3TPUE

42f3 p5e8/h2-ld complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
175
Chain Sequence
b'GPHSMRYYETATSRRGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 42F3 alpha
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 49
structure length 175
sequence length 177
chains with identical sequence I, K, Q
ec nomenclature
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tpuE00
1I1FA 2ZSVA 2GUOA 3QDGA 1KPRA 2CKBH 4PJBA 4G8IA 3I6KA 4D0CA 3PWPA 3LKSA 3GSXA 1YDPA 4JFDA 4WW2C 4X6FA 3VRIA 1S9YA 5FA4A 4NHUE 4L3EA 4FFEX 4NQXA 4ELMA 4X6DA 1P1ZA 1UQSA 1KPUA 4PREA 1JHTA 1KJMA 1I1AA 2VE6A 3O3BA 3SKMA 3W39A 3TBTA 3RUGA 3TIDA 1NAMH 3BUYA 4XXCA 3NFNA 2FWOA 3P9MA 5ENWA 3I6GA 5FA3A 1ZHBA 4MNGA 4Z76A 2NX5A 1S7XA 3KPRA 5HHQA 3OXSA 4JFFA 1W0VA 2HJKA 4ZUUA 4PDCE 3LV3A 1X7QA 2MHAA 1T21A 3CCHA 4PJ9A 1TVBA 5HGHA 4WU5A 1JF1A 3MRDA 3KPPA 1XR9A 2X4QA 4U6YA 3X12A 2J8UA 4WU7A 4QRQA 3I6LD 1E27A 1T22A 1KPVA 3RWJA 4PGCA 1EFXA 5EU4A 5INCA 3BEVA 4PJXA 4QRTA 4G9FA 4PJ5A 1DUYA 3TIEA 5B39A 4PJCA 2VABA 3FQUA 3MRHA 3VXMA 1GZPA 4CW1A 2CIIA 2P5EA 5EUOA 3VFRA 3BHBA 4JFPA 3LKPA 3ARDA 1AGBA 5EO1A 1T0MA 2JCCA 4S0UC 3OV6A 1XH3A 2FYYA 5ISZA 4L29A 2VLRA 2BNQA 3ECBA 3KYOA 2HJLA 3QFDA 4Z78A 4HV8A 1G7PA 4U1NA 4PRAA 1JFMA 3PABA 4G8GA 2X4TA 3MRBA 3PWUA 2X4PA 2OL3H 1RJYA 3BH8A 3P4NA 3MYJA 2F53A 3BH9A 3VXPA 1N5AA 5F7DA 2X4RA 3PWVA 4MJ5A 4O2CA 3TVMA 3JTCA 3RL1A 2VLKA 1S7VA 1S7SA 3D25A 1T7ZA 4NT6A 4F7PA 3MR9A 1YN7A 5D7LA 1LDPH 5IEHA 1OF2A 4U1SA 1FZJA 3RZCA 2WY3A 1A6ZA 3VH8A 1XZ0A 1S7QA 4WWKC 4U1IA 1BZ9A 4L8BA 2XPGA 1ZVSA 3VWKA 3TBYA 3RTQA 4E5XA 5DDHA 3BO8A 5BS0A 4FTVA 4MQ7A 1AGDA 4PR5A 5IB1A 3MA7A 3DMMA 4JFOA 3M1BA 5GSRA 4CVXA 1DUZA 2BSRA 3DXAA 5EFIA 1IM3A 3PWLA 5EU3A 1S7RA 2FO4A 1T7XA 3RGVC 1FFNA 2X4UA 4NO2A 3VFNA 1OGTA 3SDCA 4F7TA 3KPSA 1G7QA 2AK4A 3OX8A 4GUPA 5INDA 1HSBA 5L2KA 5C0GA 1EEYA 1UXSA 3UPRA 3D3VA 3MRJA 1KJ3H 4HUVA 4IRJA 1A1NA 2BVOA 5C08A 3O3DA 3QFJA 1C16A 4PJDA 3TBVA 4X6CA 4L8DA 1AGEA 4N0UA 4MS8A 1HHGA 2D31A 5FDWA 1T1YA 1QQDA 3QZWA 2BCKA 1S7UA 3SJVA 5IVXA 4U1MA 2ZSWA 3GSUA 3JVGA 4EN3C 3JTTA 1HHIA 1P7QA 3RWIA 4QRRA 4PG9A 4PRIA 5C0EA 3FQTA 4ZUVA 3FQRA 1NEZA 5C09A 1WBZA 4N5EA 3GMOA 1I7TA 3IT8D 3C8KA 3L3JA 2AXFA 1MI5A 3AM8A 4NQEA 3KPMA 1S7TA 1AGCA 3DX8A 3ILQC 2AV1A 4MXQA 5SWQA 1QSEA 1FZKA 5E8PA 5E9DA 2BVQA 1N3NA 1CD1A 4MVBA 3TO2A 1S9XA 1I7UA 2DYPA 5IEKA 3E6FA 1AGFA 5MEQA 3VXSA 3E3QA 3KYNA 5D2LA 5BRZA 5MEOA 5HYJA 5C9JA 1QSFA 3ARGA 4O2FA 1VACA 4V3EB 4NNXA 3H7BA 3ROOA 1AO7A 2HLAA 4G9DA 3UTTA 3WUWA 4N0FA 5HHOA 3S6CA 2X4NA 3VFMA 1JUFA 1SYSA 1M6OA 1ONQA 4IIQC 4PV8A 3LN4A 4PJHA 1ZHLA 2YEZA 3LKRA 5AD0A 5JHDA 4Y4HA 1K5NA 2X70A 4UQ2A 1RK0A 1QEWA 3MRLA 4NO5A 1BQHA 2BSSA 3KPNA 3P73A 3KLAA 3O3AA 1VGKA 1I4FA 5E00A 3B3IA 1LP9A 3H9HA 4PJGA 1ZHKA 3RWCA 3LKQA 1YN6A 3L9RA 3FOLA 1CE6A 4O2EA 3D39A 3KXFA 3MRRA 3L3IA 3ES6A 4ZUTA 1B3JA 3VXOA 1HOCA 2UWEA 3V5KA 3CPLA 1E28A 3MRIA 3FTGA 2A83A 3BP7A 4GKNA 3FQNA 3ILPA 2PYEA 3QUZA 5B38A 3L3HA 3UTSA 3TBWA 3L3GA 4QRSA 4EUPA 3REWA 3HE6A 4GKSA 3GSRA 1T1ZA 3FRUA 4NO0A 2FZ3A 3O9WA 2E7LE 2C7UA 3L3DA 4U1JA 2ZOLA 3MRQA 3GMMA 1YPZA 2X4SA 1GZQA 5IROA 3IXAA 3QULA 5F1NA 3VCLA 1Q94A 3QUKA 4L9LC 1HHHA 1T80A 2P5WA 3BEWA 4ZFZA 1MHEA 3W0WA 4JRXA 3E6HA 3OXRA 1SYVA 2BVPA 4LHUA 4PRHA 3TN0A 3LN5A 3HCVA 1S7WA 1T7YA 1S9WA 1I1YA 1AKJA 1ZS8A 4HX1A 5C0BA 2AKRA 2BSTA 1T1WA 4JQXA 3PWNA 4MNQA 4U1KA 3ROLA 1DDHA 3MRCA 1B0RA 2Q7YA 1XR8A 1Z5LA 3O3EA 3CZFA 3WL9A 3SDAA 1K8DA 3LKOA 4ZUWA 3UTQA 3VFSA 3PWJA 3MRFA 3HAEA 4JRYA 3H9SA 5IB4A 2F54A 2CLRA 5J1AA 1G6RH 5ACZA 1TVHA 4NQVA 4L3CA 5MENA 1FO0H 5D9SA 3BGMA 5HHMA 1LEGA 3HPJA 4LCWA 1T20A 4E0RA 5H94A 4MJ6A 3FONA 4F7CA 1QLFA 3WS3A 1KTLA 4G43A 3B6SA 1HSAA 2H26A 2GJ6A 4NNYA 5EO0A 1JE6A 2V2WA 3P4OA 4Y2DA 3HG1A 3SCMA 3BW9A 3TJHA 5L2JA 4Y4FA 1JPGA 1FG2A 3D18A 3MRMA 4Y4KA 1VADA 3GMRA 3GJFA 5IB3A 2GAZA 3BZFA 2HN7A 3FOMA 5C0IA 4WUUA 3P9LA 3QUXA 1EEZA 1ZT1A 4PJIA 3V5DA 4PGBA 4L8SC 1RK1A 4N8VA 3HUJA 3QDJA 4PJFA 1DE4A 3TA3A 3HLAA 3RWDA 1BD2A 1WBXA 3RWHA 3MV7A 4QRPA 5D5MA 3KPOA 1R3HA 5DEGA 1LK2A 5F1IA 1A9EA 3VFVA 3DTXA 2AV7A 4Y16A 4WJ5A 3MV9A 4HS3A 2VLLA 3GSVA 5C0JA 3FT4A 4PJEA 5HHNA 1FFOA 5EOTA 3TF7A 3TZVC 3WS6A 3VFUA 3ARBA 5D7IA 5D2NA 1FFPA 3SDXA 4IHOA 4U6XA 2CLZA 5EU5A 4WO4A 2F74A 4F7MA 3VFOA 1UXWA 3KPQA 4QOKA 3TBSA 5DEFA 3RWGA 4U1HA 1JGEA 1CG9A 4PG2A 3MGOA 1QO3A 2GTZA 5MEPA 2V2XA 4L4VA 5FKPA 1OSZA 1JGDA 4HUXA 5EU6A 3U0PA 1QRNA 1LEKA 3WLBA 1M05A 3PQYA 4MX7A 3KPLA 3TO4A 3P4MA 5HHPA 1ZHNA 2OI9A 3MRPA 3HE7A 5HGDA 4EI5A 2CIKA 4LCCC 5IM7A 4ONOA 3X14A 4JFQA 3UBXA 4WDIA 2NW3A 5J6GA 2VAAA 3CDGA 3VXUA 1MWAH 1U58A 2FIKA 3V5HA 2ZOKA 1OGAA 3GSOA 3C9NA 3VFPA 4UQ3A 1KBGH 3E2HA 4PRDA 1NANH 1JPFA 1A1OA 1FZMA 4MJIA 3ARFA 3RWFA 1FZOA 5J6HA 5F9JA 3MROA 3CH1A 3GSQA 4PRPA 1L8JA 3TPUE 3L3KA 3MRGA 1IM9A 2ESVA 3VRJA 1ZT7A 1EXUA 5BXFA 1A1MA 3BZEA 3RL2A 3SPVA 3G08A 3MRKA 3VFWA 2RFXA 3O8XA 3T1FA 5SWZA 1T0NA 3GSWA 2PO6A 3RWEA 5IB2A 3QDMA 4X6EA 2GT9A 1T7VA 5HGAA 3QI9A 1N59A 5E8NA 2GTWA 4QRUA 3BP4A 1RJZA 4ZUSA 3BVNA 1LQVA 4HUUA 4D0DA 5C0FA 1KJVA 4PRNA 3FT3A 5BJTA 3FQXA 3MREA 5E8OA 4Z77A 1HHKA 2YPKA 4LNRA 3SKOA 3VXRA 4NQCA 1A9BA 3QQ3A 3AREA 1QR1A 4L8CA 3O4LA 4I48A 3KWWA 1I7RA 5HGBA 5C0DA 3MV8A 4L4TA 4JQVA 1WBYA 3DX7A 1ZT4A 4F7EA 5C0CA 4HUWA 3ERYA 2BNRA 2H6PA 4HKJA 1N2RA 4N0CA 3GMNA 3FT2A 3GIVA 4NSKA 3SDDA 3CVHA 3JTSA 4ZAKA 4V3DB 4IRSA 3M17A 3AU1A 3QUYA 4I4WA 4LCYA 3T8XA 3VXNA 2CLVA 4G59A 1S8DA 2VLJA 3CC5A 3BWAA 3DX6A 4PGDA 4D0BA 5GSVA 3MRNA 1LD9A 1ED3A 3BXNA 4NO3A 4PJ7A 5C07A 3GSNH 3TFKA 5IB5A 4CVZA 1MHCA 3DBXA 3FFCA 1PQZA 4JFEA 5D7JC 4PRBA 4U1LA 1HYRC 3X11A 4NQDA 3LKNA 1ZAGA 1QVOA 3GMQA 5E6IC 3VWJA 3X13A 4PV9A 4PJ8A 1W0WA 5MERA 4PJAA 1T7WA 3GMPA 2YPLA 3GMLA 4K71B 5C0AA 3VFTA 3QQ4A 4PGEA 4PP8C 3MGTA 1KJ2H 3VJ6A 4G42A 4K7FA 1HHJA 2XFXA 1ZSDA 1T1XA 2GITA 3FQWA 5SWSA 3P77A 1P4LA 1W72A 1KCGC 3QEQA 1B0GA 1INQA 4APQA 2AXGA 2X4OA 4HWZA 3D2UA 1BIIA 1TMCA
