3TOYA

Crystal structure of enolase brado_4202 (target efi-501651) from bradyrhizobium sp. ors278 with calcium and acetate bound
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
359
structure length
359
Chain Sequence
b'TTAAITGVTARAVITPMKRPLRNAFGVIDSGPLVLIDVTTDQGVTGHSYLFAYTRLALKPLVHLVEDIGRELAGKALVPVDLMKAMDAKFRLLGWQGLVGMAVSGLDMAFWDALGQLAGKPVVELLGGSARPIPAYDSYGVLDARDDERTLRTACDEHGFRAIKSKGGHGDLATDEAMIKGLRALLGPDIALMLDFNQSLDPAEATRRIARLADYDLTWIEEPVPQENLSGHAAVRERSEIPIQAGENWWFPRGFAEAIAAGASDFIMPDLMKVGGITGWLNVAGQADAASIPMSSHILPEASAHVLPVTPTAHFLEVLDFAGAILTEPLRVIDGKVTAKGPGLGLAWNESAVAKYQVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mandelate racemase/muconate lactonizing enzyme family protei
molecule tags Lyase
source organism Bradyrhizobium sp. ors 278
publication title CRYSTAL STRUCTURE OF MANDELATE RACEMASE FROM Bradyrhizobium sp. ORS278
rcsb
total genus 120
structure length 359
sequence length 359
chains with identical sequence B, C, D
ec nomenclature ec 5.1.2.2: Mandelate racemase.
pdb deposition date 2011-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3toyA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3toyA01
4HNCA 3FV9A 3R0UA 4X2PA 3CB3A 3Q4DA 2AKMA 3SN4A 3ZLGA 4MKSA 2GSHA 2P0IA 1XS2A 3IJLA 2P8CA 2PP3A 4A3RA 4G8TA 4MMWA 3SN1A 5EU9A 1NU5A 3KUMA 2XH4A 3SSZA 1JPDX 2PCEA 4E5TA 2GGGA 3THUA 3TQPA 3N4FA 4KPLA 3IJQA 2HNEA 3UXKA 1MNSA 4GYPA 4ROPA 2QDDA 3N6JA 3T6CA 3FVDA 5IDZA 3TCSA 3CK5A 2P88A 4DHGA 4KWSA 3RITA 2GGJA 4GIRA 4ZA0A 3ZVHA 3OZMA 2OZ3A 2ZC8A 3I4KA 3OP2A 3ZVIA 1EC9A 2PTWA 4F4RA 3UGVA 2PTZA 1NELA 4H2HA 4K8GA 1WUFA 3B97A 4IL0A 4HPNA 3NFUA 3FJ4A 3I6TA 3QPEA 4DWDA 5ENLA 5BOFA 3GO2A 1KCZA 3SJNA 4EWJA 2PA6A 3BSMA 1WUEA 3MKCA 4E4UA 4M0XA 3UJSA 4IHCA 4IP4A 3R25A 2QJJA 3N4EA 2AKZA 3OTRA 4Z17A 2AL2A 4JN8A 4E8GA 3UJ2A 2CHRA 3HPFA 4GMEA 3ZLHA 2OKTA 4FI4A 2OPJA 2QVHA 3OPSA 2OX4A 3ES8A 1BQGA 4HCHA 3NZGA 4DN1A 3PK7A 2PPGA 3JVAA 3TOYA 1RVKA 4JN7A 2I5QA 1L8PA 3Q45A 4KEMA 1ELSA 3MQTA 2POZA 4K2SA 3S47A 2OZTA 4GFIA 3DFYA 1ONEA 1FHUA 2QQ6A 2PGWA 3UCDA 3CXOA 3T9PA 4FP1A 3RCYA 1MRAA 5BOEA 5FJOA 3DGBA 1KKOA 3DFHA 3T8QA 3CT2A 3GC2A 3JW7A 3GD6A 3R10A 3SBFA 2OZ8A 3QTPA 3EKGA 2HXTA 2FKPA 4JHMA 4A35A 1JPMA 1PDYA 4HCDA 4IP5A 1SJBA 2GGIA 3BJSA 2GL5A 3CAWA 3JZUA 4GGBA 3TTEA 2NQLA 4GISA 3SN0A 4MGGA 4GYPC 2GGHA 1P48A 3STPA 3RRAA 2O56A 5J04A 1F9CA 3N6HA 3MWCA 3TWAA 4ZCWA 2XH0A 4HNLA 2P3ZA 2MUCA 3DEQA 4HYRA 3VC6A 4G7FA 2OFJA 7ENLA 3OZYA 3VA8A 3PWIA 4H1ZA 1MDLA 5FJTA 3ZLFA 4IT1A 2HZGA 2PU0A 3K1GA 2QGYA 3FXGA 2PU1A 4IL2A 3RGTA 3QKEA 3V3WA 3H7VA 3DERA 4J3ZA 4A6GA 3MY9A 3IJIA 4Z1YA 3R0KA 1SJAA 3U9IA 1EC7A 1SJDA 2DW6A 2XH2A 3DESA 2PSNA 1P43A 4GGHA 3RR1A 2PODA 1EC8A 2PMQA 6ENLA 3GY1A 1OEPA 2PP1A 3ES7A 2GGEA 2OG9A 3I6EA 3DIPA 2PS2A 3R11A 4H83A 3NXLA 1E9IA 3TWBA 3P93A 2PTYA 1ECQA 3VCNA 4E4FA 3IK4A 2QDEA 3P3BA 1KKRA 1MDRA 3MUCA 3PWGA 3UXLA 5FJRA 2RDXA 2XSXA 1JDFA 3TW9A 2PP0A 5FJUA 2PTXA 4DXKA 4HCLA 1TKKA 2OQYA 1PDZA 3MZNA 3ENLA 3QN3A 3UJRA 2OLAA 3NO1A 3DDMA 1YEYA 2P8BA 4H19A 1R6WA 1EBHA 4KT2A 3CYJA 1BKHA 1R0MA 3U4FA 3DG6A 2ONEA 3OW1A 1W6TA 1DTNA 3PFRA 3VC5A 3FYYA 4DYEA 4DX3A 1FHVA 1TE6A 3DG3A 4E6MA 1MUCA 2AL2B 2GDQA 3V5CA 3H70A 2MNRA 3H12A 3P0WA 3VFCA 3S5SA 3T4WA 3SQSA 5FJPA 2XGZA 4IZGA 3RO6A 3V4BA 3MSYA 3TJ4A 2QJMA 3ZVHB 3UJFA 4K1WA 1XPYA 3QLDA 4J1OA 4M6UA 3BOXA 3H8AA 1EBGA 3V5FA 1IYXA 3D46A 2DW7A 2HXUA 3UCCA 2XH7A 2OVLA 1SJCA 2QJNA 3R1ZA 3TJIA 4ENLA 2PGEA 4HN8A 3VDGA 3EEZA 2FYMA 1KD0A 3FCPA 1JCTA 3VCCA 4YWSA 2OQHA 3DG7A 2AL1A 3UJEA 1TZZA 3D47A 2ZADA 2OO6A
chains in the Genus database with same CATH superfamily
4FNUA 4JKLA 4YTSA 5CBBA 2Z28A 3LGEA 5BXTA 3T8LA 3TLLA 3ZLGA 4F0HA 1ZCCA 4AHOA 3WLTA 4HOZA 3PZGA 3UT0A 1WDRA 4S3BA 4O57A 4RPQA 1HL8A 3NIYA 4PTMA 1FX6A 2ZA3A 1B4KA 4XZHA 3TU9A 1X1ZA 3TR2A 4QITA 4WJEA 3P6LA 1JFXA 1VRXA 3SSZA 2QT3A 2ZZ5A 3GNPA 1UZDA 5E6YA 2EJAA 2IKIA 2GGGA 3N4FA 2OSYA 1QWGA 4U3CA 4GI8A 3LEPA 2OB3A 3AIQA 3FEQA 3BAJA 1WYIA 1J0ZA 1B1YA 1UD6A 1I0DA 1JI1A 4CCCA 4MTVA 3UQNA 4N7QA 5DQPA 5DT5A 1EIXA 3SR6B 4LBUA 4TMCA 3ABSA 4FXSA 3KRUA 3N2BA 4EM3A 1JUKA 3S5YA 1ZJIA 1XQLA 4H7VA 3E5BA 3MO4A 4LW7A 3TN3A 1V0MA 2DJLA 1F05A 1QNPA 4Y8EA 5FF3A 1SZEA 4GA8A 3SQLA 3QFEA 2WKLA 4QX4A 4ATWA 4IPNB 3GO2A 3P2VA 4GKLA 3H54A 1UH4A 4GYJA 1PZ2A 1GVQA 2FVKA 4IHCA 3W7GA 1P7TB 4FIQA 4G7EA 3NZPA 1VS1A 4AIUA 2WHKA 4OTKA 2YBVA 3F4CA 4IOTA 1R3RA 3AJ7A 1AVAA 1RQHA 4JTUA 4MJMA 3TCEA 1UD5A 4EMIA 1R7OA 3TROA 4IMGA 4DYJA 1DNCA 2BVTA 3THDA 3TYAA 3N9SA 2AGTA 4O0ZA 3P67A 4ZGYA 3AU6A 3MCMA 4LVBA 4JTLA 3AHVA 5T9BG 2ZTKA 4JEJA 3R6IA 2ZZ7A 4CU8A 3F2DA 1DJQA 1TWIA 3NTYA 1X6UA 2GK1B 3PUEA 1NF7A 3HMCA 5GJNA 1GYLA 4EIVA 1OBAA 2IPFA 3JW7A 4E3VA 2PDLA 1XLBA 1TPEA 2WCSA 2Q01A 4KWUA 2RGLA 1GG0A 5I2UA 1G1YA 4UXDA 2QUTA 1UMYA 1XLAA 2HBXA 1TIMA 3PTDA 3PC0A 4GIYA 3OEXA 1M04A 1NVMA 1FWWA 1STZA 3BSGA 2XFYA 4WKHA 4E2OA 2J6XA 1N5WC 4NNBA 4PTDA 3LRMA 4UWMA 2W79A 4W8BA 1OHLA 1T0OA 4YCOA 1WA3A 2VM8A 2W6RA 2JEPA 2A1YA 1AD4A 3CAVA 5EMMA 4JTHA 4FXJA 1ZMDA 2BTMA 4XBKA 1SFSA 3AXHA 1A5KC 1GQLA 1ZBCA 2AMXA 2DUZA 4LSBA 4JFTA 2E9BA 3OVRA 3EA2A 4XO7A 4Z0SA 3FGCA 1JR1A 1OFQA 3GXTA 