA 5GNZA 3CZEA 1F4AA 3N3TA 3EGJA 4KBXA 4MB4A 5AVHA 4JIQA 2E3TA 1QO5A 1H1YA 2Z1KA 5TF0A 3VKCA 3WO8A 1SM9A 3VGEA 5ABEA 3LRKA 4CQDA 3W2JA 2G3NA 1XLHA 3L8KA 3LX9A 1PZ0A 4ICCX 3H7RA 1BYCA 4Q33A 4NAFA 3VVGA 4LNYA 5BYWA 1W1PA 2DW6A 1N60C 4B5NA 3V16A 2ZYFA 5CPMA 1R3TA 1VYRA 1VPQA 4QTGA 1I1WA 1V6UA 3NZPA 4RJEA 1OADA 4AMAA 5D03A 3UG3A 4JYFA 1U2YA 2DW7A 2WVUA 1JQXA 3BJFA 4P7LA 5JH2A 2P0OA 1RAKA 3MI3A 4CLMA 2ZTKA 1UW9A 2UWFA 3CUJA 2OSXA 3WEMA 3TW9A 3AICA 3Q65A 3Q6JA 3IGSA 4US5A 1RK6A 3MO7A 1EA0A 2Q8LA 1S2WA 1S5VA 2D0FA 2VC5A 3WLLA 4PODA 3P7YA 1DTUA 1QNVA 1JRPA 3OTRA 2HK1A 4YVPA 3E74A 3L21A 1UMYA 2DJLA 1CX9A 4NNAA 5LGZA 4JQ3A 4HU4A 4FR6A 3SCSA 1X6UA 3WDQA 4WQ6A 3PPFA 5CSSA 4GUJA 4EANA 2FIQA 3WL1A 4XD3A 2F61A 1VENA 4UFKA 1SGJA 4LALA 4AH7A 2PDKA 2B0MA 4M19A 1GEHA 2HSAA 1MMFA 3UZWA 2CZVA 3M07A 2VQUA 3F5KA 3QMSA 3VGDA 4JAWA 2J24A 5CGTA 5DFAA 1K70A 5D2TA 3D0CA 3KVMA 3P5ZA 3PF3A 4UTLA 3MJMA 1WYIA 5A95A 2X50A 4H7VA 4ZSTA 1D7FA 2YDRA 3G22A 2B4GA 5HAOA 4A2SA 3CGEA 3RNMA 3S1UA 1V3LA 2GR1A 4M81A 5F2LA 5K9XA 3VKKA 2PDUA 4AX7A 3SQLA 3BH4A 5H8UA 1H4PA 3LHZA 3GO2A 4JX5A 3WENA 5C2GA 3GKAA 4GVIA 2G0WA 3UT0A 4KETA 3NQ6A 4ZOEA 2XU2A 3C8FA 3SCNA 2E3ZA 4WSKA 3EWZA 4JX6A 4CN1A 2JF7A 1OINA 1W6TA 3MP3A 1LUCA 1CZ1A 3BG9A 4R5EA 2GVGA 4DBDA 4GG9A 3LM3A 1TTPA 3QQ1A 4QE1A 2X2GA 2ZZCA 3B9DA 3QZ6A 1TWZA 1CLXA 1VD6A 2YB4A 5H91A 2BC1A 4JTHA 1XFCA 1KR1A 5FJIA 4TVUA 4Q7IA 2QV4A 2OO6A 1E1EA 5K2ZA 1XLLA 3ENLA 2QJMA 1MUCA 2A3CA 2XFWA 3D3AA 3TNBA 1KQZA 1DJZA 3PZIA 4MMWA 1ZCOA 4IIGA 4NEVA 4XZBA 1WUFA 5REQB 4AVOA 4MZ1A 5CAKA 5U25A 5EFFA 4LF2A 3S3GA 1ZL1A 2EQ9A 4D2JA 4S23A 1FEAA 2CXGA 4Y9PA 3PZOA 4AD3A 5ABGA 2QCDB 3A5FA 3NSXA 3FHQA 2A8XA 4UZUA 3GW3A 1N5XA 2QKFA 3BGGA 4DNAA 2HVOA 1XH0A 2X0HA 3HG2A 4EXBA 2RDTA 3CAWA 3WNKA 3BE7A 1FBAA 2QJGA 2IS7A 4EKJA 2V2DA 2O56A 3VIJA 3GKFA 2ISWA 5GJNA 2NUYA 3HPAA 5JH1A 2QT3A 4MJMA 3NO1A 1HKMA 4UTTC 3PBGA 5LSMA 3G0UA 1AH0A 1F61A 2OQYA 3RX4A 3S83A 1Q66A 4CNNA 3U6WA 2BHZA 1WV2A 1TPUA 2YCKX 4JBRA 3L2MA 4OUIA 4HT3A 3P2VA 5CPLA 1ZP4A 2NWRA 3SUUA 1C7TA 3UW6A 1ALDA 1SW0A 4EXAA 4ZXLA 3URHA 1A5NC 1JF5A 4HCHA 2DSUA 4IH3A 1NFGA 1UUMA 2FTYA 5CGMA 5I07A 1IXQA 3FG2P 4JGDA 3GBEA 3RLGA 1YIXA 2C13A 1CPUA 1PDYA 1I2NA 2VR2A 4X0NA 1V51A 4LB4A 1IE7C 2QCFA 1X97A 1GOXA 1EUNA 3B8WA 4FDCB 2ZZ3A 4JFVA 2WBKA 1JCTA 2DJXA 4ATDA 1BLIA 1U30A 2FZMA 2QMKA 3RCYA 2GVLA 4XBJA 1YQZA 1QAPA 4PMJA 3VNMA 1GK8A 1KCXA 4XZLX 2OMAA 3PSWA 2V82A 3W7LA 3N13A 3BDKA 3RGTA 4R88A 3RPMA 2E0PA 4AD4A 2OODA 3W6MA 3MA8A 1NAL1 4DNHA 4MKSA 1Q6OA 4FZIA 4EQSA 3RRAA 5LNUA 4S2CA 4JQ4A 4WRHA 3Q45A 1B1YA 1FECA 3N2XA 3VDGA 5DF0A 3WLQA 4DJED 1BVZA 1GOIA 3M4HA 1MYRA 2IPWA 4CD7A 4IPIA 1NF7A 3MO4A 1N2VA 4HHHA 4HNCA 1W54A 4DO6A 1XLBA 1T8QA 2KX9A 1X8FA 1R2RA 2Z2BA 1GQKA 2Y5JA 1EEXA 2Q71A 3CEUA 3FGCA 1OFAA 5AHIA 3WYZA 3QLLA 4B9ZA 3HV9A 3W7RA 3BAKA 3ARYA 1FP9A 3CH0A 2V2HA 1IT7A 2Z1WA 3MVTA 3VOCA 3WFLA 1SU5A 3BL3A 4L64A 2X8CA 3TCEA 1CXFA 2E9LA 2JGYA 1FWNA 4AF0B 4DJFC 4NY2A 3DBNA 3M1ZA 5JCMA 4GZIA 3HFYA 5M2FX 1QW8A 1BWCA 1X6LA 5JXQA 3HMCA 1S1PA 2GUUA 4UCFA 3HIJA 1OZMA 1S5NA 3ABXA 2FB3A 3LCXA 4BF9A 2OOGA 1E71M 3BJSA 2E9BA 1VLIA 2FJUB 1XQLA 3T2OA 3IPWA 1CIUA 2VX4A 2EQ7A 1GORA 3D9XA 1H60A 