chains in the Genus database with same CATH superfamily
1I1FA 2ZSVA 2GUOA 3QDGA 1KPRA 2CKBH 4PJBA 4G8IA 3I6KA 4D0CA 3PWPA 3LKSA 3GSXA 1YDPA 4JFDA 4WW2C 4X6FA 3VRIA 1S9YA 5FA4A 4NHUE 4L3EA 4FFEX 4NQXA 4ELMA 4X6DA 1P1ZA 1UQSA 1KPUA 4PREA 1JHTA 1KJMA 1I1AA 2VE6A 3O3BA 3SKMA 3W39A 3TBTA 3RUGA 3TIDA 1NAMH 3BUYA 4XXCA 3NFNA 2FWOA 3P9MA 5ENWA 3I6GA 5FA3A 1ZHBA 4G59C 4MNGA 4Z76A 2NX5A 1S7XA 3KPRA 5HHQA 3OXSA 4JFFA 1W0VA 2HJKA 4ZUUA 4PDCE 3LV3A 1X7QA 2MHAA 1T21A 3CCHA 4PJ9A 1TVBA 5HGHA 4WU5A 1JF1A 3MRDA 3KPPA 1XR9A 2X4QA 4U6YA 3X12A 2J8UA 4WU7A 4QRQA 3I6LD 1E27A 1T22A 1KPVA 3RWJA 4PGCA 1EFXA 5EU4A 5INCA 3BEVA 4PJXA 4QRTA 4G9FA 4PJ5A 1DUYA 3TIEA 5B39A 4PJCA 2VABA 3FQUA 3MRHA 3VXMA 1GZPA 4CW1A 2CIIA 2P5EA 5EUOA 3VFRA 3BHBA 4JFPA 3LKPA 4BKWA 3ARDA 1AGBA 5EO1A 1T0MA 2JCCA 4S0UC 3OV6A 1XH3A 2FYYA 5ISZA 4L29A 2VLRA 2BNQA 3ECBA 3KYOA 2HJLA 3QFDA 4Z78A 4HV8A 1G7PA 4U1NA 4PRAA 1JFMA 3PABA 4G8GA 2X4TA 3MRBA 3PWUA 2X4PA 2OL3H 1RJYA 3BH8A 3P4NA 3MYJA 2F53A 3BH9A 3VXPA 1N5AA 5F7DA 2X4RA 3PWVA 4MJ5A 4O2CA 3TVMA 3JTCA 3RL1A 2VLKA 1S7VA 1S7SA 3D25A 1T7ZA 4NT6A 4F7PA 3MR9A 1YN7A 5D7LA 1LDPH 5IEHA 1OF2A 4U1SA 1FZJA 3RZCA 2WY3A 1A6ZA 3VH8A 1XZ0A 1S7QA 4WWKC 4U1IA 1BZ9A 4L8BA 2XPGA 1ZVSA 3VWKA 3TBYA 3RTQA 4E5XA 5DDHA 3BO8A 5BS0A 4FTVA 4MQ7A 1AGDA 4PR5A 5IB1A 3MA7A 3DMMA 4JFOA 3M1BA 5GSRA 4CVXA 1DUZA 2BSRA 3DXAA 5EFIA 1IM3A 3PWLA 5EU3A 1S7RA 2FO4A 1T7XA 3RGVC 1FFNA 2X4UA 4NO2A 3VFNA 1OGTA 3SDCA 4F7TA 3KPSA 1G7QA 2AK4A 3OX8A 4GUPA 5INDA 1HSBA 5L2KA 5C0GA 1EEYA 1UXSA 3UPRA 3D3VA 3MRJA 1KJ3H 4HUVA 4IRJA 1A1NA 2BVOA 5C08A 3O3DA 3QFJA 1C16A 4PJDA 3TBVA 4X6CA 4L8DA 1AGEA 4N0UA 4MS8A 1HHGA 2D31A 5FDWA 1T1YA 1QQDA 3QZWA 2BCKA 1S7UA 3SJVA 5IVXA 4U1MA 2ZSWA 3GSUA 3JVGA 4EN3C 3JTTA 1HHIA 1P7QA 3RWIA 4QRRA 4PG9A 4PRIA 5C0EA 3FQTA 4ZUVA 3FQRA 1NEZA 5C09A 1WBZA 4N5EA 3GMOA 1I7TA 3IT8D 3C8KA 3L3JA 2AXFA 1MI5A 3AM8A 4NQEA 3KPMA 1S7TA 1AGCA 3DX8A 3ILQC 2AV1A 4MXQA 5SWQA 1QSEA 1FZKA 5E8PA 5E9DA 2BVQA 1N3NA 1CD1A 4MVBA 3TO2A 1S9XA 1I7UA 2DYPA 5IEKA 3E6FA 1AGFA 5MEQA 3VXSA 3E3QA 3KYNA 5D2LA 5BRZA 5MEOA 5HYJA 5C9JA 1QSFA 3ARGA 4O2FA 1VACA 4V3EB 4NNXA 3H7BA 3ROOA 1AO7A 2HLAA 4G9DA 3UTTA 3WUWA 4N0FA 5HHOA 3S6CA 2X4NA 3VFMA 1JUFA 1SYSA 1M6OA 1ONQA 4IIQC 4PV8A 3LN4A 4PJHA 1ZHLA 2YEZA 3LKRA 5AD0A 5JHDA 4Y4HA 1K5NA 2X70A 4UQ2A 1RK0A 1QEWA 3MRLA 4NO5A 1BQHA 2BSSA 3KPNA 3P73A 3KLAA 3O3AA 1VGKA 1I4FA 5E00A 3B3IA 1LP9A 3H9HA 4PJGA 1ZHKA 3RWCA 3LKQA 1YN6A 3L9RA 3FOLA 1CE6A 4O2EA 3D39A 3KXFA 3MRRA 3L3IA 3ES6A 4ZUTA 1B3JA 3VXOA 1HOCA 2UWEA 3V5KA 3CPLA 1E28A 3MRIA 3FTGA 2A83A 3BP7A 4GKNA 3FQNA 3ILPA 2PYEA 3QUZA 5B38A 3L3HA 3UTSA 3TBWA 3L3GA 4QRSA 4EUPA 3REWA 3HE6A 4GKSA 3GSRA 1T1ZA 3FRUA 4NO0A 2FZ3A 3O9WA 2E7LE 2C7UA 3L3DA 4U1JA 2ZOLA 3MRQA 3GMMA 1YPZA 2X4SA 1GZQA 5IROA 3IXAA 3QULA 5F1NA 3I0TA 3VCLA 1Q94A 3QUKA 4L9LC 1HHHA 1T80A 2P5WA 3BEWA 4ZFZA 1MHEA 3W0WA 4JRXA 3E6HA 3OXRA 1SYVA 2BVPA 4LHUA 4PRHA 3TN0A 3LN5A 3HCVA 1S7WA 1T7YA 1S9WA 1I1YA 1AKJA 1ZS8A 4HX1A 5C0BA 2AKRA 2BSTA 1T1WA 4JQXA 3PWNA 4MNQA 4U1KA 3ROLA 1DDHA 3MRCA 1B0RA 2Q7YA 1XR8A 1Z5LA 3O3EA 3CZFA 3WL9A 3SDAA 1K8DA 3LKOA 4ZUWA 3UTQA 3VFSA 3PWJA 3MRFA 3HAEA 4JRYA 3H9SA 5IB4A 2F54A 2CLRA 5J1AA 1G6RH 5ACZA 1TVHA 4NQVA 4L3CA 5MENA 1FO0H 5D9SA 3BGMA 5HHMA 1LEGA 3HPJA 4LCWA 1T20A 4E0RA 5H94A 4MJ6A 3FONA 4F7CA 1QLFA 3WS3A 1KTLA 4G43A 3B6SA 1HSAA 2H26A 2GJ6A 4NNYA 5EO0A 1JE6A 2V2WA 3P4OA 4Y2DA 3HG1A 3SCMA 3BW9A 3TJHA 5L2JA 4Y4FA 1JPGA 1FG2A 3D18A 3MRMA 4Y4KA 1VADA 3GMRA 3GJFA 5IB3A 2GAZA 3BZFA 2HN7A 3FOMA 5C0IA 4WUUA 3P9LA 3QUXA 1EEZA 1ZT1A 4PJIA 3V5DA 4PGBA 4L8SC 1RK1A 4N8VA 3HUJA 3QDJA 4PJFA 1DE4A 3TA3A 3HLAA 3RWDA 1BD2A 1WBXA 3RWHA 3MV7A 4QRPA 5D5MA 3KPOA 1R3HA 5DEGA 1LK2A 5F1IA 1A9EA 3VFVA 3DTXA 2AV7A 4Y16A 4WJ5A 3MV9A 4HS3A 2VLLA 3GSVA 5C0JA 3FT4A 4PJEA 5HHNA 1FFOA 5EOTA 3TF7A 3TZVC 3WS6A 3VFUA 3ARBA 5D7IA 5D2NA 1FFPA 3SDXA 4IHOA 4U6XA 2CLZA 5EU5A 4WO4A 2F74A 4F7MA 3VFOA 1UXWA 3KPQA 4QOKA 3TBSA 5DEFA 3RWGA 4U1HA 1JGEA 1CG9A 4PG2A 3MGOA 1QO3A 2GTZA 5MEPA 2V2XA 4L4VA 5FKPA 1OSZA 1JGDA 4HUXA 5EU6A 3U0PA 1QRNA 1LEKA 3WLBA 1M05A 3PQYA 4MX7A 3KPLA 3TO4A 3P4MA 5HHPA 1ZHNA 2OI9A 3MRPA 3HE7A 5HGDA 4EI5A 2CIKA 4LCCC 5IM7A 4ONOA 3X14A 4JFQA 3UBXA 4WDIA 2NW3A 5J6GA 2VAAA 3CDGA 3VXUA 1MWAH 1U58A 2FIKA 3V5HA 2ZOKA 1OGAA 3GSOA 3C9NA 3VFPA 4UQ3A 1KBGH 3E2HA 4PRDA 1NANH 1JPFA 1A1OA 1FZMA 4MJIA 3ARFA 3RWFA 1FZOA 5J6HA 5F9JA 3MROA 3CH1A 3GSQA 4PRPA 1L8JA 3TPUE 3L3KA 3MRGA 1IM9A 2ESVA 3VRJA 1ZT7A 1EXUA 5BXFA 1A1MA 3BZEA 3RL2A 3SPVA 3G08A 3MRKA 3VFWA 2RFXA 3O8XA 3T1FA 5SWZA 1T0NA 3GSWA 2PO6A 3RWEA 5IB2A 3QDMA 4X6EA 