2HPMA 4ZQCA 4NI8A 2ACQA 4Y9AA 1L2QA 1QI0A 3OVGA 1KFKA 3MMUA 4BEQA 2R91A 2GR1A 1A0CA 3WK1A 1ME9A 3KL3A 1C93A 1REQB 1W1VA 3CL8A 3NAVA 5FS9A 2G37A 3O2LA 3VE7A 3MUY1 4JL1A 4XKMA 4PULA 2P0OA 3NGJA 1EL3A 3POCA 2CITA 3NL6A 1SO5A 1REQA 2WHJA 3GKAA 1GTHA 2WBGA 5AVNA 1TTPA 4ZBCA 5AYZA 4PMDA 3W38A 5A69A 3MP5A 5CEWA 4GVGA 1N60C 1SO3A 3KZPA 3LBMA 2I17A 1PV8A 3MO7A 5A6LA 3FK4A 3N19B 4GUHA 5MF5A 1A5NC 4GQ0A 5RUBA 1C9DA 3S1UA 4B5WA 3SB0A 3VPLA 4XD6A 4BQ3A 2NVCA 3EX4A 4O0QA 3AOFA 2H3DA 1M9HA 1H63A 3CHFA 5C2GA 5LHFA 1EZ2A 3OU8A 1W9BM 3UW6A 1GGOA 2WM1A 4PTWA 1FKWA 2WZTA 3C8NA 5BZAA 1CZ1A 1RY8A 1DJZA 4K3ZA 1DJIA 2JALA 4KFOA 5LZLA 3HMJG 4GI6A 4TVUA 2BXZA 2RGMA 9RUBA 4KCUA 1BRLB 4PL1A 1YEYA 2ZUTA 7CGTA 3UR8A 1JQVA 3RX4A 1EJUC 4Q22A 4V28A 1AJZA 3M9YA 5M03A 3O16A 3G1FA 4BI6A 3B8TA 2PRMA 3P81A 1IT7A 4R9XA 2DZUA 1XHCA 4ZXOA 4LY8A 1OINA 4V2XA 3PUOA 5E0CA 4FPSA 3IJDA 4L1XA 2VGFA 1Q6CA 4OBRA 2Y8VA 3A3WA 3VFCA 2VKZG 2VFFA 4XAZA 3UYCA 3T55A 3EMZA 3LQLA 4LANA 3LZ5A 4M1BA 4KERA 1GRBA 1UP0A 2I7GA 2JK2A 3ZJ8A 3V16A 1P0NA 4H3DA 5CPMA 1A5SA 2VUNA 3QC0A 4Q8UA 2GJLA 1SPQA 4UOJA 3C0JA 4ZOCA 4A8LA 1QPQA 3I65A 3VK5A 2FHCA 3WNPA 2VZSA 1XIBA 4ICMA 4RDYA 2FZDA 4QDPA 1QPKA 5GQBA 3GNDA 1VRDA 1QCWA 4UTUA 2QJNA 4JQ9A 2CKSA 1NTHA 3HQNA 4XVEA 1WQ5A 1JAEA 4X0NA 1RV8A 4WOZA 2O9RA 3SSJA 1KRBC 4UIOA 1ZLPA 3B05A 2VURA 2EBNA 3KVLA 1EDTA 2IS7A 5D8ZA 3VO0A 2DV0A 3IVSA 3JR2A 2F2HA 3VX0A 1Y5XA 3SN4A 3NJ3A 1EUAA 1V59A 1H7XA 3C0LA 4A05A 1TMHA 5LIWX 3MYOA 5JBDA 1AG1O 2QXWA 3CLMA 2ZUUA 2R82A 1XW8A 3D5HA 3BTNA 3R2GA 3T0CA 4Q4OA 4D6HA 4Y90A 4DBUA 4YHGA 4H50A 2EG8A 3C0SA 3SUWA 1YDOA 5KZMA 3A3HA 3NVDA 3O3RA 2PDHA 3LB0A 4ILSA 3W87A 2DFAA 1FCVA 2V81A 3RM8A 2Y8UA 4LGXA 3T40A 1IE7C 1XYFA 3SQPA 5C2CA 4NEVA 2CLLA 2D0HA 8RUCA 7XIMA 3GK0A 3LN3A 3C52A 3NFUA 5HWJA 1BVWA 3ABRA 1IEQA 4ZO9A 4AISA 4NASA 4J2PA 3R4IA 3CUXA 2WCAA 2XDFA 4OOZA 4X3ZA 2VFEA 5EB8A 3SAZA 2GZXA 1VPYA 4U10A 4M0XA 4M29A 4IP4A 3N13A 3R25A 1Q6LA 4NXSA 3LLXA 2DIKA 5G1MA 2EGZA 1I2RA 4ZB2A 3LCLA 3OTRA 2ICSA 2A3HA 4ES4A 1ZMCA 3M0YA 3NZ1A 3CMFA 4LAKA 3H4KA 3SGGA 2X50A 3WFAA 2ZWYA 3U2EA 2ZTJA 4UQEA 4O18A 2XIJA 3WD4A 4S39A 2WOIA 3HGRA 4PGLA 3PJUA 2POTA 4XZLX 3Q2DA 2POZA 1N5XA 4K2SA 1V6TA 1WKDA 1CXLA 3VDBA 1BYBA 1R3WA 3OHIA 4XSLA 5EFFA 3L4TA 3UEQA 2FZMA 3SUUA 4J9JA 4D6DA 2R9ZA 1W3IA 5A6JA 2GDVA 4JFSA 4OKDA 4F0MA 5HQMA 7REQB 3EXSA 5I06A 1PHWA 3B03A 3AYVA 3G8EA 2OZ8A 2WVTA 3WEZA 1ODZA 5T8GA 3CHEA 2E5AA 1QMLA 3W86A 5DCBA 3AXMA 4JNYA 4BR1A 2F7FA 4AIEA 3H2CA 2J7FA 2EJ1A 2X0HA 4XWUA 3VIMA 1PX4A 1XGZA 4GC3A 4HN4A 4K8HA 1NDWA 3ARVA 1H62A 4R5EA 1BSIA 4JAWA 2O56A 4J40A 1ZSXA 4GJJA 3EAOA 4XTDA 2RABA 1UH3A 3TWAA 4AUBA 2ZRUA 3AMLA 3IACA 4PMUA 3L0KA 4X61A 5HOSA 1L8NA 2EG6A 5D2WA 1Q8AA 2X8CA 5G5HB 1XLMA 4CQ8A 4EP8C 4NNAA 4UB9A 3OZYA 2DZBA 4ZEPA 1Z6KA 4WY0A 1M3UA 3BG5A 3GW3A 4H1ZA 1RK6A 4BEUA 4QHRA 3TAOA 4OFCA 5DRCA 3TSDA 1JGMA 3PJXA 4QAWA 3RGTA 4TTGA 5CQ1A 3DYPA 4ROQA 4I8DA 2BMBA 1EGZA 1SJAA 1SJDA 2A3CA 3K5XA 2YDAA 1KV8A 3O05A 4ZQNA 3RFAA 1E71M 1KCXA 3GH4A 2G0WA 3QR3A 5AHMA 1P0EA 2E67A 4Q6XA 4WUIA 1S3TC 3QZEA 1GYNA 3I6EA 4FX6M 4L64A 4XZMX 2NUWA 1P1MA 3WMCA 1MOKA 3B8UA 5AVHA 2PBGA 1GQNA 3P93A 3E1F1 1OCJA 2FTWA 1VBGA 1CDGA 4B3KA 4E4FA 3E12A 1TPVA 3W22A 1OT2A 1FXQA 1H41A 3DX5A 3W76A 3ARSA 3P62A 3RUBL 1MMFA 3BDKA 3L2IA 1EF2A 5BXRA 3E9AA 2X1IA 1C7TA 1OG6A 3H2MA 3W88A 3H53A 4W93A 3G2GA 3AZSA 3KRBA 2Y61A 2Z1BA 4AQLA 4LYKA 8XIMA 4H4XA 4WF7A 3TZFA 3UVIA 5HR7A 2VEIA 2HROA 2JKPA 3C2YA 3UBPC 4WDWA 3CIVA 3ID7A 1CNVA 3E5PA 4XAYA 1W6TA 4TX6A 3N9RA 4EKJA 3L4XA 5HPCA 3TTSA 3WO8A 2FGLA 1SYTA 3TC3A 2YZ5A 4M8UA 3W00A 1XP3A 5KTLA 2VRJA 5A8OA 1VJIA 2OX1A 3ITGA 1W1B1 4LFYA 4L61A 1AJ0A 3NQ7A 4KF1A 4REQA 2E3TA 4GVFA 1ZK7A 1SO6A 3TJLA 1IGSA 1H7OA 4Q7NA 1LWHA 2E77A 1AA1B 4H9VA 1VPXA 3EUB3 4DJEC 3WH6A 4J1OA 3SGUA 4B5XA 4YMZA 3WJZA 2OSWA 2YIHA 1R9XA 4DXVA 3KRZA 5F4XA 5TQLA 1ME8A 1VZWA 4IMDA 3DYMA 2VDHA 3QY7A 3QHNA 4WSHA 3G1VA 2J9ZA 1WV2A 2XVPA 1OJTA 4TU1A 4O15A 4L7ZA 2X42A 1KN0A 4DRSA 3PUGA 1W5PA 2J25A 1KQZA 1VCVA 3PFMA 1XUUA 5AC7A 3GRIA 2AKMA 1O68A 3R5EA 1OK6A 3WBXA 3M46A 3M7SA 1XLEA 4Q4PA 3B8IA 1KTCA 3SN1A 5AFDA 4RV8A 1JZ7A 3W1XA 6REQA 3CYVA 1SMDA 3PN8A 1Z9AA 1JOAA 4HZMA 4H6RA 5D2TA 2BWGA 1UIPA 4HNVA 2HS6A 4HZ6A 3THUA 1KWKA 4DPQA 4L6DA 3DBPA 2DQXA 3VGBA 3STEA 2PDKA 1XLJA 2QDDA 3AHZA 5K3VA 5TAOA 3TCSA 2QCNA 3ZVHA 4HJWA 2OZ3A 5CGQA 1DJNA 1JCNA 5ABEA 1JDCA 3OP2A 1Q1WA 4UTKA 3N73A 3CHVA 2PTZA 1V51A 4JTKA 4UR7A 4EPKA 3NXFA 4WY0B 1ADSA 1XRSA 4HOWA 1KO0A 1KCZA 2B31A 3LRKA 3BSMA 3SCUA 3GVVA 2CHNA 2O92A 3CS2A 3XISA 3ZJ6A 5CH9A 5BU6A 1GNXA 1FWRA 3AIEA 3EMCA 3SEPA 1E15A 1YNPA 1EA9C 1ZB5A 3OODA 1QOPA 1L9WA 1W5QA 3ZLHA 3LTYA 1RJPA 1ZHAA 4DQWA 3IRDA 4O10A 1PJ9A 4ATLA 1QU4A 5BOOA 2I5QA 3B4YA 3OZOA 4TQTA 2XVNA 3QFBA 4DUOA 3F4DA 3W2NA 5IOBA 4P7QA 3FA5A 2VZTA 4PMXA 4IGMA 4D9PA 1A3HA 4A4AA 2GRTA 1XRTA 3LCXA 2OODA 4O19A 3TYEA 3B04A 3N15A 4FP1A 4JXCA 1S2UA 2BG5A 1MRAA 5A8QA 1GOQA 2G3NA 3AIVA 3S5ZA 2BS9A 3ONCA 4AZ5A 3GC2A 1PIFA 3FYOA 5D9NA 3SBFA 1XDIA 1KFBA 4F0KA 5TF0A 5AC6A 3GIPA 3DZ1A 3EA3A 5FKYA 4M19A 3WDHA 2WCGA 1KLZA 3ATZA 3ARRA 3NQBA 4R53A 2HRWA 1DJXA 3QV8A 1KA9F 6ALDA 