5FEZA 1VKFA 3QR0A 3KVLA 1K6WA 1CGTA 3FFSA 3AS3A 3TYUA 5FJRA 2VZTA 3O05A 3CMJA 4PUNA 3KOFA 1G69A 1S3HA 2X7WA 4HKPA 2CLOA 1RK5A 3ZJKA 3CV2A 2ZKMX 4M6QA 8XIAA 4PTWA 4WZHA 3UCDA 3IS4A 3EOSA 3DFTA 3R13A 4LRTA 3DIPA 2GJRA 3UJ2A 5MKGB 1WYGA 4ACZA 3E02A 3M41A 2ZUWA 4CUCA 1XD1A 3M0JA 4OJYA 2GSEA 1LT7A 3PWGA 1GYMA 3WMCA 2WANA 1W5PA 1QVBA 3B9NA 1K7EA 3M0MA 1W1ZA 3S9IA 4LAOA 1HJUA 2EAWA 3BPWA 2WMGA 4KWWA 3ZJ6A 4XZIA 5CPOA 4HOWA 3EDDA 2BBFA 4B16A 3O8AA 1QU4A 1MI3A 2RDUA 3W7EA 2QF8A 2O9TA 1AFSA 4H6RA 1QJWA 2ACQA 5MF5A 2I17A 1QWGA 2QUTA 2V5KA 4GMEA 2QCLA 2QUMA 2PD5A 3NQMA 5E6ZA 3RCNA 1IZCA 3N04A 3BCJA 3VKDA 2FPVA 3V5OA 4NRSA 2OGJA 2RDXA 3CK5A 3LV5A 5D8WA 1P0EA 3VIFA 1FQ0A 1K4HA 2ZUUA 4H01A 2AQWA 1OK4A 3VIHA 3G1YA 4IWWA 2WMHA 1A5OC 1GEQA 4IGMA 4Y7EA 3N6JA 1POKA 3FV9A 2EPKX 1TVPA 3RCMA 1RPXA 2JQXA 3G24A 1DE5A 3PUEA 4K3ZA 4M29A 1OB0A 2QAFA 1XFBA 3MQTA 2OXNA 1QI4A 1QOPA 5CGQA 1B3ZA 3LTYA 3TMLA 4GC3A 3AIWA 3GAYA 4DUWA 5HMFA 3SW6A 2J7BA 2YCLB 4AIOA 2EHHA 2BVYA 2OJPA 2IKIA 3E49A 3LQGA 2DZSA 3O63A 4Q8OA 3LY0A 4IIDA 1WKEA 1OHLA 3L5AA 4ATWA 4Z17A 3HPXA 5HMSA 1A3XA 2BOFX 4H4WA 1LJYA 4H4TA 5TR3A 1XLJA 2PBGA 1NHQA 3IANA 3AQUA 1EDTA 4W86A 4PMXA 1Q6QA 1ZZMA 3DJJA 1NHSA 1P4CA 1Z8AA 3L4TA 4H4PA 5FJJA 4U2ZA 3U2OA 4NUWA 4ZMGA 1F6YA 2XH7A 1LG1A 1I1XA 4LUTB 3TONA 1AW5A 2XINA 1Q4NX 4H50A 5J04A 3NQ7A 4HPHA 1M01A 3AU2A 3AFBA 4GI6A 5LGXA 2WLZA 2E09A 1CGVA 3THUA 1T41A 3WN6A 1OEPA 3RX3A 2JGQA 1K8YA 3NQGA 1WBHA 1CI1A 3VGFA 5IDIA 1FY6A 4QSFA 4XVEA 1M6JA 3TJ4A 1UPPA 3UF9A 3UCCA 4E2DA 5FAJA 2PWDA 3W7GA 2W66A 3WF3A 1AJ0A 1A5KC 4BA0A 1R8LA 4R53A 4ZQRA 3IWPA 1UD4A 4TO8A 2PF0A 3UWYA 3MU7A 4QFUA 3P6LA 3PBUA 1LLWA 2DIJA 2FGLA 5E0CA 4U3CA 4PCSA 4I3GA 3VKBA 4JTAA 1MEWA 1EPXA 1TQJA 1EFZA 2B31A 4PBEA 1QPNA 3S2CA 4UC5A 5HJLA 3NVZB 3QTPA 1J01A 3APYA 1F5ZA 1VFHA 5A69A 2YQUA 1S38A 4UIOA 5KZEA 1KCZA 2NXIA 2O9OA 4CU6A 1H5YA 2VEGA 2GVYA 4GK8A 1T96A 2VX6A 3RFAA 2XHYA 4RCXA 3WNLA 1W9DM 4RV8A 1NOWA 3LCIA 3STGA 1ZY9A 1BXCA 1R9YA 5AZ1A 5KVHA 1DL3A 1CEOA 4GC4A 3NG3A 3VPLA 1WAWA 5HJYA 3EBVA 3W2KA 5HQMA 1WNOA 1YE4A 1DNCA 2E6AA 3WBAA 2BDQA 1XLAA 5DRCA 3WQCA 4HPJA 1V6VA 3C61A 5DXYA 4G56A 3JS3A 3CQ0A 3LSCA 3DI0A 4TMCA 4NAEA 3MJYA 3CHEA 3T0BA 1EBGA 1BG4A 1OT1A 2GJXA 4GIAA 3MV01 2OPJA 3ZVHA 3L4UA 2FVLA 1FWAC 4O1DA 2JKEA 3W86A 4LW7A 2WW5A 4RE3A 4QHRA 1GVOA 4XD6A 1XJBA 4C6MA 4I90A 1M65A 2GQ8A 1XBZA 1T99A 3AXMA 3WQOA 2VX5A 4XD5A 4HSOA 1ZK7A 1WKFA 1TMLA 3CL8A 3GXTA 1BGGA 3WQ6A 4HSHA 1RSCA 4WDUA 4US5D 3E9AA 4L4PA 1ISWA 1ZAHA 2E4TA 1PKNA 3QV7A 2W0UA 5LHEA 3LSBA 4OE7A 1T6MA 4QG9A 4O8RA 1K7FA 2V5DA 4NAFB 5CSUA 3EKLA 3BW2A 4MPKA 2QJNA 3THAA 4FR1A 3IJQA 5EBUA 1D7YA 1P0BA 5HWMA 4AC1X 2IW0A 3ID7A 4BWLA 2YXGA 3LMYA 3BAJA 3RUBL 3KOWA 4WVXA 4LAMA 3ECQA 4IIHA 4ILSA 2HWGA 3VD9A 3VKJA 2ATSA 1JZ4A 4QROA 2WV8A 2OEKA 2PDPA 1V02E 1H0GA 5AHMA 1NH6A 2WCAA 3CIXA 1UJQA 3W85A 1RJRA 4IP5A 2YA2A 3THCA 3FY1A 3PN8A 1US2A 3AM9A 3A4JA 2X16A 1P0KA 2VC9A 3F4VA 3AIQA 1XUUA 3GVGA 4H8NA 1AD1A 3F5JA 2EJ1A 3V0UA 3W53A 1GZ1A 3NZ1A 3PZ9A 4GH3A 1TJ1A 3MP5A 5CC3A 1OFRA 1Z42A 1TPVA 2ZUTA 3ZS4A 2JBMA 5AYBA 4KCUA 3NOEA 4XIMA 2ZZ1A 3R2GA 4IQEA 5E5CA 5CG7A 2ZRYA 2PZNA 3NUKA 1XLCA 4HNNA 4DZ5A 1EKOA 1QNRA 4QCFA 