3TPUE

42f3 p5e8/h2-ld complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
175
Chain Sequence
GPHSMRYYETATSRRGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 42F3 alpha
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 49
structure length 175
sequence length 177
chains with identical sequence I, K, Q
ec nomenclature
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tpuE00
3L3HA 4ZUUA 3QUZA 3JVGA 2BVOA 3MR9A 3MRLA 3VRJA 2BVQA 3BO8A 5ACZA 4U6XA 3HPJA 1A6ZA 2XFXA 5D2LA 3T8XA 4EI5A 4X6FA 2CKBH 3O8XA 2NW3A 3M1BA 3L3IA 3VFOA 4ZUTA 5BS0A 2CIKA 2H6PA 3QDJA 4QRPA 1T1YA 3TBSA 3DXAA 1K8DA 2NX5A 3BVNA 1Z5LA 3GMQA 1ZHNA 5MERA 1G7QA 3WL9A 1FZJA 4JFFA 5GSVA 4XXCA 3S6CA 4ONOA 3NFNA 3UTQA 3MREA 3AM8A 3JTTA 4Y4HA 3MGTA 4G9FA 1ED3A 4FFEX 3X13A 3P73A 5D7IA 4PJ8A 3JTSA 3O3EA 3ECBA 4I48A 5IEHA 5IVXA 1Q94A 2OI9A 1UXWA 3P4NA 3MRKA 5HGHA 2FWOA 2P5WA 1DE4A 4PJGA 4PJBA 3TIDA 2BCKA 3FOMA 1A1NA 5BRZA 4G42A 4D0BA 2CLRA 3VRIA 5F1NA 3PWVA 3FQNA 3DX7A 4HKJA 3GSUA 3RWGA 4U1MA 5H94A 3H7BA 4Z78A 3PWUA 4U1NA 2HN7A 5E00A 1BQHA 3MRCA 5E8OA 5GSRA 1KJMA 3TJHA 4Y4KA 1AO7A 3LV3A 3QEQA 3BH8A 4NO2A 3FONA 2XPGA 3BW9A 4PJ9A 1FG2A 3MRRA 3MRGA 2CIIA 4PR5A 3RGVC 2VABA 5D2NA 4GKNA 1RK1A 1WBYA 4PG2A 3V5DA 2P5EA 1XR9A 3FT2A 3UPRA 3W39A 4L29A 1ZVSA 5SWZA 3MRHA 3KWWA 2GITA 3M17A 1T80A 3VCLA 4O2CA 3ERYA 3SCMA 4EUPA 4JFEA 1ZSDA 3TBYA 3GMRA 5EU5A 4L8BA 5DEGA 3WUWA 3FQXA 3OXSA 3VXMA 1OGTA 4QRQA 4MNGA 3UBXA 1HSAA 1K5NA 4MVBA 3BHBA 5IEKA 2FO4A 1KCGC 1I4FA 4X6CA 4Z76A 3BP7A 1RJYA 4G9DA 4MJ6A 2BNRA 3HG1A 4NO0A 1KPRA 3QUXA 4N0UA 1E28A 5F7DA 4ZFZA 3MRFA 1KPUA 1HOCA 3BGMA 3RWFA 5HGBA 1I1YA 4N5EA 5EU3A 1KPVA 3AREA 4HUVA 3GSXA 3VFRA 4L3CA 3VFWA 5ENWA 3GMPA 5INDA 3RWEA 1PQZA 4NQXA 1G7PA 5B39A 3TPUE 1UQSA 4MNQA 3LKRA 3TO2A 1YDPA 3BZFA 4MJ5A 5EO1A 4HUUA 4U1KA 