3TPUE

42f3 p5e8/h2-ld complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
175
Chain Sequence
GPHSMRYYETATSRRGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords 42F3 alpha
total genus 49
structure length 175
sequence length 177
chains with identical sequence I, K, Q
ec nomenclature
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tpuE00
2OI9A 4X6EA 3BHBA 4U1LA 3SDCA 5EFIA 1XR8A 2X4SA 2UWEA 3FOMA 4IHOA 2XFXA 3O3EA 4G59A 4PJFA 1T1YA 3L3HA 5HYJA 1UXSA 1KTLA 1QEWA 2RFXA 1NEZA 1TVHA 2HJLA 3H9HA 4L29A 5C0DA 1G6RH 5SWSA 3E6FA 1JGDA 2PYEA 4QRRA 4WW2C 3MRPA 1B0RA 5H94A 3O3DA 3P4MA 4S0UC 3W39A 1ZHNA 3OV6A 4IRJA 1B3JA 4PJCA 5HGAA 3VXSA 3VFPA 3TIDA 2BNQA 3LKRA 3D3VA 1QSEA 1ED3A 2ZSVA 3GSUA 3LN4A 4CVZA 4G9DA 3RWHA 4U6YA 2FZ3A 2X4UA 4N5EA 4ZUVA 1XZ0A 4Y4KA 5IEKA 1MHCA 3BZFA 5FA4A 3U0PA 1AGEA 3IT8D 3VFWA 1P4LA 5L2JA 4G42A 5C08A 1MI5A 4XXCA 3V5HA 4MNQA 1JHTA 2GTZA 4MJ5A 3E6HA 4L4VA 4U6XA 5BRZA 1I1FA 2BNRA 2VE6A 3BH9A 5EOTA 3I6LD 4N8VA 3MGOA 5EUOA 4Z78A 5GSVA 3T8XA 1S7SA 3BZEA 4NQEA 4G43A 3VFSA 4U1IA 5AD0A 4Y4HA 3CC5A 3PWLA 5E8OA 5IB3A 3D2UA 1EEZA 3LKNA 4F7TA 1Q94A 3HUJA 3ARDA 1JPFA 3VJ6A 4N0FA 1DDHA 3QQ3A 1YPZA 3LKOA 5C0BA 4PG9A 3P4NA 3FOLA 4PRBA 1ZHBA 1FZMA 3BEVA 3IXAA 1QQDA 4K71B 1LK2A 1A1MA 1UQSA 1HHHA 1BQHA 3VFRA 1JFMA 1IM9A 5DDHA 3BP7A 3GJFA 1JPGA 3MA7A 4U1JA 5E8NA 3WLBA 5IROA 4F7PA 2FIKA 4FTVA 3MV8A 5F1NA 4GKSA 4D0DA 1ZSDA 3RWFA 4X6FA 3QDMA 1IM3A 1AGDA 3KYOA 4D0CA 2X4PA 2F53A 5MEPA 3CZFA 5B38A 4L8DA 3FT2A 3BP4A 3C9NA 2F54A 3GMOA 4O2CA 4IRSA 4L8CA 3MRRA 2GT9A 3FTGA 3GSNH 3O3BA 1VGKA 4MJ6A 4WU5A 1S7QA 3UTTA 1I1AA 3X14A 1LDPH 1FFOA 4NQDA 3ILQC 3ARBA 3X11A 1RK1A 5C0FA 3MRNA 3PWNA 4PR5A 5IB4A 1A1NA 1T7ZA 2FO4A 3SDXA 3L3IA 1DUYA 3QUZA 4PJGA 4WDIA 1K8DA 1RK0A 5J6HA 1INQA 1ONQA 1P7QA 5IEHA 4ZAKA 3CPLA 1LD9A 1S7UA 1CG9A 1KPVA 1S9YA 1DE4A 4LCCC 2CIIA 4MVBA 3GMQA 3VRJA 1S7XA 3JVGA 4PJIA 4PV8A 2ZOKA 3ILPA 4PJ7A 3L3DA 3BW9A 4MS8A 3WUWA 3LKSA 1RJZA 4ONOA 3KPLA 2VAAA 2NX5A 3JTSA 4JFEA 4PGCA 1JE6A 5E6IC 3VXMA 4PRDA 3VFNA 2HLAA 3PWPA 4Y16A 3UPRA 1QVOA 3VRIA 1YDPA 3CDGA 5D7JC 3VWJA 1E28A 5C0AA 1S9WA 2P5EA 3FQTA 1QSFA 3VXUA 5INDA 2BCKA 5L2KA 3TBSA 1NAMH 4F7CA 5HHOA 4V3EB 4WUUA 5IM7A 4ZUTA 1I7UA 3KLAA 2J8UA 3RGVC 4JQXA 3WS6A 4E0RA 4PJHA 1PQZA 2AXFA 4JQVA 3PQYA 4JRXA 1TMCA 4L9LC 3FT4A 3GSQA 1NANH 1I7TA 1YN7A 4GKNA 4NO2A 4NQVA 4CW1A 3RWJA 2P5WA 1I7RA 3AU1A 3KPOA 3QDJA 3D25A 3HG1A 4EI5A 3SPVA 3I6GA 4PRHA 2VLKA 1BZ9A 3B6SA 2XPGA 1T20A 1ZT1A 1QRNA 3D18A 5FKPA 1W0WA 2BVQA 2H6PA 5ACZA 2CIKA 2NW3A 4FFEX 3RWEA 5F9JA 4MQ7A 3VCLA 1HHIA 3LKPA 1ZHKA 5MERA 5C9JA 3TZVC 3P73A 3GMRA 3T1FA 4JFOA 5BS0A 1M05A 4ZFZA 4MJIA 3H7BA 3HPJA 1AKJA 1QLFA 3MROA 4O2EA 1QR1A 1W72A 4L8BA 3HAEA 4Z77A 5BXFA 3TPUE 5C0JA 1T21A 3M17A 4LCWA 3REWA 1OGTA 3BGMA 1HHKA 1A1OA 5HHQA 1T80A 2A83A 1HHGA 5D7IA 4PV9A 3FONA 1E27A 3MRCA 1FFNA 3MRIA 3MRHA 5E9DA 3CVHA 3MRKA 4HUXA 1YN6A 4PJXA 3DBXA 3GSOA 3MRGA 4G8IA 3WL9A 3QZWA 2CLZA 1N5AA 4QRQA 3RWCA 4F7EA 4NO3A 3B3IA 2WY3A 5HHNA 3BH8A 2CLRA 2F74A 1G7QA 1B0GA 4JFFA 2H26A 3MRFA 1KPUA 4PJBA 3SCMA 1T22A 3L3JA 3OXRA 3RL2A 4U1SA 3CH1A 3FQXA 3HLAA 3VXNA 1JF1A 1X7QA 1FO0H 4N0CA 3QFJA 4NNYA 5IB2A 3MRMA 1CD1A 3RUGA 1A9BA 5JHDA 3TF7A 4G9FA 1BD2A 4PJ8A 5IB1A 2YPKA 4PRNA 4EN3C 4PDCE 1VACA 3PWUA 3ARFA 5DEFA 1HYRC 1LEGA 3MV9A 4G8GA 3UTSA 4QRSA 2YEZA 5INCA 5IB5A 1AGCA 2VLLA 5HGHA 4WU7A 4PG2A 1ZAGA 5C07A 4QOKA 1OGAA 3FQWA 3QUKA 4IIQC 5FA3A 3KPMA 4HWZA 4NO0A 5EU5A 3HCVA 5D5MA 2X4NA 5D9SA 3DTXA 1KJVA 3ARGA 3ES6A 5HHPA 3MYJA 1U58A 5MEQA 4PRIA 3X12A 4PJAA 2CLVA 4MX7A 3QFDA 4L8SC 3L3GA 3GIVA 3PWJA 3VFMA 4LNRA 1T1XA 1WBYA 3DX8A 3GSVA 4O2FA 3ERYA 3GSXA 3O8XA 4L4TA 3DMMA 4U1HA 1ZT4A 3QUXA 3O4LA 4JFDA 1EFXA 4PJ5A 4PGEA 4QRPA 5MEOA 3BXNA 4ZUSA 4LCYA 4Y2DA 5J1AA 2X4TA 1T0MA 3NFNA 1N2RA 1S7TA 2GTWA 1SYSA 4N0UA 1T7YA 5EU6A 1UXWA 3C8KA 1T7XA 3TA3A 1HHJA 4JFQA 3LV3A 5HGDA 5C09A 1TVBA 2AV7A 4PP8C 3PWVA 1ZS8A 3PABA 5EU4A 3TBYA 4QRTA 4NO5A 2HN7A 1MWAH 2X4RA 4JRYA 2AK4A 1JGEA 3MGTA 1L8JA 5HHMA 4GUPA 3TN0A 3VWKA 4ZUWA 2X4OA 3ROLA 1LEKA 2ESVA 5DEGA 4E5XA 2BVPA 3S6CA 3BVNA 3KPQA 2AKRA 3GSRA 5FDWA 4NQCA 1KJ2H 2VLRA 2YPLA 3KPNA 1WBZA 3E3QA 1I4FA 1VADA 1ZT7A 4HUUA 4NT6A 3FQUA 2V2XA 1ZVSA 3LN5A 3E2HA 1HSBA 1C16A 4D0BA 4PREA 1S7RA 3OXSA 1DUZA 1HOCA 1N59A 3QUYA 3TVMA 3HE6A 1Z5LA 3LKQA 1AGFA 4PGDA 3QDGA 1I1YA 3ROOA 3KPSA 2BSSA 4PJDA 2BSTA 4HS3A 2Q7YA 1R3HA 3RZCA 4NHUE 4ZUUA 1T1ZA 5B39A 4X6DA 3UTQA 3HE7A 3KYNA 5C0EA 1EXUA 3ECBA 4WJ5A 5F7DA 3RWIA 5J6GA 5D7LA 2D31A 2GITA 4UQ3A 3FFCA 3VXPA 3MRDA 2E7LE 3VFOA 4U1NA 4HX1A 4HUVA 1P1ZA 3DX7A 3AM8A 1KBGH 2FYYA 3TBWA 5E00A 5C0IA 3X13A 4APQA 1BIIA 3O3AA 1LQVA 4QRUA 1T0NA 3WS3A 4PRAA 3BO8A 5D2LA 4MXQA 2VABA 2ZSWA 5HGBA 2CKBH 1S7VA 4L3EA 2GAZA 4NNXA 5F1IA 3MRBA 3VXRA 1G7PA 1S8DA 1FZKA 2BSRA 2MHAA 5MENA 3O9WA 4L3CA 4NQXA 4I48A 5ISZA 3FT3A 1A9EA 3VFUA 1JUFA 3SKMA 1FZOA 3H9SA 3MRQA 4U1MA 3RL1A 3VFTA 5GSRA 1HSAA 3BEWA 1XH3A 3L3KA 1SYVA 2OL3H 4WWKC 1EEYA 3FQNA 4PJ9A 3VFVA 1KPRA 2VLJA 3GMNA 3D39A 3CCHA 4CVXA 3GMPA 2GJ6A 1M6OA 1OF2A 3TJHA 4LHUA 4HV8A 2X4QA 3RWGA 4PGBA 3QEQA 3TBTA 1MHEA 3MR9A 4UQ2A 4I4WA 3SDAA 3TO4A 2JCCA 3P4OA 1N3NA 3UBXA 4PRPA 3M1BA 3V5DA 1T1WA 4HUWA 1KCGC 3VXOA 4PJEA 1S7WA 3QULA 4EUPA 1CE6A 3QQ4A 3BWAA 2BVOA 3OX8A 5BJTA 4ELMA 3W0WA 2HJKA 3AREA 2AV1A 3TIEA 1OSZA 5D2NA 3QI9A 3SDDA 3JTCA 3SJVA 1A6ZA 5SWQA 3KPPA 3MRJA 1AO7A 4HKJA 3DXAA 3MREA 1FG2A 5EO1A 1GZQA 1GZPA 1FZJA 3TBVA 1S9XA 1FFPA 3KPRA 1KJ3H 2FWOA 5C0CA 4V3DB 1KJMA 1T7VA 2DYPA 2AXGA 3KXFA 3TFKA 3TO2A 1LP9A 1T7WA 3MRLA 3G08A 3L9RA 3GMLA 2GUOA 4Y4FA 2PO6A 5EU3A 3DX6A 5E8PA 4MNGA 3I6KA 4F7MA 3FQRA 5C0GA 3MV7A 4U1KA 1XR9A 5SWZA 5EO0A 3VH8A 4NSKA 5IVXA 3KWWA 1W0VA 3RWDA 3V5KA 3JTTA 3P9LA 1QO3A 2V2WA 1K5NA 1ZHLA 1AGBA 1WBXA 4Z76A 4JFPA 4X6CA 3FRUA 3BUYA 3GSWA 2X70A 2ZOLA 3GMMA 3P9MA 5ENWA 4K7FA 3RTQA 1RJYA 3SKOA 2C7UA 3P77A 4WO4A