1HL9A 1J0KA 5A5WA 2Z6JA 4FX9A 4HN8A 4IJBA 4Q4QA 2WC3A 1F76A 1X6NA 2YX0A 3A4XA 3RLVA 1XLKA 5D9OA 5H6HA 2BMBA 5K4XA 1ZP3A 3CH9A 2X41A 1IEQA 2G3JA 5F7UA 3UA4A 4L4LA 2SFPA 3R8RA 1H7RA 2BY0A 1S7MA 4W93A 5CC6A 4JNYA 2IKGA 1D8WA 4ZB5A 4N9EA 5HPCA 4F0HA 2AMGA 1PUDA 2I5GA 1AK5A 4K39A 1YDYA 1SZRA 4W8BA 2YJQA 1R7OA 4I7VA 1LUCB 3QOMA 2EO7A 4UQBA 2GZXA 1D3CA 3FNDA 3LPFA 4US6A 4FO4A 1IXPA 4P7RA 2WOWA 3ITVA 4LYQA 4GRTA 3A4WA 1AZ2A 3BLPX 4Q4MA 2WO5A 2I9UA 2R24A 5ABTA 1XDJA 1NSJA 1WOAA 3DC8A 1XH1A 4WR3A 2MNRA 3CTLA 1HO1A 2PTZA 1WCGA 5A6AA 3DHPA 3UVAA 1C8YA 1UBPC 3UXIA 3LTPA 4HK6A 4UB9A 3I68A 4A8NA 3TYAA 1BF6A 3CWOX 4HZ7A 2IPJA 1UKSA 8CGTA 5I5RA 4AWEA 1FWRA 5A2BA 1H6VA 4RK8A 3S2LA 2WQPA 4W84A 3KWXA 5I79A 4X9YA 3TCSA 1ZBCA 2JK2A 1ONRA 3N4EA 1XCWA 1NFBA 4LVDA 2PRLA 1JPMA 1P7TB 4E0CA 3MSGA 3L5MA 4XKYB 3WDJA 1XSJA 2WKJA 4GISA 4AB4A 2G5WA 3Q67A 4RNIA 3PZVA 4WY0A 5A6BA 1DOSA 1HF6A 2VO5A 5I06A 1PS9A 2VRJA 2O55A 4L5ZA 3TN5A 5HWNA 3W01A 4JKMA 2Y7DA 1L2QA 3TYDA 4RW3A 4HMEA 7TAAA 1VCGA 3DFQA 4AD5A 4AZGA 3VC6A 1ITCA 1R38A 3G8RA 4Y8EA 2YSWA 4C6FA 3WF4A 3AHVA 4ZOCA 1VH7A 4DB7A 2V38A 2AL2B 1XUZA 3IACA 2V6OA 1UR4A 2YL9A 1UR0A 1SW3A 3HQ1A 1AUSL 4XAPA 1R3QA 3BAYA 1C7SA 1Q2RA 5HQEA 1QI5A 1DE6A 2UY2A 4JHOA 4LVAA 5DMNA 4UTHA 2DQXA 5FL0A 1J0YA 3MW7A 1F3WA 2I14A 2YXOA 1E9IA 1Q8AA 2G97A 3R0KA 4IX0A 3AIRA 3M0YA 2QIIA 3Q58A 3ABOA 3STEA 2EQ6A 2XN2A 4ZA0A 2J27A 2GJNA 9CGTA 5CSRA 5C9XA 5JCLA 2WOIA 2ZXBA 3EAOA 1XPYA 3WLMA 4U3AA 2DSKA 1TWWA 4GABA 4V33A 1QT1A 1W3NA 3WH8A 1Z6KA 2C6QA 3WMLA 2Q02A 4YJ5A 1RQBA 4GI9A 1EH9A 2QS8A 4LTSA 3PJTA 3APGA 1SSDA 3EKZA 1GJPA 1TFVA 3R1ZA 3KXQA 1Y5VA 3VD4A 1HW6A 1Q85A 2C16A 2F2KA 1E9YB 4IT1A 4C6IA 2ZC1A 3MYOA 3HG4A 1C93A 3T2QA 5FOOA 4F3HA 3CHVA 1PX3A 2PDWA 2GDQA 4A3QA 3ISIX 3KZPA 5FIPA 4B5TA 5RUBA 1I8JA 1IZKA 2Q8ZA 4GBUA 5AFDA 3ZZ1A 2B7OA 3F2DA 4JIRA 2V9DA 3I10A 2HBXA 1S2CA 1EP3A 1DJHA 4UMBA 3W22A 5L9FA 1WBJA 4GNJA 4TTUA 4YLWA 3G1HA 5KMYA 4KKXA 1NDVA 3FGCB 3V4BA 3NOYA 5HUOA 2JE8A 4LVGA 5IHSA 1SW7A 3VINA 3A7AA 4GQQA 1DORA 3DXIA 3L23A 3H53A 3QEZA 3P84A 4R9XA 3CUXA 3VCNA 3VD7A 3FN9A 3MKVA 3AMCA 3MUCA 3W29A 1XDMA 4GGHA 3IJ7A 4UTTA 1BXNA 3U5UA 3PAJA 4Y8FA 4IQLA 3DFNA 3UQNA 3LHUA 4GY7A 4NYUA 1EXBA 3ZWSA 2B81A 4KIEA 3WELA 2F6XA 5I3IA 1FVPA 1K6AA 3IGXA 2GGIA 2XSBA 1TIWA 1OSEA 1UP0A 3QPEA 4RNJA 1EQCA 2Z24A 2ISSA 3B05A 2B7NA 4HPNA 4H9ZA 4E6MA 4LXFA 5D33A 3VILA 5G4HC 1WA3A 3TMQA 4QDMA 3GLCA 1LZOA 3D46A 5SWUA 4MWAD 1H11A 3GYCA 4PB3A 5F2IA 4ACZB 5CAHA 4PTDA 3HV8A 1Q6DA 4NXSA 3VIKA 3P5YA 4H6KA 3HMJG 1GW9A 3LD5A 1L6WA 3T08A 4NZJA 1UPMB 3W38A 1MOKA 2E5BA 2R1NA 3MUIA 2ZUVA 1OFDA 3H12A 3CTTA 1KTBA 4K37A 3W26A 3KP0A 2FHBA 4KRZA 1MUMA 3MDUA 4DWSD 1CW2A 4GVFA 5M17A 4CD8A 1N8WA 3M47A 1GTEA 4J3SA 3L2LA 2XGBA 3BAWA 2WBGA 1XYCA 1FOBA 1W9BM 3N19B 5GNYA 2J75A 2INEA 3WJXA 1E6PA 1RZMA 4ZO7A 2V3DA 2BVWA 4BURA 3TZFA 2H9AA 1TV4A 2X8GA 3WDPP 4MWAB 4EM4A 1NQ6A 1J11A 4JX4A 4QITA 4QXIA 1FHVA 1QWKA 5TQLA 2ZZ5A 4J3XA 3SI9A 2ZZ7A 1YMYA 3GR7A 2F9RA 4LY8A 3R07C 3H22A 3QPYA 3I6RA 2E67A 2J6VA 3FW6A 2WHMA 3IIOA 3NEVA 1V3HA 4DWSB 3PUOA 4HYRA 1OFBA 4AG0A 2XWDA 3E96A 1FWCC 4KS0A 4QG8A 2A85A 1YXYA 2ZTJA 4A3RA 2J7HA 3LNPA 3AIUA 2ZWYA 3QF0A 3N11A 4ADUA 