2GT9A 1T7VA 5HGAA 3QI9A 1N59A 5E8NA 2GTWA 4QRUA 3BP4A 1RJZA 4ZUSA 3BVNA 1LQVA 4HUUA 4D0DA 5C0FA 1KJVA 4PRNA 3FT3A 5BJTA 3FQXA 3MREA 5E8OA 4Z77A 1HHKA 2YPKA 4LNRA 3SKOA 3VXRA 4NQCA 1A9BA 3QQ3A 3AREA 1QR1A 4L8CA 3O4LA 4I48A 3KWWA 1I7RA 5HGBA 5C0DA 3MV8A 4L4TA 4JQVA 1WBYA 3DX7A 1ZT4A 4F7EA 5C0CA 4HUWA 3ERYA 2BNRA 2H6PA 4HKJA 1N2RA 4N0CA 3GMNA 3FT2A 3GIVA 4NSKA 3SDDA 3CVHA 3JTSA 4ZAKA 4V3DB 4IRSA 3M17A 3AU1A 3QUYA 4I4WA 4LCYA 3T8XA 3VXNA 2CLVA 4G59A 1S8DA 2VLJA 3CC5A 3BWAA 3DX6A 4PGDA 4D0BA 5GSVA 3MRNA 1LD9A 1ED3A 3BXNA 4NO3A 4PJ7A 5C07A 3GSNH 3TFKA 5IB5A 4CVZA 1MHCA 3DBXA 3FFCA 1PQZA 4JFEA 5D7JC 4PRBA 4U1LA 1HYRC 3X11A 4NQDA 3LKNA 1ZAGA 1QVOA 3GMQA 5E6IC 3VWJA 2O5NA 3X13A 4PV9A 4PJ8A 1W0WA 5MERA 4PJAA 1T7WA 3GMPA 2YPLA 3GMLA 4K71B 5C0AA 3VFTA 3QQ4A 4PGEA 4PP8C 2IA1A 3MGTA 1KJ2H 3VJ6A 4G42A 4K7FA 1HHJA 2XFXA 1ZSDA 1T1XA 2GITA 3FQWA 5SWSA 3P77A 1P4LA 1W72A 1KCGC 3QEQA 1B0GA 1INQA 2NYKA 4APQA 2AXGA 2X4OA 4HWZA 3D2UA 4JO8A 1BIIA 1TMCA
chains in the Genus database with same CATH topology
1I1FA 2ZSVA 2GUOA 3QDGA 1KPRA 2CKBH 4PJBA 4G8IA 3I6KA 4D0CA 3PWPA 3LKSA 3GSXA 1YDPA 4JFDA 4WW2C 4X6FA 3VRIA 1S9YA 5FA4A 4NHUE 4L3EA 4FFEX 4NQXA 4ELMA 4X6DA 1P1ZA 1UQSA 1KPUA 4PREA 1JHTA 1KJMA 1I1AA 2VE6A 3O3BA 3SKMA 3W39A 3TBTA 3RUGA 3TIDA 1NAMH 3BUYA 4XXCA 3NFNA 2FWOA 3P9MA 5ENWA 3I6GA 5FA3A 1ZHBA 4MNGA 4Z76A 2NX5A 1S7XA 3KPRA 5HHQA 3OXSA 4JFFA 1W0VA 2HJKA 4ZUUA 4PDCE 3LV3A 1X7QA 2MHAA 1T21A 3CCHA 4PJ9A 1TVBA 5HGHA 4WU5A 1JF1A 3MRDA 3KPPA 1XR9A 2X4QA 4U6YA 3X12A 2J8UA 4WU7A 4QRQA 3I6LD 1E27A 1T22A 1KPVA 3RWJA 4PGCA 1EFXA 5EU4A 5INCA 3BEVA 4PJXA 4QRTA 4G9FA 4PJ5A 1DUYA 3TIEA 5B39A 4PJCA 2VABA 3FQUA 3MRHA 3VXMA 1GZPA 4CW1A 2CIIA 2P5EA 5EUOA 3VFRA 3BHBA 4JFPA 3LKPA 3ARDA 1AGBA 5EO1A 1T0MA 2JCCA 4S0UC 3OV6A 1XH3A 2FYYA 5ISZA 4L29A 2VLRA 2BNQA 3ECBA 3KYOA 2HJLA 3QFDA 4Z78A 4HV8A 1G7PA 4U1NA 4PRAA 1JFMA 3PABA 4G8GA 2X4TA 3MRBA 3PWUA 2X4PA 2OL3H 1RJYA 3BH8A 3P4NA 3MYJA 2F53A 3BH9A 3VXPA 1N5AA 5F7DA 2X4RA 3PWVA 4MJ5A 4O2CA 3TVMA 3JTCA 3RL1A 2VLKA 1S7VA 1S7SA 3D25A 1T7ZA 4NT6A 4F7PA 3MR9A 1YN7A 5D7LA 1LDPH 5IEHA 1OF2A 4U1SA 1FZJA 3RZCA 2WY3A 1A6ZA 3VH8A 1XZ0A 1S7QA 4WWKC 4U1IA 1BZ9A 4L8BA 2XPGA 1ZVSA 3VWKA 3TBYA 3RTQA 4E5XA 5DDHA 3BO8A 5BS0A 4FTVA 4MQ7A 1AGDA 4PR5A 5IB1A 3MA7A 3DMMA 4JFOA 3M1BA 5GSRA 4CVXA 1DUZA 2BSRA 3DXAA 5EFIA 1IM3A 3PWLA 5EU3A 1S7RA 2FO4A 1T7XA 3RGVC 1FFNA 2X4UA 4NO2A 3VFNA 1OGTA 3SDCA 4F7TA 3KPSA 1G7QA 2AK4A 3OX8A 4GUPA 5INDA 1HSBA 5L2KA 5C0GA 1EEYA 1UXSA 3UPRA 3D3VA 3MRJA 1KJ3H 4HUVA 4IRJA 1A1NA 2BVOA 5C08A 3O3DA 3QFJA 1C16A 4PJDA 3TBVA 4X6CA 4L8DA 1AGEA 4N0UA 4MS8A 1HHGA 2D31A 5FDWA 1T1YA 1QQDA 3QZWA 2BCKA 1S7UA 3SJVA 5IVXA 4U1MA 2ZSWA 3GSUA 3JVGA 4EN3C 3JTTA 1HHIA 1P7QA 3RWIA 4QRRA 4PG9A 4PRIA 5C0EA 3FQTA 4ZUVA 3FQRA 1NEZA 5C09A 1WBZA 4N5EA 3GMOA 1I7TA 3IT8D 3C8KA 3L3JA 2AXFA 1MI5A 3AM8A 4NQEA 3KPMA 1S7TA 1AGCA 3DX8A 3ILQC 2AV1A 4MXQA 5SWQA 1QSEA 1FZKA 5E8PA 5E9DA 2BVQA 1N3NA 1CD1A 4MVBA 3TO2A 1S9XA 1I7UA 2DYPA 5IEKA 3E6FA 1AGFA 5MEQA 3VXSA 3E3QA 3KYNA 5D2LA 5BRZA 5MEOA 5HYJA 5C9JA 1QSFA 3ARGA 4O2FA 1VACA 4V3EB 4NNXA 3H7BA 3ROOA 1AO7A 2HLAA 4G9DA 3UTTA 3WUWA 4N0FA 5HHOA 3S6CA 2X4NA 3VFMA 1JUFA 1SYSA 1M6OA 1ONQA 4IIQC 4PV8A 3LN4A 4PJHA 1ZHLA 2YEZA 3LKRA 5AD0A 5JHDA 4Y4HA 1K5NA 2X70A 4UQ2A 1RK0A 1QEWA 3MRLA 4NO5A 1BQHA 2BSSA 3KPNA 3P73A 3KLAA 3O3AA 1VGKA 1I4FA 5E00A 3B3IA 1LP9A 3H9HA 4PJGA 1ZHKA 3RWCA 3LKQA 1YN6A 3L9RA 3FOLA 1CE6A 4O2EA 3D39A 3KXFA 3MRRA 3L3IA 3ES6A 4ZUTA 1B3JA 3VXOA 1HOCA 2UWEA 3V5KA 3CPLA 1E28A 3MRIA 3FTGA 2A83A 3BP7A 4GKNA 3FQNA 3ILPA 2PYEA 3QUZA 5B38A 3L3HA 3UTSA 3TBWA 3L3GA 4QRSA 4EUPA 3REWA 3HE6A 4GKSA 3GSRA 1T1ZA 3FRUA 4NO0A 2FZ3A 3O9WA 2E7LE 2C7UA 3L3DA 4U1JA 2ZOLA 3MRQA 3GMMA 1YPZA 2X4SA 1GZQA 5IROA 3IXAA 3QULA 5F1NA 3VCLA 1Q94A 3QUKA 4L9LC 1HHHA 1T80A 2P5WA 3BEWA 4ZFZA 1MHEA 3W0WA 4JRXA 3E6HA 3OXRA 1SYVA 2BVPA 4LHUA 4PRHA 3TN0A 3LN5A 3HCVA 1S7WA 1T7YA 1S9WA 1I1YA 1AKJA 1ZS8A 4HX1A 5C0BA 2AKRA 2BSTA 1T1WA 4JQXA 3PWNA 4MNQA 4U1KA 3ROLA 1DDHA 3MRCA 1B0RA 2Q7YA 1XR8A 1Z5LA 3O3EA 3CZFA 3WL9A 3SDAA 1K8DA 3LKOA 4ZUWA 3UTQA 3VFSA 3PWJA 3MRFA 3HAEA 4JRYA 3H9SA 5IB4A 2F54A 2CLRA 5J1AA 1G6RH 5ACZA 1TVHA 4NQVA 4L3CA 5MENA 1FO0H 5D9SA 3BGMA 5HHMA 1LEGA 3HPJA 4LCWA 1T20A 4E0RA 5H94A 4MJ6A 3FONA 4F7CA 1QLFA 3WS3A 1KTLA 4G43A 3B6SA 1HSAA 2H26A 2GJ6A 4NNYA 5EO0A 1JE6A 2V2WA 3P4OA 4Y2DA 3HG1A 3SCMA 3BW9A 3TJHA 5L2JA 4Y4FA 1JPGA 1FG2A 3D18A 3MRMA 4Y4KA 1VADA 3GMRA 3GJFA 5IB3A 2GAZA 3BZFA 2HN7A 3FOMA 5C0IA 4WUUA 3P9LA 3QUXA 1EEZA 1ZT1A 4PJIA 3V5DA 4PGBA 4L8SC 1RK1A 4N8VA 3HUJA 3QDJA 4PJFA 1DE4A 3TA3A 3HLAA 3RWDA 1BD2A 1WBXA 3RWHA 3MV7A 4QRPA 5D5MA 3KPOA 1R3HA 5DEGA 1LK2A 5F1IA 1A9EA 3VFVA 3DTXA 2AV7A 4Y16A 4WJ5A 3MV9A 4HS3A 2VLLA 3GSVA 5C0JA 3FT4A 4PJEA 5HHNA 1FFOA 5EOTA 3TF7A 3TZVC 3WS6A 3VFUA 3ARBA 5D7IA 5D2NA 1FFPA 3SDXA 4IHOA 4U6XA 2CLZA 5EU5A 4WO4A 2F74A 4F7MA 3VFOA 1UXWA 3KPQA 4QOKA 3TBSA 5DEFA 3RWGA 4U1HA 1JGEA 1CG9A 4PG2A 3MGOA 1QO3A 2GTZA 5MEPA 2V2XA 4L4VA 5FKPA 1OSZA 1JGDA 4HUXA 5EU6A 3U0PA 1QRNA 1LEKA 3WLBA 1M05A 3PQYA 4MX7A 3KPLA 3TO4A 3P4MA 5HHPA 1ZHNA 2OI9A 3MRPA 3HE7A 5HGDA 4EI5A 2CIKA 4LCCC 5IM7A 4ONOA 3X14A 4JFQA 3UBXA 4WDIA 2NW3A 5J6GA 2VAAA 3CDGA 3VXUA 1MWAH 1U58A 2FIKA 3V5HA 2ZOKA 