3QDGA 1JFMA 4HS3A 4PRDA 3B3IA 5C08A 1B0GA 2AXGA 3DTXA 3E3QA 3VXPA 5MEOA 4NQCA 2GTWA 3UTTA 1LDPH 4N8VA 5AD0A 3CPLA 2D31A 2WY3A 2J8UA 1T0NA 1CE6A 1QRNA 1W0WA 3GMNA 3KPSA 3QQ4A 4EN3C 1W0VA 1T7YA 3MRDA 1N5AA 3O9WA 3DBXA 4N0FA 3VFSA 4MXQA 1S7WA 4PV9A 1INQA 3GJFA 3QQ3A 3BWAA 1T1WA 4F7MA 1FFPA 3I6GA 1S7RA 2X70A 2HJKA 3HCVA 1FFNA 5IB5A 3FQTA 4NHUE 3FQRA 1OSZA 2AKRA 5MENA 1RJZA 2BSTA 4GKSA 3BP4A 4HUWA 4LHUA 3D3VA 3PQYA 4LCCC 4WO4A 1CD1A 3SDCA 2YPLA 3VXNA 3GMLA 1I1FA 4PJ7A 3MRJA 5HHMA 3L9RA 3ILQC 4QRSA 1FO0H 1A1MA 2VLLA 1QEWA 5EO0A 3TBVA 4JQVA 1U58A 3VH8A 4L4VA 3KPOA 4PRPA 5F1IA 3X14A 4Y16A 3D18A 3L3JA 4HX1A 1ZHLA 3H9SA 3C8KA 5HHOA 1FZKA 4NO3A 4PGDA 4QRTA 5L2KA 3KLAA 3D25A 3L3GA 4JFQA 4LCYA 1LEKA 1AGDA 5FA3A 1JPGA 4WU7A 2BNQA 1HHIA 1S7VA 2GUOA 4K71B 2X4PA 3AU1A 3HLAA 2FYYA 4ZUSA 2ZSVA 5EUOA 3VXOA 5MEQA 3TFKA 4ZAKA 1LP9A 3KPRA 5D5MA 1I7UA 1VGKA 3LKSA 4JRXA 4U1JA 4WU5A 4X6EA 3FOLA 3VFVA 3BZEA 1A9BA 3L3DA 4K7FA 3TA3A 4E5XA 4NT6A 3RZCA 4GUPA 3RUGA 5IB1A 3QDMA 4F7CA 1FZMA 3FQWA 3KPNA 1DUZA 1T7WA 2AXFA 5FKPA 1SYSA 1QSEA 1LK2A 3L3KA 3E2HA 4G8IA 3ROOA 3TBWA 5J6GA 1VADA 4N0CA 3ARBA 1KBGH 3OV6A 3PWPA 4WDIA 3QUKA 3TBTA 3IT8D 3MRNA 5INCA 4PJDA 3SDDA 3MGOA 1ONQA 5IM7A 1XZ0A 5DDHA 1FFOA 1KJ3H 5HGDA 2HLAA 1HHKA 1S7SA 3VFUA 3GMMA 3U0PA 4WWKC 1LQVA 5D9SA 5EFIA 4PJ5A 2E7LE 4NNXA 2AK4A 4ZUVA 4QRUA 3MV8A 5IB4A 5C0DA 1S8DA 3BEVA 1S7XA 3BH9A 4UQ3A 1EEYA 2CLZA 5FA4A 3KPQA 1JUFA 3FTGA 3PWNA 3MRQA 3VWJA 3C9NA 2F74A 2F54A 3DMMA 5E8PA 3D39A 4L8CA 3TIEA 3REWA 1EFXA 1NEZA 1TVBA 4I4WA 1JF1A 3SDAA 3MV9A 2X4OA 1EEZA 2FIKA 1FZOA 1S7QA 2VLJA 4PJFA 4PJXA 5DEFA 1VACA 1T0MA 4PJHA 3LKPA 1QQDA 4IIQC 5HYJA 1LD9A 3X11A 4PRAA 5ISZA 4JFOA 1P4LA 2VLRA 2C7UA 3MROA 1MHEA 5C0AA 2ZOLA 4HUXA 4JFPA 3VFPA 3ARGA 1EXUA 1XH3A 1ZT4A 4Y4FA 1HHGA 3SKOA 3HUJA 3BXNA 3O4LA 5F9JA 