chains in the Genus database with same CATH superfamily
2OI9A 4X6EA 3BHBA 4U1LA 3SDCA 5EFIA 1XR8A 2X4SA 2UWEA 3FOMA 4IHOA 2XFXA 3O3EA 4G59A 4PJFA 1T1YA 3L3HA 5HYJA 1UXSA 1KTLA 1QEWA 2RFXA 1NEZA 1TVHA 2HJLA 3H9HA 4L29A 5C0DA 1G6RH 5SWSA 3E6FA 1JGDA 2PYEA 4QRRA 4WW2C 3MRPA 1B0RA 5H94A 3O3DA 3P4MA 4S0UC 3W39A 1ZHNA 3OV6A 4IRJA 1B3JA 4PJCA 5HGAA 3VXSA 3VFPA 3TIDA 2BNQA 3LKRA 3D3VA 1QSEA 1ED3A 2ZSVA 3GSUA 3LN4A 4CVZA 4G9DA 3RWHA 4U6YA 2FZ3A 2X4UA 4N5EA 4ZUVA 1XZ0A 4Y4KA 5IEKA 1MHCA 3BZFA 5FA4A 2O5NA 3U0PA 1AGEA 3IT8D 3VFWA 1P4LA 5L2JA 4G42A 5C08A 1MI5A 4XXCA 3V5HA 4MNQA 1JHTA 2GTZA 4MJ5A 3E6HA 4L4VA 4U6XA 5BRZA 1I1FA 2BNRA 2VE6A 3BH9A 5EOTA 3I6LD 4N8VA 3MGOA 5EUOA 4Z78A 5GSVA 3T8XA 1S7SA 3BZEA 4NQEA 4G43A 3VFSA 4U1IA 5AD0A 4Y4HA 3CC5A 3PWLA 5E8OA 5IB3A 3D2UA 1EEZA 3LKNA 4F7TA 1Q94A 3HUJA 3ARDA 1JPFA 3VJ6A 4N0FA 1DDHA 3QQ3A 1YPZA 3LKOA 5C0BA 4PG9A 3P4NA 3FOLA 4PRBA 1ZHBA 1FZMA 3BEVA 3IXAA 1QQDA 4K71B 1LK2A 1A1MA 1UQSA 1HHHA 1BQHA 3VFRA 1JFMA 1IM9A 5DDHA 3BP7A 3GJFA 1JPGA 3MA7A 4U1JA 5E8NA 3WLBA 5IROA 4F7PA 2FIKA 4FTVA 3MV8A 5F1NA 4GKSA 4D0DA 1ZSDA 3RWFA 4X6FA 3QDMA 1IM3A 1AGDA 3KYOA 4D0CA 2X4PA 2F53A 5MEPA 3CZFA 5B38A 4L8DA 3FT2A 3BP4A 3C9NA 2F54A 3GMOA 4O2CA 4IRSA 4L8CA 3MRRA 2GT9A 3FTGA 3GSNH 3O3BA 1VGKA 4MJ6A 4WU5A 1S7QA 3UTTA 1I1AA 3X14A 1LDPH 1FFOA 4NQDA 3ILQC 3ARBA 3X11A 1RK1A 5C0FA 3MRNA 3PWNA 4PR5A 5IB4A 1A1NA 1T7ZA 2FO4A 3SDXA 3L3IA 1DUYA 3QUZA 4PJGA 4WDIA 1K8DA 1RK0A 5J6HA 1INQA 1ONQA 1P7QA 5IEHA 4ZAKA 3CPLA 1LD9A 1S7UA 1CG9A 1KPVA 1S9YA 1DE4A 4LCCC 2CIIA 4MVBA 3GMQA 3VRJA 1S7XA 3JVGA 4PJIA 4PV8A 2ZOKA 3ILPA 4PJ7A 3L3DA 3BW9A 4MS8A 3WUWA 3LKSA 1RJZA 4ONOA 3KPLA 2VAAA 2NX5A 3JTSA 4JFEA 4PGCA 1JE6A 5E6IC 3VXMA 4PRDA 3VFNA 2HLAA 3PWPA 4Y16A 3UPRA 1QVOA 3VRIA 1YDPA 3CDGA 5D7JC 3VWJA 1E28A 5C0AA 1S9WA 2P5EA 3FQTA 1QSFA 3VXUA 5INDA 2BCKA 5L2KA 3TBSA 1NAMH 4F7CA 5HHOA 4V3EB 4WUUA 5IM7A 4ZUTA 1I7UA 3KLAA 2J8UA 3RGVC 4JQXA 3WS6A 4E0RA 4PJHA 1PQZA 2AXFA 4JQVA 3PQYA 4JRXA 1TMCA 4L9LC 3FT4A 3GSQA 1NANH 1I7TA 1YN7A 4GKNA 4NO2A 4NQVA 4CW1A 3RWJA 2P5WA 1I7RA 3AU1A 3KPOA 3QDJA 3D25A 3HG1A 4EI5A 3SPVA 3I6GA 4PRHA 2VLKA 1BZ9A 3B6SA 2XPGA 1T20A 1ZT1A 1QRNA 3D18A 5FKPA 1W0WA 2BVQA 2H6PA 5ACZA 2CIKA 2NW3A 4FFEX 3RWEA 5F9JA 4MQ7A 3VCLA 1HHIA 3LKPA 1ZHKA 5MERA 5C9JA 3TZVC 3P73A 3GMRA 2NYKA 4JFOA 3T1FA 5BS0A 1M05A 4ZFZA 4MJIA 3H7BA 3HPJA 1AKJA 1QLFA 3MROA 4O2EA 1QR1A 1W72A 4L8BA 3HAEA 4Z77A 5BXFA 3TPUE 5C0JA 1T21A 3M17A 4LCWA 3REWA 1OGTA 3BGMA 1HHKA 1A1OA 5HHQA 1T80A 2A83A 1HHGA 5D7IA 4PV9A 3FONA 1E27A 3MRCA 1FFNA 3MRIA 3MRHA 5E9DA 3CVHA 3MRKA 4HUXA 1YN6A 4PJXA 3DBXA 3GSOA 3MRGA 4G8IA 3WL9A 3QZWA 2CLZA 1N5AA 4QRQA 3RWCA 4F7EA 4NO3A 3B3IA 2WY3A 5HHNA 3BH8A 2CLRA 2F74A 1G7QA 1B0GA 4JFFA 2H26A 3MRFA 1KPUA 4PJBA 3SCMA 1T22A 3L3JA 3OXRA 3RL2A 4U1SA 3CH1A 3FQXA 3HLAA 3VXNA 1JF1A 1X7QA 1FO0H 4N0CA 3QFJA 4NNYA 5IB2A 3MRMA 1CD1A 3RUGA 1A9BA 5JHDA 3TF7A 4G9FA 1BD2A 4PJ8A 5IB1A 2YPKA 4PRNA 4EN3C 4PDCE 1VACA 3PWUA 3ARFA 5DEFA 1HYRC 1LEGA 3MV9A 4G8GA 3UTSA 4QRSA 2YEZA 5INCA 5IB5A 1AGCA 2VLLA 5HGHA 4WU7A 4PG2A 1ZAGA 5C07A 4QOKA 1OGAA 3FQWA 3QUKA 4IIQC 5FA3A 3KPMA 4HWZA 4NO0A 5EU5A 3HCVA 5D5MA 2X4NA 5D9SA 3DTXA 1KJVA 3ARGA 3ES6A 5HHPA 3MYJA 1U58A 5MEQA 4PRIA 3X12A 4PJAA 2CLVA 4MX7A 3QFDA 4L8SC 3L3GA 3GIVA 3PWJA 3VFMA 4LNRA 1T1XA 1WBYA 3DX8A 3GSVA 4O2FA 3ERYA 3GSXA 3O8XA 3I0TA 4L4TA 3DMMA 4U1HA 1ZT4A 3QUXA 3O4LA 4JFDA 1EFXA 4PJ5A 4PGEA 4QRPA 5MEOA 3BXNA 4ZUSA 4LCYA 4Y2DA 5J1AA 2X4TA 1T0MA 3NFNA 1N2RA 1S7TA 2GTWA 1SYSA 4N0UA 4BKWA 1T7YA 5EU6A 1UXWA 3C8KA 1T7XA 3TA3A 1HHJA 4JFQA 3LV3A 5HGDA 5C09A 1TVBA 2AV7A 4PP8C 3PWVA 1ZS8A 3PABA 5EU4A 3TBYA 4QRTA 4NO5A 2HN7A 1MWAH 2X4RA 4JRYA 2AK4A 1JGEA 3MGTA 1L8JA 5HHMA 4GUPA 3TN0A 3VWKA 4ZUWA 2X4OA 3ROLA 1LEKA 2ESVA 5DEGA 4E5XA 2BVPA 3S6CA 3BVNA 3KPQA 2AKRA 3GSRA 5FDWA 4NQCA 1KJ2H 2VLRA 2YPLA 3KPNA 1WBZA 4G59C 3E3QA 1I4FA 1VADA 1ZT7A 4HUUA 4NT6A 3FQUA 2V2XA 1ZVSA 3LN5A 3E2HA 1HSBA 1C16A 4D0BA 4PREA 1S7RA 3OXSA 1DUZA 1HOCA 1N59A 3QUYA 3TVMA 3HE6A 1Z5LA 3LKQA 1AGFA 4PGDA 3QDGA 1I1YA 3ROOA 3KPSA 2BSSA 4PJDA 2BSTA 4HS3A 2Q7YA 1R3HA 3RZCA 4NHUE 4ZUUA 1T1ZA 5B39A 4X6DA 3UTQA 3HE7A 3KYNA 5C0EA 1EXUA 3ECBA 4WJ5A 5F7DA 3RWIA 5J6GA 5D7LA 2D31A 2GITA 4UQ3A 3FFCA 3VXPA 3MRDA 2E7LE 3VFOA 4U1NA 4HX1A 4HUVA 1P1ZA 3DX7A 3AM8A 1KBGH 2FYYA 3TBWA 5E00A 5C0IA 3X13A 4APQA 1BIIA 3O3AA 1LQVA 4QRUA 1T0NA 3WS3A 2IA1A 4PRAA 3BO8A 5D2LA 4MXQA 2VABA 2ZSWA 5HGBA 2CKBH 1S7VA 4L3EA 2GAZA 4NNXA 5F1IA 3MRBA 3VXRA 1G7PA 1S8DA 1FZKA 2BSRA 2MHAA 5MENA 3O9WA 4L3CA 4NQXA 4I48A 5ISZA 3FT3A 1A9EA 3VFUA 1JUFA 3SKMA 1FZOA 3H9SA 3MRQA 4U1MA 3RL1A 3VFTA 5GSRA 