4FOUA 1MQQA 2UY3A 4DJFA 2XSXA 3GRTA 1KB3A 3II4A 4JTGA 1SZGA 2V3FA 5FMHA 3T6CA 2VX7A 3SDOA 5A3HA 2CBUA 2VQTA 1V02A 1TR1A 3HN3A 4KERA 3WSUA 3QGVA 4C7FA 4HPGA 3VC5A 1KXHA 3WIJA 1O95A 2BGSA 4C6EA 1TMQA 3UXLA 4I5XA 1XW8A 5LXEA 3IJDA 3L4ZA 3SGUA 3QTGA 4JY8A 3R43A 4LBSA 1JZ6A 1EOMA 4YVXA 3CLMA 3MS8A 3WLRA 2PDHA 2TMDA 4HYWA 2HDJA 3ARVA 2ZRWA 2OELA 4MF4A 4MB5A 2OWXA 1YNPA 4L1WA 4GIYA 5CZTA 4B15A 3S8HA 3GFXA 3NYZA 2HVNA 1W3TA 3O6CA 4C7DA 1EWEA 4BQ3A 3DN5A 5GRTA 1P6WA 2DORA 4PFMA 3TA9A 4Q32A 3E0IA 1K3UA 1K4QA 2WHKA 4AD1A 3P62A 2HEJA 3F7JA 2QLYA 3L67A 2REQB 3UJSA 1CGUA 1POJA 1EYEA 4TV5A 4XUYA 3WLKX 4FSAA 1JDEA 2HMCA 1F05A 2J8TA 2RKXA 3CO4A 2DH3A 2O9PA 4PMQA 1ICSA 4IJRA 5M5DA 4R7OA 4LCRA 4NJKA 3P61A 1SO4A 3VE7A 4PFHA 1JUBA 3SEPA 1TPEA 3ATYA 4XB3A 2PS2A 4H6QA 4AIUA 1FCUA 2BWGA 2HTMA 4DVOA 1A0EA 4GI4A 2GGHA 1R3SA 5DMMA 1A5UA 2XIJA 5E0FA 2OLAA 1XP3A 2X40A 3ES7A 4GXMA 3B3DA 4PZVA 3F4CA 4B9YA 2V3AA 4U2YA 4BI5A 3N6HA 1MNZA 1NTHA 3IV3A 2D3NA 3CPGA 2E5CA 3DK9A 2GQWA 1BQCA 1NEYA 3KTSA 2BOEX 1AA1B 3TC3A 4EMIA 5KEZA 4KFPA 4J56A 3BAXA 3W71A 5CPSA 2VZOA 4KPRA 4I7WA 3K13A 5HQLA 1TMHA 3MVIA 2PODA 4O28A 3RJXA 4NNBA 1RLDA 1B0IA 1WDSA 3K30A 2AKMA 1AZ1A 4NIRA 3W6LA 3T8QA 1GV4A 1GJUA 1IHIA 4KEUA 5A2AA 4W87A 1R0MA 1SMAA 4FLOA 1G7VA 3PPCA 2O4QA 4OU1A 5HATA 4ZQOA 2E6FA 5KINA 1AQMA 2PU0A 3W70A 4DXKA 4ECLA 2W62A 3AAMA 4LV9A 4NAEB 1Q6EA 4QJ3B 3ZT6A 2O9RA 4JD4A 3ZVHB 4YPJA 2YW4A 2C1IA 4QJ1A 1G4SA 4Z0JA 2OQLA 2OU4A 1N8IA 1QMLA 4PUKA 5BMXA 3PANA 1J96A 4K8HA 4AD2A 3MYPA 1M5WA 4Q6JA 3S9ZA 4DUOA 1H5VA 3B8IA 4PCPA 1BRLB 4HZMA 1PKLA 1FUYA 5E9XA 4A21A 3KL5A 3K4DA 3GW0A 3MHUA 3R12A 4MTVA 4O11A 2V5CA 1UP2A 3UWWA 1JUKA 4LFYA 3W28A 3GB6A 1A5MC 4H04A 1Q2SA 1OJXA 5CPTA 3EOOA 3URNA 2W27A 1Q3NA 4M24A 4AZ7A 4Y96A 1JCXA 4JTCA 1V3MA 4P8UA 3BO9A 4ROPA 4NZCA 2TYSA 1HKVA 1M04A 2PGWA 3AOFA 3WLOA 2QNEA 1JIBA 1MXGA 3TEVA 3U57A 1B90A 1VQTA 4WY0F 2A3BA 1QOQA 3WD1A 2R9RA 2G96A 4K1WA 3N12A 3KX6A 5HNRA 5D9NA 1M03A 5EA9A 5D09A 1A5CA 1X8CA 5DN1A 3SRFA 3CZGA 3P82A 1VLWA 2X99A 4LIIA 4HMCA 3RPDA 3LXDA 3LZ3A 2VL4A 1KFLA 1VFLA 2EBNA 3TAKA 3WH7A 7PTDA 5TBOA 1EGMA 3JR2A 3BC9A 2YFOA 3DG6A 4Z2IA 5K9CA 4CNUA 3G3DA 3I65A 1E5JA 3EDKA 3KBJA 4LOCA 2Y70A 3W7MA 5IDZA 4LSBA 4PYSA 2HZGA 1OF6A 3DYOA 4H4UA 3OHIA 2WMKA 4BS0A 1Z41A 3GH5A 1TYPA 2PTWA 4LUSA 3W07A 4JTKA 4J3WA 2PPGA 3BOFA 3MZ2A 1Y7VA 4DM1A 3BLLA 2PDJA 1DEDA 3DFPA 5I0DA 1VFSA 3IV8A 2OX1A 1M7XA 3GHRA 2A3LA 3E0FA 1PIFA 2A7RA 1GVQA 4O1AA 4QAWA 2G50A 2W63A 3CPUA 3Q94A 1ESWA 3MMUA 4J1OA 3L65A 3SIMA 1W1VA 3T42A 3ARRA 1FHLA 3TZNA 4JPGA 1Q5MA 1I75A 3P81A 2WHLA 4FA3A 3AYVA 4EWJA 1AL8A 5A8MA 1NDAA 4RXFA 1LQAA 1B5TA 4AWUA 1XV8A 3W37A 2VFDA 3B40A 4GJJA 1PWMA 3WD2A 2J74A 3N1AA 4EE9A 2VCBA 2C91A 1Q45A 3DI1A 1TPFA 2ANUA 3S6DA 4A3YA 3WLIA 1UBSA 1MXDA 2HCVA 1KM5A 3EX3A 1REQA 3TQ0A 1AQ0A 5HK4A 3P0XA 4M51A 2DIKA 4LUYA 4TR9A 1KO0A 4DBUA 2H3DA 1ISYA 3QGKC 4KWSA 3N2MA 4BEUA 1OFOA 4ZL1A 3OLDA 3ZLGA 5E93A 5JUVA 3S1VA 3A9BA 1X98A 2R1MA 4YTTA 1ZKQA 4CD6A 1WO2A 4Z1YA 1K9DA 3SURA 1OYCA 3G2GA 4OQVA 1ELSA 4V2XA 4WGHA 3URBA 1MDRA 2PDXA 4FI4A 2XTKA 5HMDA 3WBEA 3AHZA 3CU2A 4YTUA 3H7UA 2PRHA 2ZZ4A 5D2XA 2W3SA 5F4WA 4MGGA 3L66A 1IWBA 2P8CA 4ENLA 1X2HA 2VGIA 