1AUSL 3W83A 3ZSSA 4I9MA 1U5HA 3IGUA 3MYPA 1W9VA 4XV0A 1YW1A 3QF0A 3L4YA 4FX9A 3QRHA 1N62C 3HGOA 5U7SA 1PKLA 4QROA 1JNDA 2WYSA 1DVJA 3LYEA 4KMQA 2ZCGA 5GNZA 4LT9A 1V77A 4P61A 4XSMA 2OGYA 4J2MA 4W8LA 3WD1A 4JIRA 1VBRA 4AVFA 4MYAA 1US3A 9CGTA 3GW0A 1K02A 2Q71A 4F66A 4L65A 2Y7FA 2OEJA 3MKKA 3MA8A 3SCVA 2WQDA 4CNTA 1TPDA 3NNTA 1JCJA 1VBHA 2Z6IA 3EDDA 1AH3A 3PBYA 3QC3A 1XIMA 2YX0A 3V3WA 4KRUA 1VFUA 1DBTA 1Q6FA 3KOXA 2HS8A 3WMLA 2CDUA 1K9EA 1ML1A 3PUDA 1G7UA 2V5JA 3SRFA 1S5TA 4C7GA 3N1AA 4C1KA 3HRDC 6ENLA 2BASA 2WOWA 1SSDA 1OEPA 1VHNA 4B91A 4AXKA 3HM7A 2VOMA 1Q4WA 3S6OA 1UR4A 5F4SA 2A2IA 3N14A 2PTYA 3T08A 1R46A 3PZTA 4FR6A 1XLHA 2HE8A 1WDQA 3EXRA 2Z4GA 3OOQA 4CN6A 2BVYA 4EAMA 5FJIA 3TW6A 4G9PA 4DJED 3WQEA 5C9WA 5I3HA 2VWSA 3TN6A 5D9PA 4M56A 1BVZA 1VD6A 1QDSA 4MB1A 1V5XA 1LOLA 2CLFA 1S46A 2WMKA 3QFAA 1UHVA 1EOKA 4KT2A 5A6MA 1TYGA 1BKHA 4P8UA 3M0MA 5E1QA 1V08A 3U4FA 4KCVA 4H9YA 1A5BA 4HU4A 3FEMA 3G1RA 3MI2A 5IM51 1KLYA 1K8CA 3PNUA 3EKLA 4ZXLA 3WLRA 4PE8A 2QF7A 1I1WA 1JFHA 1FH9A 4G2DA 4B90A 8TIMA 3RRXA 1GV4A 1E0WA 4IJBA 1BF6A 3CQJA 2BY2A 3QKZA 3C0QA 3MI6A 1RK5A 1LRNA 1MO9A 1KNWA 2QMJA 2VFDA 2WQPA 1ZY8A 2VDGA 4MKNA 4QEHA 1XDJA 4K1WA 5A5WA 4C6DA 3HG4A 1OD8A 4MY1A 4EK7A 3S2CA 4YTRA 3LHUA 3K4DA 1M7OA 1ALDA 1CGYA 4KGLA 2NUXA 3AMDA 1EF3A 1YPIA 3O9NA 4GH3A 3S46A 2HXUA 3UCCA 1AZ1A 3BMXA 2VFIA 2CZDA 2Q8XA 1SJCA 3QV6A 5CKSA 3VUSA 5BCAA 2A8XA 2I57A 4IIEA 5AHIA 4S3KA 5CC6A 3K46A 3LGGA 3EEZA 3AIWA 3LENA 1TWSA 4W8AA 4HMCA 4BF5A 4CNOA 1PYMA 3W7RA 2OO6A 5D2XA 2WBKA 3ARQA 1Q65A 1ISVA 4AHQA 2DPEA 4HK7A 2CU0A 3WBAA 4AWEA 4FAMA 4NZ1A 4AZBA 4ZQPA 3LI1A 3ARTA 4PB4A 1UG6A 1GQJA 3U7VA 1XRVA 3VNJA 4C7FA 1T8QA 4QSFA 3TNOA 4W9TA 4A21A 3W01A 1A47A 2F8QA 3GDLA 4AX6A 5IFPA 1O1ZA 3B8VA 1JPDX 2WLYA 4PCNA 1VC4A 5D37A 1ZGDA 1KQYA 4PMRA 2J7EA 1BG4A 5D9OA 3HU7A 1W32A 3L4WA 1TX0A 4ROPA 5HR6A 3UD6A 1DIOA 3W74A 2ANUA 1UR3M 3MW7A 3TV8A 3CK5A 2P88A 4MWAA 2CYGA 2GGJA 4GO8A 2CLIA 2GFTA 1EOMA 3OZMA 2ZC8A 3VTRA 5A6AA 3L0NA 3ZVIA 4PCPA 3N17A 2FDSA 1GG1A 2FZBA 2WSKA 5KSWA 1EJ7L 2NX1A 1US2A 3N4AA 4I3GA 3GXMA 2ZKMX 3MV11 2JKEA 1JG9A 2TPRA 5BOFA 1XBXA 2ASHA 4IQJA 1CXEA 1YQ2A 4CNNA 3I68A 2Y63A 4GRSA 1PHQA 2XZ7A 4E4UA 1VJSA 4IFKA 2H9AA 4KW2A 2QCHA 2QCDA 5E9AA 3EYPA 4ERIA 3SDOA 3Q94A 5C55A 4MDOA 1KGXA 1X7FA 1UD4A 4US6A 1QPNA 2WNQA 1VYSX 4QE4A 4DWSC 4JN7A 3G1XA 4WIWA 4WOQA 1FBAA 1T96A 2Z1XA 1SU5A 3QM3A 3C2FA 2J78A 2BSLA 3L9CA 2H90A 1JROA 2V69A 1EJRC 3K4WA 2WSQA 3E0FA 3NDOA 3CXOA 1FP9A 1AD1A 2I5IA 4LAZA 4LF2A 2CLPA 5C71A 3H4GA 2PAJA 3VIJA 4GVIA 4LAMA 2XIOA 2VVSA 1XIJA 4J3UA 3EXTA 4PC8A 1W5NA 1NWUA 1TFVA 1NWTA 1HJXA 5G2HA 2O0TA 3HA1A 1B3YA 3TJXA 4ZOEA 3A3XA 5DRIA 3QH2A 4HCDA 4Q8PA 3WFLA 3CAKA 1JDAA 5FEWA 3PVFA 5CC5A 3LK6A 5BXSA 3VD5A 2GH5A 3D3FA 4HMEA 5D05A 1TYPA 1GVSA 2VEMA 4DAFA 5KETA 3KHDA 2CPUA 4PMYA 3LZ3A 4MAZA 4C6KA 1QXLA 1VFSA 3B9OA 2VL4A 4JKKA 2HK0A 3NVTA 1W9XA 3FA3A 4KESA 2QV4A 3ABQA 2XUCA 3S3GA 3VC6A 2Q3OA 4HSOA 3MCNA 7ENLA 4DJFA 1LORA 2A7RA 3M16A 1ISWA 3AWNA 1QR7A 1J93A 5ABGA 3II1A 1ZY9A 2GJXB 1H1YA 1XYBA 3GZAA 1YTEA 3CMJA 3GNOA 4AZ7A 3MVIA 3URQA 4UCFA 2XH2A 4WEVX 3DESA 3EEGA 1P43A 2HWGA 4GGHA 1IHIA 3RU6A 1IZJA 3KBVA 1I9CB 4YU1A 2HMCA 2J75A 3HG5A 4PEKA 2WMJA 2VDIA 1TUXA 2PP1A 3SUTA 1EXBA 3BICA 3WH5A 4AWTA 5HQEA 2OG9A 2VXNA 1AFSA 3VIFA 1E5JA 3WQCA 2BNJA 1SVDA 2ABAA 1A3WA 4AIOA 1LBLA 1XLIA 4DJEA 2DDXA 1O12A 5D9MA 3PM6A 3APYA 2PP0A 3FAXA 4XUYA 1OGGA 5EMJA 4Q7IA 1U2YA 4D72A 1JF6A 2EKGA 1F74A 2XFFA 1V97A 1ZALA 2YFNA 5AC8A 3UJRA 2DZPA 2WV8A 4MZYA 2OYLA 3CL6A 5C54A 2ACRA 4WGHA 1R6WA 1IEXA 4LPCA 3W29A 4LV9A 4JDYA 4L5ZA 4BA0A 1KBLA 3M0HA 5FI8A 1DTNA 3LHTA 3CZLA 5F1VA 1FIQB 3ABXA 3FYYA 3UPMA 3FG2P 2J27A 3HBLA 4HK6A 4MWAB 4YCPA 4DX3A 3S9IA 1JCYA 1QWKA 3RPDA 3M0XA 4GK8A 4HOXA 1E9YB 3HJEA 3V0UA 3WLPA 1NAL1 1A5MC 2QCFA 4Z2KA 1JD7A 3U0HA 2WW5A 4UFMA 1F8WA 3A13A 4ML9A 2X7VA 1WE5A 3QFWA 5EBAA 1XANA 3OVPA 4L80A 5LSMA 1VQTA 3ZOAA 3UJFA 3FXYA 1XXXA 4IFKB 1UKSA 3QLDA 4LYQA 3EWDA 4O0KA 3SUSA 4L9YA 2IXUA 5H2ZA 3ATYA 1ZBVA 3WQPA 1XH2A 1A0DA 4EQXA 4WVXA 3GNRA 1HFBA 4YWOA 3W1TA 3C2OA 5AOUA 4M51A 2O4MA 3B8SA 4ZOBA 1K03A 2HDJA 5F2GA 5LA2A 4UTFA 3VCCA 1GT8A 3M44A 2GOKA 2YW4A 3TEVA 4Z08A 4AH7A 5CZTA 4RL3A 2C8NA 3FN9A 3I3DA 4HNCA 3SY5A 1W3NA 4Q3MA 4WGXA 3RPTA 1EKOA 1QHZA 1KBKA 2XVKA 2PF8A 3CPUA 2GSHA 1LWIA 3W7QA 1RCXB 1FHLA 3TN5A 3WL1A 4FA3A 4NY2A 2GVLA 3LTPA 3NDYA 1GETA 1PTAA 3KUMA 3E6EA 5FMHA 3VD9A 4F0SA 4JHZA 2PDIA 2CWNA 3BLOA 5ECVA 3ONBA 2XFRA 4WSJA 4ICCX 2DVXA 3KFTA 1LWJA 3VNLA 3QEZA 4WXZA 4DO4A 1KFLA 1X38A 2CFFA 2WANA 5CCZA 2DZTA 2ZZ4A 3M0ZA 4M5PA 4O8RA 3N25A 4K8DA 1VH7A 3CO4A 4LC8A 4LAUA 2YW3A 5D03A 3LI0A 2WMIA 1XFCA 2PRLA 4AEOA 4XZIA 1R30A 2QCEA 1GEQA 2PTWA 4H01A 2X16A 5FSDC 4LC6A 5E9XA 3CZJA 3ZT6A 2WZEA 2DGAA 1GHRA 1O5RA 3T4CA 3GC4A 4PFMA 3FHQA 1RM6B 5JBEA 5LHEA 4IMEA 2FGBA 4ZSTA 4UBPC 3MSDA 1IZKA 3S5OA 3KHJA 3W2LA 2Z29A 1QATA 3CB8A 3UWVA 2NV1A 2VQUA 1T5AA 4LVDA 1R9ZA 3IAQA 3UG8A 4E8GA 3TYZA 1BKSA 3EX1A 3ZT5A 1NJJA 4GMEA 3LNMA 5DEZA 8CGTA 1L6YA 3TZNA 2OPJA 3DAQA 1KM1A 4WCJA 1R8LA 1BQGA 3V0TA 3S8HA 4C1NB 1XGEA 1DE6A 1EO7A 1WAWA 4GQGA 3AZRA 1HJVA 2QPXA 4CU6A 4LCQA 3UGRA 2DT1A 