1HSAA 3BEWA 1XH3A 3L3KA 1SYVA 2OL3H 4WWKC 1EEYA 3FQNA 4PJ9A 3VFVA 4JO8A 1KPRA 2VLJA 3GMNA 3D39A 3CCHA 4CVXA 3GMPA 2GJ6A 1M6OA 1OF2A 3TJHA 4LHUA 4HV8A 2X4QA 3RWGA 4PGBA 3QEQA 3TBTA 1MHEA 3MR9A 4UQ2A 4I4WA 3SDAA 3TO4A 2JCCA 3P4OA 1N3NA 3UBXA 4PRPA 3M1BA 3V5DA 1T1WA 4HUWA 1KCGC 3VXOA 4PJEA 1S7WA 3QULA 4EUPA 1CE6A 3QQ4A 3BWAA 2BVOA 3OX8A 5BJTA 4ELMA 3W0WA 2HJKA 3AREA 2AV1A 3TIEA 1OSZA 5D2NA 3QI9A 3SDDA 3JTCA 3SJVA 1A6ZA 5SWQA 3KPPA 3MRJA 1AO7A 4HKJA 3DXAA 3MREA 1FG2A 5EO1A 1GZQA 1GZPA 1FZJA 3TBVA 1S9XA 1FFPA 3KPRA 1KJ3H 2FWOA 5C0CA 4V3DB 1KJMA 1T7VA 2DYPA 2AXGA 3KXFA 3TFKA 3TO2A 1LP9A 1T7WA 3MRLA 3G08A 3L9RA 3GMLA 2GUOA 4Y4FA 2PO6A 5EU3A 3DX6A 5E8PA 4MNGA 3I6KA 4F7MA 3FQRA 5C0GA 3MV7A 4U1KA 1XR9A 5SWZA 5EO0A 3VH8A 4NSKA 5IVXA 3KWWA 1W0VA 3RWDA 3V5KA 3JTTA 3P9LA 1QO3A 2V2WA 1K5NA 1ZHLA 1AGBA 1WBXA 4Z76A 4JFPA 4X6CA 3FRUA 3BUYA 3GSWA 2X70A 2ZOLA 3GMMA 3P9MA 5ENWA 4K7FA 3RTQA 1RJYA 3SKOA 2C7UA 3P77A 4WO4A
chains in the Genus database with same CATH topology
2OI9A 4X6EA 3BHBA 4U1LA 3SDCA 5EFIA 1XR8A 2X4SA 2UWEA 3FOMA 4IHOA 2XFXA 3O3EA 4G59A 4PJFA 1T1YA 3L3HA 5HYJA 1UXSA 1KTLA 1QEWA 2RFXA 1NEZA 1TVHA 2HJLA 3H9HA 4L29A 5C0DA 1G6RH 5SWSA 3E6FA 1JGDA 2PYEA 4QRRA 4WW2C 3MRPA 1B0RA 5H94A 3O3DA 3P4MA 4S0UC 3W39A 1ZHNA 3OV6A 4IRJA 1B3JA 4PJCA 5HGAA 3VXSA 3VFPA 3TIDA 2BNQA 3LKRA 3D3VA 1QSEA 1ED3A 2ZSVA 3GSUA 3LN4A 4CVZA 4G9DA 3RWHA 4U6YA 2FZ3A 2X4UA 4N5EA 4ZUVA 1XZ0A 4Y4KA 5IEKA 1MHCA 3BZFA 5FA4A 3U0PA 1AGEA 3IT8D 3VFWA 1P4LA 5L2JA 4G42A 5C08A 1MI5A 4XXCA 3V5HA 4MNQA 1JHTA 2GTZA 4MJ5A 3E6HA 4L4VA 4U6XA 5BRZA 1I1FA 2BNRA 2VE6A 3BH9A 5EOTA 3I6LD 4N8VA 3MGOA 5EUOA 4Z78A 5GSVA 3T8XA 1S7SA 3BZEA 4NQEA 4G43A 3VFSA 4U1IA 5AD0A 4Y4HA 3CC5A 3PWLA 5E8OA 5IB3A 3D2UA 1EEZA 3LKNA 4F7TA 1Q94A 3HUJA 3ARDA 1JPFA 3VJ6A 4N0FA 1DDHA 3QQ3A 1YPZA 3LKOA 5C0BA 4PG9A 3P4NA 3FOLA 4PRBA 1ZHBA 1FZMA 3BEVA 3IXAA 1QQDA 4K71B 1LK2A 1A1MA 1UQSA 1HHHA 1BQHA 3VFRA 1JFMA 1IM9A 5DDHA 3BP7A 3GJFA 1JPGA 3MA7A 4U1JA 5E8NA 3WLBA 5IROA 4F7PA 2FIKA 4FTVA 3MV8A 5F1NA 4GKSA 4D0DA 1ZSDA 3RWFA 4X6FA 3QDMA 1IM3A 1AGDA 3KYOA 4D0CA 2X4PA 2F53A 5MEPA 3CZFA 5B38A 4L8DA 3FT2A 3BP4A 3C9NA 2F54A 3GMOA 4O2CA 4IRSA 4L8CA 3MRRA 2GT9A 3FTGA 3GSNH 3O3BA 1VGKA 4MJ6A 4WU5A 1S7QA 3UTTA 1I1AA 3X14A 1LDPH 1FFOA 4NQDA 3ILQC 3ARBA 3X11A 1RK1A 5C0FA 3MRNA 3PWNA 4PR5A 5IB4A 1A1NA 1T7ZA 2FO4A 3SDXA 3L3IA 1DUYA 3QUZA 4PJGA 4WDIA 1K8DA 1RK0A 5J6HA 1INQA 1ONQA 1P7QA 5IEHA 4ZAKA 3CPLA 1LD9A 1S7UA 1CG9A 1KPVA 1S9YA 1DE4A 4LCCC 2CIIA 4MVBA 3GMQA 3VRJA 1S7XA 3JVGA 4PJIA 4PV8A 2ZOKA 3ILPA 4PJ7A 3L3DA 3BW9A 4MS8A 3WUWA 3LKSA 1RJZA 4ONOA 3KPLA 2VAAA 2NX5A 3JTSA 4JFEA 4PGCA 1JE6A 5E6IC 3VXMA 4PRDA 3VFNA 2HLAA 3PWPA 4Y16A 3UPRA 1QVOA 3VRIA 1YDPA 3CDGA 5D7JC 3VWJA 1E28A 5C0AA 1S9WA 2P5EA 3FQTA 1QSFA 3VXUA 5INDA 2BCKA 5L2KA 3TBSA 1NAMH 4F7CA 5HHOA 4V3EB 4WUUA 5IM7A 4ZUTA 1I7UA 3KLAA 2J8UA 3RGVC 4JQXA 3WS6A 4E0RA 4PJHA 1PQZA 2AXFA 4JQVA 3PQYA 4JRXA 1TMCA 4L9LC 3FT4A 3GSQA 1NANH 1I7TA 1YN7A 4GKNA 4NO2A 4NQVA 4CW1A 3RWJA 2P5WA 1I7RA 3AU1A 3KPOA 3QDJA 3D25A 3HG1A 4EI5A 3SPVA 3I6GA 4PRHA 2VLKA 1BZ9A 3B6SA 2XPGA 1T20A 1ZT1A 1QRNA 3D18A 5FKPA 1W0WA 2BVQA 2H6PA 5ACZA 2CIKA 2NW3A 4FFEX 3RWEA 5F9JA 4MQ7A 3VCLA 1HHIA 3LKPA 1ZHKA 5MERA 5C9JA 3TZVC 3P73A 3GMRA 3T1FA 4JFOA 5BS0A 1M05A 4ZFZA 4MJIA 3H7BA 3HPJA 1AKJA 1QLFA 3MROA 4O2EA 1QR1A 1W72A 4L8BA 3HAEA 4Z77A 5BXFA 3TPUE 5C0JA 1T21A 3M17A 4LCWA 3REWA 1OGTA 3BGMA 1HHKA 1A1OA 5HHQA 1T80A 2A83A 1HHGA 5D7IA 4PV9A 3FONA 1E27A 3MRCA 1FFNA 3MRIA 3MRHA 5E9DA 3CVHA 3MRKA 4HUXA 1YN6A 4PJXA 3DBXA 3GSOA 3MRGA 4G8IA 3WL9A 3QZWA 2CLZA 1N5AA 4QRQA 3RWCA 4F7EA 4NO3A 3B3IA 2WY3A 5HHNA 3BH8A 2CLRA 2F74A 1G7QA 1B0GA 4JFFA 2H26A 3MRFA 1KPUA 4PJBA 3SCMA 1T22A 3L3JA 3OXRA 3RL2A 4U1SA 3CH1A 3FQXA 3HLAA 3VXNA 1JF1A 1X7QA 1FO0H 4N0CA 3QFJA 4NNYA 5IB2A 3MRMA 1CD1A 3RUGA 1A9BA 5JHDA 3TF7A 4G9FA 1BD2A 4PJ8A 5IB1A 2YPKA 4PRNA 4EN3C 4PDCE 1VACA 3PWUA 3ARFA 5DEFA 1HYRC 1LEGA 3MV9A 4G8GA 3UTSA 4QRSA 2YEZA 5INCA 5IB5A 1AGCA 2VLLA 5HGHA 4WU7A 4PG2A 1ZAGA 5C07A 4QOKA 1OGAA 3FQWA 3QUKA 4IIQC 5FA3A 3KPMA 4HWZA 4NO0A 5EU5A 3HCVA 5D5MA 2X4NA 5D9SA 3DTXA 1KJVA 3ARGA 3ES6A 5HHPA 3MYJA 1U58A 5MEQA 4PRIA 3X12A 4PJAA 2CLVA 4MX7A 3QFDA 4L8SC 3L3GA 3GIVA 3PWJA 3VFMA 4LNRA 1T1XA 1WBYA 3DX8A 3GSVA 4O2FA 3ERYA 3GSXA 3O8XA 4L4TA 3DMMA 4U1HA 1ZT4A 3QUXA 3O4LA 4JFDA 1EFXA 4PJ5A 4PGEA 4QRPA 5MEOA 3BXNA 4ZUSA 4LCYA 4Y2DA 5J1AA 2X4TA 1T0MA 3NFNA 1N2RA 1S7TA 2GTWA 1SYSA 4N0UA 1T7YA 5EU6A 1UXWA 3C8KA 1T7XA 3TA3A 1HHJA 4JFQA 3LV3A 5HGDA 5C09A 1TVBA 2AV7A 4PP8C 3PWVA 1ZS8A 3PABA 5EU4A 3TBYA 4QRTA 4NO5A 2HN7A 1MWAH 2X4RA 4JRYA 2AK4A 1JGEA 3MGTA 1L8JA 5HHMA 4GUPA 3TN0A 3VWKA 4ZUWA 2X4OA 3ROLA 1LEKA 2ESVA 5DEGA 4E5XA 2BVPA 3S6CA 3BVNA 3KPQA 2AKRA 3GSRA 5FDWA 4NQCA 1KJ2H 2VLRA 2YPLA 3KPNA 1WBZA 3E3QA 1I4FA 1VADA 1ZT7A 4HUUA 4NT6A 3FQUA 2V2XA 1ZVSA 3LN5A 3E2HA 1HSBA 1C16A 4D0BA 4PREA 1S7RA 3OXSA 1DUZA 1HOCA 1N59A 3QUYA 3TVMA 3HE6A 1Z5LA 3LKQA 1AGFA 4PGDA 3QDGA 1I1YA 3ROOA 3KPSA 2BSSA 4PJDA 2BSTA 4HS3A 2Q7YA 1R3HA 3RZCA 4NHUE 4ZUUA 1T1ZA 5B39A 4X6DA 3UTQA 3HE7A 3KYNA 5C0EA 1EXUA 3ECBA 4WJ5A 5F7DA 3RWIA 5J6GA 5D7LA 2D31A 2GITA 4UQ3A 3FFCA 3VXPA 3MRDA 2E7LE 3VFOA 4U1NA 4HX1A 4HUVA 1P1ZA 3DX7A 3AM8A 1KBGH 2FYYA 3TBWA 