2VWSA 5H8MA 4JN7A 1EO5A 3IAPA 1OGGA 4QR6A 1F74A 5AHLA 2OZ3A 6ALDA 4FIRA 2AAAA 4WY0B 2E8ZA 3UGVA 1RD6A 2YVFA 1BKSA 3LCHA 1W3HA 1GCYA 3FYYA 3NL5A 5LNSA 2ATMA 1XDLA 2WJFA 1V08A 1ISZA 4POCA 2A7PA 1OG0A 1JCYA 3IEBA 4ICNA 3STPA 4NRRA 4Y9AA 4EMJA 4DYKA 3WG6A 2ZZBA 1TV8A 1P0NA 4XAGA 1E51A 2D0HA 3ARZA 4DLFA 2FGBA 3TTOA 4DM2A 2QHAA 1LLZA 5I23A 1J10A 3LI0A 3VNIA 5HULA 3HOJA 2VDHA 3SZ8A 1QPKA 3W3OA 4NJJA 3STCA 4Q8PA 4PTMA 3AI0A 4GLEA 1NWRA 4UFIA 1HGYA 4UFMA 2HVMA 3PR2A 1MNSA 4M1BA 1H2JA 4JTDA 1XLGA 4JTQA 4AIEA 1W8SA 2C0AA 4DF0A 3T4CA 3C0LA 3TYZA 4HB7A 3U2ZA 4MYXA 1I6NA 4HVXA 1V6WA 2VR5A 1EL3A 2YZ5A 3OLGA 3H4GA 4KCWA 1E4NA 2PWVA 2KZHA 1UZ1A 1UKOA 2WPGA 4HN4A 2WVTA 3WLJA 2E5DA 3CT2A 3DKLA 4YTQA 4L4OA 1E3ZA 1EC9A 4EK7A 4JICA 1N5WC 2CKRA 4LNCA 1JEHA 1UWQA 1E0TA 5D04C 4MFDA 3T55A 4F2TA 3S0CA 5KITA 3OA5A 1PL9A 1TZ7A 4HTYA 1L0PA 1XYFA 5CZJA 2I56A 4HGXA 3G3MA 3ME3A 3S4TA 1DJNA 3BCDA 3GH7A 3PNZA 4H19A 3ZOAA 4GO8A 1HKWA 1O4UA 4HCDA 2AKZA 4JEQA 3M7SA 8TIMA 1U5HA 5T91A 2X8RA 1MEHA 1TYGA 3DU0A 1R46A 2F38A 1XLDA 5A6JA 4DRSA 2W79A 3L4VA 4IX2A 3AHYA 3LGGA 1OCQA 1PTDA 4JHZA 4B5SA 2A2IA 2GJPA 1PXGA 5C71A 3TW7A 4JIPA 4IL0A 4WK9A 4S3FA 3TC7A 2GSJA 3DYMA 3PTKA 2A5HA 3RK8A 5DCDA 1UIPA 2NW0A 4YVVA 2YL8A 1WXZA 3NIYA 4NZ3A 5FF2A 1E73M 3EB2A 1K8ZA 4DXVA 3BARA 2J9ZA 4M7SA 1G4PA 2RGLA 4UNIA 3W2NA 2QCCA 3GK0A 4Y9MA 3UR5A 2XIQA 3OBAA 4L1XA 4AYGA 2OB3A 1ZQ5A 3VOFA 4GKLA 4LCSA 2Y1HA 5BOOA 5EYWA 2AAMA 2XFRA 4IG2B 5B7ZA 1VFMA 1Z9AA 3P60A 5GVJA 3B0XA 3CEPA 2PWGA 2QMJA 2JK6A 4G5DA 1QUMA 4R7WA 1V6TA 1RV8A 1NOFA 2PURA 3KS5A 1KRAC 5GJMA 1TWSA 3RLUA 5HWJA 3VDBA 4KESA 3BURA 1UD2A 4GACA 3T4WA 1TVNA 3U4FA 9XIAA 2A4AA 3SR7A 1SMDA 2WZEA 3B03A 3WQEA 4KWVA 2F84A 1SJBA 3W9ZA 4TQTA 1M9HA 3E1F1 1R9ZA 4LC6A 3UZXA 2QQ6A 5E09A 2I5QA 3B9JB 1AW2A 4XV0A 4A2RA 3V5CA 3KLKA 3TNOA 1PX4A 3H26A 1AL7A 1OYAA 2GOKA 3P74A 1PZ3A 1VYSX 1DJIA 4ZO9A 3NVVB 3MB9A 2HJPA 2NV2A 3A4AA 3GQYA 2XGZA 1H2IA 5AECA 1KXTA 3ITCA 3SY1A 3KOZA 3N14A 3I4EA 4O8AA 4B5XA 3TTEA 1P1XA 2DUZA 4OUEA 4ZBCA 3JUGA 3HF3A 1TIMA 3OIXA 3QMTA 2H6RA 4DJFD 4ZE4A 1JD7A 2YA0A 1VFUA 5F4SA 2CBJA 5LYRA 2VC6A 2VZSA 2W4XA 3PG6A 3FJ4A 2HROA 4R34A 3CZ8A 4WD0A 4LYRA 3EMZA 5BXRA 2GDUA 3ZXWA 1QK0A 2W54A 2YYTA 2CLHA 3SQMA 4MIMA 1UH2A 3DECA 2AMXA 2C79A 1EIBA 4GYJA 4GZJA 3V5FA 3NRZB 3RLHA 4IXHA 3ZYZA 2EQDA 2JKAA 2C1HA 4KEZA 4GCXA 3M0VA 2ZZ0A 1UP3A 2BHYA 3GU1A 3TA6A 2OYMA 5FD0A 2WMJA 2J7GA 4LQ1A 3N4AA 1ZRQA 5GPRA 3UYIA 2C1GA 3VU2A 4N02A 3UGRA 4NQ1A 1R86A 3CUZA 3GHSA 3NAVA 1AH4A 2NUXA 4IMAA 1F3TA 3IGHX 5BWFA 4HJWA 1J93A 2WPFA 4LGXA 3GD4A 1NFPA 2VENA 2BB0A 1KBBA 3BK0A 1XRFA 3B0YA 4JYEA 4D6HA 3QZEA 1GJWA 3G18A 4CNTA 5FEPA 4H41A 4U4MA 3VOGA 3FCPA 3GXDA 2F7FA 3H2AA 3UD6A 3SY8A 1NQKA 2E1WA 1W31A 1DIEA 1R47A 4Z1BA 2HE8A 4S39A 2ZIDA 3TYEA 3TTSA 4TVWA 3UU0A 1DWAM 4DZIA 1HT6A 2YDAA 2VEPA 2BCPA 1FKXA 5CLWA 3CXOA 2V67A 4AAJA 3B8SA 4C5YA 3WLTA 1BWVA 1KLYA 4LX4A 1ONWA 2G3IA 5BRBA 5IBXC 2QV5A 1KM3A 3NQAA 4S3EA 3W75A 4EF9A 3BAIA 2X1UA 2QAEA 4MZ8A 2FHFA 2WNNA 2FMNA 1MQRA 2OT0A 1HJQA 4TIMA 4AF0A 1BVWA 4N42A 2QGHA 3STFA 1EZ2A 4C5ZA 7ODCA 3NQEA 4IP4A 3MY9A 3OPSA 1EJTC 4OT7A 4GXPA 4OBSA 2J7FA 2DSVA 3O6DA 3A23A 1WDQA 1R87A 1CXLA 2A7NA 5J5RA 