1S9YA 3E6HA 3QFDA 3KPMA 1JE6A 3LKOA 3O3DA 5JHDA 1XR8A 3PWJA 4U1HA 4Z77A 2GT9A 3CCHA 4G8GA 3VXRA 4NQVA 4LCWA 4L3EA 3V5KA 1DUYA 2A83A 3CVHA 4PJIA 1CG9A 2RFXA 4PG9A 3I6LD 3LN4A 4NQEA 2MHAA 5HHQA 1T1XA 2F53A 2X4NA 2BSRA 4FTVA 1QO3A 4IRSA 5HHPA 1T20A 3IXAA 2VAAA 1S9XA 5C0CA 3GSQA 1JGEA 4PV8A 5J6HA 1DDHA 4PRNA 4NSKA 4U1SA 3X12A 4PJEA 3CZFA 3QULA 4O2EA 5E6IC 3TO4A 1RK0A 3ARFA 4JRYA 3TVMA 3ES6A 3GSWA 3P4MA 5C07A 1R3HA 5IROA 4JFDA 4PGEA 3FRUA 2HJLA 5BJTA 4F7TA 3V5HA 3QUYA 4LNRA 3P9MA 1TMCA 1P1ZA 5EU6A 1T7ZA 4APQA 1N2RA 1I7RA 3I6KA 3BEWA 2X4TA 4O2FA 4D0DA 1X7QA 5EU4A 5HGAA 4MS8A 4PRIA 3WS6A 1GZQA 3G08A 1QSFA 3QI9A 3OXRA 3KPPA 1ZT7A 4F7PA 4G59A 1G6RH 3P4OA 1N59A 1S7UA 3LN5A 5E9DA 1L8JA 3W0WA 4QRRA 3MYJA 1HHHA 1YN7A 3RTQA 5L2JA 1ZHKA 4WJ5A 4U1LA 1AGFA 1C16A 3MRPA 4G43A 3T1FA 4NNYA 1LEGA 1HSBA 5C0IA 1NANH 1M05A 3VWKA 4JQXA 3ILPA 5C09A 4E0RA 2UWEA 1T22A 1JHTA 1A9EA 1NAMH 3TN0A 4PGBA 4X6DA 2X4SA 3OX8A 3UTSA 2AV7A 2VE6A 3VFNA 4CVXA 5C0FA 4PDCE 3WS3A 1UXSA 1WBZA 2YPKA 1QR1A 4IHOA 2GAZA 5SWQA 2ZSWA 3FFCA 1BZ9A 1ZAGA 1ZT1A 3GIVA 5EOTA 1JPFA 4UQ2A 2CLVA 3WLBA 5C0EA 3CC5A 1S9WA 3LKNA 3VXUA 3GSRA 1AGCA 1I1AA 5FDWA 3VJ6A 1WBXA 3RWHA 3FT4A 1IM3A 3RWCA 1MI5A 3GSNH 4PGCA 4U1IA 4F7EA 2H26A 3H9HA 4PJCA 1T1ZA 5J1AA 3PWLA 2BSSA 1MHCA 2X4UA 1TVHA 4L8DA 4WUUA 2ESVA 5E8NA 4V3DB 2GJ6A 3P77A 2V2WA 1YN6A 3DX8A 1P7QA 2AV1A 3FQUA 3KYNA 4PREA 5C0BA 3SJVA 5IB2A 1KJVA 3TZVC 1B0RA 3MV7A 4L9LC 4CVZA 1MWAH 3BUYA 3TF7A 4MX7A 1T21A 2OL3H 4MQ7A 5SWSA 2GTZA 1IM9A 3KYOA 4PRHA 3KPLA 2VLKA 4PRBA 5MEPA 4ZUWA 1QLFA 4U6YA 1QVOA 2DYPA 1AGEA 3GMOA 4HV8A 1OGAA 3DX6A 3CH1A 3B6SA 3SKMA 3LKQA 3E6FA 4L4TA 1AGBA 4QOKA 4Y2DA 3GSOA 3CDGA 4IRJA 3O3BA 5D7JC 4NO5A 2JCCA 1YPZA 1T7XA 1ZS8A 2BVPA 5D7LA 5C0JA 3FT3A 5C9JA 1B3JA 3P9LA 3HAEA 3RWDA 3VFMA 3QZWA 1T7VA 4HWZA 4V3EB 4CW1A 