1OGAA 3GSOA 3C9NA 3VFPA 4UQ3A 1KBGH 3E2HA 4PRDA 1NANH 1JPFA 1A1OA 1FZMA 4MJIA 3ARFA 3RWFA 1FZOA 5J6HA 5F9JA 3MROA 3CH1A 3GSQA 4PRPA 1L8JA 3TPUE 3L3KA 3MRGA 1IM9A 2ESVA 3VRJA 1ZT7A 1EXUA 5BXFA 1A1MA 3BZEA 3RL2A 3SPVA 3G08A 3MRKA 3VFWA 2RFXA 3O8XA 3T1FA 5SWZA 1T0NA 3GSWA 2PO6A 3RWEA 5IB2A 3QDMA 4X6EA 2GT9A 1T7VA 5HGAA 3QI9A 1N59A 5E8NA 2GTWA 4QRUA 3BP4A 1RJZA 4ZUSA 3BVNA 1LQVA 4HUUA 4D0DA 5C0FA 1KJVA 4PRNA 3FT3A 5BJTA 3FQXA 3MREA 5E8OA 4Z77A 1HHKA 2YPKA 4LNRA 3SKOA 3VXRA 4NQCA 1A9BA 3QQ3A 3AREA 1QR1A 4L8CA 3O4LA 4I48A 3KWWA 1I7RA 5HGBA 5C0DA 3MV8A 4L4TA 4JQVA 1WBYA 3DX7A 1ZT4A 4F7EA 5C0CA 4HUWA 3ERYA 2BNRA 2H6PA 4HKJA 1N2RA 4N0CA 3GMNA 3FT2A 3GIVA 4NSKA 3SDDA 3CVHA 3JTSA 4ZAKA 4V3DB 4IRSA 3M17A 3AU1A 3QUYA 4I4WA 4LCYA 3T8XA 3VXNA 2CLVA 4G59A 1S8DA 2VLJA 3CC5A 3BWAA 3DX6A 4PGDA 4D0BA 5GSVA 3MRNA 1LD9A 1ED3A 3BXNA 4NO3A 4PJ7A 5C07A 3GSNH 3TFKA 5IB5A 4CVZA 1MHCA 3DBXA 3FFCA 1PQZA 4JFEA 5D7JC 4PRBA 4U1LA 1HYRC 3X11A 4NQDA 3LKNA 1ZAGA 1QVOA 3GMQA 5E6IC 3VWJA 3X13A 4PV9A 4PJ8A 1W0WA 5MERA 4PJAA 1T7WA 3GMPA 2YPLA 3GMLA 4K71B 5C0AA 3VFTA 3QQ4A 4PGEA 4PP8C 3MGTA 1KJ2H 3VJ6A 4G42A 4K7FA 1HHJA 2XFXA 1ZSDA 1T1XA 2GITA 3FQWA 5SWSA 3P77A 1P4LA 1W72A 1KCGC 3QEQA 1B0GA 1INQA 4APQA 2AXGA 2X4OA 4HWZA 3D2UA 1BIIA 1TMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I1F A;  2ZSV A;  2GUO A;  3QDG A;  1KPR A;  2CKB H;  4PJB A;  4G8I A;  3I6K A;  4D0C A;  3PWP A;  3LKS A;  3GSX A;  1YDP A;  4JFD A;  4WW2 C;  4X6F A;  3VRI A;  1S9Y A;  5FA4 A;  4NHU E;  4L3E A;  4FFE X;  4NQX A;  4ELM A;  4X6D A;  1P1Z A;  1UQS A;  1KPU A;  4PRE A;  1JHT A;  1KJM A;  1I1A A;  2VE6 A;  3O3B A;  3SKM A;  3W39 A;  3TBT A;  3RUG A;  3TID A;  1NAM H;  3BUY A;  4XXC A;  3NFN A;  2FWO A;  3P9M A;  5ENW A;  3I6G A;  5FA3 A;  1ZHB A;  4MNG A;  4Z76 A;  2NX5 A;  1S7X A;  3KPR A;  5HHQ A;  3OXS A;  4JFF A;  1W0V A;  2HJK A;  4ZUU A;  4PDC E;  3LV3 A;  1X7Q A;  2MHA A;  1T21 A;  3CCH A;  4PJ9 A;  1TVB A;  5HGH A;  4WU5 A;  1JF1 A;  3MRD A;  3KPP A;  1XR9 A;  2X4Q A;  4U6Y A;  3X12 A;  2J8U A;  4WU7 A;  4QRQ A;  3I6L D;  1E27 A;  1T22 A;  1KPV A;  3RWJ A;  4PGC A;  1EFX A;  5EU4 A;  5INC A;  3BEV A;  4PJX A;  4QRT A;  4G9F A;  4PJ5 A;  1DUY A;  3TIE A;  5B39 A;  4PJC A;  2VAB A;  3FQU A;  3MRH A;  3VXM A;  1GZP A;  4CW1 A;  2CII A;  2P5E A;  5EUO A;  3VFR A;  3BHB A;  4JFP A;  3LKP A;  3ARD A;  1AGB A;  5EO1 A;  1T0M A;  2JCC A;  4S0U C;  3OV6 A;  1XH3 A;  2FYY A;  5ISZ A;  4L29 A;  2VLR A;  2BNQ A;  3ECB A;  3KYO A;  2HJL A;  3QFD A;  4Z78 A;  4HV8 A;  1G7P A;  4U1N A;  4PRA A;  1JFM A;  3PAB A;  4G8G A;  2X4T A;  3MRB A;  3PWU A;  2X4P A;  2OL3 H;  1RJY A;  3BH8 A;  3P4N A;  3MYJ A;  2F53 A;  3BH9 A;  3VXP A;  1N5A A;  5F7D A;  2X4R A;  3PWV A;  4MJ5 A;  4O2C A;  3TVM A;  3JTC A;  3RL1 A;  2VLK A;  1S7V A;  1S7S A;  3D25 A;  1T7Z A;  4NT6 A;  4F7P A;  3MR9 A;  1YN7 A;  5D7L A;  1LDP H;  5IEH A;  1OF2 A;  4U1S A;  1FZJ A;  3RZC A;  2WY3 A;  1A6Z A;  3VH8 A;  1XZ0 A;  1S7Q A;  4WWK C;  4U1I A;  1BZ9 A;  4L8B A;  2XPG A;  1ZVS A;  3VWK A;  3TBY A;  3RTQ A;  4E5X A;  5DDH A;  3BO8 A;  5BS0 A;  4FTV A;  4MQ7 A;  1AGD A;  4PR5 A;  5IB1 A;  3MA7 A;  3DMM A;  4JFO A;  3M1B A;  5GSR A;  4CVX A;  1DUZ A;  2BSR A;  3DXA A;  5EFI A;  1IM3 A;  3PWL A;  5EU3 A;  1S7R A;  2FO4 A;  1T7X A;  3RGV C;  1FFN A;  2X4U A;  4NO2 A;  3VFN A;  1OGT A;  3SDC A;  4F7T A;  3KPS A;  1G7Q A;  2AK4 A;  3OX8 A;  4GUP A;  5IND A;  1HSB A;  5L2K A;  5C0G A;  1EEY A;  1UXS A;  3UPR A;  3D3V A;  3MRJ A;  1KJ3 H;  4HUV A;  4IRJ A;  1A1N A;  2BVO A;  5C08 A;  3O3D A;  3QFJ A;  1C16 A;  4PJD A;  3TBV A;  4X6C A;  4L8D A;  1AGE A;  4N0U A;  4MS8 A;  1HHG A;  2D31 A;  5FDW A;  1T1Y A;  1QQD A;  3QZW A;  2BCK A;  1S7U A;  3SJV A;  5IVX A;  4U1M A;  2ZSW A;  3GSU A;  3JVG A;  4EN3 C;  3JTT A;  1HHI A;  1P7Q A;  3RWI A;  4QRR A;  4PG9 A;  4PRI A;  5C0E A;  3FQT A;  4ZUV A;  3FQR A;  1NEZ A;  5C09 A;  1WBZ A;  4N5E A;  3GMO A;  1I7T A;  3IT8 D;  3C8K A;  3L3J A;  2AXF A;  1MI5 A;  3AM8 A;  4NQE A;  3KPM A;  1S7T A;  1AGC A;  3DX8 A;  3ILQ C;  2AV1 A;  4MXQ A;  5SWQ A;  1QSE A;  1FZK A;  5E8P A;  5E9D A;  2BVQ A;  1N3N A;  1CD1 A;  4MVB A;  3TO2 A;  1S9X A;  1I7U A;  2DYP A;  5IEK A;  3E6F A;  1AGF A;  5MEQ A;  3VXS A;  3E3Q A;  3KYN A;  5D2L A;  5BRZ A;  5MEO A;  5HYJ A;  5C9J A;  1QSF A;  3ARG A;  4O2F A;  1VAC A;  4V3E B;  4NNX A;  3H7B A;  3ROO A;  1AO7 A;  2HLA A;  4G9D A;  3UTT A;  3WUW A;  4N0F A;  5HHO A;  3S6C A;  2X4N A;  3VFM A;  1JUF A;  1SYS A;  1M6O A;  1ONQ A;  4IIQ C;  4PV8 A;  3LN4 A;  4PJH A;  1ZHL A;  2YEZ A;  3LKR A;  5AD0 A;  5JHD A;  4Y4H A;  1K5N A;  2X70 A;  4UQ2 A;  1RK0 A;  1QEW A;  3MRL A;  4NO5 A;  1BQH A;  2BSS A;  3KPN A;  3P73 A;  3KLA A;  3O3A A;  1VGK A;  1I4F A;  5E00 A;  3B3I A;  1LP9 A;  3H9H A;  4PJG A;  1ZHK A;  3RWC A;  3LKQ A;  1YN6 A;  3L9R A;  3FOL A;  1CE6 A;  4O2E A;  3D39 A;  3KXF A;  3MRR A;  3L3I A;  3ES6 A;  4ZUT A;  1B3J A;  3VXO A;  1HOC A;  2UWE A;  3V5K A;  3CPL A;  1E28 A;  3MRI A;  3FTG A;  2A83 A;  3BP7 A;  4GKN A;  3FQN A;  3ILP A;  2PYE A;  3QUZ A;  5B38 A;  3L3H A;  3UTS A;  3TBW A;  3L3G A;  4QRS A;  4EUP A;  3REW A;  3HE6 A;  4GKS