3QQWA 4QJ5B 2HNHA 3HPXA 4AF0B 1OC7A 1JZ8A 3AM9A 1PX3A 1HTIA 1HL2A 4ZOAA 1RZMA 2ATMA 2XN2A 3DFYA 1EBDA 4DO6A 1MUMA 3WNKA 1NP0A 1LRTA 2C3CA 3NGFA 3GXPA 4I8YA 4JHOA 3H2AA 3SCNA 1HQTA 1QOXA 1VBUA 1C90A 4LAOA 1F3TA 1M03A 3QTPA 4GO9A 3TDFA 3GU1A 1C3FA 5PTDA 1O7AA 4OZOA 3EB3A 2YXGA 3P0XA 3K2GA 1ZQ5A 4KQNA 3F5JA 4P7LA 3SIZA 1FUYA 1SJBA 5CLTA 2HJPA 1UQYA 3CZGA 4RXFA 4F0RA 5MKGB 1RALA 4D1IA 1AOGA 1GKPA 4RNIA 4JCLA 1BYDA 3CZ8A 4DBWA 4PMZA 2RAGA 2JE8A 4KWWA 2GVJA 3L12A 5LIKX 3SCPA 3LPFA 1XD1A 3R8GA 4LJ3A 4OV4A 3MWCA 3EOOA 1XSKA 1MI3A 1OB0A 1J0HA 3INPA 2F61A 2J7GA 4GR1A 3N3TA 4IIFA 3TH6A 4B5UA 3WDJA 3EBVA 4ZR8A 1O1HA 3MJMA 3DYOA 3G1DA 1F6YA 3I3BA 3T0DA 3LBCA 4QDMA 1V7YA 2GQWA 1XINA 4GBDA 5DLCA 2DIJA 4RLIA 2WZHA 1DTUA 2L5HA 3LOTA 2ZA2A 3W75A 2ZZBA 1UD2A 4E8CA 4WHBA 3DERA 5FL1A 4KEVA 4DZAA 4H7CA 4WDXA 1EEPA 1RP8A 2DW6A 5CAKA 4KKXA 4HD5A 1KC7A 5T26A 3DHFA 1ZX9A 1S1PA 3A4AA 5HUOA 2OT0A 4UMCA 4U3AA 3TA6A 3RJXA 4H83A 2XN1A 4AX7A 3UYIA 3WF0A 1IXNA 2DP3A 3KVMA 2HTMA 2VP8A 3G6MA 3I7QA 3M5VA 1A4LA 1MW0A 2DY3A 3AAMA 3SR7A 3WSUA 1B3ZA 1O5QA 1PS9A 2E5DA 3O07A 2PTXA 2WWCA 3CASA 1I0BA 3MZNA 4B4HA 3G1AA 2X09A 4QE1A 2X05A 1T8XA 3N2TA 3BW4A 3VNZA 1S1RA 1K4HA 2GWGA 4Y9OA 2Y88A 4X60A 3N29A 3FS2A 1W31A 4JX5A 4H4YA 2YXXA 1K9DA 2V6AA 3EB4A 1VIWA 2NUYA 4G6CA 3MHUA 2ONEA 3V1PA 3PWAA 2A7NA 1B2YA 3PPHA 3EAUA 2ZX8A 2PD9A 3VD7A 1ZU8A 5HMEA 1W3LA 1VF8A 2UWFA 1SO4A 3AS0A 3M1ZA 2ACSA 1I8JA 4HPJA 2G4FA 1GVOA 4O53A 4A2RA 5A6BD 5ABFA 3KCJA 3P84A 3TYBA 3L7RA 4OBSA 3LHVA 1WKFA 1W1A1 3LXAA 1E4IA 4HYVA 1WNOA 3KRSA 1SR0A 4WY0F 1BYAA 4J3WA 3BANA 3VXGA 3MANA 3GDTA 4PBGA 2PWFA 2OJPA 1GRGA 3U48A 3PZIA 1NFGA 2V9DA 2VI0A 4AZCA 4O4VA 1QASA 3F4VA 4NQ1A 5DBUA 4Q4MA 2ALRA 5KZDA 4LIIA 1EX5A 4QNEA 2ZZ6A 4N6FA 3WQVA 3R12A 3EA1A 3EF6A 4QCEA 1LBMA 1BPLB 2JIWA 3GFZA 4XK2A 2JGQA 1YE4A 3NWRA 3P8JA 4A8IA 1UP2A 5U25A 4JYEA 3TJIA 2FQIA 3WDQA 4ADSA 4ENLA 4MNJA 3EDJA 3MDUA 2B4GA 5HNRA 1GOIA 3L66A 1DWFM 1TZ9A 1QI2A 2XIQA 4YWSA 4EOUA 4GZEA 2AL1A 4C6EA 1DOSA 4CU7A 5K9XA 3D47A 3SURA 3EOSA 4DZ5A 3NSXA 3WNOA 3ITVA 1YNQA 2J88A 4GQBA 4GY1A 4DB7A 3E2VA 2G41A 5JMUA 4AFYA 3M0VA 4GBUA 3S4TA 1WAUA 1PSCA 2P8CA 2PDUA 4GE8A 1CLXA 1UUQA 1Q13A 4EPEC 2A4AA 1BWKA 3DH7A 4WRHA 4H4WA 3WBYA 3RLHA 3KBWA 3LPPA 2OQLA 5GNYA 1FDJA 3OZPA 3VKCA 2Z1KA 2D2OA 3F1QA 3ETRB 4WDUA 2JQXA 1FWSA 4HMDA 1P0DA 1Q63A 1OD0A 2R1NA 4HNNA 3ITTA 5LGXA 4KFNA 3IJ8A 4H8UA 3F7JA 2WNZA 5C8BB 3W3OA 4M52A 1M41A 4JFWA 2Y7EA 3DHDA 4N9EA 2VJXA 4DHGA 5LGZA 4BF7A 1NY1A 4FO4A 4L4LA 4AC7C 1J6PA 4IF2A 4PSRA 5IDIA 2PGRA 2FPVA 3DI1A 1XPGA 2XVGA 3N34A 3RK8A 2VUYA 1UUMA 1BEUA 3RU8X 4L9ZA 3W2UA 4MNMA 3CL7A 5K7JA 2EPOA 2ZXDA 1NDYA 1FXPA 4QLKA 3OJGA 2PA6A 1DQXA 2PLJA 2P5NA 1EDQA 2ZX9A 1LQAA 1EP2A 1E9ZB 3NQDA 3WQDA 4H8VA 4NZ5A 3AS3A 4KWVA 2PDCA 3LCFA 2NZLA 3NDZA 2X99A 2Y7GA 1N8FA 4JN8A 4IFRA 2A85A 3UJ2A 1TQXA 3ERPA 3QW4B 2BFGA 2BXVA 3H7UA 1FFVC 3DFNA 4RW3A 2Z1VA 2UY5A 4CD6A 5K4ZA 4KEUA 3BWWA 4U28A 1YRRA 3HF3A 3ELFA 4AZGA 4HTYA 3MQTA 3O0FA 4XKYB 3VIPA 4BHYA 4QP0A 1LL7A 3COTA 1E51A 1Z41A 4FX8A 4NRRA 1ONEA 1W2PA 1M5WA 1MQRA 2YB4A 3ZR5A 3AXKA 3UCDA 2PB1A 3VNYA 3WELA 4OWGA 4DJDC 2I14A 2FGZA 4ACZA 3BLFA 4L1GA 3HZ3A 3BE7A 1A53A 3WX7A 2PDYA 3G8RA 3RF9A 3P14A 2VZOA 3ANYA 3FDGA 4NYYA 4LB3A 1Q7MA 2BZNA 1O66A 1XIEA 4KWOA 3GVRA 2GGIA 1TWWA 3R94A 1XBVA 1EH9A 3TC6A 3IGHX 3UR2A 4L6OA 1GZ1A 1PKMA 2H6RA 4GISA 1EJSC 1P48A 4F9JA 1OWQA 1O95A 3AIUA 2V5DA 5J04A 4NZ3A 3EPMA 1TPB1 2Z0IA 2Y6ZA 1PCKA 2WK2A 1IWPA 3HIJA 4Y2WA 2OFJA 2YQUA 3L2LA 5CSYA 4C6PA 5LNSA 1SZFA 1VR6A 4MFEA 4QS5A 1P4CA 3ZFHA 4CVUA 1SZGA 1JIBA 4MSSA 1O6IA 4JDBA 3EPNA 1WOAA 3K30A 3VE9A 2B7QA 2WKGA 3H24A 4TX9A 5FF0A 2FJUB 1ZTVA 4A8RA 2WVSA 4MJZA 1AQ0A 3SW6A 4Z1YA 3HPZA 5AB3A 2UY4A 4I5UA 2NQ5A 2PSNA 5M5DA 1VGAA 3VIOA 2NXIA 3WF3A 1R2SA 3WF2A 3QGAC 4W86A 4HNOA 3GVGA 3KP1A 4YXGA 4QJ1A 2ZE0A 1FCQA 2WVVB 4G56A 5JCIA 3ZM8A 4A3YA 4NZFA 1DP0A 5CPSA 1SFJA 2X30A 1L2UA 3H6OA 2QDEA 2FH6A 4LY4A 5D8WA 1X98A 3GE7A 2V3DA 4E3TA 5JCLA 4FEZA 3U2CA 1BWCA 1LYXA 4FOUA 3ZR6A 3DKJA 4OE7A 4RZ5A 4N9CA 4GXWA 4WKFA 5E70A 1DIKA 1EXPA 3KM8A 2V8ZA 1J10A 3RPMA 4CQBA 3BGJA 3G1SA 2VGBA 1X8FA 1TSIA 2E6AA 4JQ4A 3WMBA 3FLUA 4H9MA 1UPMB 3OW1A 2E25A 2YCKX 4KH2A 4LYRA 4TVCA 5LXXA 3LU2A 2NLIA 3CQIA 2OR2A 5C0QA 3GC5A 3SGZA 5AYBA 2PDBA 4CEXC 4LB4A 1RH9A 1J96A 5HNTA 4HQVA 5AYXA 2G96A 2YL8A 2FHFA 2D1ZA 3AMCA 1B30A 1Y0EA 3ANVA 4RZ6A 5EBKA 1I2NA 4GUJA 3LBOA 3G24A 2CBVA 4JQ3A 3UR5A 2QJMA 1HF6A 3O0KA 3UWZA 1GKQA 2H8XA 4I5XA 2ZUMA 5FAJA 3V5FA 1EP3A 4MJ4A 3E74A 3EPOA 3KLJA 1QT1A 2O7SA 3SZ8A 4NEWA 3EZ4A 1JAKA 1X1OA 3B0XA 4RNHA 4HNUA 4UFLA 4NJHA 4RDZA 5CZKA 3NEVA 3NOEA 1UASA 1TPH1 4MKVA 1OM0A 3ZSTA 3DG7A 4B3ZA 1VFLA 4CNSA 2B7PA 1TZZA 2YLLA 3L5MA 3ARZA 3TOPA 1XIDA 3KVJA 2IQDA 2ZVRA 3FDKA 4L9XA 2A21A 3DGHA 3S9ZA 5C9ZA 1FEAA 3N2XA 1H4PA 1Z42A 3NSNA 3O6YX 1X2HA 2PP3A 3BJTA 3BZGA 3B8WA 3QQ0A 1TZ7A 2C3ZA 4GZIA 1HG3A 3O0HA 1TX2A 2BLEA 1X39A 3PZVA 4IG2B 4NVTA 3BAWA 1GOKA 1M68A 1RHCA 3H21A 3TFCA 4UNLA 3LUTA 4UTTC 4LQ1A 2NX3A 5HULA 3M5ZA 2GSEA 3MB9A 2PFHA 2INFA 3W7LA 1VKFA 4GYPA 3T6CA 3H26A 3HOJA 2OT1A 4BURA 3DH9A 3OLEA 1NP2A 2ZBTA 3G6LA 3S42A 4MWAE 5CXPA 2F84A 3QSTA 