1M6OA 4MJIA 1SYVA 3ROLA 3MRBA 1JGDA 4NQDA 1KJ2H 1BIIA 3QFJA 2YEZA 1ZHBA 1BD2A 4S0UC 3HE7A 3RWJA 3HE6A 3RL1A 3KXFA 2X4RA 3VXSA 5B38A 1S7TA 1I7TA 1N3NA 1OF2A 1W72A 2Q7YA 4D0CA 3VFTA 5BXFA 2PYEA 3D2UA 1HYRC 2V2XA 4PP8C 3RL2A 3SDXA 4L8SC 1AKJA 3ARDA 1KTLA 3RWIA 2PO6A 2X4QA 1GZPA 3O3AA 4ELMA 4PJAA 1E27A 5C0GA 4WW2C 1A1OA 3MA7A 3MRIA 5IB3A 2FZ3A 1HHJA 3PABA 3GSVA 3SPVA 2ZOKA 3JTCA 5HHNA 3MRMA
chains in the Genus database with same CATH superfamily
3L3HA 4ZUUA 3QUZA 3JVGA 2BVOA 3MR9A 3MRLA 3VRJA 2BVQA 3BO8A 5ACZA 4U6XA 3HPJA 1A6ZA 2XFXA 5D2LA 3T8XA 4EI5A 4X6FA 2CKBH 3O8XA 2NW3A 3M1BA 3L3IA 3VFOA 4ZUTA 5BS0A 2CIKA 2H6PA 3QDJA 4QRPA 1T1YA 3TBSA 3DXAA 1K8DA 2NX5A 3BVNA 1Z5LA 4JO8A 3GMQA 1ZHNA 5MERA 1G7QA 3WL9A 1FZJA 4JFFA 5GSVA 4XXCA 3S6CA 4ONOA 3NFNA 3UTQA 3MREA 3AM8A 3JTTA 4Y4HA 3MGTA 4G9FA 1ED3A 4FFEX 3X13A 3P73A 5D7IA 4PJ8A 3JTSA 3O3EA 3ECBA 4I48A 5IEHA 5IVXA 1Q94A 2OI9A 1UXWA 3P4NA 3MRKA 5HGHA 2FWOA 2P5WA 1DE4A 4PJGA 4PJBA 3TIDA 2BCKA 3FOMA 1A1NA 5BRZA 4G42A 4D0BA 2CLRA 3VRIA 5F1NA 3PWVA 3FQNA 3DX7A 4HKJA 3GSUA 3RWGA 4U1MA 5H94A 3H7BA 4Z78A 3PWUA 4U1NA 2HN7A 5E00A 1BQHA 3MRCA 5E8OA 5GSRA 1KJMA 3TJHA 4Y4KA 1AO7A 3LV3A 3QEQA 3BH8A 4NO2A 3FONA 2XPGA 3BW9A 4PJ9A 1FG2A 3MRRA 3MRGA 2CIIA 4PR5A 3RGVC 2VABA 5D2NA 4GKNA 1RK1A 1WBYA 4PG2A 3V5DA 2P5EA 1XR9A 3FT2A 3UPRA 3W39A 4L29A 1ZVSA 5SWZA 3MRHA 3KWWA 2GITA 3M17A 1T80A 3VCLA 4O2CA 3ERYA 3SCMA 4EUPA 4JFEA 1ZSDA 3TBYA 3GMRA 5EU5A 4L8BA 5DEGA 3WUWA 3FQXA 3OXSA 3VXMA 1OGTA 4QRQA 4MNGA 3UBXA 1HSAA 1K5NA 4MVBA 3BHBA 5IEKA 2FO4A 1KCGC 1I4FA 4X6CA 4Z76A 3BP7A 1RJYA 4G9DA 4MJ6A 2BNRA 3HG1A 4NO0A 1KPRA 3QUXA 4N0UA 1E28A 5F7DA 4ZFZA 3MRFA 1KPUA 1HOCA 3BGMA 3RWFA 5HGBA 1I1YA 4N5EA 5EU3A 1KPVA 3AREA 4HUVA 3GSXA 3VFRA 4L3CA 3VFWA 5ENWA 3GMPA 5INDA 3RWEA 1PQZA 4NQXA 1G7PA 5B39A 3TPUE 1UQSA 