A;  3GSR A;  1T1Z A;  3FRU A;  4NO0 A;  2FZ3 A;  3O9W A;  2E7L E;  2C7U A;  3L3D A;  4U1J A;  2ZOL A;  3MRQ A;  3GMM A;  1YPZ A;  2X4S A;  1GZQ A;  5IRO A;  3IXA A;  3QUL A;  5F1N A;  3VCL A;  1Q94 A;  3QUK A;  4L9L C;  1HHH A;  1T80 A;  2P5W A;  3BEW A;  4ZFZ A;  1MHE A;  3W0W A;  4JRX A;  3E6H A;  3OXR A;  1SYV A;  2BVP A;  4LHU A;  4PRH A;  3TN0 A;  3LN5 A;  3HCV A;  1S7W A;  1T7Y A;  1S9W A;  1I1Y A;  1AKJ A;  1ZS8 A;  4HX1 A;  5C0B A;  2AKR A;  2BST A;  1T1W A;  4JQX A;  3PWN A;  4MNQ A;  4U1K A;  3ROL A;  1DDH A;  3MRC A;  1B0R A;  2Q7Y A;  1XR8 A;  1Z5L A;  3O3E A;  3CZF A;  3WL9 A;  3SDA A;  1K8D A;  3LKO A;  4ZUW A;  3UTQ A;  3VFS A;  3PWJ A;  3MRF A;  3HAE A;  4JRY A;  3H9S A;  5IB4 A;  2F54 A;  2CLR A;  5J1A A;  1G6R H;  5ACZ A;  1TVH A;  4NQV A;  4L3C A;  5MEN A;  1FO0 H;  5D9S A;  3BGM A;  5HHM A;  1LEG A;  3HPJ A;  4LCW A;  1T20 A;  4E0R A;  5H94 A;  4MJ6 A;  3FON A;  4F7C A;  1QLF A;  3WS3 A;  1KTL A;  4G43 A;  3B6S A;  1HSA A;  2H26 A;  2GJ6 A;  4NNY A;  5EO0 A;  1JE6 A;  2V2W A;  3P4O A;  4Y2D A;  3HG1 A;  3SCM A;  3BW9 A;  3TJH A;  5L2J A;  4Y4F A;  1JPG A;  1FG2 A;  3D18 A;  3MRM A;  4Y4K A;  1VAD A;  3GMR A;  3GJF A;  5IB3 A;  2GAZ A;  3BZF A;  2HN7 A;  3FOM A;  5C0I A;  4WUU A;  3P9L A;  3QUX A;  1EEZ A;  1ZT1 A;  4PJI A;  3V5D A;  4PGB A;  4L8S C;  1RK1 A;  4N8V A;  3HUJ A;  3QDJ A;  4PJF A;  1DE4 A;  3TA3 A;  3HLA A;  3RWD A;  1BD2 A;  1WBX A;  3RWH A;  3MV7 A;  4QRP A;  5D5M A;  3KPO A;  1R3H A;  5DEG A;  1LK2 A;  5F1I A;  1A9E A;  3VFV A;  3DTX A;  2AV7 A;  4Y16 A;  4WJ5 A;  3MV9 A;  4HS3 A;  2VLL A;  3GSV A;  5C0J A;  3FT4 A;  4PJE A;  5HHN A;  1FFO A;  5EOT A;  3TF7 A;  3TZV C;  3WS6 A;  3VFU A;  3ARB A;  5D7I A;  5D2N A;  1FFP A;  3SDX A;  4IHO A;  4U6X A;  2CLZ A;  5EU5 A;  4WO4 A;  2F74 A;  4F7M A;  3VFO A;  1UXW A;  3KPQ A;  4QOK A;  3TBS A;  5DEF A;  3RWG A;  4U1H A;  1JGE A;  1CG9 A;  4PG2 A;  3MGO A;  1QO3 A;  2GTZ A;  5MEP A;  2V2X A;  4L4V A;  5FKP A;  1OSZ A;  1JGD A;  4HUX A;  5EU6 A;  3U0P A;  1QRN A;  1LEK A;  3WLB A;  1M05 A;  3PQY A;  4MX7 A;  3KPL A;  3TO4 A;  3P4M A;  5HHP A;  1ZHN A;  2OI9 A;  3MRP A;  3HE7 A;  5HGD A;  4EI5 A;  2CIK A;  4LCC C;  5IM7 A;  4ONO A;  3X14 A;  4JFQ A;  3UBX A;  4WDI A;  2NW3 A;  5J6G A;  2VAA A;  3CDG A;  3VXU A;  1MWA H;  1U58 A;  2FIK A;  3V5H A;  2ZOK A;  1OGA A;  3GSO A;  3C9N A;  3VFP A;  4UQ3 A;  1KBG H;  3E2H A;  4PRD A;  1NAN H;  1JPF A;  1A1O A;  1FZM A;  4MJI A;  3ARF A;  3RWF A;  1FZO A;  5J6H A;  5F9J A;  3MRO A;  3CH1 A;  3GSQ A;  4PRP A;  1L8J A;  3TPU E;  3L3K A;  3MRG A;  1IM9 A;  2ESV A;  3VRJ A;  1ZT7 A;  1EXU A;  5BXF A;  1A1M A;  3BZE A;  3RL2 A;  3SPV A;  3G08 A;  3MRK A;  3VFW A;  2RFX A;  3O8X A;  3T1F A;  5SWZ A;  1T0N A;  3GSW A;  2PO6 A;  3RWE A;  5IB2 A;  3QDM A;  4X6E A;  2GT9 A;  1T7V A;  5HGA A;  3QI9 A;  1N59 A;  5E8N A;  2GTW A;  4QRU A;  3BP4 A;  1RJZ A;  4ZUS A;  3BVN A;  1LQV A;  4HUU A;  4D0D A;  5C0F A;  1KJV A;  4PRN A;  3FT3 A;  5BJT A;  3FQX A;  3MRE A;  5E8O A;  4Z77 A;  1HHK A;  2YPK A;  4LNR A;  3SKO A;  3VXR A;  4NQC A;  1A9B A;  3QQ3 A;  3ARE A;  1QR1 A;  4L8C A;  3O4L A;  4I48 A;  3KWW A;  1I7R A;  5HGB A;  5C0D A;  3MV8 A;  4L4T A;  4JQV A;  1WBY A;  3DX7 A;  1ZT4 A;  4F7E A;  5C0C A;  4HUW A;  3ERY A;  2BNR A;  2H6P A;  4HKJ A;  1N2R A;  4N0C A;  3GMN A;  3FT2 A;  3GIV A;  4NSK A;  3SDD A;  3CVH A;  3JTS A;  4ZAK A;  4V3D B;  4IRS A;  3M17 A;  3AU1 A;  3QUY A;  4I4W A;  4LCY A;  3T8X A;  3VXN A;  2CLV A;  4G59 A;  1S8D A;  2VLJ A;  3CC5 A;  3BWA A;  3DX6 A;  4PGD A;  4D0B A;  5GSV A;  3MRN A;  1LD9 A;  1ED3 A;  3BXN A;  4NO3 A;  4PJ7 A;  5C07 A;  3GSN H;  3TFK A;  5IB5 A;  4CVZ A;  1MHC A;  3DBX A;  3FFC A;  1PQZ A;  4JFE A;  5D7J C;  4PRB A;  4U1L A;  1HYR C;  3X11 A;  4NQD A;  3LKN A;  1ZAG A;  1QVO A;  3GMQ A;  5E6I C;  3VWJ A;  3X13 A;  4PV9 A;  4PJ8 A;  1W0W A;  5MER A;  4PJA A;  1T7W A;  3GMP A;  2YPL A;  3GML A;  4K71 B;  5C0A A;  3VFT A;  3QQ4 A;  4PGE A;  4PP8 C;  3MGT A;  1KJ2 H;  3VJ6 A;  4G42 A;  4K7F A;  1HHJ A;  2XFX A;  1ZSD A;  1T1X A;  2GIT A;  3FQW A;  5SWS A;  3P77 A;  1P4L A;  1W72 A;  1KCG C;  3QEQ A;  1B0G A;  1INQ A;  4APQ A;  2AXG A;  2X4O A;  4HWZ A;  3D2U A;  1BII A;  1TMC A; 
#chains in the Genus database with same CATH topology
 1I1F A;  2ZSV A;  2GUO A;  3QDG A;  1KPR A;  2CKB H;  4PJB A;  4G8I A;  3I6K A;  4D0C A;  3PWP A;  3LKS A;  3GSX A;  1YDP A;  4JFD A;  4WW2 C;  4X6F A;  3VRI A;  1S9Y A;  5FA4 A;  4NHU E;  4L3E A;  4FFE X;  4NQX A;  4ELM A;  4X6D A;  1P1Z A;  1UQS A;  1KPU A;  4PRE A;  1JHT A;  1KJM A;  1I1A A;  2VE6 A;  3O3B A;  3SKM A;  3W39 A;  3TBT A;  3RUG A;  3TID A;  1NAM H;  3BUY A;  4XXC A;  3NFN A;  2FWO A;  3P9M A;  5ENW A;  3I6G A;  5FA3 A;  1ZHB A;  4G59 C;  4MNG A;  4Z76 A;  2NX5 A;  1S7X A;  3KPR A;  5HHQ A;  3OXS A;  4JFF A;  1W0V A;  2HJK A;  4ZUU A;  4PDC E;  3LV3 A;  1X7Q A;  2MHA A;  1T21 A;  3CCH A;  4PJ9 A;  1TVB A;  5HGH A;  4WU5 A;  1JF1 A;  3MRD A;  3KPP A;  1XR9 A;  2X4Q A;  4U6Y A;  3X12 A;  2J8U A;  4WU7 A;  4QRQ A;  3I6L D;  1E27 A;  1T22 A;  1KPV A;  3RWJ A;  4PGC A;  1EFX A;  5EU4 A;  5INC A;  3BEV A;  4PJX A;  