5E00A 5C0IA 3X13A 4APQA 1BIIA 3O3AA 1LQVA 4QRUA 1T0NA 3WS3A 4PRAA 3BO8A 5D2LA 4MXQA 2VABA 2ZSWA 5HGBA 2CKBH 1S7VA 4L3EA 2GAZA 4NNXA 5F1IA 3MRBA 3VXRA 1G7PA 1S8DA 1FZKA 2BSRA 2MHAA 5MENA 3O9WA 4L3CA 4NQXA 4I48A 5ISZA 3FT3A 1A9EA 3VFUA 1JUFA 3SKMA 1FZOA 3H9SA 3MRQA 4U1MA 3RL1A 3VFTA 5GSRA 1HSAA 3BEWA 1XH3A 3L3KA 1SYVA 2OL3H 4WWKC 1EEYA 3FQNA 4PJ9A 3VFVA 1KPRA 2VLJA 3GMNA 3D39A 3CCHA 4CVXA 3GMPA 2GJ6A 1M6OA 1OF2A 3TJHA 4LHUA 4HV8A 2X4QA 3RWGA 4PGBA 3QEQA 3TBTA 1MHEA 3MR9A 4UQ2A 4I4WA 3SDAA 3TO4A 2JCCA 3P4OA 1N3NA 3UBXA 4PRPA 3M1BA 3V5DA 1T1WA 4HUWA 1KCGC 3VXOA 4PJEA 1S7WA 3QULA 4EUPA 1CE6A 3QQ4A 3BWAA 2BVOA 3OX8A 5BJTA 4ELMA 3W0WA 2HJKA 3AREA 2AV1A 3TIEA 1OSZA 5D2NA 3QI9A 3SDDA 3JTCA 3SJVA 1A6ZA 5SWQA 3KPPA 3MRJA 1AO7A 4HKJA 3DXAA 3MREA 1FG2A 5EO1A 1GZQA 1GZPA 1FZJA 3TBVA 1S9XA 1FFPA 3KPRA 1KJ3H 2FWOA 5C0CA 4V3DB 1KJMA 1T7VA 2DYPA 2AXGA 3KXFA 3TFKA 3TO2A 1LP9A 1T7WA 3MRLA 3G08A 3L9RA 3GMLA 2GUOA 4Y4FA 2PO6A 5EU3A 3DX6A 5E8PA 4MNGA 3I6KA 4F7MA 3FQRA 5C0GA 3MV7A 4U1KA 1XR9A 5SWZA 5EO0A 3VH8A 4NSKA 5IVXA 3KWWA 1W0VA 3RWDA 3V5KA 3JTTA 3P9LA 1QO3A 2V2WA 1K5NA 1ZHLA 1AGBA 1WBXA 4Z76A 4JFPA 4X6CA 3FRUA 3BUYA 3GSWA 2X70A 2ZOLA 3GMMA 3P9MA 5ENWA 4K7FA 3RTQA 1RJYA 3SKOA 2C7UA 3P77A 4WO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OI9 A;  4X6E A;  3BHB A;  4U1L A;  3SDC A;  5EFI A;  1XR8 A;  2X4S A;  2UWE A;  3FOM A;  4IHO A;  2XFX A;  3O3E A;  4G59 A;  4PJF A;  1T1Y A;  3L3H A;  5HYJ A;  1UXS A;  1KTL A;  1QEW A;  2RFX A;  1NEZ A;  1TVH A;  2HJL A;  3H9H A;  4L29 A;  5C0D A;  1G6R H;  5SWS A;  3E6F A;  1JGD A;  2PYE A;  4QRR A;  4WW2 C;  3MRP A;  1B0R A;  5H94 A;  3O3D A;  3P4M A;  4S0U C;  3W39 A;  1ZHN A;  3OV6 A;  4IRJ A;  1B3J A;  4PJC A;  5HGA A;  3VXS A;  3VFP A;  3TID A;  2BNQ A;  3LKR A;  3D3V A;  1QSE A;  1ED3 A;  2ZSV A;  3GSU A;  3LN4 A;  4CVZ A;  4G9D A;  3RWH A;  4U6Y A;  2FZ3 A;  2X4U A;  4N5E A;  4ZUV A;  1XZ0 A;  4Y4K A;  5IEK A;  1MHC A;  3BZF A;  5FA4 A;  3U0P A;  1AGE A;  3IT8 D;  3VFW A;  1P4L A;  5L2J A;  4G42 A;  5C08 A;  1MI5 A;  4XXC A;  3V5H A;  4MNQ A;  1JHT A;  2GTZ A;  4MJ5 A;  3E6H A;  4L4V A;  4U6X A;  5BRZ A;  1I1F A;  2BNR A;  2VE6 A;  3BH9 A;  5EOT A;  3I6L D;  4N8V A;  3MGO A;  5EUO A;  4Z78 A;  5GSV A;  3T8X A;  1S7S A;  3BZE A;  4NQE A;  4G43 A;  3VFS A;  4U1I A;  5AD0 A;  4Y4H A;  3CC5 A;  3PWL A;  5E8O A;  5IB3 A;  3D2U A;  1EEZ A;  3LKN A;  4F7T A;  1Q94 A;  3HUJ A;  3ARD A;  1JPF A;  3VJ6 A;  4N0F A;  1DDH A;  3QQ3 A;  1YPZ A;  3LKO A;  5C0B A;  4PG9 A;  3P4N A;  3FOL A;  4PRB A;  1ZHB A;  1FZM A;  3BEV A;  3IXA A;  1QQD A;  4K71 B;  1LK2 A;  1A1M A;  1UQS A;  1HHH A;  1BQH A;  3VFR A;  1JFM A;  1IM9 A;  5DDH A;  3BP7 A;  3GJF A;  1JPG A;  3MA7 A;  4U1J A;  5E8N A;  3WLB A;  5IRO A;  4F7P A;  2FIK A;  4FTV A;  3MV8 A;  5F1N A;  4GKS A;  4D0D A;  1ZSD A;  3RWF A;  4X6F A;  3QDM A;  1IM3 A;  1AGD A;  3KYO A;  4D0C A;  2X4P A;  2F53 A;  5MEP A;  3CZF A;  5B38 A;  4L8D A;  3FT2 A;  3BP4 A;  3C9N A;  2F54 A;  3GMO A;  4O2C A;  4IRS A;  4L8C A;  3MRR A;  2GT9 A;  3FTG A;  3GSN H;  3O3B A;  1VGK A;  4MJ6 A;  4WU5 A;  1S7Q A;  3UTT A;  1I1A A;  3X14 A;  1LDP H;  1FFO A;  4NQD A;  3ILQ C;  3ARB A;  3X11 A;  1RK1 A;  5C0F A;  3MRN A;  3PWN A;  4PR5 A;  5IB4 A;  1A1N A;  1T7Z A;  2FO4 A;  3SDX A;  3L3I A;  1DUY A;  3QUZ A;  4PJG A;  4WDI A;  1K8D A;  1RK0 A;  5J6H A;  1INQ A;  1ONQ A;  1P7Q A;  5IEH A;  4ZAK A;  3CPL A;  1LD9 A;  1S7U A;  1CG9 A;  1KPV A;  1S9Y A;  1DE4 A;  4LCC C;  2CII A;  4MVB A;  3GMQ A;  3VRJ A;  1S7X A;  3JVG A;  4PJI A;  4PV8 A;  2ZOK A;  3ILP A;  4PJ7 A;  3L3D A;  3BW9 A;  4MS8 A;  3WUW A;  3LKS A;  1RJZ A;  4ONO A;  3KPL A;  2VAA A;  2NX5 A;  3JTS A;  4JFE A;  4PGC A;  1JE6 A;  5E6I C;  3VXM A;  4PRD A;  3VFN A;  2HLA A;  3PWP A;  4Y16 A;  3UPR A;  1QVO A;  3VRI A;  1YDP A;  3CDG A;  5D7J C;  3VWJ A;  1E28 A;  5C0A A;  1S9W A;  2P5E A;  3FQT A;  1QSF A;  3VXU A;  5IND A;  2BCK A;  5L2K A;  3TBS A;  1NAM H;  4F7C A;  5HHO A;  4V3E B;  4WUU A;  5IM7 A;  4ZUT A;  1I7U A;  3KLA A;  2J8U A;  3RGV C;  4JQX A;  3WS6 A;  4E0R A;  4PJH A;  1PQZ A;  2AXF A;  4JQV A;  3PQY A;  4JRX A;  1TMC A;  4L9L C;  3FT4 A;  3GSQ A;  1NAN H;  1I7T A;  1YN7 A;  4GKN A;  4NO2 A;  4NQV A;  4CW1 A;  3RWJ A;  2P5W A;  1I7R A;  3AU1 A;  3KPO A;  3QDJ A;  3D25 A;  3HG1 A;  4EI5 A;  3SPV A;  3I6G A;  4PRH A;  2VLK A;  1BZ9 A;  3B6S A;  2XPG A;  1T20 A;  1ZT1 A;  1QRN A;  3D18 A;  5FKP A;  1W0W A;  2BVQ A;  2H6P A;  5ACZ A;  2CIK A;  2NW3 A;  4FFE X;  3RWE A;  5F9J A;  4MQ7 A;  3VCL A;  1HHI A;  3LKP A;  1ZHK A;  5MER A;  5C9J A;  3TZV C;  3P73 A;  3GMR A;  3T1F A;  4JFO A;  5BS0 A;  1M05 A;  4ZFZ A;  4MJI A;  3H7B A;  3HPJ A;  1AKJ A;  1QLF A;  3MRO A;  4O2E A;  1QR1 A;  1W72 A;  4L8B A;  3HAE A;  4Z77 A;  5BXF A;  3TPU E;  5C0J A;  1T21 A;  3M17 A;  4LCW A;  3REW A;  1OGT A;  3BGM A;  1HHK A;  1A1O A;  5HHQ A;  1T80 A;  2A83 A;  1HHG A;  5D7I A;  4PV9 A;  3FON A;  1E27 A;  3MRC A;  1FFN A;  3MRI A;  3MRH A;  5E9D A;  3CVH A;  3MRK A;  4HUX A;  1YN6 A;  4PJX A;  3DBX A;  3GSO A;  3MRG A;  4G8I A;  3WL9 A;  3QZW A;  2CLZ A;  1N5A A;  4QRQ A;  3RWC A;  4F7E A;  4NO3 A;  3B3I A;  