4MNQA 3LKRA 3TO2A 1YDPA 3BZFA 4MJ5A 5EO1A 4HUUA 4U1KA 3QDGA 1JFMA 4HS3A 4PRDA 3B3IA 5C08A 1B0GA 2AXGA 3DTXA 3E3QA 3VXPA 5MEOA 4NQCA 2GTWA 3UTTA 1LDPH 4N8VA 5AD0A 3CPLA 2D31A 2WY3A 2J8UA 4G59C 1T0NA 1CE6A 1QRNA 1W0WA 3GMNA 3KPSA 3QQ4A 4EN3C 1W0VA 1T7YA 3MRDA 1N5AA 3O9WA 3DBXA 4N0FA 3VFSA 4MXQA 1S7WA 4PV9A 1INQA 3GJFA 3QQ3A 3BWAA 1T1WA 4F7MA 1FFPA 3I6GA 1S7RA 2X70A 2HJKA 3HCVA 1FFNA 5IB5A 3FQTA 4NHUE 3FQRA 1OSZA 2AKRA 5MENA 1RJZA 2BSTA 4GKSA 3BP4A 4HUWA 4LHUA 3D3VA 3PQYA 4LCCC 4WO4A 1CD1A 3SDCA 2YPLA 3VXNA 3GMLA 1I1FA 4PJ7A 3MRJA 5HHMA 3L9RA 3ILQC 4QRSA 1FO0H 1A1MA 2VLLA 1QEWA 5EO0A 3TBVA 4JQVA 1U58A 3VH8A 4L4VA 3KPOA 4PRPA 5F1IA 3X14A 4Y16A 3D18A 3L3JA 4HX1A 2NYKA 1ZHLA 3H9SA 3C8KA 5HHOA 1FZKA 4NO3A 4PGDA 4QRTA 5L2KA 3KLAA 3D25A 3L3GA 4JFQA 4LCYA 1LEKA 1AGDA 5FA3A 1JPGA 4WU7A 2BNQA 1HHIA 1S7VA 2GUOA 4K71B 2X4PA 3AU1A 3HLAA 2FYYA 4ZUSA 2ZSVA 5EUOA 3VXOA 5MEQA 3TFKA 4ZAKA 1LP9A 3KPRA 5D5MA 1I7UA 1VGKA 3LKSA 4JRXA 4U1JA 4WU5A 4X6EA 3FOLA 3VFVA 3BZEA 1A9BA 3L3DA 4K7FA 3TA3A 4E5XA 4NT6A 3RZCA 4GUPA 3RUGA 5IB1A 3QDMA 4F7CA 1FZMA 3FQWA 3KPNA 1DUZA 1T7WA 2AXFA 5FKPA 1SYSA 1QSEA 1LK2A 3L3KA 3E2HA 4G8IA 3ROOA 3TBWA 5J6GA 1VADA 4N0CA 3ARBA 1KBGH 3OV6A 3PWPA 4WDIA 3QUKA 3TBTA 3IT8D 3MRNA 5INCA 4PJDA 3SDDA 3MGOA 1ONQA 5IM7A 1XZ0A 5DDHA 1FFOA 1KJ3H 5HGDA 2HLAA 1HHKA 1S7SA 3VFUA 3GMMA 3U0PA 4WWKC 1LQVA 5D9SA 5EFIA 4PJ5A 2E7LE 4NNXA 2AK4A 4ZUVA 4QRUA 3MV8A 5IB4A 5C0DA 1S8DA 3BEVA 1S7XA 3BH9A 4UQ3A 1EEYA 2CLZA 5FA4A 3KPQA 1JUFA 3FTGA 3PWNA 3MRQA 3VWJA 3C9NA 2F74A 2F54A 3DMMA 5E8PA 3D39A 4L8CA 3TIEA 3REWA 1EFXA 1NEZA 1TVBA 4I4WA 1JF1A 3SDAA 3MV9A 2X4OA 1EEZA 2FIKA 1FZOA 1S7QA 2VLJA 4PJFA 4PJXA 5DEFA 1VACA 1T0MA 2O5NA 3LKPA 1QQDA 4IIQC 4PJHA 5HYJA 1LD9A 3X11A 4PRAA 5ISZA 4JFOA 1P4LA 2VLRA 2C7UA 3MROA 1MHEA 5C0AA 2ZOLA 4HUXA 4JFPA 