4QRT A;  4G9F A;  4PJ5 A;  1DUY A;  3TIE A;  5B39 A;  4PJC A;  2VAB A;  3FQU A;  3MRH A;  3VXM A;  1GZP A;  4CW1 A;  2CII A;  2P5E A;  5EUO A;  3VFR A;  3BHB A;  4JFP A;  3LKP A;  4BKW A;  3ARD A;  1AGB A;  5EO1 A;  1T0M A;  2JCC A;  4S0U C;  3OV6 A;  1XH3 A;  2FYY A;  5ISZ A;  4L29 A;  2VLR A;  2BNQ A;  3ECB A;  3KYO A;  2HJL A;  3QFD A;  4Z78 A;  4HV8 A;  1G7P A;  4U1N A;  4PRA A;  1JFM A;  3PAB A;  4G8G A;  2X4T A;  3MRB A;  3PWU A;  2X4P A;  2OL3 H;  1RJY A;  3BH8 A;  3P4N A;  3MYJ A;  2F53 A;  3BH9 A;  3VXP A;  1N5A A;  5F7D A;  2X4R A;  3PWV A;  4MJ5 A;  4O2C A;  3TVM A;  3JTC A;  3RL1 A;  2VLK A;  1S7V A;  1S7S A;  3D25 A;  1T7Z A;  4NT6 A;  4F7P A;  3MR9 A;  1YN7 A;  5D7L A;  1LDP H;  5IEH A;  1OF2 A;  4U1S A;  1FZJ A;  3RZC A;  2WY3 A;  1A6Z A;  3VH8 A;  1XZ0 A;  1S7Q A;  4WWK C;  4U1I A;  1BZ9 A;  4L8B A;  2XPG A;  1ZVS A;  3VWK A;  3TBY A;  3RTQ A;  4E5X A;  5DDH A;  3BO8 A;  5BS0 A;  4FTV A;  4MQ7 A;  1AGD A;  4PR5 A;  5IB1 A;  3MA7 A;  3DMM A;  4JFO A;  3M1B A;  5GSR A;  4CVX A;  1DUZ A;  2BSR A;  3DXA A;  5EFI A;  1IM3 A;  3PWL A;  5EU3 A;  1S7R A;  2FO4 A;  1T7X A;  3RGV C;  1FFN A;  2X4U A;  4NO2 A;  3VFN A;  1OGT A;  3SDC A;  4F7T A;  3KPS A;  1G7Q A;  2AK4 A;  3OX8 A;  4GUP A;  5IND A;  1HSB A;  5L2K A;  5C0G A;  1EEY A;  1UXS A;  3UPR A;  3D3V A;  3MRJ A;  1KJ3 H;  4HUV A;  4IRJ A;  1A1N A;  2BVO A;  5C08 A;  3O3D A;  3QFJ A;  1C16 A;  4PJD A;  3TBV A;  4X6C A;  4L8D A;  1AGE A;  4N0U A;  4MS8 A;  1HHG A;  2D31 A;  5FDW A;  1T1Y A;  1QQD A;  3QZW A;  2BCK A;  1S7U A;  3SJV A;  5IVX A;  4U1M A;  2ZSW A;  3GSU A;  3JVG A;  4EN3 C;  3JTT A;  1HHI A;  1P7Q A;  3RWI A;  4QRR A;  4PG9 A;  4PRI A;  5C0E A;  3FQT A;  4ZUV A;  3FQR A;  1NEZ A;  5C09 A;  1WBZ A;  4N5E A;  3GMO A;  1I7T A;  3IT8 D;  3C8K A;  3L3J A;  2AXF A;  1MI5 A;  3AM8 A;  4NQE A;  3KPM A;  1S7T A;  1AGC A;  3DX8 A;  3ILQ C;  2AV1 A;  4MXQ A;  5SWQ A;  1QSE A;  1FZK A;  5E8P A;  5E9D A;  2BVQ A;  1N3N A;  1CD1 A;  4MVB A;  3TO2 A;  1S9X A;  1I7U A;  2DYP A;  5IEK A;  3E6F A;  1AGF A;  5MEQ A;  3VXS A;  3E3Q A;  3KYN A;  5D2L A;  5BRZ A;  5MEO A;  5HYJ A;  5C9J A;  1QSF A;  3ARG A;  4O2F A;  1VAC A;  4V3E B;  4NNX A;  3H7B A;  3ROO A;  1AO7 A;  2HLA A;  4G9D A;  3UTT A;  3WUW A;  4N0F A;  5HHO A;  3S6C A;  2X4N A;  3VFM A;  1JUF A;  1SYS A;  1M6O A;  1ONQ A;  4IIQ C;  4PV8 A;  3LN4 A;  4PJH A;  1ZHL A;  2YEZ A;  3LKR A;  5AD0 A;  5JHD A;  4Y4H A;  1K5N A;  2X70 A;  4UQ2 A;  1RK0 A;  1QEW A;  3MRL A;  4NO5 A;  1BQH A;  2BSS A;  3KPN A;  3P73 A;  3KLA A;  3O3A A;  1VGK A;  1I4F A;  5E00 A;  3B3I A;  1LP9 A;  3H9H A;  4PJG A;  1ZHK A;  3RWC A;  3LKQ A;  1YN6 A;  3L9R A;  3FOL A;  1CE6 A;  4O2E A;  3D39 A;  3KXF A;  3MRR A;  3L3I A;  3ES6 A;  4ZUT A;  1B3J A;  3VXO A;  1HOC A;  2UWE A;  3V5K A;  3CPL A;  1E28 A;  3MRI A;  3FTG A;  2A83 A;  3BP7 A;  4GKN A;  3FQN A;  3ILP A;  2PYE A;  3QUZ A;  5B38 A;  3L3H A;  3UTS A;  3TBW A;  3L3G A;  4QRS A;  4EUP A;  3REW A;  3HE6 A;  4GKS A;  3GSR A;  1T1Z A;  3FRU A;  4NO0 A;  2FZ3 A;  3O9W A;  2E7L E;  2C7U A;  3L3D A;  4U1J A;  2ZOL A;  3MRQ A;  3GMM A;  1YPZ A;  2X4S A;  1GZQ A;  5IRO A;  3IXA A;  3QUL A;  5F1N A;  3I0T A;  3VCL A;  1Q94 A;  3QUK A;  4L9L C;  1HHH A;  1T80 A;  2P5W A;  3BEW A;  4ZFZ A;  1MHE A;  3W0W A;  4JRX A;  3E6H A;  3OXR A;  1SYV A;  2BVP A;  4LHU A;  4PRH A;  3TN0 A;  3LN5 A;  3HCV A;  1S7W A;  1T7Y A;  1S9W A;  1I1Y A;  1AKJ A;  1ZS8 A;  4HX1 A;  5C0B A;  2AKR A;  2BST A;  1T1W A;  4JQX A;  3PWN A;  4MNQ A;  4U1K A;  3ROL A;  1DDH A;  3MRC A;  1B0R A;  2Q7Y A;  1XR8 A;  1Z5L A;  3O3E A;  3CZF A;  3WL9 A;  3SDA A;  1K8D A;  3LKO A;  4ZUW A;  3UTQ A;  3VFS A;  3PWJ A;  3MRF A;  3HAE A;  4JRY A;  3H9S A;  5IB4 A;  2F54 A;  2CLR A;  5J1A A;  1G6R H;  5ACZ A;  1TVH A;  4NQV A;  4L3C A;  5MEN A;  1FO0 H;  5D9S A;  3BGM A;  5HHM A;  1LEG A;  3HPJ A;  4LCW A;  1T20 A;  4E0R A;  5H94 A;  4MJ6 A;  3FON A;  4F7C A;  1QLF A;  3WS3 A;  1KTL A;  4G43 A;  3B6S A;  1HSA A;  2H26 A;  2GJ6 A;  4NNY A;  5EO0 A;  1JE6 A;  2V2W A;  3P4O A;  4Y2D A;  3HG1 A;  3SCM A;  3BW9 A;  3TJH A;  5L2J A;  4Y4F A;  1JPG A;  1FG2 A;  3D18 A;  3MRM A;  4Y4K A;  1VAD A;  3GMR A;  3GJF A;  5IB3 A;  2GAZ A;  3BZF A;  2HN7 A;  3FOM A;  5C0I A;  4WUU A;  3P9L A;  3QUX A;  1EEZ A;  1ZT1 A;  4PJI A;  3V5D A;  4PGB A;  4L8S C;  1RK1 A;  4N8V A;  3HUJ A;  3QDJ A;  4PJF A;  1DE4 A;  3TA3 A;  3HLA A;  3RWD A;  1BD2 A;  1WBX A;  3RWH A;  3MV7 A;  4QRP A;  5D5M A;  3KPO A;  1R3H A;  5DEG A;  1LK2 A;  5F1I A;  1A9E A;  3VFV A;  3DTX A;  2AV7 A;  4Y16 A;  4WJ5 A;  3MV9 A;  4HS3 A;  2VLL A;  3GSV A;  5C0J A;  3FT4 A;  4PJE A;  5HHN A;  1FFO A;  5EOT A;  3TF7 A;  3TZV C;  3WS6 A;  3VFU A;  3ARB A;  5D7I A;  5D2N A;  1FFP A;  3SDX A;  4IHO A;  4U6X A;  2CLZ A;  5EU5 A;  4WO4 A;  2F74 A;  4F7M A;  3VFO A;  1UXW A;  3KPQ A;  4QOK A;  3TBS A;  5DEF A;  3RWG A;  4U1H A;  1JGE A;  1CG9 A;  4PG2 A;  3MGO A;  1QO3 A;  2GTZ A;  5MEP A;  2V2X A;  4L4V A;  5FKP A;  1OSZ A;  1JGD A;  4HUX A;  5EU6 A;  3U0P A;  1QRN A;  1LEK A;  3WLB A;  1M05 A;  3PQY A;  4MX7 A;  3KPL A;  3TO4 A;  3P4M A;  5HHP A;  1ZHN A;  2OI9 A;  3MRP