1D3HA 2FPTA 1G4TA 4F4RA 3PAJA 3ITYA 4BFAA 4I6VA 5DANA 2O9OA 4U2ZA 4AEFA 4GOAA 4MIMA 4M7SA 5JUVA 4IL0A 1R3SA 1VFTA 3L67A 3MU7A 1DL3A 2BGNE 1DJHA 1OC5A 4H9TA 3VYLA 3KLKA 4IPPA 4UOQA 2TODA 3IIOA 2YBTA 1FQ0A 4IWWA 2DEPA 2NPXA 2CNCA 1G69A 4Q8QA 1JCLA 3CLWA 1THFD 1U5VA 5CC7A 5CSUA 3REQA 1B9ZA 3GM8A 3ES8A 1Y5VA 1RLCL 2PPGA 4IPJA 4DY1A 1J9YA 4B5TA 1E9LA 1R3TA 1KM6A 4AMAA 1OZMA 1LCOA 5I7GA 4P8WA 2E8ZA 1ZS2A 3JU2A 5U4NA 1E6ZA 4GX8A 3MKVA 3ZIZA 2NQHA 4QGCA 3PNZA 4JNMA 1GOMA 3E0WA 2V5LA 4PFHA 2X0YA 3KOYA 1U1HA 4V27A 2QGHA 3T7VA 3MI3A 1S5NA 2OEMA 3UWWA 4BQ2A 1NM9A 2VCAA 3T2OA 5K9DA 5C2XA 4MB5A 3GD6A 3BO9A 2Z7KA 1UMLA 1LPFA 1UR1A 1GORA 4MY9A 6XIMA 1PZ0A 4QBXA 1WDSA 4K36A 3CHDA 4HMNA 3W1NA 1YHTA 1M7PA 5A3HA 2OMAA 4IP5A 3CM4A 4E4PA 3WIJA 1ECEA 5DO8A 3TR9A 4C6LA 4QSHA 5DY3A 4UQBA 2NLYA 2ZZ0A 1KFWA 2D24A 3WD2A 2WC3A 4EAYA 3BW2A 2VZUA 4W7WA 1V93A 1E73M 2Y7DA 1UOKA 3OLIA 1EO5A 1XM3A 4LVAA 2XU2A 4ATDA 1QBAA 4V33A 3WLQA 1VBJA 3TTYA 5E5CA 5D38A 1TQJA 3V18A 4HYRA 4ACYA 3VM7A 5FAGA 3JUGA 4KCWA 5AYIA 2O4QA 3CGDA 5D33A 1GYMA 3OIXA 3EWYA 1L6WA 4OUEA 2E7FA 1A5OC 1VEMA 4H4UA 1GZGA 3R13A 1EJWC 4UUIA 4LVGA 4OV9A 4JTIA 2Z7GA 3QKEA 1E0VA 3NO3A 1GPWA 1X6LA 2BV9A 2BGSA 3BSHA 3KDOA 3W73A 3NQMA 3IJIA 3DI0A 1TPC1 1DIDA 1G0CA 1JRBA 3M43A 5CPNA 4AZ6A 2E8YA 3APGA 4QJ4B 3GY1A 2VENA 1IIGA 3DHUA 3BLEA 4HA3A 3W70A 4YN5A 3OO2A 4GNKB 2PF0A 1KRCC 1RP9A 1BZLA 1HKJA 2PWVA 2VX6A 1GRHA 5FD0A 1F3XA 4ERGA 1PZ1A 4IGSA 1LOSA 1I2PA 1ECQA 2DSKA 4NG3A 3AUJA 1H7PA 2Z6JA 4P7OA 3CNYA 1FH7A 4H04A 3WDRA 4DWSB 3NQCA 4XD3A 2OGJA 2XISA 2Y5JA 2A3AA 2PWGA 4YTTA 5JBFA 5E0FA 1CBGA 3QN3A 1OYAA 4YVXA 4BY3A 4J28A 3W2KA 3SCTA 4QRNA 2INEA 3M0LA 4PMJA 1OFRA 2WKJA 8XIAA 4OUIA 2WMGA 1MEWA 5CC3A 1RVGA 1TTQA 5I6SA 4OGZA 1FFRA 1KBIA 4FNSA 3B06A 4MG4A 1MUCA 2QUUA 2GDQA 1JYVA 3B0PA 3QW3A 4AD4A 2MNRA 5BRPA 1LT8A 3GTIA 1S39A 1J5SA 1XI3A 3P0WA 3CAQA 3T4WA 2V5CA 1ZZMA 3SQSA 2D0GA 3CU2A 4MADA 4MFDA 5EMUA 1GOWA 4D6CA 3QOKA 4IZGA 3UNDA 1DHKA 1Q3NA 3TJ4A 1Q6QA 1DV7A 5D09A 4TIMA 5DCDA 3CMGA 4E8DA 3W1MA 4LH8A 4M6UA 1NOWA 1EBGA 3IUIA 3KBNA 5G5GB 1EGVA 2ZWZA 3WLMA 2DW7A 1JZ4A 2XH7A 1CXFA 2QKFA 3WL0A 1VFOA 3RHGA 3VOIA 3TK7A 4OU1A 1H11A 5CG7A 4JTFA 4DM2A 2ZXBA 4Y7EA 2Z1SA 2WLZA 3PPCA 4PA8A 4RE3A 2OQHA 5D2VA 2REQB 1UR0A 3U4AA 3K8LA 3QXBA 3R7MA 2F2KA 3N9KA 4HT3A 3L4VA 4D6IA 1NFBA 3Q4DA 1RUSA 1VENA 1BRLA 2FZNA 1WB0A 5I78A 1GRAA 1XS2A 3DGZA 1GQKA 2CBIA 3IJLA 4KIRA 4ZO6A 1N82A 3EANA 3LRLA 3GXIA 3KS5A 4C5YA 3CJPA 4AZIA 1KBJA 3I4EA 4UC5A 1OGBA 3EGJA 1JUEA 3PTKA 1XHGA 3E3HA 3ZJKA 1XIGA 1TMQA 3HGJA 3QQ1A 2RJHA 4QQ3A 3NYZA 2EF9A 3NG3A 3ZQ9A 3GTNA 4Y9PA 4DM1A 2V2CA 3CZEA 4YS1A 2E09A 3EWWA 5A6TC 4NF7A 1JZ6A 4J3SA 1PBGA 5I79A 4ONVA 7PTDA 1K8XA 3UXKA 1E56A 3XIMA 4Z2GA 2Q8LA 4EPDC 3C4UA 5IDZA 1QBBA 2WB5A 3GG8A 1UR2A 2V5KA 2V2DA 2PDFA 4KWSA 5FF2A 1QNSA 4B9YA 4AZCB 2NVKX 4J57A 1TPWA 4HA4A 4NT0A 4JTEA 5DXYA 2FTYA 1NELA 3T05A 5ABFB 1KXHA 3K8MA 2YA2A 1BTCA 3GIYA 1VB9A 4DWDA 3CIWA 2OYMA 3O06A 4MNKA 4BI5A 2FPYA 2G3FA 3LCWA 2X8HA 1F76A 1Q5MA 1OFDA 4V1XA 3W84A 1J11A 3A7RA 3CIXA 1FCUA 3CBWA 4PUDA 5CSSA 1V4YA 1RAKA 1TREA 3DENA 4EQWA 1OFAA 1KFCA 3HPFA 2CXEA 2CZFA 1XCFA 3BCJA 3ABOA 1GK8A 5AHNA 3NZGA 4I6KA 3IEBA 3WUBA 4GYFA 4CNUA 4N6EA 3MWAA 2CFYA 3Q45A 2X2YA 3UXAA 1MZHA 1YQZA 1RJRA 4DF2A 5M2FX 2R1KA 2G3IA 1X2GA 2CLMA 3S47A 3VKAA 1XC4A 4DF0A 1E6PA 4JEQA 1I60A 4UFIA 1TJ0A 3TMLA 1K4GA 2D3NA 5B7YA 2QULA 2GR3A 3QHMA 4R7OA 3R43A 4O16A 1UUOA 4GG9A 4TMBA 5DF0A 3HV9A 1WO2A 4O17A 3M0IA 2VD9A 4RDWA 1ZBKA 1DWHM 2Y2WA 4JIIX 1F4AA 3WUGA 1N7KA 4NAEB 2DIEA 2FKPA 1TTJA 5A8PA 7ODCA 2PDWA 3GBDA 2DSWA 2G4JA 4ZZ9A 4TUFA 1S38A 1TR9A 5XIAA 4H9ZA 2GL5A 1VHCA 3QR1A 1Y65A 1GVIA 2ZXAA 3W27A 4S3AA 1NIUA 3TONA 3PG6A 4ADTA 3O6AA 2CLHA 3W6MA 3N6HA 1A0EA 1GVEA 1JD9A 1J0YA 5F7UA 1PTDA 1GWJA 3GTHA 4HHMA 5H6HA 1L6GA 2WPCA 3GH7A 2KAUC 1SFLA 5HUPA 2W92A 1UBSA 3KCLA 1EPXA 5HJXA 3MSGA 5KEZA 3WZ0E 1QI5A 1I4NA 2HISA 4ASTA 1H60A 4V15A 3B9JB 2Y1HA 2W67A 3W7NA 1O4UA 3LHZA 4D6JA 4UR8A 3W7HA 3NRZB 3WK3A 4H4IA 1DXFA 5B80A 3PSVA 3UZJA 4A6GA 2QW5A 3GR4A 3TXVA 3SFKA 4I9JA 2BHUA 4O13A 2V38A 3EWCA 1B5TA 2ACUA 2YB1A 1FKXA 1BFNA 1SM9A 3FSUA 3Q6JA 4IX0A 1RCOB 4KIEA 5A6SA 1HGYA 1GVFA 3M6YA 4U2YA 3KTCA 4NJGA 4IM4A 4YVVA 3NM1A 1ITCA 2PS2A 5DELA 2J74A 2W27A 3BG3A 1F5ZA 2XVLA 1E40A 4K68A 3USBA 4LXFA 3VCNA 2R6OA 5C7HA 4QDWA 4J5NA 4UFHA 3NL5A 3DK9A 3GAYA 4QM1A 3H22A 3FJ6A 2VFHA 1Q6GA 1H2IA 4PTXA 1TE1A 4IFOA 5DXXA 3ZT7A 4F3HA 3GU2A 4LOCA 3W4RA 2HQMA 4W5ZA 2OELA 1SW0A 2C1IA 4ZFCA 3GFYA 4CVWA 3VX1A 1L0PA 3GTFA 1DWIM 3W0KA 1FWJC 2E28A 1NWRA 4IJCA 3S1XA 4O1DA 4S2BA 1UWRA 4JBRA 2EQ9A 2FB2A 1X96A 3GX9A 4OBTA 3ZYZA 2W5FA 4J56A 4U33A 3BQ5A 3S6DA 4NILA 3DG3A 2ZDSA 5GNXA 1E1CB 2HE5A 3P5ZA 4DNHA 5IHSA 3R07C 2AL2B 2ZX5A 3N2OA 4Q33A 5REQB 4HSHA 4H00A 1TA3B 3VKDA 2GSJA 2JFEX 2DZWA 1WXYA 3PZNA 1W9DM 3AFBA 1BG9A 1R2RA 3MSYA 4DI8A 1FP8A 3DXIA 1KXQA 4N4QA 1UJQA 4HNTA 4UTHA 4CQCA 3CPRA 4RJEA 2A3EA 4JTJA 2VC9A 2WJZA 3FJNA 3P82A 3BCDA 3OGVA 4KGJA 4ZODA 4YL2A 3W9ZA 4N42A 4HU0A 1YTDA 1BTMA 3GD4A 2VT0A 4DBDA 3CWNA 1TPUA 3MHGA 3A9BA 1J0KA 3W7OA 3KEHA 3UJEA 4BCEA 3B0VC 3M0KA 4I7UA 2QF8A 1E6XM 2ZADA 1KTNA 