2WY3 A;  5HHN A;  3BH8 A;  2CLR A;  2F74 A;  1G7Q A;  1B0G A;  4JFF A;  2H26 A;  3MRF A;  1KPU A;  4PJB A;  3SCM A;  1T22 A;  3L3J A;  3OXR A;  3RL2 A;  4U1S A;  3CH1 A;  3FQX A;  3HLA A;  3VXN A;  1JF1 A;  1X7Q A;  1FO0 H;  4N0C A;  3QFJ A;  4NNY A;  5IB2 A;  3MRM A;  1CD1 A;  3RUG A;  1A9B A;  5JHD A;  3TF7 A;  4G9F A;  1BD2 A;  4PJ8 A;  5IB1 A;  2YPK A;  4PRN A;  4EN3 C;  4PDC E;  1VAC A;  3PWU A;  3ARF A;  5DEF A;  1HYR C;  1LEG A;  3MV9 A;  4G8G A;  3UTS A;  4QRS A;  2YEZ A;  5INC A;  5IB5 A;  1AGC A;  2VLL A;  5HGH A;  4WU7 A;  4PG2 A;  1ZAG A;  5C07 A;  4QOK A;  1OGA A;  3FQW A;  3QUK A;  4IIQ C;  5FA3 A;  3KPM A;  4HWZ A;  4NO0 A;  5EU5 A;  3HCV A;  5D5M A;  2X4N A;  5D9S A;  3DTX A;  1KJV A;  3ARG A;  3ES6 A;  5HHP A;  3MYJ A;  1U58 A;  5MEQ A;  4PRI A;  3X12 A;  4PJA A;  2CLV A;  4MX7 A;  3QFD A;  4L8S C;  3L3G A;  3GIV A;  3PWJ A;  3VFM A;  4LNR A;  1T1X A;  1WBY A;  3DX8 A;  3GSV A;  4O2F A;  3ERY A;  3GSX A;  3O8X A;  4L4T A;  3DMM A;  4U1H A;  1ZT4 A;  3QUX A;  3O4L A;  4JFD A;  1EFX A;  4PJ5 A;  4PGE A;  4QRP A;  5MEO A;  3BXN A;  4ZUS A;  4LCY A;  4Y2D A;  5J1A A;  2X4T A;  1T0M A;  3NFN A;  1N2R A;  1S7T A;  2GTW A;  1SYS A;  4N0U A;  1T7Y A;  5EU6 A;  1UXW A;  3C8K A;  1T7X A;  3TA3 A;  1HHJ A;  4JFQ A;  3LV3 A;  5HGD A;  5C09 A;  1TVB A;  2AV7 A;  4PP8 C;  3PWV A;  1ZS8 A;  3PAB A;  5EU4 A;  3TBY A;  4QRT A;  4NO5 A;  2HN7 A;  1MWA H;  2X4R A;  4JRY A;  2AK4 A;  1JGE A;  3MGT A;  1L8J A;  5HHM A;  4GUP A;  3TN0 A;  3VWK A;  4ZUW A;  2X4O A;  3ROL A;  1LEK A;  2ESV A;  5DEG A;  4E5X A;  2BVP A;  3S6C A;  3BVN A;  3KPQ A;  2AKR A;  3GSR A;  5FDW A;  4NQC A;  1KJ2 H;  2VLR A;  2YPL A;  3KPN A;  1WBZ A;  3E3Q A;  1I4F A;  1VAD A;  1ZT7 A;  4HUU A;  4NT6 A;  3FQU A;  2V2X A;  1ZVS A;  3LN5 A;  3E2H A;  1HSB A;  1C16 A;  4D0B A;  4PRE A;  1S7R A;  3OXS A;  1DUZ A;  1HOC A;  1N59 A;  3QUY A;  3TVM A;  3HE6 A;  1Z5L A;  3LKQ A;  1AGF A;  4PGD A;  3QDG A;  1I1Y A;  3ROO A;  3KPS A;  2BSS A;  4PJD A;  2BST A;  4HS3 A;  2Q7Y A;  1R3H A;  3RZC A;  4NHU E;  4ZUU A;  1T1Z A;  5B39 A;  4X6D A;  3UTQ A;  3HE7 A;  3KYN A;  5C0E A;  1EXU A;  3ECB A;  4WJ5 A;  5F7D A;  3RWI A;  5J6G A;  5D7L A;  2D31 A;  2GIT A;  4UQ3 A;  3FFC A;  3VXP A;  3MRD A;  2E7L E;  3VFO A;  4U1N A;  4HX1 A;  4HUV A;  1P1Z A;  3DX7 A;  3AM8 A;  1KBG H;  2FYY A;  3TBW A;  5E00 A;  5C0I A;  3X13 A;  4APQ A;  1BII A;  3O3A A;  1LQV A;  4QRU A;  1T0N A;  3WS3 A;  4PRA A;  3BO8 A;  5D2L A;  4MXQ A;  2VAB A;  2ZSW A;  5HGB A;  2CKB H;  1S7V A;  4L3E A;  2GAZ A;  4NNX A;  5F1I A;  3MRB A;  3VXR A;  1G7P A;  1S8D A;  1FZK A;  2BSR A;  2MHA A;  5MEN A;  3O9W A;  4L3C A;  4NQX A;  4I48 A;  5ISZ A;  3FT3 A;  1A9E A;  3VFU A;  1JUF A;  3SKM A;  1FZO A;  3H9S A;  3MRQ A;  4U1M A;  3RL1 A;  3VFT A;  5GSR A;  1HSA A;  3BEW A;  1XH3 A;  3L3K A;  1SYV A;  2OL3 H;  4WWK C;  1EEY A;  3FQN A;  4PJ9 A;  3VFV A;  1KPR A;  2VLJ A;  3GMN A;  3D39 A;  3CCH A;  4CVX A;  3GMP A;  2GJ6 A;  1M6O A;  1OF2 A;  3TJH A;  4LHU A;  4HV8 A;  2X4Q A;  3RWG A;  4PGB A;  3QEQ A;  3TBT A;  1MHE A;  3MR9 A;  4UQ2 A;  4I4W A;  3SDA A;  3TO4 A;  2JCC A;  3P4O A;  1N3N A;  3UBX A;  4PRP A;  3M1B A;  3V5D A;  1T1W A;  4HUW A;  1KCG C;  3VXO A;  4PJE A;  1S7W A;  3QUL A;  4EUP A;  1CE6 A;  3QQ4 A;  3BWA A;  2BVO A;  3OX8 A;  5BJT A;  4ELM A;  3W0W A;  2HJK A;  3ARE A;  2AV1 A;  3TIE A;  1OSZ A;  5D2N A;  3QI9 A;  3SDD A;  3JTC A;  3SJV A;  1A6Z A;  5SWQ A;  3KPP A;  3MRJ A;  1AO7 A;  4HKJ A;  3DXA A;  3MRE A;  1FG2 A;  5EO1 A;  1GZQ A;  1GZP A;  1FZJ A;  3TBV A;  1S9X A;  1FFP A;  3KPR A;  1KJ3 H;  2FWO A;  5C0C A;  4V3D B;  1KJM A;  1T7V A;  2DYP A;  2AXG A;  3KXF A;  3TFK A;  3TO2 A;  1LP9 A;  1T7W A;  3MRL A;  3G08 A;  3L9R A;  3GML A;  2GUO A;  4Y4F A;  2PO6 A;  5EU3 A;  3DX6 A;  5E8P A;  4MNG A;  3I6K A;  4F7M A;  3FQR A;  5C0G A;  3MV7 A;  4U1K A;  1XR9 A;  5SWZ A;  5EO0 A;  3VH8 A;  4NSK A;  5IVX A;  3KWW A;  1W0V A;  3RWD A;  3V5K A;  3JTT A;  3P9L A;  1QO3 A;  2V2W A;  1K5N A;  1ZHL A;  1AGB A;  1WBX A;  4Z76 A;  4JFP A;  4X6C A;  3FRU A;  3BUY A;  3GSW A;  2X70 A;  2ZOL A;  3GMM A;  3P9M A;  5ENW A;  4K7F A;  3RTQ A;  1RJY A;  3SKO A;  2C7U A;  3P77 A;  4WO4 A; 
#chains in the Genus database with same CATH topology
 2OI9 A;  4X6E A;  3BHB A;  4U1L A;  3SDC A;  5EFI A;  1XR8 A;  2X4S A;  2UWE A;  3FOM A;  4IHO A;  2XFX A;  3O3E A;  4G59 A;  4PJF A;  1T1Y A;  3L3H A;  5HYJ A;  1UXS A;  1KTL A;  1QEW A;  2RFX A;  1NEZ A;  1TVH A;  2HJL A;  3H9H A;  4L29 A;  5C0D A;  1G6R H;  5SWS A;  3E6F A;  1JGD A;  2PYE A;  4QRR A;  4WW2 C;  3MRP A;  1B0R A;  5H94 A;  3O3D A;  3P4M A;  4S0U C;  3W39 A;  1ZHN A;  3OV6 A;  4IRJ A;  1B3J A;  4PJC A;  5HGA A;  3VXS A;  3VFP A;  3TID A;  2BNQ A;  3LKR A;  3D3V A;  1QSE A;  1ED3 A;  2ZSV A;  3GSU A;  3LN4 A;  4CVZ A;  4G9D A;  3RWH A;  4U6Y A;  2FZ3 A;  2X4U A;  4N5E A;  4ZUV A;  1XZ0 A;  4Y4K A;  5IEK A;  1MHC A;  3BZF A;  5FA4 A;  2O5N A;  3U0P A;  1AGE A;  3IT8 D;  3VFW A;  1P4L A;  5L2J A;  4G42 A;  5C08 A;  1MI5 A;  4XXC A;  3V5H A;  4MNQ A;  1JHT A;  2GTZ A;  4MJ5 A;  3E6H A;  4L4V A;  4U6X A;  5BRZ A;  1I1F A;  2BNR A;  