4C65A 3EWYA 3H7VA 3N34A 1UD6A 2XFFA 4EQWA 1FA2A 3BLOA 5HPOA 3AIEA 4OIFA 1LOLA 2BP1A 3BLEA 4O54A 3KLLA 3KOXA 4XO7A 3F4NA 3NA8A 3W1LA 4AQLA 3NDZA 3EMQA 1EIXA 2NQHA 2OZ8A 2DT1A 3HGOA 3WH5A 1T40A 2ZWZA 2J7EA 4MNMA 3B0VC 1BQGA 5DT5A 3GXIA 3LNMA 3CNYA 2OQHA 1PKYA 2EPHA 2VOMA 1DWJM 5G4EA 2BX7A 1QBAA 1OWQA 5BRQA 4KIRA 1GONA 1ZB5A 3OVGA 1FFQA 2W92A 1STZA 2GGJA 2GPTA 3MMDA 5KETA 5LIUX 4Q6XA 4UR8A 4AY8A 1CWYA 2O7QA 4D6GA 5CSYA 3DERA 1ZJBA 1HJVA 4PL1A 5HDRA 1TE1A 1H7PA 4TTGA 4DJEC 1SFLA 1EA9C 2XGIA 5A6KA 2PA6A 2NZLA 3L4XA 3W82A 3GXPA 1TE6A 2XM2A 1RVGA 4C60A 3M44A 1OCNA 3WNOA 1UR9A 3UG4A 1BWKA 1KM2A 4F48A 1ZALA 2QDHA 2FB2A 3ORWA 3GVRA 4B90A 3IJIA 3GXNA 4JS3A 2GYIA 1TJ0A 3CWNA 1W2VA 4S3GA 1SZEA 3C5QA 4ZO6A 3LHYA 1OG6A 1UMLA 3PTQA 4HA0A 3S42A 4ZO8A 3V1HA 4HZ8A 1QI0A 3SB0A 4MSSA 2PMQA 1S2AA 4I6KA 4NJGA 3CB8A 2CETA 5EBKA 1H51A 3GUWA 4CNOA 4OECA 3RRXA 3WNMA 3G1RA 2WBAA 4E2BA 4PMNA 4XVDA 2PDFA 3GC2A 4D1JA 4WKFA 5A8QA 2ZBTA 2YCLA 4GYPC 1P43A 4Z2LA 3G77A 2RGMA 1W3JA 1DWFM 3QV8A 1N8FA 3AIBA 4QSHA 2DT2A 3LRLA 1YQ2A 1LOSA 3QQWA 5I00A 3KBSA 4J7RA 4C7GA 4NZ5A 1PJ9A 4C1KA 3M43A 2P10A 6XIAA 3WD3A 4H4XA 2FPYA 4J27A 1S1RA 2BS9A 2VM8A 3L4YA 5C9ZA 2D0GA 2E77A 4XAYA 4GH1A 4QBXA 3V36A 3PP7A 5IFTA 3O07A 1DJGA 3FSTA 4GQ0A 4I9JA 4IM4A 1J0JA 1M7JA 4LAUA 4DELA 1YDNA 4DAFA 3HA1A 5A94A 1GYNA 2Y7GA 3CUFA 1XLFA 3KTCA 1XQKA 5FF3A 1XBYA 3TXZA 2OO0A 3TVAA 4J3TA 3H54A 3EYPA 3WY1A 1K77A 3CMFA 5D37A 5HNUA 3EXTA 1V7AA 1LF1A 1JFXA 3ITXA 3P8JA 3RNDA 2A3HA 3ZLHA 1TJRA 2GLKA 2ZCGA 3KDNA 3PM6A 4LUSB 3MCMA 1H3GA 2CWXA 2DGAA 1QO2A 3AS1A 2TSYA 3UWZA 3LHTA 1ZTVA 4X2PA 2YGYA 3W7QA 1UASA 4E3TA 3BGAA 2NQ5A 4MB3A 3ETRB 3VMNA 4GYKA 2EQ8A 5JQ9A 3LI1A 2YDQA 1AOGA 3KP1A 1VCVA 1W1B1 4DBEA 5AY7A 1JG9A 3T2PA 1ML1A 1GKPA 3EX2A 3WDRA 2VJXA 1KW1A 2DDXA 1IT8A 4KRUA 1C3FA 3VM7A 3UWEA 3PJXA 4AZ5A 3KL3A 4Q8TA 5CC5A 3PUGA 3KAOA 1XLMA 4UQDA 2DFAA 1SO6A 4Z08A 2PDNA 3U2EA 3AZRA 4FF7A 2PWUA 5CBJA 3B9AA 3VI2A 3TIMA 1TJPA 2LLEA 1GUVA 9XIMA 2V30A 3SIZA 1NWUA 3UNTA 2YLAA 2VFHA 1GQJA 2H90A 5F2GA 2TODA 3W6YA 1WZKA 1DJWA 1HO4A 1B9BA 3MWCA 3S2NA 3SJ3A 1U5JA 3HB9A 1OC6A 2WB5A 4ROQA 3R58A 1VGAA 2FDSA 3FXYA 1SO3A 5EMKA 3MUZ1 2NV9A 1BHGA 1KXVA 5BXTA 3DBPA 2OZ0A 2CZFA 3BLFA 2FH8A 4AISA 1RXOB 4L9XA 5T8GA 1V4YA 2W67A 1UR8A 3E3HA 1FCBA 3MSRA 2J7DA 3DHDA 1NJJA 2ZA3A 1F6KA 4JTEA 4F40A 3CL6A 1FWFC 3WNPA 4NASA 1H50A 1K8XA 1FFVC 2O7SA 3A5VA 4H9MA 2ALDA 3WZ0E 1RA0A 1V6XA 2NLYA 5A6LA 4GWEA 1C9DA 4RLIA 3HGSA 1N63C 4C6JA 3RM8A 4QEEA 2ZDSA 4XZWA 2ZA1A 4JFTA 1DHKA 3CB3A 3NPXA 4AXNA 5IOBA 1ZY8A 3GXFA 3SCPA 4B2DA 3L68A 3W24A 3QR3A 2BASA 1V0NA 1Q6RA 1UIOA 4ERGA 3LBOA 1E72M 1Y65A 2EF9A 4RKAA 4H7ZA 2GUBA 1OX4B 2CC0A 2FHCA 1H61A 4BK9A 5LHFA 3AZTA 3NQCA 1G67A 4BHYA 4A8RA 1MZHA 3GE7A 3KRBA 2Y6ZA 4J4KA 3TW6A 3WK0A 3UWUA 2H8XA 4IIEA 4Y9OA 3U7VA 3TDFA 4H4QA 3R6IA 5D38A 4UOQA 3RO8A 4TVYA 4QNEA 5C5YA 1D7KA 3R89A 3KZSA 5DMLA 2EGZA 4NYYA 3TOYA 3NVDA 1JEZA 3WLHA 1YBQA 1ZXIC 3GG7A 1TPC1 4H4ZA 3O7UA 1JYWA 4ZZ9A 3UETA 3QHOA 3TK7A 4EQRA 3PJWA 3H55A 4IMDA 4D8LA 5CH9A 1XRTA 3NSMA 4RZ6A 1WDPA 4JFSA 2Y4SA 4DPPA 1AVAA 1FFRA 1IEIA 3FAXA 3GVWA 3LHVA 1R9XA 2Y24A 4CGTA 2XH4A 2BVTA 2EPLX 2NVCA 1SJCA 2VT0A 4P7QA 2DZXA 1GW1A 