1CLKA 1BGAA 4AW7A 3TE9A 4IIDA 2CESA 1UKPA 4U4MA 3GB6A 3ARUA 5HNNA 3LGDA 1HUVA 4O11A 5CZ0A 2QUVA 2WAGA 4NX0A 3H7RA 4LWWA 5D32A 2E5BA 2DQWA 3AALA 4NAEA 2EPMX 3R8HA 5EL1A 1D2KA 2XYLA 4AZHA 4P2VA 2AGKA 1SW3A 2NT0A 4HTBA 2P10A 3KOZA 4ZL1A 4Z1AA 3PP7A 1LP6A 4K1GA 1RA0A 1HGWA 3DFTA 3WNLA 3N6JA 1Z7AA 3NQFA 1R86A 1RXOB 2PLCA 2WMHA 4H8HA 5F2IA 1WZLA 3AQUA 2A3LA 3RLVA 4NU7A 2X1RA 2V3EA 2E1DA 2GJXA 2IPJA 1V3IA 4PMVA 4WX2A 3NL2A 3R89A 1TR1A 2D0FA 4O14A 1UBPC 4HP5A 1PXGA 1KM2A 2IQTA 2CBUA 1LTDA 1ZRQA 1YDYA 1CCWB 4RW5A 3WCZA 1ONWA 4GWEA 4ZOHB 3I6TA 3QPEA 5HDRA 5ENLA 1UP3A 5FEZA 1Z8AA 3A24A 1U1UA 1WUEA 4D8ZA 4E2DA 3RJYA 2YYUA 1YXDA 1C8QA 1ICQA 3UJSA 3KX6A 2YKKA 4AY1A 3A9IA 3C8FA 4NX5A 1G67A 3E02A 4IIGA 2NSXA 4KETA 3WD3A 1KW1A 1UZHA 1I2OA 1MWOA 3LCGA 4WKAA 4PCTA 4DN1A 4O1FA 3A47A 5AKQA 3IK2A 7A3HA 2A3BA 4DBEA 2F9RA 3RNDA 1K7FA 5AHLA 1UZ4A 2GVYA 1L8PA 1FO4A 1BXCA 1CIUA 5G5IA 3IIPA 3EWZA 4MJ2A 1XKJA 4UNKA 3TX9A 4PUKA 2BC0A 1AQFA 1JJKA 5CPQA 4DJFD 4ACZB 4R85A 3V5OA 3V1HA 3WEMA 5I3DA 4M3PA 2QCCA 4LRSA 4Y8FA 1H50A 2BB0A 4JIPA 4JTAA 1TVPA 3GG7A 2HPIA 3BLDA 1UKOA 1LRQA 3VIGA 4ZTYA 3AS1A 1T6MA 2WMFA 4PR4A 2DUAA 2UV8G 3AU2A 3EKGA 3M4HA 4JQ1A 3OGSA 1KRMA 1F6KA 4IG2A 2QDGA 1LDCA 3FVMA 1JRPA 4CCEA 1ZAIA 4W4QA 2WP5A 3TTEA 3Q65A 4YLWA 2IQ0A 3RDKA 1UC5A 4R7JA 4Z42C 5CG0A 5H8MA 1HN1A 1IT8A 3M7WA 3UG3A 4FR1A 4UTWA 1OYBA 3WJXA 4HU3A 2Z2BA 2XH0A 3W2MA 1E70M 5I00A 1GOOA 3H55A 5KVIA 3ARYA 1GJWA 1IWBA 1IQ8A 4G7FA 4AWUA 3VILA 4HVXA 2XZ9A 5CZSA 2AMGA 3EMQA 4OHQA 5HNUA 2V67A 1W9PA 1P6CA 2YFOA 2J66A 3C5QA 1XIFA 3BZJA 3CUHA 2E6DA 4IX2A 1GRTA 3VNKA 1VQZA 3EDKA 2WZMA 4J3ZA 3W1AA 1G4EA 2B7OA 3MMWA 3WQ5A 1J79A 2IKJA 2ODOA 4REQB 1BSLA 4G5DA 1WZKA 4IH3A 2EPLX 1J2WA 2YJQA 1H1ZA 3LHYA 5LNRA 2RJGA 1A5AA 3URAA 3USZA 3WYZA 1HNYA 4MVAA 1JUBA 5KZ6A 3LCIA 2XGIA 1KR0A 4ZO7A 3ALGA 3KAOA 1QI4A 3HQPA 2X8GA 4GUIA 3MS8A 1GW1A 1XDLA 3QLLA 3S83A 3GQYA 3F2CA 1EZWA 1Q6OA 1H51A 5AECA 1BHGA 3VD4A 2XIBA 1C8XA 3PWGA 3TQ0A 1XLKA 3WH9A 4Q8TA 1QK2A 4BZYA 3CUFA 3M5YA 1TJ2A 1E0TA 2VTFA 1HX0A 3HJZA 3UNTA 3OIHA 1T41A 1Q66A 1MXSA 1WXJA 1XICA 3WLIA 3RYSA 4C6FA 3H4WA 2FTPA 3P80A 2OLAA 4JTGA 2EEXA 5DMMA 4BWLC 1GREA 2V3AA 3QTGA 2BX7A 1Q1RA 2BOFX 3CH9A 1PTGA 5IXEA 1WOBA 1GVRA 4D2JA 4LUSA 4DBSA 2BC1A 1WBJA 2BY3A 2ZVIA 4DUXA 4L4MA 3RR4A 1A49A 4G7EB 3TW7A 1V0KA 4DJFC 4H9XA 4QE5A 1FFQA 3S1WA 1PVNA 2KX9A 3AWOA 3KL5A 4H6EA 3AXIA 4KRZA 3NURA 3QV7A 4QISA 2F6KA 3WLJA 4JKMA 2YA0A 1T3QC 5A95A 3S5SA 3AHTA 4URIA 4DLFA 4F2TA 2V3BA 4DO5A 4FALA 2W61A 3OYXA 3M47A 1EHAA 2YAUA 3DGRA 4DO7A 2FFCA 2P53A 1AODA 1DIEA 3N6QA 1H3GA 3R8RA 5KVHA 1OFEA 1A5CA 2VHLA 5H91A 3W82A 4PH6A 5L9FA 1A80A 4EANA 3T78A 2V3GA 5KZEA 4QTGA 1OCBA 2BY0A 3NM3A 2YL9A 1F8MA 5MHBA 3WG6A 4ZB5A 2C1HA 5CBJA 1D7YA 3W1QA 3N2CA 4FZIA 3ZXWA 2DZXA 1IT0A 5J5RA 3UESA 1KGUA 4J7RA 4R27A 4CKQA 3DK8A 2IMRA 4UQ9A 3FCPA 4IXHA 3PANA 1AK5A 2NT1A 3ZMRA 2O7QA 3NPXA 3MHFA 3NQGA 3N04A 3BVJA 3R0UA 4X2PA 5JH1A 4GXMA 2YA1A 3CUIA 1OY0A 1TJPA 3S9YA 3ITXA 3IV3A 1PAMA 3IIXA 4RPPA 4LCRA 3FIGA 4O50A 1V3MA 3B8DA 5BWFA 4LTSA 1ITQA 1NU5A 4NIRA 4S3GA 3T0TA 2R1MA 4D71A 3WBEA 4TOQA 3WK0A 2RDWA 4FOKA 3A7UA 2TMDA 3SY1A 1K4QA 4RZBA 4KRTA 3CC1A 3G5EA 5KITA 1O94A 4HZ8A 3MV01 4AD1A 3K4AA 4JTRA 4D1JA 3TQPA 4JY8A 1Q2RA 2DORA 2Y5EA 1EUNA 4UFJA 5AN7A 1AQMA 1YXYA 2VX5A 3WY1A 1BXBA 1M53A 3EWBX 4CD5A 4MYXA 2X41A 5E6ZA 3IV8A 3APTA 3FA4A 1F2JA 4JQ2A 1T40A 5HMDA 3KVKA 3PG8A 1XLDA 3NL3A 3HW2A 2ZOXA 2DJXA 3TMQA 3LQGA 3LADA 4RX0A 2XTKA 4GY0A 2PI6A 4YIWA 2Q02A 4K39A 4Q4RA 3V35A 1LUCA 1ZXIC 4MWAC 4K8EA 2P3EA 3IARA 4ZFMA 3THQA 1Q7ZA 4IISA 4EWJA 1WDWA 2VEKA 1XH1A 5EMYA 1TJRA 5TR3A 1GQIA 3DKLA 2AQVA 1I45A 1UWSA 1CB2A 4DYKA 3BC9A 1RLDA 1UCWA 1ZDLA 1VFMA 3MTWA 3SCWA 3GH5A 3I7SA 3VDHA 1OF6A 2OKTA 2YL6A 4RXGA 2OX4A 4PUUA 1YADA 4GI4A 4E0CA 3JVAA 1CGXA 3AMZA 3SRKA 5CGTA 1GVYA 2HVOA 1V3LA 5FSEC 2CETA 4Q4KA 1BD0A 3S0CA 4DELA 1ZPTA 4ECLA 3WUFA 4GX9A 3O63A 2NV9A 1Q6EA 4V1YA 2R1LA 1TVNA 2PTDA 2PGWA 2PDPA 3NVZB 3VOHA 2OTDA 3G0XA 3AYRA 3BGAA 4Z2LA 1R85A 3W7JA 1CB7B 4JQAA 4X9YA 4PYSA 1F3EA 3D6NA 2PWHA 3F03K 2A6NA 4TXEA 5GJMA 4JIQA 2AOSA 2NQ9A 1S3HA 1NFPA 5K9CA 3BAYA 2TSYA 1KGWA 4GACA 4JTCA 1HKWA 1IEWA 4M7TA 4O28A 3W02A 3OLDA 1RD5A 2NWSA 3VMOA 5EYWA 4L6HA 2FFIA 1HJWA 2NQLA 4JX4A 4MGGA 3CV1A 1HJSA 2ZX6A 3CGCA 5A94A 2Y8KA 1AQHA 2ISFA 1KM3A 3TTQA 5G4HC 1S5MA 1UYQA 1NSJA 2ATSA 4XAPA 3GVWA 2D20A 1A4MA 3UCQA 2E3ZA 2X0SA 1CI1A 1S5VA 1VPQA 3VOCA 3DEQA 3LTSA 5JU6A 3RXZA 1OFBA 1VEOA 3IPWA 3UWEA 4MLRA 4B15A 1OCNA 1M01A 3TSMA 3QMTA 1KBBA 3CQKA 3PWIA 2ISVA 1F6PA 1UW9A 1XYMA 3QMRA 2Z24A 5J8LA 1FRBA 1XKYA 4JCMA 2F5ZA 4NAFB 3SM0A 1QNRA 1CGWA 1POJA 3CWOX 2YCJA 6TIMA 1DJYA 2JF6A 1R5YA 3DECA 1SW7A 1RPKA 4MB4A 5TD4A 2V5BA 4CD8A 3L5LA 4EF8A 2XIMA 4IGNA 1WX0A 1OX4B 3E2QA 3W2JA 3ZJ7A 2O55A 1EC8A 1UB3A 5C9UA 1QNVA 4PB3A 4XIMA 1FA2A 4NZ4A 2ZQ0A 4DIAA 2WNWA 4QS6A 2QCGA 2GGEA 4RZ4A 1AZ2A 2CLEA 1LLWA 3ZS4A 1OX4A 5F1UA 3TWBA 5LNWA 2J8GA 4FNQA 3MC5A 4A8NA 4Z2JA 1KKRA 6XIAA 3RCMA 1FWBC 3A5VA 3PAOA 2OSXA 4FK9A 3TC7A 3MDWA 3PBUA 3GD3A 1G7VA 1XR2A 2F6XA 4XISA 1MSSA 1W3HA 4HPXA 3BXWA 3HGSA 3ENLA 3SCOA 3DFQA 3VOJA 3NVYB 4H41A 3TTOA 4R33A 1M6IA 