A;  3HE7 A;  5HGD A;  4EI5 A;  2CIK A;  4LCC C;  5IM7 A;  4ONO A;  3X14 A;  4JFQ A;  3UBX A;  4WDI A;  2NW3 A;  5J6G A;  2VAA A;  3CDG A;  3VXU A;  1MWA H;  1U58 A;  2FIK A;  3V5H A;  2ZOK A;  1OGA A;  3GSO A;  3C9N A;  3VFP A;  4UQ3 A;  1KBG H;  3E2H A;  4PRD A;  1NAN H;  1JPF A;  1A1O A;  1FZM A;  4MJI A;  3ARF A;  3RWF A;  1FZO A;  5J6H A;  5F9J A;  3MRO A;  3CH1 A;  3GSQ A;  4PRP A;  1L8J A;  3TPU E;  3L3K A;  3MRG A;  1IM9 A;  2ESV A;  3VRJ A;  1ZT7 A;  1EXU A;  5BXF A;  1A1M A;  3BZE A;  3RL2 A;  3SPV A;  3G08 A;  3MRK A;  3VFW A;  2RFX A;  3O8X A;  3T1F A;  5SWZ A;  1T0N A;  3GSW A;  2PO6 A;  3RWE A;  5IB2 A;  3QDM A;  4X6E A;  2GT9 A;  1T7V A;  5HGA A;  3QI9 A;  1N59 A;  5E8N A;  2GTW A;  4QRU A;  3BP4 A;  1RJZ A;  4ZUS A;  3BVN A;  1LQV A;  4HUU A;  4D0D A;  5C0F A;  1KJV A;  4PRN A;  3FT3 A;  5BJT A;  3FQX A;  3MRE A;  5E8O A;  4Z77 A;  1HHK A;  2YPK A;  4LNR A;  3SKO A;  3VXR A;  4NQC A;  1A9B A;  3QQ3 A;  3ARE A;  1QR1 A;  4L8C A;  3O4L A;  4I48 A;  3KWW A;  1I7R A;  5HGB A;  5C0D A;  3MV8 A;  4L4T A;  4JQV A;  1WBY A;  3DX7 A;  1ZT4 A;  4F7E A;  5C0C A;  4HUW A;  3ERY A;  2BNR A;  2H6P A;  4HKJ A;  1N2R A;  4N0C A;  3GMN A;  3FT2 A;  3GIV A;  4NSK A;  3SDD A;  3CVH A;  3JTS A;  4ZAK A;  4V3D B;  4IRS A;  3M17 A;  3AU1 A;  3QUY A;  4I4W A;  4LCY A;  3T8X A;  3VXN A;  2CLV A;  4G59 A;  1S8D A;  2VLJ A;  3CC5 A;  3BWA A;  3DX6 A;  4PGD A;  4D0B A;  5GSV A;  3MRN A;  1LD9 A;  1ED3 A;  3BXN A;  4NO3 A;  4PJ7 A;  5C07 A;  3GSN H;  3TFK A;  5IB5 A;  4CVZ A;  1MHC A;  3DBX A;  3FFC A;  1PQZ A;  4JFE A;  5D7J C;  4PRB A;  4U1L A;  1HYR C;  3X11 A;  4NQD A;  3LKN A;  1ZAG A;  1QVO A;  3GMQ A;  5E6I C;  3VWJ A;  2O5N A;  3X13 A;  4PV9 A;  4PJ8 A;  1W0W A;  5MER A;  4PJA A;  1T7W A;  3GMP A;  2YPL A;  3GML A;  4K71 B;  5C0A A;  3VFT A;  3QQ4 A;  4PGE A;  4PP8 C;  2IA1 A;  3MGT A;  1KJ2 H;  3VJ6 A;  4G42 A;  4K7F A;  1HHJ A;  2XFX A;  1ZSD A;  1T1X A;  2GIT A;  3FQW A;  5SWS A;  3P77 A;  1P4L A;  1W72 A;  1KCG C;  3QEQ A;  1B0G A;  1INQ A;  2NYK A;  4APQ A;  2AXG A;  2X4O A;  4HWZ A;  3D2U A;  4JO8 A;  1BII A;  1TMC A; 
#chains in the Genus database with same CATH homology
 1I1F A;  2ZSV A;  2GUO A;  3QDG A;  1KPR A;  2CKB H;  4PJB A;  4G8I A;  3I6K A;  4D0C A;  3PWP A;  3LKS A;  3GSX A;  1YDP A;  4JFD A;  4WW2 C;  4X6F A;  3VRI A;  1S9Y A;  5FA4 A;  4NHU E;  4L3E A;  4FFE X;  4NQX A;  4ELM A;  4X6D A;  1P1Z A;  1UQS A;  1KPU A;  4PRE A;  1JHT A;  1KJM A;  1I1A A;  2VE6 A;  3O3B A;  3SKM A;  3W39 A;  3TBT A;  3RUG A;  3TID A;  1NAM H;  3BUY A;  4XXC A;  3NFN A;  2FWO A;  3P9M A;  5ENW A;  3I6G A;  5FA3 A;  1ZHB A;  4MNG A;  4Z76 A;  2NX5 A;  1S7X A;  3KPR A;  5HHQ A;  3OXS A;  4JFF A;  1W0V A;  2HJK A;  4ZUU A;  4PDC E;  3LV3 A;  1X7Q A;  2MHA A;  1T21 A;  3CCH A;  4PJ9 A;  1TVB A;  5HGH A;  4WU5 A;  1JF1 A;  3MRD A;  3KPP A;  1XR9 A;  2X4Q A;  4U6Y A;  3X12 A;  2J8U A;  4WU7 A;  4QRQ A;  3I6L D;  1E27 A;  1T22 A;  1KPV A;  3RWJ A;  4PGC A;  1EFX A;  5EU4 A;  5INC A;  3BEV A;  4PJX A;  4QRT A;  4G9F A;  4PJ5 A;  1DUY A;  3TIE A;  5B39 A;  4PJC A;  2VAB A;  3FQU A;  3MRH A;  3VXM A;  1GZP A;  4CW1 A;  2CII A;  2P5E A;  5EUO A;  3VFR A;  3BHB A;  4JFP A;  3LKP A;  3ARD A;  1AGB A;  5EO1 A;  1T0M A;  2JCC A;  4S0U C;  3OV6 A;  1XH3 A;  2FYY A;  5ISZ A;  4L29 A;  2VLR A;  2BNQ A;  3ECB A;  3KYO A;  2HJL A;  3QFD A;  4Z78 A;  4HV8 A;  1G7P A;  4U1N A;  4PRA A;  1JFM A;  3PAB A;  4G8G A;  2X4T A;  3MRB A;  3PWU A;  2X4P A;  2OL3 H;  1RJY A;  3BH8 A;  3P4N A;  3MYJ A;  2F53 A;  3BH9 A;  3VXP A;  1N5A A;  5F7D A;  2X4R A;  3PWV A;  4MJ5 A;  4O2C A;  3TVM A;  3JTC A;  3RL1 A;  2VLK A;  1S7V A;  1S7S A;  3D25 A;  1T7Z A;  4NT6 A;  4F7P A;  3MR9 A;  1YN7 A;  5D7L A;  1LDP H;  5IEH A;  1OF2 A;  4U1S A;  1FZJ A;  3RZC A;  2WY3 A;  1A6Z A;  3VH8 A;  1XZ0 A;  1S7Q A;  4WWK C;  4U1I A;  1BZ9 A;  4L8B A;  2XPG A;  1ZVS A;  3VWK A;  3TBY A;  3RTQ A;  4E5X A;  5DDH A;  3BO8 A;  5BS0 A;  4FTV A;  4MQ7 A;  1AGD A;  4PR5 A;  5IB1 A;  3MA7 A;  3DMM A;  4JFO A;  3M1B A;  5GSR A;  4CVX A;  1DUZ A;  2BSR A;  3DXA A;  5EFI A;  1IM3 A;  3PWL A;  5EU3 A;  1S7R A;  2FO4 A;  1T7X A;  3RGV C;  1FFN A;  2X4U A;  4NO2 A;  3VFN A;  1OGT A;  3SDC A;  4F7T A;  3KPS A;  1G7Q A;  2AK4 A;  3OX8 A;  4GUP A;  5IND A;  1HSB A;  5L2K A;  5C0G A;  1EEY A;  1UXS A;  3UPR A;  3D3V A;  3MRJ A;  1KJ3 H;  4HUV A;  4IRJ A;  1A1N A;  2BVO A;  5C08 A;  3O3D A;  3QFJ A;  1C16 A;  4PJD A;  3TBV A;  4X6C A;  4L8D A;  1AGE A;  4N0U A;  4MS8 A;  1HHG A;  2D31 A;  5FDW A;  1T1Y A;  1QQD A;  3QZW A;  2BCK A;  1S7U A;  3SJV A;  5IVX A;  4U1M A;  2ZSW A;  3GSU A;  3JVG A;  4EN3 C;  3JTT A;  1HHI A;  1P7Q A;  3RWI A;  4QRR A;  4PG9 A;  4PRI A;  5C0E A;  3FQT A;  4ZUV A;  3FQR A;  1NEZ A;  5C09 A;  1WBZ A;  4N5E A;  3GMO A;  1I7T A;  3IT8 D;  3C8K A;  3L3J A;  2AXF A;  1MI5 A;  3AM8 A;  4NQE A;  3KPM A;  1S7T A;  1AGC A;  3DX8 A;  3ILQ C;  2AV1 A;  4MXQ A;  5SWQ A;  1QSE A;  1FZK A;  5E8P A;  5E9D A;  2BVQ A;  1N3N A;  1CD1 A;  4MVB A;  3TO2 A;  1S9X A;  1I7U A;  2DYP A;  5IEK A;  3E6F A;  1AGF A;  5MEQ A;  3VXS A;  3E3Q A;  3KYN A;  5D2L A;  5BRZ A;  5MEO A;  