3PB0A 4NILA 3H6OA 3NTYA 4PBFA 3TLQA 3UXAA 5FS9A 1WQ5A 1I0DA 3LQLA 3AWNA 3CT7A 1TA3A 4S3CA 4XBSA 3AS2A 1EUAA 3WL0A 3IARA 3GNPA 5HA7A 3U3HA 5U4NA 4CD5A 4UR7A 2PBOA 4A22A 2BG5A 2E1DA 4H7CA 2IPGA 2XN0A 2YIHA 1FWSA 4Q4KA 1UD3A 1MW2A 3EWCA 1Q65A 1IXOA 4XAFA 1GOMA 4D9PA 5TD4A 1CTNA 3ANUA 3VFLA 4MM1A 3SQPA 1RCOB 4ZQNA 4IFRA 4PUJA 4UBPC 4PUWA 4G7EA 2AL1A 3PWAA 4AIBA 2FZ8A 3TJIA 2IKHA 1B3YA 1TELA 3KUMA 3LXCA 3CYJA 5EB8A 2ON3A 4G7FA 1ITQA 4FK9A 3PC0A 3G1XA 1G7UA 4P61A 1QFEA 1DPMA 1VHNA 4GFSA 3IIVA 1MRAA 3C86A 1JNEA 3NDYA 1TVLA 1K03A 3LPGA 4MKNA 1EZWA 1JL8A 3L7RA 3B8VA 4H4VA 1A4MA 3KRZA 1VB9A 5EPDA 4LA1A 3VX0A 2HE5A 1B2YA 3NXLA 4V1XA 4DEFA 2G3MA 1NWTA 3G5EA 4Q4OA 4EAYA 1Z3NA 2OLSA 2WPEA 3VTRA 1XLIA 2PRMA 1P7TA 1Q63A 3I4KA 3EA1A 1LM1A 1QASA 1AQFA 4PMYA 2A3EA 4XKYA 1E6RA 2Q01A 3A3WA 4K36A 4LU0A 3RU8X 1HP5A 1HQTA 2JKPA 2VP8A 5I6SA 3B04A 3L4WA 1QCWA 1GOKA 2VNCA 1EGZA 2Y88A 4LF1A 1VCFA 4JL2A 1S5TA 4WKAA 3VNZA 1QI2A 3N29A 3EX1A 4CCZA 1BKHA 1WX0A 3A21A 3LGDA 5A6TC 2VFFA 4GA8A 2HISA 1TYTA 3WQDA 1JZ2A 4P2VA 3E38A 4XO6A 4QDPA 1FWEC 1VP5A 4H9XA 4ZEPA 1LVLA 1ECEA 3C6CA 1A47A 3FVDA 3WFAA 2Z1VA 5DY2A 2Z26A 5PTDA 1GWJA 1UD5A 4XZHA 3OBEA 2AL2A 5IRPA 3LENA 5D02A 3LLFA 3F2CA 2OG9A 3CV7A 4N0RA 2OKOA 1LCOA 2PDLA 4FALA 1KM0A 4ML9A 1W5OA 1A49A 4O1BA 4C6PA 2CBIA 5I3GA 5DCEA 2WYSA 1KTCA 4HK5A 4XD4A 2X0YA 4ORMA 3WJSA 2EXOA 9RUBA 3SCTA 1RJQA 5C2XA 4UQAA 4M52A 3P0WA 1LL4A 3QW4B 2VUYA 1FH8A 3GIQA 1HFBA 4YN5A 2EPNA 1IIGA 4DIAA 2WVVA 2MUCA 3EWDA 3U9IA 1N7KA 3N2OA 2X09A 4PCNA 1KCKA 1TO3A 3W7HA 4N9BA 4GI8A 5G1TA 2YL6A 5FA5A 3WEOA 4D6CA 2W61A 1EQPA 3M0HA 3P93A 1GERA 5HXMA 5CJMA 4FNPA 3SADA 1X1OA 4ZTYA 4WKHA 3UCQA 4I7UA 1K7XA 4GUHA 3XISA 2E7FA 2CIPA 1VZWA 1A5LC 4UNKA 4MADA 1C91A 5HANA 1NY1A 3NQBA 4BCEA 3UR7A 1WE5A 3B06A 4JY9A 3DHFA 1SB3B 2QJJA 3B9OA 3OLEA 3C2YA 1M1BA 5AYYA 4UQCA 4ADSA 1ODZA 4DLMA 1TJ2A 4NHVA 1XIGA 3W87A 4S3KA 4Q8MA 4GXWA 3VMOA 4ASTA 1BG9A 1KWGA 5AZ0A 4DY1A 1XISA 2ALRA 3V0TA 4ZFMA 2E9MA 1EJRC 4ADTA 5EBAA 3A3XA 3PAOA 5G4WA 4R3UA 3LCGA 2XG9A 1R2TA 1IEXA 4RNHA 1WUEA 4JKLA 1P0DA 1X96A 2FZNA 1O6IA 1XYZA 1X1ZA 3RITA 1WAUA 5FCZA 2YFNA 4I9AA 1G4EA 2D1ZA 3JW7A 3AROA 4CQBA 2IXVA 3WK1A 3NL2A 5FACA 3AC0A 1VR6A 2Y0FA 1V3IA 2GUYA 4I9MA 4INFA 3INPA 3UP8A 4HD5A 3VOIA 2VDIA 3VYLA 3QC0A 4YNGA 4A3HA 3WX7A 3GTFA 2YPIA 3EA3A 3A7UA 4XZ9A 3PTMA 4B5WA 2PP3A 1XRSA 1ZLPA 3WQWA 4IHCA 1BF2A 5CXPA 4PSPA 2ACUA 1XGZA 5HNTA 5D9MA 1ODUA 3N9SA 3POHA 1A0DA 4PA8A 2WJEA 1Q7MA 3GD3A 3N9RA 1KGWA 2OEMA 3VE9A 2WCSA 3UERA 3HPZA 1S5MA 1MFUA 2J13A 1S3TC 2OX4A 2RDWA 1M6IA 2ICSA 5LA0A 4A3UA 4HU0A 1UH4A 1S2UA 1XG4A 3H2EA 2V0TA 2PEVA 2WKGA 3F03K 3T09A 4AZBA 3AUOA 1SZFA 1F73A 1RQHA 1PCWA 4H1ZA 1WXYA 1UWIA 3KFTA 1QNQA 5JIPA 3EF6A 3WF1A 4O50A 1E9ZB 4UTJA 7TIMA 4Y2WA 3IC9A 1Y5WA 1JCLA 4DWDA 3IRSA 3MMTA 4LC8A 3WLPA 1B3WA 4EX4A 3B4YA 4N4QA 3T0DA 2V69A 3T81A 1V5XA 5C7VA 2D23A 5D05A 4V15A 2I7GA 1TTJA 1BGAA 2YW3A 2BZNA 3K5XA 4IF2A 4AEEA 4MWAA 3EDEA 5I02A 4NX5A 5F4XA 3C3NA 3VGHA 3M0KA 1Z44A 5H8PA 3AMZA 4UR9A 3TTYA 1TPWA 1TTQA 4JTJA 2JEPA 3M0LA 3KBMA 1SSGA 2W91A 3QW3A 1J5TA 1GQIA 6A3HA 4WIWA 5IBXA 4XTIA 4DWSA 4Z1AA 2CZEA 4IFKA 1OQFA 5AHFA 5BROA 2ZRZA 3SCOA 3HBLA 3LUTA 2OWWA 4BF7A 