1Q2SA 4H19A 1QOQA 4KS0A 1C8VA 1K6WA 1JGIA 2PC4A 5BRQA 2WM0A 1E1FA 1FWIC 3DBNA 1KFJA 4ORIA 1D3CA 4H4ZA 3UP8A 1T99A 1OX5A 5CPTA 3B9AA 1ZFJA 1TYTA 3KTSA 2QAFA 1FTXA 3SRHA 3VGGA 1SB3B 1EEXA 2X1UA 4C5ZA 3E2SA 2XN0A 1ZUAX 3T42A 3UERA 3PPGA 2E0PA 2EG7A 2YLAA 4FF5A 4WJXA 1D8CA 2ZFAA 4MPQA 2NV2A 2C3DA 2WSYA 2VO5A 2WO5A 4AXNA 3VZZA 3T0BA 3ZZ1A 3QGKC 4ZENA 4LUJA 1XYZA 1NPXA 3CUJA 3LXBA 4H7ZA 2QEZA 4XVDA 3AO0A 2Y5SA 5EMLA 4N9BA 2XG9A 5I03A 1W3JA 4GVHA 4JX6A 1DQUA 2FIQA 5EFDA 1OC6A 3POHA 2VC6A 3DK4A 6CGTA 3VZYA 2A79A 3K1DA 2ZDRA 4HHLA 3BMWA 2E6YA 2V30A 1JULA 3VM5A 2QCDB 2H3BA 3UU0A 2C0HA 1CX9A 2OOFA 1K7EA 3BAKA 4U31A 3R58A 1C9WA 4BKNA 5LA0A 3FNDA 3G1YA 3O1NA 2G8ZA 4JFUA 2RDTA 3M6DA 1J8VA 3JS3A 1UWAA 3WQ8A 1H6VA 2EQ8A 4G8TA 4MMWA 1XFBA 2DU2A 4LNCA 3URBA 2EPNA 4C1LA 4QR6A 1M6JA 3GTXA 3RAOA 1WKEA 3VGDA 2PCEA 3KP0A 5DN1A 3VNMA 5C9XA 3CV6A 1HKVA 4XO6A 1NARA 1V8EA 3G3DA 4LYPA 1DXLA 4EQRA 2BY1A 3LXCA 4NNCA 1D3GA 3GFXA 4PMNA 1V6VA 4CGTA 4I5RA 1J2BA 1E3XA 2J9YA 3IC9A 3IJ9A 1RBAA 1HW6A 1B3VA 4A2SA 1XRFA 3CO8A 2NQZA 4O8AA 3TA9A 2PEVA 4H4SA 4GLEA 2QUMA 4EXBA 1VLIA 2QZRA 3T2PA 4B9ZA 1CENA 1LT7A 2E9MA 4FMVA 4FNRA 1U33A 1I6NA 4Q8NA 3AZTA 4LUTB 2WVVA 1ONXA 3I3EA 1TV3A 4Z0JA 4A29A 6PTDA 4TV6A 5TNVA 2Z2UA 1XDMA 2G3JA 5C9RA 3H4XA 1OF8A 2I1OA 4LUTA 3VU2A 2CHRA 4P8XA 3G18A 1QI3A 3WLNA 2PUZA 1JRCA 5FOOA 1V3KA 1FVPA 3WJSA 2BHZA 2TRSA 4HB7A 2NVAA 3WQOA 1MFVA 1WZMA 1OADA 3TYDA 2PLKA 2FDMA 2DZSA 3H2NA 4EE9A 3KL0A 4LS2A 3G1HA 4LEQA 2VQTA 1E43A 3GHSA 3O6CA 3HQOA 1POKA 1FDZA 2QQ6A 2C7FA 2PDMA 4JIHA 5EKYA 3T9PA 4XBSA 3RCYA 4AU0A 5LIUX 4HK5A 1KKOA 3T8QA 2GQAA 3CT2A 3V7PA 3MMDA 3PJTA 2ZUVA 4C7DA 1W37A 6TAAA 2W3RA 4RV3A 4OT7A 1F3PA 3L5OA 1D9EA 2EHHA 1TIWA 4QNWA 1QO2A 3WH8A 3BJSA 3CAWA 1UWQA 1ADDA 4P7RA 5TIMA 4H6QA 3UZ5A 1BAGA 3BAXA 1PPIA 3WQGA 4GRTA 4MM1A 3RRAA 3HB9A 2G5WA 1XYAA 2VOTA 3NYDA 5J5DA 1W8GA 2VRKA 3PZ9A 3P74A 1E6NA 1DKWA 4L56A 3IVTA 3L0GA 3SO7A 4GABA 2CBJA 4O1EA 4NSBA 2MANA 3KW3A 2WJDA 4PCFA 3QZ6A 1RD6A 2VCBA 1K8YA 1JZ3A 1NF0A 1W3TA 3ZLFA 1W5MA 3MVTA 1US0A 3W26A 3V36A 2EO7A 4PTNA 4IT1A 2PU0A 1RBOB 1QFEA 4MF4A 2I56A 4R34A 2ZICA 1HL9A 1AW1A 5XIMA 3RO8A 2ADAA 3H7VA 3QY8A 4HZ7A 4UQDA 1ZJBA 2GDUA 1GUVA 3TAKA 2WPGA 1EC7A 3MUAA 4JY9A 3GVQA 2PWUA 3LM3A 2W9MA 3UPWA 2B0MA 3HV8A 2J47A 2ZRYA 4GNVA 4L1WA 1JDEA 2J79A 5DCEA 5FA5A 3IUDA 3EOLA 1BGGA 3W7MA 4Q32A 1G5AA 4HPHA 3DIPA 3KE0A 3LD5A 3WK2A 3LSBA 1YMYA 1ODUA 3WQ6A 3UXLA 2D2JA 4R88A 1D7FA 4GKTA 3TW9A 2YDRA 4O1AA 1V02A 4JTDA 1ZNNA 4NHVA 2XJ7A 4LUYA 2EPKX 3NVWB 4IMCA 1TKKA 1PL9A 2OEKA 4B4FA 4RUBA 2FB3A 1Y8BA 1B4EA 1K77A 5FS6A 3V75A 3NO1A 5DY2A 1W1PA 2J24A 3TUUA 2PZNA 4R7WA 2XPKA 2YVJA 2XGBA 1B9BA 1ZP3A 1KM4A 1R0MA 2X1SA 1VCGA 4CEUC 3GHUA 5E93A 3AHYA 3DG6A 1XYLA 4ADWA 1IZCA 3M41A 2QPUA 2QPSA 4DYEA 3BJFA 1EWEA 3RLUA 1FHVA 3S1GA 1NQ6A 5A6KA 1FY6A 4JYDA 5AZ1A 3C86A 5BYWA 4C6QA 2E9LA 1ME7A 1LG2A 1FWCC 5CJMA 5G2WA 1DXEA 3OBAA 5EMKA 5FJPA 1CWYA 2HSAA 4NYUA 4S3EA 5DT7A 3V4BA 1E0XA 7TIMA 3KZSA 3P8IA 4CNPA 1F61A 2IXVA 1J0IA 2OLSA 1SMAA 1GHSA 1XSIA 3IIZA 1R87A 3WQ4A 3H8AA 1V6YA 3QJAA 4PCSA 1Q6DA 3D46A 4MDPA 4Y96A 1GPFA 1QPRA 2YCIX 1K9TA 4H4RA 1XQKA 3NQEA 4WQ6A 2GWNA 4AWSA 1GCYA 1LLZA 1MQPA 1QUMA 4HN8A 1WCGA 3GXFA 3GDKA 3S6TA 3GRTA 4RE2A 5CPLA 1KD0A 3GKFA 8A3HA 5HINA 1EFZA 2GR2A 5LKYA 1UKQA 1EB3A 3VFLA 2ZRVA 3U2ZA 1TRIA 1YBQA 1LVLA 2RFGA 3FV9A 4GI9A 3OG3A 2NW0A 4DJDD 3LX9A 4YYCA 2PDXA 3W1RA 3W1UA 4MKSA 4DNMA 2QJIA 4NUWA 3HO8A 4L4OA 3WLHA 4DUVA 1O5XA 5LYRA 2WHMA 4AF0A 5HANA 3L2MA 5B7ZA 1B3WA 2QDHA 1IEVA 2D2GA 4WXYA 5HJLA 3W23A 1XLGA 1K1DA 5I07A 4IUOA 2FJKA 2QV5A 5CBIA 4KPLA 3IJQA 3KS6A 2VZVA 1V02E 2XINA 2YCLA 4C6OA 1MNSA 3VINA 1EPVA 1UQZA 1C8YA 3VUPA 4CN1A 1ICSA 3FOKA 1ZCOA 4IIBA 1Q6RA 1NH6A 2BXYA 3DU0A 2CZ5A 3R79A 1QAPA 1IV8A 1E1EA 2Z2AA 3NSMA 4B2DA 1JDDA 5E09A 2J9XA 4LS0A 4GINA 3W7EA 5DX7A 1WUFA 3UA3A 4CQAA 3PF3A 1WDPA 3TYCA 4K7VA 4J3VA 4Y9NA 5JXQA 1XV8A 3C3UA 2CERA 3ZR4A 4C6JA 3SJNA 3NQVA 4XG1A 3SIMA 2V82A 1OIFA 2D22A 1R3YA 3A5FA 2ESCA 2BCPA 4YJ5A 3BPWA 3FYPA 3B9NA 3TSBA 5LXEA 5H8PA 4JD4A 1N2VA 4O1BA 3GAKA 1DE5A 5D30A 3VOGA 3CT7A 2PE4A 1SZRA 2WHLA 4XAGA 2QCMA 3C56A 1DWAM 1AMKA 1CGTA 1UA7A 4WSKA 2I5GA 5I09A 1FWDC 1W54A 3R0DA 3Q58A 1RQBA 2FHBA 3BARA 4MLJA 1OFOA 1GXFA 1BXNA 2A5HA 3UWUA 2X40A 2C91A 3D3AA 2CLOA 3FKRA 4PRRA 4BQ5A 4Z1DA 4M80A 4UMBA 1FWNA 3AISA 3QGVA 5IFTA 1N63C 2J8FA 5EA9A 1YNYA 4IP7A 5BROA 5BU9A 3FHAA 2C6QA 3W1PA 3WUEA 1PKYA 1QHOA 1TB3A 4B5VA 1E3ZA 2VELA 5G4WA 4PUMA 3U3HA 4GGBA 4F40A 3VAVA 5HXMA 4GJ1A 2GGHA 4HU8A 1A3XA 3GIQA 2CHOA 3STPA 2OOGA 3NQ2A 4PEEA 4ZE5A 3CQHA 4ZSUA 3IVUA 4D6GA 1WYGA 4QCFA 4IJRA 2GVGA 1CEOA 1EJTC 2WWDA 1VLWA 1G4SA 2D3LA 3WLKX 2DUXA 1GOXA 2C71A 4HBKA 4DZHA 4ZQMA 4ERAA 3P7YA 3IS4A 4M24A 2MUCA 2RH9A 2CW6A 1S2VA 4DF1A 3M0JA 5AC4A 4C90A 4CN4A 4WDTA 4FF7A 1K3UA 1EHNA 4Z2HA 4LS1A 1E6QM 1X6NA 2OWXA 4MUZA 2HVNA 2J77A 1XJBA 1ZAJA 4Q4QA 2QGYA 3T0AA 2REQA 4IPIA 3HQ1A 3ISIX 1KXVA 2INZA 4K37A 4U5KA 3CHCA 3SUVA 1ISXA 4FLOA 1LJYA 1DJGA 2Z25A 3DUGA 4NZJA 4XUGA 4DJDA 4N4PA 2WPEA 4L4PA 1C7SA 3ABZA 6A3HA 3O7UA 4BS0A 3F5LA 2GUYA 3TLQA 1GZJA 4MZ1A 1G94A 1IXOA 4NRSA 3DFSA 4WR3A 1YDVA 5HWMA 