2VE6 A;  3BH9 A;  5EOT A;  3I6L D;  4N8V A;  3MGO A;  5EUO A;  4Z78 A;  5GSV A;  3T8X A;  1S7S A;  3BZE A;  4NQE A;  4G43 A;  3VFS A;  4U1I A;  5AD0 A;  4Y4H A;  3CC5 A;  3PWL A;  5E8O A;  5IB3 A;  3D2U A;  1EEZ A;  3LKN A;  4F7T A;  1Q94 A;  3HUJ A;  3ARD A;  1JPF A;  3VJ6 A;  4N0F A;  1DDH A;  3QQ3 A;  1YPZ A;  3LKO A;  5C0B A;  4PG9 A;  3P4N A;  3FOL A;  4PRB A;  1ZHB A;  1FZM A;  3BEV A;  3IXA A;  1QQD A;  4K71 B;  1LK2 A;  1A1M A;  1UQS A;  1HHH A;  1BQH A;  3VFR A;  1JFM A;  1IM9 A;  5DDH A;  3BP7 A;  3GJF A;  1JPG A;  3MA7 A;  4U1J A;  5E8N A;  3WLB A;  5IRO A;  4F7P A;  2FIK A;  4FTV A;  3MV8 A;  5F1N A;  4GKS A;  4D0D A;  1ZSD A;  3RWF A;  4X6F A;  3QDM A;  1IM3 A;  1AGD A;  3KYO A;  4D0C A;  2X4P A;  2F53 A;  5MEP A;  3CZF A;  5B38 A;  4L8D A;  3FT2 A;  3BP4 A;  3C9N A;  2F54 A;  3GMO A;  4O2C A;  4IRS A;  4L8C A;  3MRR A;  2GT9 A;  3FTG A;  3GSN H;  3O3B A;  1VGK A;  4MJ6 A;  4WU5 A;  1S7Q A;  3UTT A;  1I1A A;  3X14 A;  1LDP H;  1FFO A;  4NQD A;  3ILQ C;  3ARB A;  3X11 A;  1RK1 A;  5C0F A;  3MRN A;  3PWN A;  4PR5 A;  5IB4 A;  1A1N A;  1T7Z A;  2FO4 A;  3SDX A;  3L3I A;  1DUY A;  3QUZ A;  4PJG A;  4WDI A;  1K8D A;  1RK0 A;  5J6H A;  1INQ A;  1ONQ A;  1P7Q A;  5IEH A;  4ZAK A;  3CPL A;  1LD9 A;  1S7U A;  1CG9 A;  1KPV A;  1S9Y A;  1DE4 A;  4LCC C;  2CII A;  4MVB A;  3GMQ A;  3VRJ A;  1S7X A;  3JVG A;  4PJI A;  4PV8 A;  2ZOK A;  3ILP A;  4PJ7 A;  3L3D A;  3BW9 A;  4MS8 A;  3WUW A;  3LKS A;  1RJZ A;  4ONO A;  3KPL A;  2VAA A;  2NX5 A;  3JTS A;  4JFE A;  4PGC A;  1JE6 A;  5E6I C;  3VXM A;  4PRD A;  3VFN A;  2HLA A;  3PWP A;  4Y16 A;  3UPR A;  1QVO A;  3VRI A;  1YDP A;  3CDG A;  5D7J C;  3VWJ A;  1E28 A;  5C0A A;  1S9W A;  2P5E A;  3FQT A;  1QSF A;  3VXU A;  5IND A;  2BCK A;  5L2K A;  3TBS A;  1NAM H;  4F7C A;  5HHO A;  4V3E B;  4WUU A;  5IM7 A;  4ZUT A;  1I7U A;  3KLA A;  2J8U A;  3RGV C;  4JQX A;  3WS6 A;  4E0R A;  4PJH A;  1PQZ A;  2AXF A;  4JQV A;  3PQY A;  4JRX A;  1TMC A;  4L9L C;  3FT4 A;  3GSQ A;  1NAN H;  1I7T A;  1YN7 A;  4GKN A;  4NO2 A;  4NQV A;  4CW1 A;  3RWJ A;  2P5W A;  1I7R A;  3AU1 A;  3KPO A;  3QDJ A;  3D25 A;  3HG1 A;  4EI5 A;  3SPV A;  3I6G A;  4PRH A;  2VLK A;  1BZ9 A;  3B6S A;  2XPG A;  1T20 A;  1ZT1 A;  1QRN A;  3D18 A;  5FKP A;  1W0W A;  2BVQ A;  2H6P A;  5ACZ A;  2CIK A;  2NW3 A;  4FFE X;  3RWE A;  5F9J A;  4MQ7 A;  3VCL A;  1HHI A;  3LKP A;  1ZHK A;  5MER A;  5C9J A;  3TZV C;  3P73 A;  3GMR A;  2NYK A;  4JFO A;  3T1F A;  5BS0 A;  1M05 A;  4ZFZ A;  4MJI A;  3H7B A;  3HPJ A;  1AKJ A;  1QLF A;  3MRO A;  4O2E A;  1QR1 A;  1W72 A;  4L8B A;  3HAE A;  4Z77 A;  5BXF A;  3TPU E;  5C0J A;  1T21 A;  3M17 A;  4LCW A;  3REW A;  1OGT A;  3BGM A;  1HHK A;  1A1O A;  5HHQ A;  1T80 A;  2A83 A;  1HHG A;  5D7I A;  4PV9 A;  3FON A;  1E27 A;  3MRC A;  1FFN A;  3MRI A;  3MRH A;  5E9D A;  3CVH A;  3MRK A;  4HUX A;  1YN6 A;  4PJX A;  3DBX A;  3GSO A;  3MRG A;  4G8I A;  3WL9 A;  3QZW A;  2CLZ A;  1N5A A;  4QRQ A;  3RWC A;  4F7E A;  4NO3 A;  3B3I A;  2WY3 A;  5HHN A;  3BH8 A;  2CLR A;  2F74 A;  1G7Q A;  1B0G A;  4JFF A;  2H26 A;  3MRF A;  1KPU A;  4PJB A;  3SCM A;  1T22 A;  3L3J A;  3OXR A;  3RL2 A;  4U1S A;  3CH1 A;  3FQX A;  3HLA A;  3VXN A;  1JF1 A;  1X7Q A;  1FO0 H;  4N0C A;  3QFJ A;  4NNY A;  5IB2 A;  3MRM A;  1CD1 A;  3RUG A;  1A9B A;  5JHD A;  3TF7 A;  4G9F A;  1BD2 A;  4PJ8 A;  5IB1 A;  2YPK A;  4PRN A;  4EN3 C;  4PDC E;  1VAC A;  3PWU A;  3ARF A;  5DEF A;  1HYR C;  1LEG A;  3MV9 A;  4G8G A;  3UTS A;  4QRS A;  2YEZ A;  5INC A;  5IB5 A;  1AGC A;  2VLL A;  5HGH A;  4WU7 A;  4PG2 A;  1ZAG A;  5C07 A;  4QOK A;  1OGA A;  3FQW A;  3QUK A;  4IIQ C;  5FA3 A;  3KPM A;  4HWZ A;  4NO0 A;  5EU5 A;  3HCV A;  5D5M A;  2X4N A;  5D9S A;  3DTX A;  1KJV A;  3ARG A;  3ES6 A;  5HHP A;  3MYJ A;  1U58 A;  5MEQ A;  4PRI A;  3X12 A;  4PJA A;  2CLV A;  4MX7 A;  3QFD A;  4L8S C;  3L3G A;  3GIV A;  3PWJ A;  3VFM A;  4LNR A;  1T1X A;  1WBY A;  3DX8 A;  3GSV A;  4O2F A;  3ERY A;  3GSX A;  3O8X A;  3I0T A;  4L4T A;  3DMM A;  4U1H A;  1ZT4 A;  3QUX A;  3O4L A;  4JFD A;  1EFX A;  4PJ5 A;  4PGE A;  4QRP A;  5MEO A;  3BXN A;  4ZUS A;  4LCY A;  4Y2D A;  5J1A A;  2X4T A;  1T0M A;  3NFN A;  1N2R A;  1S7T A;  2GTW A;  1SYS A;  4N0U A;  4BKW A;  1T7Y A;  5EU6 A;  1UXW A;  3C8K A;  1T7X A;  3TA3 A;  1HHJ A;  4JFQ A;  3LV3 A;  5HGD A;  5C09 A;  1TVB A;  2AV7 A;  4PP8 C;  3PWV A;  1ZS8 A;  3PAB A;  5EU4 A;  3TBY A;  4QRT A;  4NO5 A;  2HN7 A;  1MWA H;  2X4R A;  4JRY A;  2AK4 A;  1JGE A;  3MGT A;  1L8J A;  5HHM A;  4GUP A;  3TN0 A;  3VWK A;  4ZUW A;  2X4O A;  3ROL A;  1LEK A;  2ESV A;  5DEG A;  4E5X A;  2BVP A;  3S6C A;  3BVN A;  3KPQ A;  2AKR A;  3GSR A;  5FDW A;  4NQC A;  1KJ2 H;  2VLR A;  2YPL A;  3KPN A;  1WBZ A;  4G59 C;  3E3Q A;  1I4F A;  1VAD A;  1ZT7 A;  4HUU A;  4NT6 A;  3FQU A;  2V2X A;  1ZVS A;  3LN5 A;  3E2H A;  1HSB A;  1C16 A;  4D0B A;  4PRE A;  1S7R A;  3OXS A;  1DUZ A;  1HOC A;  1N59 A;  3QUY A;  3TVM A;  3HE6 A;  1Z5L A;  3LKQ A;  1AGF A;  4PGD A;  3QDG A;  1I1Y A;  3ROO A;  3KPS A;  2BSS A;  4PJD A;  2BST A;  4HS3 A;  2Q7Y A;  1R3H A;  3RZC A;  4NHU E;  4ZUU A;  1T1Z A;  5B39 A;  4X6D A;  3UTQ A;  3HE7 