1E56A 1DXLA 4KMQA 4AEOA 3AALA 2XZ7A 2GVEA 3QZAA 2PB1A 4ZB2A 1H7WA 5D2VA 4AX6A 2WNWA 3N6QA 4W7VA 5AN7A 1B4KA 1X7IA 1YKWA 3W1NA 1LG2A 4I8YA 3VUPA 1W17A 5HUPA 4DN1A 4CCEA 2PAJA 1T3QC 2ABBA 4JQ9A 1NARA 3AMLA 3PPGA 3S1XA 1PAMA 1HKKA 4WEVX 4AZ6A 5CEWA 1KKOA 1OVDA 1W1TA 5CG0A 3DK8A 5I09A 1Q7ZA 3CGDA 3NVYB 4QJ5B 3WDIA 3MZNA 1KV5A 5EMJA 1JXKA 4JZ5A 3CO8A 3R11A 2J8FA 1LL6A 3C2RA 4LBUA 4MOZA 5G5IA 2XDFA 5FS7A 1ECQA 1PV8A 1EF3A 1B3OA 3W81A 4CNPA 1OABA 1E0XA 4HOXA 2I9EA 4H4IA 3FHAA 4CCDA 4G9PA 3C0JA 2F6KA 4IUGA 3AS0A 4NF7A 4XZNX 3F4DA 1GVRA 5C55A 2NT0A 1LYXA 3LTSA 3PBVA 3D5HA 1GKQA 2FFIA 3I7SA 1ZCCA 3H24A 3DFYA 2DVXA 5E0KA 4M5PA 3VDCA 3NQ2A 1BPLB 3CZJA 1UR3M 3LCFA 3ARTA 1J5SA 4GD0A 1UWRA 1YXDA 2REQA 5EL1A 4K8DA 2G41A 4AXKA 1P48A 2AQVA 6PTDA 2NUWA 4PEKA 4W8LA 5ABFA 3LRMA 1QR7A 3JZEA 1DIDA 3GG0A 4L65A 3NM1A 1BSLA 2PC8A 4AD0A 1EOKA 3AZSA 4PUMA 3B8TA 4PMVA 5DO8A 3MDWA 1KBLA 3CWHA 3GIYA 1FCQA 4GIEA 3OG3A 1KR0A 4JL1A 3BCFA 4PTVA 4RDYA 4C91A 3NPVA 2VMFA 1XCXA 1GYLA 3EB4A 4B3LA 1BXBA 3P8IA 2WSKA 1SO5A 4EVZA 3TWBA 2QUVA 3U4AA 2WLYA 2XISA 1CLKA 4JNZA 2WKLA 2CESA 3AHXA 3UNDA 3SSJA 3IJ9A 2PGRA 3K8LA 3WJZA 4M80A 5H2ZA 5LA1A 4BKNA 4I5RA 4IPPA 4PB4A 4O1EA 4B4HA 1OJTA 3AMGA 3SUWA 3VZXA 1W9XA 1LROA 5MHBA 3H2CA 4WSJA 1WZMA 3M5YA 2R1KA 4PH6A 3ZT7A 4GKTA 1JCNA 1HP4A 1OZQA 1QK2A 4QS6A 2YBVA 4B2DD 1FFUC 5I3HA 3W25A 4A8IA 2NXHA 4R9OA 3PBMA 3KM8A 4TU1A 5EMMA 1YTKA 4UTKA 2FFCA 1XKYA 3QQ0A 3RILA 2VHLA 1FH9A 3NPUA 5EGRA 3QV9A 4RUBA 1JYVA 3DGRA 4YYCA 5CLTA 3ZIZA 3LA4A 1TCDA 2PLMA 4K2SA 1JQVA 1ITXA 1NP2A 3AJ7A 3C4UA 1BRLA 3EWUA 3M6DA 4W9TA 3RJYA 3O6AA 1ITUA 2X7VA 3ITGA 3TN3A 2VCAA 3GY1A 4QG6A 5DX7A 1UC4A 5A2CA 1YADA 5FJOA 3DJGX 1ICQA 3NNTA 3ATZA 4WXYA 4G1KA 1JZ7A 2Z1SA 2VR4A 1M53A 1JNDA 1Q1RA 4H6EA 5LZLA 3UG5A 3G0XA 3EEZA 4GIRA 4YHGA 3MBDA 5HBFA 1JI2A 2DIEA 2WSYA 4WF7A 3WF0A 1R2SA 1O5XA 1KTNA 4H00A 4Q4RA 1KA9F 2XJ7A 2PF8A 5CQ1A 1H1ZA 3GDKA 2UV8G 2EPOA 5D4YA 4CD4A 4GJIA 1EP1A 1W8GA 4XG1A 3W7OA 1H7OA 1JR1A 2HS8A 3USBA 1JPIA 1YBQB 4CU8A 1XGDA 2P0IA 1PIIA 2HXTA 1XX1A 3CGCA 1UYQA 2QUNA 3ABZA 3E2VA 3WQ5A 4RR4A 3DAQA 2WNZA 1L6GA 2Q6ZA 2HXUA 3WQVA 4LYPA 1GVSA 2ZZ2A 4UCGA 2FH6A 1JDCA 1O1ZA 7REQB 2CU0A 1G5AA 1JPDX 3ICJA 3AMKA 4HA4A 4O18A 1M41A 3GX9A 2Q8XA 3ES8A 4EMWA 2Y7EA 1LTDA 4IISA 1CGWA 2WZHA 3WNNA 4WX2A 2OOFA 1JGMA 2D69A 3BV4A 3G6MA 3NFUA 3QYQA 3U7BA 3S9YA 1TA3B 2WWDA 1OCBA 2VVSA 2GR0A 2BTMA 1MEIA 3WLSA 3NO3A 4KPLA 4PCFA 4HHPA 3AWOA 1XYMA 2BY2A 2ISVA 1GG1A 2QAPA 3M16A 2V5BA 2QDEA 3PG8A 4J3UA 3NURA 3FAWA 3MKCA 3QXBA 4H2HA 3KCLA 4DUVA 4QP0A 4QISA 1DJQA 1RCQA 1LRNA 3W76A 1PYMA 3L12A 1W2PA 1YE6A 1VF8A 5CCZA 3W1PA 3F1QA 1W9VA 3PZNA 4MFEA 3R7MA 4G7EB 3RAOA 4YYFA 2UY5A 1TRIA 3WD4A 4DX3A 1KFCA 2OKTA 4GCAA 1GREA 3MUY1 1CDGA 1ADSA 4HMNA 1LP6A 2F2HA 4A29A 4UFJA 4Q8VA 4FLRA 3VGGA 3UPBA 5KZ6A 4LEQA 1J4EA 3LGEA 4IMGA 2OEJA 1VHCA 3HTWA 1RD5A 4Z2GA 2PWFA 3VIPA 3QJAA 3A22A 3QY8A 4FP1A 3QYSA 3ONCA 1UA7A 3B8UA 3OO2A 4GYFA 4CNSA 1MRQA 1RA5A 4LBRA 4MG4A 2HS6A 3CQIA 4UOJA 3XIMA 4WOZA 2ZFAA 2NSOA 2VD9A 2OT1A 4AHQA 3GNXA 1JDFA 4TOQA 1JGIA 1GHRA 3AXHA 3MSYA 3WUEA 5M3WA 2YR1A 3LHWA 1HNYA 3T05A 3PZTA 1VRDA 1MW0A 3VDHA 3FSUA 1GOWA 4UMAA 4IL2A 4JN6A 3DC0A 1XBXA