3LLFA 5FL0A 5M3WA 1CLVA 5AC5A 4YPJA 2J7DA 3BCFA 4W85A 1TV7A 2OLHA 1AH4A 2H9AB 3F5KA 1ITUA 1LL4A 3ZWSA 3NR0A 2AAQA 3E0VA 3RX2A 2JIEA 3N2MA 1HT6A 3UWQA 1JDFA 4GD0A 1BLIA 4AHPA 4UTJA 5HMFA 3OG2A 2DT2A 4KCTA 4Q4SA 3EDFA 4DXKA 3LPOA 4TO8A 3RMJA 2VYOA 4ML4A 3STCA 4GYKA 1G01A 2WZIA 3FSTA 2IUZA 2P8BA 3EKZA 1TVLA 2YR1A 4JS3A 1Q45A 1F73A 3S2JA 3CXBA 4APNA 2VEPA 3B0YA 3N18A 2VCCA 1C91A 4FB7A 5AZ0A 3PBVA 1K6AA 5JRBA 4GHRA 4JNZA 4F8XA 4B2DD 3OBEA 4E6MA 1QHPA 1OQFA 2JBMA 4PSPA 3V5CA 1HP4A 1EJVC 1TO3A 1SQ7A 2NWRA 3PZMA 3UZYA 1R38A 3WQFA 4HYWA 3AXXA 3FGCB 1ZKQA 2WJFA 4JTQA 1ONRA 1DORA 2Y24A 3VVGA 5K2ZA 3BH4A 3RO6A 1ISZA 3PR2A 1E4NA 2JF7A 3UY8A 1KM0A 1F07A 1TG7A 1OIMA 3VKKA 1AL8A 5AYYA 1PE1A 2Z1WA 1IXQA 4HA1A 1XPYA 1D7KA 3E0LA 4JN6A 4TR9A 3E0IA 3AUOA 2OWWA 1R3VA 4AD2A 1NEYA 1J6OA 3G0UA 3JRKA 1H49A 3RM9A 1BWVA 2YPIA 2Z26A 1WKYA 3UZWA 1UD3A 3RILA 3E49A 3RLGA 2J6VA 3W72A 2W91A 3MMTA 4IICA 3VGHA 4A3UA 2VGIA 2V68A 2WSPA 2AQWA 2QUNA 1YLVA 3NVVB 3D9XA 1FWEC 1H1NA 2QVNA 1EYEA 1UA3A 4JFVA 4H2CA 4S3CA 4H9UA 1QW8A 4OVXA 2PDQA 4GXPA 4P7NA 1XISA 2V2HA 3STFA 2CZVA 4H8NA 1KCKA 4AY7A 2R8WA 3ECQA 3QV9A 4GCXA 4GJIA 5E0KA 1U30A 2P0IA 1J4EA 1HIZA 2EPHA 5FACA 4A3RA 5KINA 3W24A 5EU9A 4ZE4A 1HXJA 4I7WA 2XH4A 4K7ZA 3GUGA 3U8GA 3QBUA 2GJPA 2ISSA 4F2BA 4EPBC 5BMXA 1FCBA 2E1WA 2VMFA 1LOQA 5L6UA 5M17A 2NX9A 4GC4A 3MCOA 3CGTA 3A12A 4FDCB 1AH0A 4FS9A 1JXKA 2YL5A 1AW2A 5F4WA 3NOYA 3SRDA 4GIRA 3RITA 1NHRA 5FEPA 1Z48A 5CLWA 1E72M 4CUCA 1EC9A 4QLLA 2YDSA 1OGSA 2H8ZA 4P8VA 3SECA 3LDVA 3KBMA 1XLCA 1EIBA 2W63A 1JYWA 3SADA 1TCDA 4M1RA 5FCZA 2J13A 3LSCA 1BF2A 3BLPX 2GJRA 2FH8A 4AEEA 4QG9A 3WQWA 1V0LA 3C2EA 1R2TA 3PULA 4Z17A 2AL2A 4BQ4A 3W28A 1FECA 1LF1A 2HK1A 4LUIA 3TIMA 1XSJA 4WJ8A 3W53A 1V3HA 3VCRA 4JIEA 3OPSA 1ZAHA 2QNEA 3PB0A 4HKPA 4XKYA 5A8MA 5D2YA 3HFTA 2GQ9A 3TP4A 4EACA 4QXIA 1RQEA 3KBJA 1QTWA 1QW7A 4AD3A 3U5YA 4AVNA 1PB0A 1OFPA 4LX4A 1OJXA 3CZKA 3LB8A 2QR6A 1UZ1A 2W55A 1KR1A 5H1WA 3AROA 2RKXA 5I23A 4F48A 1OX6A 5A8NA 5LNVA 4PB5A 2D69A 2W0UA 3DFHA 2X7WA 2PBOA 1M1BA 1B54A 1MVYA 2CXGA 3ITCA 4RNFA 1HJUA 3OQ8A 1Z69A 1OVDA 4PUJA 3GLCA 4K38A 1TV4A 4PUNA 4Y9MA 1VFFA 1Z44A 4ZQRA 3G3MA 3SFWA 1PDYA 3ANUA 2G97A 2EAWA 3PY2A 4PZVA 3K13A 3GXNA 3JZUA 4AMCA 3W81A 3WDIA 3LMYA 1GRFA 4EWND 3IWPA 5LIYX 2VX4A 3RX3A 5U1OA 3PBMA 1A5UA 4WLCA 1H61A 3MBDA 5A2AA 4UOZA 3G0SA 5FS7A 1YXCA 2R24A 3S2MA 4IMAA 3WFZA 1XBZA 2ZZ2A 4KBXA 4UNIA 4HNLA 3QPYA 4E2VA 5C70A 3YPIA 1N61C 2AAMA 4PUWA 4X0VA 5C7VA 4NAFA 5SWUA 1SUXA 1KXTA 2VRQA 2RHGA 2C0AA 2YBUA 3FKKA 4XX6A 3GRSA 3T2QA 3TFXA 1UOZA 3FXGA 3WBWA 2VEGA 4O1CA 4BF9A 1PX8A 4DZIA 4NJIA 4S3DA 1B3OA 2YVFA 3MY9A 2C15A 4MHBA 1S5WA 4FNTA 4XTIA 4DLMA 2ZUNA 5DFAA 3WEOA 2YOCA 1CYGA 3MBFA 1UH2A 3MJYA 4RE0A 1P0BA 2W3ZA 5D04C 3MZ2A 3ES7A 2OWCA 2KZHA 4XB3A 3R11A 4N2YA 2FZ9A 3NXLA 2A7PA 4MB3A 1WDDA 4MPKA 1XL9A 2NXGA 1F8IA 2X8RA 4ZVJA 3IK4A 4EMJA 3RIKA 3KOWA 3P3BA 2AQOA 1MW2A 5GVJA 2RUSA 3QR0A 4MOZA 1YTKA 1FWGC 1J01A 3GS6A 2VNCA 1HZYA 3BMVA 3KBSA 2E6FA 4PRWA 1CTNA 4X22A 4LVFA 1MO0A 2ZUSA 7REQA 1PIIA 2A6LA 4NP7A 4C65A 4HCLA 1MXDA 1PDZA 4EXQA 3SQMA 5HATA 3CV2A 3LMZA 1F7BA 3HURA 1EGMA 3U6WA 5F2MA 2YCLB 1W0MA 2JGYA 3MUXA 3KCOA 3NZRA 3TN4A 1HKIA 3NEHA 4RCXA 1JYNA 2VGGA 4GIEA 2PWDA 5JIPA 3H2OA 3HN3A 2Q8ZA 2GJNA 4G1NA 4YNGA 3UXIA 4DPPA 3OA5A 4MZ8A 3H2EA 3GUWA 4M82A 4BV6A 1P6WA 3NQ8A 1OZQA 3L68A 1PEZA 3LS9A 3H12A 5HWNA 2WC4A 4YVPA 3UZXA 3FAWA 1GTEA 1XH0A 5HA7A 4D8AA 5A8GA 1MRQA 1B31A 1IIHA 4DNAA 4QAIA 5HAOA 1DHPA 5A6BA 2YYTA 4DAIA 3UZZA 4PBEA 2DZVA 1GJPA 4GUGA 1XD0A 4Q8MA 3FX4A 1QO5A 4WD0A 1TPFA 1UWIA 2TPSA 4UTIA 1IYXA 2P50A 4GIAA 4C6NA 1HJQA 3W6YA 2YCEA 3DJJA 3MT1A 2VFGA 3GWQA 2XSBA 4X2RA 3UFYA 4BK9A 3IRSA 4E2BA 1UR9A 2BOEX 3B4UA 1V0NA 3S5NA 4H4TA 2Q3RA 1GEUA 2I9EA 4EXAA 1ZJHA 4Z1CA 2E40A 1G4PA 3CTLA 1TTIA 1H7WA 1R3QA 1NQKA 4RK8A 3W7IA 1VAHA 3KLLA 4NKCA 2PURA 3W7PA 4LF1A 3REQB 3CB3A 4IXXA 4NJKA 1JCMP 3RNMA 4HJFA 1QW9A 2PLMA 2YVGA 4LBRA 2BOGX 4ADUA 5CSRA 4AYGA 2C19A 3WENA 1R9YA 4O12A 1L6SA 5G1YA 1HVQA 4AIBA 1R47A 3CV7A 3BGGA 4FNPA 1X7IA 1S2TA 2WPBA 4LBSA 1E1CA 4HSNA 1Z3NA 3P5YA 4KEZA 4DI9A 4J3TA 3O8AA 3GDBA 3AYTA 3T1GA 3F4WA 2HNEA 9XIMA 4JYFA 1XCXA 1IXPA 3CQ0A 2EXOA 1WPCA 3FVDA 1XF0A 2O9TA 1H5VA 1P1XA 4W7VA 4E38A 2QMKA 5AHEA 4NZCA 3STGA 5A2BA 2A0NA 1AMYA 4H4QA 3NA8A 4ZA0A 4UQCA 1XUZA 1QVBA 4HGXA 4FSAA 1PUDA 3SY8A 2PZ0A 2G95A 1U22A 3MUIA 4TV5A 3OGRA 5BRBA 4A22A 1RJQA 1FWHC 3CEUA 4KPRA 4RR4A 1PKNA 3IGXA 3VI2A 1UD8A 4CLMA 4LNYA 1IWAA 3KDNA 3CUZA 4W89A 1D8WA 5I5RA 4INFA 2ZUWA 1XCWA 4H4PA 3TYUA 1N55A 3LG3A 3VGEA 2XHYA 4J35A 1W3KA 1LBFA 4HIBA 4US5A 2AKZA 1S7MA 4IMFA 2GQ3A 1M7XA 2SFPA 2QVHA 3MUZ1 5DMLA 5JCMA 3EX3A 5ER0A 3PK7A 1S2CA 4Q6JA 5XINA 3TOYA 1SFTA 1TJ1A 3EDEA 2WC7A 1OT1A 1V6XA 2EQ7A 4KEMA 1ELSA 1PWMA 4WZHA 5FESA 1JXJA 1H0IA 2DVTA 4UR9A 1CXHA 4R9OA 1VFHA 3JZEA 3OC4A 1E4MM 2OZTA 1H0GA 3O6DA 1J12A 4PUEA 1FHUA 2EQ6A 3LM7A 3QPZA 2W4XA 1H7RA 3VNIA 1NDVA 5TBOA 1QK0A 5EY5A 2DSUA 2W62A 5BOEA 4GY7A 4U5IA 2PWEA 2YDQA 4C6CA 2CZEA 2FLIA 3WLOA 4JR5A 4N9DA 3GNXA 5AHFA 4EM4A 3R10A 3LHWA 3VD3A 4JL2A 1X1NA 2Q09A 1H09A 1XLLA 3BOLA 2GK1A 4JHMA 4N02A 3PZOA 1EQPA 2G50A 1ZP4A 2ZX7A