A;  3KYN A;  5C0E A;  1EXU A;  3ECB A;  4WJ5 A;  5F7D A;  3RWI A;  5J6G A;  5D7L A;  2D31 A;  2GIT A;  4UQ3 A;  3FFC A;  3VXP A;  3MRD A;  2E7L E;  3VFO A;  4U1N A;  4HX1 A;  4HUV A;  1P1Z A;  3DX7 A;  3AM8 A;  1KBG H;  2FYY A;  3TBW A;  5E00 A;  5C0I A;  3X13 A;  4APQ A;  1BII A;  3O3A A;  1LQV A;  4QRU A;  1T0N A;  3WS3 A;  2IA1 A;  4PRA A;  3BO8 A;  5D2L A;  4MXQ A;  2VAB A;  2ZSW A;  5HGB A;  2CKB H;  1S7V A;  4L3E A;  2GAZ A;  4NNX A;  5F1I A;  3MRB A;  3VXR A;  1G7P A;  1S8D A;  1FZK A;  2BSR A;  2MHA A;  5MEN A;  3O9W A;  4L3C A;  4NQX A;  4I48 A;  5ISZ A;  3FT3 A;  1A9E A;  3VFU A;  1JUF A;  3SKM A;  1FZO A;  3H9S A;  3MRQ A;  4U1M A;  3RL1 A;  3VFT A;  5GSR A;  1HSA A;  3BEW A;  1XH3 A;  3L3K A;  1SYV A;  2OL3 H;  4WWK C;  1EEY A;  3FQN A;  4PJ9 A;  3VFV A;  4JO8 A;  1KPR A;  2VLJ A;  3GMN A;  3D39 A;  3CCH A;  4CVX A;  3GMP A;  2GJ6 A;  1M6O A;  1OF2 A;  3TJH A;  4LHU A;  4HV8 A;  2X4Q A;  3RWG A;  4PGB A;  3QEQ A;  3TBT A;  1MHE A;  3MR9 A;  4UQ2 A;  4I4W A;  3SDA A;  3TO4 A;  2JCC A;  3P4O A;  1N3N A;  3UBX A;  4PRP A;  3M1B A;  3V5D A;  1T1W A;  4HUW A;  1KCG C;  3VXO A;  4PJE A;  1S7W A;  3QUL A;  4EUP A;  1CE6 A;  3QQ4 A;  3BWA A;  2BVO A;  3OX8 A;  5BJT A;  4ELM A;  3W0W A;  2HJK A;  3ARE A;  2AV1 A;  3TIE A;  1OSZ A;  5D2N A;  3QI9 A;  3SDD A;  3JTC A;  3SJV A;  1A6Z A;  5SWQ A;  3KPP A;  3MRJ A;  1AO7 A;  4HKJ A;  3DXA A;  3MRE A;  1FG2 A;  5EO1 A;  1GZQ A;  1GZP A;  1FZJ A;  3TBV A;  1S9X A;  1FFP A;  3KPR A;  1KJ3 H;  2FWO A;  5C0C A;  4V3D B;  1KJM A;  1T7V A;  2DYP A;  2AXG A;  3KXF A;  3TFK A;  3TO2 A;  1LP9 A;  1T7W A;  3MRL A;  3G08 A;  3L9R A;  3GML A;  2GUO A;  4Y4F A;  2PO6 A;  5EU3 A;  3DX6 A;  5E8P A;  4MNG A;  3I6K A;  4F7M A;  3FQR A;  5C0G A;  3MV7 A;  4U1K A;  1XR9 A;  5SWZ A;  5EO0 A;  3VH8 A;  4NSK A;  5IVX A;  3KWW A;  1W0V A;  3RWD A;  3V5K A;  3JTT A;  3P9L A;  1QO3 A;  2V2W A;  1K5N A;  1ZHL A;  1AGB A;  1WBX A;  4Z76 A;  4JFP A;  4X6C A;  3FRU A;  3BUY A;  3GSW A;  2X70 A;  2ZOL A;  3GMM A;  3P9M A;  5ENW A;  4K7F A;  3RTQ A;  1RJY A;  3SKO A;  2C7U A;  3P77 A;  4WO4 A; 
#chains in the Genus database with same CATH homology
 2OI9 A;  4X6E A;  3BHB A;  4U1L A;  3SDC A;  5EFI A;  1XR8 A;  2X4S A;  2UWE A;  3FOM A;  4IHO A;  2XFX A;  3O3E A;  4G59 A;  4PJF A;  1T1Y A;  3L3H A;  5HYJ A;  1UXS A;  1KTL A;  1QEW A;  2RFX A;  1NEZ A;  1TVH A;  2HJL A;  3H9H A;  4L29 A;  5C0D A;  1G6R H;  5SWS A;  3E6F A;  1JGD A;  2PYE A;  4QRR A;  4WW2 C;  3MRP A;  1B0R A;  5H94 A;  3O3D A;  3P4M A;  4S0U C;  3W39 A;  1ZHN A;  3OV6 A;  4IRJ A;  1B3J A;  4PJC A;  5HGA A;  3VXS A;  3VFP A;  3TID A;  2BNQ A;  3LKR A;  3D3V A;  1QSE A;  1ED3 A;  2ZSV A;  3GSU A;  3LN4 A;  4CVZ A;  4G9D A;  3RWH A;  4U6Y A;  2FZ3 A;  2X4U A;  4N5E A;  4ZUV A;  1XZ0 A;  4Y4K A;  5IEK A;  1MHC A;  3BZF A;  5FA4 A;  3U0P A;  1AGE A;  3IT8 D;  3VFW A;  1P4L A;  5L2J A;  4G42 A;  5C08 A;  1MI5 A;  4XXC A;  3V5H A;  4MNQ A;  1JHT A;  2GTZ A;  4MJ5 A;  3E6H A;  4L4V A;  4U6X A;  5BRZ A;  1I1F A;  2BNR A;  2VE6 A;  3BH9 A;  5EOT A;  3I6L D;  4N8V A;  3MGO A;  5EUO A;  4Z78 A;  5GSV A;  3T8X A;  1S7S A;  3BZE A;  4NQE A;  4G43 A;  3VFS A;  4U1I A;  5AD0 A;  4Y4H A;  3CC5 A;  3PWL A;  5E8O A;  5IB3 A;  3D2U A;  1EEZ A;  3LKN A;  4F7T A;  1Q94 A;  3HUJ A;  3ARD A;  1JPF A;  3VJ6 A;  4N0F A;  1DDH A;  3QQ3 A;  1YPZ A;  3LKO A;  5C0B A;  4PG9 A;  3P4N A;  3FOL A;  4PRB A;  1ZHB A;  1FZM A;  3BEV A;  3IXA A;  1QQD A;  4K71 B;  1LK2 A;  1A1M A;  1UQS A;  1HHH A;  1BQH A;  3VFR A;  1JFM A;  1IM9 A;  5DDH A;  3BP7 A;  3GJF A;  1JPG A;  3MA7 A;  4U1J A;  5E8N A;  3WLB A;  5IRO A;  4F7P A;  2FIK A;  4FTV A;  3MV8 A;  5F1N A;  4GKS A;  4D0D A;  1ZSD A;  3RWF A;  4X6F A;  3QDM A;  1IM3 A;  1AGD A;  3KYO A;  4D0C A;  2X4P A;  2F53 A;  5MEP A;  3CZF A;  5B38 A;  4L8D A;  3FT2 A;  3BP4 A;  3C9N A;  2F54 A;  3GMO A;  4O2C A;  4IRS A;  4L8C A;  3MRR A;  2GT9 A;  3FTG A;  3GSN H;  3O3B A;  1VGK A;  4MJ6 A;  4WU5 A;  1S7Q A;  3UTT A;  1I1A A;  3X14 A;  1LDP H;  1FFO A;  4NQD A;  3ILQ C;  3ARB A;  3X11 A;  1RK1 A;  5C0F A;  3MRN A;  3PWN A;  4PR5 A;  5IB4 A;  1A1N A;  1T7Z A;  2FO4 A;  3SDX A;  3L3I A;  1DUY A;  3QUZ A;  4PJG A;  4WDI A;  1K8D A;  1RK0 A;  5J6H A;  1INQ A;  1ONQ A;  1P7Q A;  5IEH A;  4ZAK A;  3CPL A;  1LD9 A;  1S7U A;  1CG9 A;  1KPV A;  1S9Y A;  1DE4 A;  4LCC C;  2CII A;  4MVB A;  3GMQ A;  3VRJ A;  1S7X A;  3JVG A;  4PJI A;  4PV8 A;  2ZOK A;  3ILP A;  4PJ7 A;  3L3D A;  3BW9 A;  4MS8 A;  3WUW A;  3LKS A;  1RJZ A;  4ONO A;  3KPL A;  2VAA A;  2NX5 A;  3JTS A;  4JFE A;  4PGC A;  1JE6 A;  5E6I C;  3VXM A;  4PRD A;  3VFN A;  2HLA A;  3PWP A;  4Y16 A;  3UPR A;  1QVO A;  3VRI A;  1YDP A;  3CDG A;  5D7J C;  3VWJ A;  1E28 A;  5C0A A;  1S9W A;  2P5E A;  3FQT A;  1QSF A;  3VXU A;  5IND A;  2BCK A;  5L2K A;  3TBS A;  1NAM H;  4F7C A;  5HHO A;  4V3E B;  4WUU A;  5IM7 A;  4ZUT A;  1I7U A;  3KLA A;  2J8U A;  3RGV C;  4JQX A;  3WS6 A;  4E0R A;  4PJH A;  1PQZ A;  2AXF A;  4JQV A;  3PQY A;  4JRX A;  1TMC A;  4L9L C;  3FT4 A;  3GSQ A;  1NAN H;  1I7T A;  1YN7 A;  4GKN A;  4NO2 A;  4NQV A;  4CW1 A;  3RWJ A;  2P5W A;  1I7R A;  3AU1 