5HYJ A;  5C9J A;  1QSF A;  3ARG A;  4O2F A;  1VAC A;  4V3E B;  4NNX A;  3H7B A;  3ROO A;  1AO7 A;  2HLA A;  4G9D A;  3UTT A;  3WUW A;  4N0F A;  5HHO A;  3S6C A;  2X4N A;  3VFM A;  1JUF A;  1SYS A;  1M6O A;  1ONQ A;  4IIQ C;  4PV8 A;  3LN4 A;  4PJH A;  1ZHL A;  2YEZ A;  3LKR A;  5AD0 A;  5JHD A;  4Y4H A;  1K5N A;  2X70 A;  4UQ2 A;  1RK0 A;  1QEW A;  3MRL A;  4NO5 A;  1BQH A;  2BSS A;  3KPN A;  3P73 A;  3KLA A;  3O3A A;  1VGK A;  1I4F A;  5E00 A;  3B3I A;  1LP9 A;  3H9H A;  4PJG A;  1ZHK A;  3RWC A;  3LKQ A;  1YN6 A;  3L9R A;  3FOL A;  1CE6 A;  4O2E A;  3D39 A;  3KXF A;  3MRR A;  3L3I A;  3ES6 A;  4ZUT A;  1B3J A;  3VXO A;  1HOC A;  2UWE A;  3V5K A;  3CPL A;  1E28 A;  3MRI A;  3FTG A;  2A83 A;  3BP7 A;  4GKN A;  3FQN A;  3ILP A;  2PYE A;  3QUZ A;  5B38 A;  3L3H A;  3UTS A;  3TBW A;  3L3G A;  4QRS A;  4EUP A;  3REW A;  3HE6 A;  4GKS A;  3GSR A;  1T1Z A;  3FRU A;  4NO0 A;  2FZ3 A;  3O9W A;  2E7L E;  2C7U A;  3L3D A;  4U1J A;  2ZOL A;  3MRQ A;  3GMM A;  1YPZ A;  2X4S A;  1GZQ A;  5IRO A;  3IXA A;  3QUL A;  5F1N A;  3VCL A;  1Q94 A;  3QUK A;  4L9L C;  1HHH A;  1T80 A;  2P5W A;  3BEW A;  4ZFZ A;  1MHE A;  3W0W A;  4JRX A;  3E6H A;  3OXR A;  1SYV A;  2BVP A;  4LHU A;  4PRH A;  3TN0 A;  3LN5 A;  3HCV A;  1S7W A;  1T7Y A;  1S9W A;  1I1Y A;  1AKJ A;  1ZS8 A;  4HX1 A;  5C0B A;  2AKR A;  2BST A;  1T1W A;  4JQX A;  3PWN A;  4MNQ A;  4U1K A;  3ROL A;  1DDH A;  3MRC A;  1B0R A;  2Q7Y A;  1XR8 A;  1Z5L A;  3O3E A;  3CZF A;  3WL9 A;  3SDA A;  1K8D A;  3LKO A;  4ZUW A;  3UTQ A;  3VFS A;  3PWJ A;  3MRF A;  3HAE A;  4JRY A;  3H9S A;  5IB4 A;  2F54 A;  2CLR A;  5J1A A;  1G6R H;  5ACZ A;  1TVH A;  4NQV A;  4L3C A;  5MEN A;  1FO0 H;  5D9S A;  3BGM A;  5HHM A;  1LEG A;  3HPJ A;  4LCW A;  1T20 A;  4E0R A;  5H94 A;  4MJ6 A;  3FON A;  4F7C A;  1QLF A;  3WS3 A;  1KTL A;  4G43 A;  3B6S A;  1HSA A;  2H26 A;  2GJ6 A;  4NNY A;  5EO0 A;  1JE6 A;  2V2W A;  3P4O A;  4Y2D A;  3HG1 A;  3SCM A;  3BW9 A;  3TJH A;  5L2J A;  4Y4F A;  1JPG A;  1FG2 A;  3D18 A;  3MRM A;  4Y4K A;  1VAD A;  3GMR A;  3GJF A;  5IB3 A;  2GAZ A;  3BZF A;  2HN7 A;  3FOM A;  5C0I A;  4WUU A;  3P9L A;  3QUX A;  1EEZ A;  1ZT1 A;  4PJI A;  3V5D A;  4PGB A;  4L8S C;  1RK1 A;  4N8V A;  3HUJ A;  3QDJ A;  4PJF A;  1DE4 A;  3TA3 A;  3HLA A;  3RWD A;  1BD2 A;  1WBX A;  3RWH A;  3MV7 A;  4QRP A;  5D5M A;  3KPO A;  1R3H A;  5DEG A;  1LK2 A;  5F1I A;  1A9E A;  3VFV A;  3DTX A;  2AV7 A;  4Y16 A;  4WJ5 A;  3MV9 A;  4HS3 A;  2VLL A;  3GSV A;  5C0J A;  3FT4 A;  4PJE A;  5HHN A;  1FFO A;  5EOT A;  3TF7 A;  3TZV C;  3WS6 A;  3VFU A;  3ARB A;  5D7I A;  5D2N A;  1FFP A;  3SDX A;  4IHO A;  4U6X A;  2CLZ A;  5EU5 A;  4WO4 A;  2F74 A;  4F7M A;  3VFO A;  1UXW A;  3KPQ A;  4QOK A;  3TBS A;  5DEF A;  3RWG A;  4U1H A;  1JGE A;  1CG9 A;  4PG2 A;  3MGO A;  1QO3 A;  2GTZ A;  5MEP A;  2V2X A;  4L4V A;  5FKP A;  1OSZ A;  1JGD A;  4HUX A;  5EU6 A;  3U0P A;  1QRN A;  1LEK A;  3WLB A;  1M05 A;  3PQY A;  4MX7 A;  3KPL A;  3TO4 A;  3P4M A;  5HHP A;  1ZHN A;  2OI9 A;  3MRP A;  3HE7 A;  5HGD A;  4EI5 A;  2CIK A;  4LCC C;  5IM7 A;  4ONO A;  3X14 A;  4JFQ A;  3UBX A;  4WDI A;  2NW3 A;  5J6G A;  2VAA A;  3CDG A;  3VXU A;  1MWA H;  1U58 A;  2FIK A;  3V5H A;  2ZOK A;  1OGA A;  3GSO A;  3C9N A;  3VFP A;  4UQ3 A;  1KBG H;  3E2H A;  4PRD A;  1NAN H;  1JPF A;  1A1O A;  1FZM A;  4MJI A;  3ARF A;  3RWF A;  1FZO A;  5J6H A;  5F9J A;  3MRO A;  3CH1 A;  3GSQ A;  4PRP A;  1L8J A;  3TPU E;  3L3K A;  3MRG A;  1IM9 A;  2ESV A;  3VRJ A;  1ZT7 A;  1EXU A;  5BXF A;  1A1M A;  3BZE A;  3RL2 A;  3SPV A;  3G08 A;  3MRK A;  3VFW A;  2RFX A;  3O8X A;  3T1F A;  5SWZ A;  1T0N A;  3GSW A;  2PO6 A;  3RWE A;  5IB2 A;  3QDM A;  4X6E A;  2GT9 A;  1T7V A;  5HGA A;  3QI9 A;  1N59 A;  5E8N A;  2GTW A;  4QRU A;  3BP4 A;  1RJZ A;  4ZUS A;  3BVN A;  1LQV A;  4HUU A;  4D0D A;  5C0F A;  1KJV A;  4PRN A;  3FT3 A;  5BJT A;  3FQX A;  3MRE A;  5E8O A;  4Z77 A;  1HHK A;  2YPK A;  4LNR A;  3SKO A;  3VXR A;  4NQC A;  1A9B A;  3QQ3 A;  3ARE A;  1QR1 A;  4L8C A;  3O4L A;  4I48 A;  3KWW A;  1I7R A;  5HGB A;  5C0D A;  3MV8 A;  4L4T A;  4JQV A;  1WBY A;  3DX7 A;  1ZT4 A;  4F7E A;  5C0C A;  4HUW A;  3ERY A;  2BNR A;  2H6P A;  4HKJ A;  1N2R A;  4N0C A;  3GMN A;  3FT2 A;  3GIV A;  4NSK A;  3SDD A;  3CVH A;  3JTS A;  4ZAK A;  4V3D B;  4IRS A;  3M17 A;  3AU1 A;  3QUY A;  4I4W A;  4LCY A;  3T8X A;  3VXN A;  2CLV A;  4G59 A;  1S8D A;  2VLJ A;  3CC5 A;  3BWA A;  3DX6 A;  4PGD A;  4D0B A;  5GSV A;  3MRN A;  1LD9 A;  1ED3 A;  3BXN A;  4NO3 A;  4PJ7 A;  5C07 A;  3GSN H;  3TFK A;  5IB5 A;  4CVZ A;  1MHC A;  3DBX A;  3FFC A;  1PQZ A;  4JFE A;  5D7J C;  4PRB A;  4U1L A;  1HYR C;  3X11 A;  4NQD A;  3LKN A;  1ZAG A;  1QVO A;  3GMQ A;  5E6I C;  3VWJ A;  3X13 A;  4PV9 A;  4PJ8 A;  1W0W A;  5MER A;  4PJA A;  1T7W A;  3GMP A;  2YPL A;  3GML A;  4K71 B;  5C0A A;  3VFT A;  3QQ4 A;  4PGE A;  4PP8 C;  3MGT A;  1KJ2 H;  3VJ6 A;  4G42 A;  4K7F A;  1HHJ A;  2XFX A;  1ZSD A;  1T1X A;  2GIT A;  3FQW A;  5SWS A;  3P77 A;  1P4L A;  1W72 A;  1KCG C;  3QEQ A;  1B0G A;  1INQ A;  4APQ A;  2AXG A;  2X4O A;  4HWZ A;  3D2U A;  1BII A;  1TMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...