A;  3KPO A;  3QDJ A;  3D25 A;  3HG1 A;  4EI5 A;  3SPV A;  3I6G A;  4PRH A;  2VLK A;  1BZ9 A;  3B6S A;  2XPG A;  1T20 A;  1ZT1 A;  1QRN A;  3D18 A;  5FKP A;  1W0W A;  2BVQ A;  2H6P A;  5ACZ A;  2CIK A;  2NW3 A;  4FFE X;  3RWE A;  5F9J A;  4MQ7 A;  3VCL A;  1HHI A;  3LKP A;  1ZHK A;  5MER A;  5C9J A;  3TZV C;  3P73 A;  3GMR A;  3T1F A;  4JFO A;  5BS0 A;  1M05 A;  4ZFZ A;  4MJI A;  3H7B A;  3HPJ A;  1AKJ A;  1QLF A;  3MRO A;  4O2E A;  1QR1 A;  1W72 A;  4L8B A;  3HAE A;  4Z77 A;  5BXF A;  3TPU E;  5C0J A;  1T21 A;  3M17 A;  4LCW A;  3REW A;  1OGT A;  3BGM A;  1HHK A;  1A1O A;  5HHQ A;  1T80 A;  2A83 A;  1HHG A;  5D7I A;  4PV9 A;  3FON A;  1E27 A;  3MRC A;  1FFN A;  3MRI A;  3MRH A;  5E9D A;  3CVH A;  3MRK A;  4HUX A;  1YN6 A;  4PJX A;  3DBX A;  3GSO A;  3MRG A;  4G8I A;  3WL9 A;  3QZW A;  2CLZ A;  1N5A A;  4QRQ A;  3RWC A;  4F7E A;  4NO3 A;  3B3I A;  2WY3 A;  5HHN A;  3BH8 A;  2CLR A;  2F74 A;  1G7Q A;  1B0G A;  4JFF A;  2H26 A;  3MRF A;  1KPU A;  4PJB A;  3SCM A;  1T22 A;  3L3J A;  3OXR A;  3RL2 A;  4U1S A;  3CH1 A;  3FQX A;  3HLA A;  3VXN A;  1JF1 A;  1X7Q A;  1FO0 H;  4N0C A;  3QFJ A;  4NNY A;  5IB2 A;  3MRM A;  1CD1 A;  3RUG A;  1A9B A;  5JHD A;  3TF7 A;  4G9F A;  1BD2 A;  4PJ8 A;  5IB1 A;  2YPK A;  4PRN A;  4EN3 C;  4PDC E;  1VAC A;  3PWU A;  3ARF A;  5DEF A;  1HYR C;  1LEG A;  3MV9 A;  4G8G A;  3UTS A;  4QRS A;  2YEZ A;  5INC A;  5IB5 A;  1AGC A;  2VLL A;  5HGH A;  4WU7 A;  4PG2 A;  1ZAG A;  5C07 A;  4QOK A;  1OGA A;  3FQW A;  3QUK A;  4IIQ C;  5FA3 A;  3KPM A;  4HWZ A;  4NO0 A;  5EU5 A;  3HCV A;  5D5M A;  2X4N A;  5D9S A;  3DTX A;  1KJV A;  3ARG A;  3ES6 A;  5HHP A;  3MYJ A;  1U58 A;  5MEQ A;  4PRI A;  3X12 A;  4PJA A;  2CLV A;  4MX7 A;  3QFD A;  4L8S C;  3L3G A;  3GIV A;  3PWJ A;  3VFM A;  4LNR A;  1T1X A;  1WBY A;  3DX8 A;  3GSV A;  4O2F A;  3ERY A;  3GSX A;  3O8X A;  4L4T A;  3DMM A;  4U1H A;  1ZT4 A;  3QUX A;  3O4L A;  4JFD A;  1EFX A;  4PJ5 A;  4PGE A;  4QRP A;  5MEO A;  3BXN A;  4ZUS A;  4LCY A;  4Y2D A;  5J1A A;  2X4T A;  1T0M A;  3NFN A;  1N2R A;  1S7T A;  2GTW A;  1SYS A;  4N0U A;  1T7Y A;  5EU6 A;  1UXW A;  3C8K A;  1T7X A;  3TA3 A;  1HHJ A;  4JFQ A;  3LV3 A;  5HGD A;  5C09 A;  1TVB A;  2AV7 A;  4PP8 C;  3PWV A;  1ZS8 A;  3PAB A;  5EU4 A;  3TBY A;  4QRT A;  4NO5 A;  2HN7 A;  1MWA H;  2X4R A;  4JRY A;  2AK4 A;  1JGE A;  3MGT A;  1L8J A;  5HHM A;  4GUP A;  3TN0 A;  3VWK A;  4ZUW A;  2X4O A;  3ROL A;  1LEK A;  2ESV A;  5DEG A;  4E5X A;  2BVP A;  3S6C A;  3BVN A;  3KPQ A;  2AKR A;  3GSR A;  5FDW A;  4NQC A;  1KJ2 H;  2VLR A;  2YPL A;  3KPN A;  1WBZ A;  3E3Q A;  1I4F A;  1VAD A;  1ZT7 A;  4HUU A;  4NT6 A;  3FQU A;  2V2X A;  1ZVS A;  3LN5 A;  3E2H A;  1HSB A;  1C16 A;  4D0B A;  4PRE A;  1S7R A;  3OXS A;  1DUZ A;  1HOC A;  1N59 A;  3QUY A;  3TVM A;  3HE6 A;  1Z5L A;  3LKQ A;  1AGF A;  4PGD A;  3QDG A;  1I1Y A;  3ROO A;  3KPS A;  2BSS A;  4PJD A;  2BST A;  4HS3 A;  2Q7Y A;  1R3H A;  3RZC A;  4NHU E;  4ZUU A;  1T1Z A;  5B39 A;  4X6D A;  3UTQ A;  3HE7 A;  3KYN A;  5C0E A;  1EXU A;  3ECB A;  4WJ5 A;  5F7D A;  3RWI A;  5J6G A;  5D7L A;  2D31 A;  2GIT A;  4UQ3 A;  3FFC A;  3VXP A;  3MRD A;  2E7L E;  3VFO A;  4U1N A;  4HX1 A;  4HUV A;  1P1Z A;  3DX7 A;  3AM8 A;  1KBG H;  2FYY A;  3TBW A;  5E00 A;  5C0I A;  3X13 A;  4APQ A;  1BII A;  3O3A A;  1LQV A;  4QRU A;  1T0N A;  3WS3 A;  4PRA A;  3BO8 A;  5D2L A;  4MXQ A;  2VAB A;  2ZSW A;  5HGB A;  2CKB H;  1S7V A;  4L3E A;  2GAZ A;  4NNX A;  5F1I A;  3MRB A;  3VXR A;  1G7P A;  1S8D A;  1FZK A;  2BSR A;  2MHA A;  5MEN A;  3O9W A;  4L3C A;  4NQX A;  4I48 A;  5ISZ A;  3FT3 A;  1A9E A;  3VFU A;  1JUF A;  3SKM A;  1FZO A;  3H9S A;  3MRQ A;  4U1M A;  3RL1 A;  3VFT A;  5GSR A;  1HSA A;  3BEW A;  1XH3 A;  3L3K A;  1SYV A;  2OL3 H;  4WWK C;  1EEY A;  3FQN A;  4PJ9 A;  3VFV A;  1KPR A;  2VLJ A;  3GMN A;  3D39 A;  3CCH A;  4CVX A;  3GMP A;  2GJ6 A;  1M6O A;  1OF2 A;  3TJH A;  4LHU A;  4HV8 A;  2X4Q A;  3RWG A;  4PGB A;  3QEQ A;  3TBT A;  1MHE A;  3MR9 A;  4UQ2 A;  4I4W A;  3SDA A;  3TO4 A;  2JCC A;  3P4O A;  1N3N A;  3UBX A;  4PRP A;  3M1B A;  3V5D A;  1T1W A;  4HUW A;  1KCG C;  3VXO A;  4PJE A;  1S7W A;  3QUL A;  4EUP A;  1CE6 A;  3QQ4 A;  3BWA A;  2BVO A;  3OX8 A;  5BJT A;  4ELM A;  3W0W A;  2HJK A;  3ARE A;  2AV1 A;  3TIE A;  1OSZ A;  5D2N A;  3QI9 A;  3SDD A;  3JTC A;  3SJV A;  1A6Z A;  5SWQ A;  3KPP A;  3MRJ A;  1AO7 A;  4HKJ A;  3DXA A;  3MRE A;  1FG2 A;  5EO1 A;  1GZQ A;  1GZP A;  1FZJ A;  3TBV A;  1S9X A;  1FFP A;  3KPR A;  1KJ3 H;  2FWO A;  5C0C A;  4V3D B;  1KJM A;  1T7V A;  2DYP A;  2AXG A;  3KXF A;  3TFK A;  3TO2 A;  1LP9 A;  1T7W A;  3MRL A;  3G08 A;  3L9R A;  3GML A;  2GUO A;  4Y4F A;  2PO6 A;  5EU3 A;  3DX6 A;  5E8P A;  4MNG A;  3I6K A;  4F7M A;  3FQR A;  5C0G A;  3MV7 A;  4U1K A;  1XR9 A;  5SWZ A;  5EO0 A;  3VH8 A;  4NSK A;  5IVX A;  3KWW A;  1W0V A;  3RWD A;  3V5K A;  3JTT A;  3P9L A;  1QO3 A;  2V2W A;  1K5N A;  1ZHL A;  1AGB A;  1WBX A;  4Z76 A;  4JFP A;  4X6C A;  3FRU A;  3BUY A;  3GSW A;  2X70 A;  2ZOL A;  3GMM A;  3P9M A;  5ENW A;  4K7F A;  3RTQ A;  1RJY A;  3SKO A;  2C7U A;  3P77 A;  4WO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...