3VFPA 3ARGA 1EXUA 1XH3A 1ZT4A 4Y4FA 1HHGA 3SKOA 3HUJA 3BXNA 3O4LA 5F9JA 1S9YA 3E6HA 3QFDA 3KPMA 1JE6A 3LKOA 3O3DA 5JHDA 1XR8A 3PWJA 4U1HA 4Z77A 2GT9A 3CCHA 4G8GA 3VXRA 4NQVA 4LCWA 4L3EA 3V5KA 1DUYA 2A83A 3CVHA 4PJIA 1CG9A 2RFXA 4PG9A 3I6LD 3LN4A 4NQEA 2MHAA 5HHQA 1T1XA 2F53A 2X4NA 2BSRA 4FTVA 1QO3A 4IRSA 5HHPA 1T20A 3IXAA 2VAAA 1S9XA 5C0CA 3GSQA 1JGEA 4PV8A 5J6HA 1DDHA 4PRNA 4NSKA 4U1SA 3X12A 4PJEA 3CZFA 3QULA 4O2EA 5E6IC 3TO4A 1RK0A 3ARFA 4JRYA 3TVMA 3ES6A 3GSWA 3P4MA 5C07A 1R3HA 5IROA 4JFDA 4PGEA 3FRUA 2HJLA 5BJTA 4F7TA 3V5HA 3QUYA 4LNRA 3P9MA 1TMCA 1P1ZA 5EU6A 1T7ZA 4APQA 1N2RA 1I7RA 3I6KA 3BEWA 2X4TA 4O2FA 4D0DA 1X7QA 5EU4A 5HGAA 4MS8A 4PRIA 3WS6A 1GZQA 3G08A 1QSFA 3QI9A 3OXRA 3KPPA 1ZT7A 4F7PA 4G59A 1G6RH 3P4OA 1N59A 1S7UA 3LN5A 5E9DA 1L8JA 3W0WA 4QRRA 3MYJA 1HHHA 1YN7A 3RTQA 5L2JA 1ZHKA 4WJ5A 4U1LA 1AGFA 1C16A 3MRPA 4G43A 3T1FA 4NNYA 1LEGA 1HSBA 5C0IA 1NANH 1M05A 3VWKA 4JQXA 3ILPA 5C09A 4E0RA 2UWEA 1T22A 1JHTA 1A9EA 1NAMH 3TN0A 2IA1A 4PGBA 4X6DA 2X4SA 3OX8A 3UTSA 2AV7A 2VE6A 3I0TA 3VFNA 4CVXA 5C0FA 4PDCE 3WS3A 1UXSA 1WBZA 2YPKA 1QR1A 4IHOA 2GAZA 5SWQA 2ZSWA 3FFCA 1BZ9A 1ZAGA 1ZT1A 3GIVA 5EOTA 1JPFA 4UQ2A 2CLVA 3WLBA 5C0EA 3CC5A 1S9WA 3LKNA 3VXUA 3GSRA 1AGCA 1I1AA 5FDWA 3VJ6A 1WBXA 3RWHA 3FT4A 1IM3A 3RWCA 1MI5A 3GSNH 4PGCA 4U1IA 4F7EA 2H26A 3H9HA 4PJCA 1T1ZA 5J1AA 3PWLA 2BSSA 1MHCA 2X4UA 1TVHA 4L8DA 4WUUA 2ESVA 5E8NA 4V3DB 2GJ6A 3P77A 2V2WA 1YN6A 3DX8A 1P7QA 2AV1A 3FQUA 3KYNA 4PREA 5C0BA 3SJVA 5IB2A 1KJVA 3TZVC 1B0RA 3MV7A 4L9LC 4CVZA 1MWAH 3BUYA 3TF7A 4MX7A 1T21A 2OL3H 4MQ7A 5SWSA 2GTZA 1IM9A 3KYOA 4PRHA 3KPLA 2VLKA 4PRBA 5MEPA 4ZUWA 1QLFA 4U6YA 1QVOA 2DYPA 1AGEA 3GMOA 4HV8A 1OGAA 3DX6A 3CH1A 3B6SA 3SKMA 3LKQA 3E6FA 4L4TA 1AGBA 4QOKA 4Y2DA 3GSOA 3CDGA 4IRJA 3O3BA 5D7JC 4NO5A 2JCCA 1YPZA 1T7XA 1ZS8A 2BVPA 5D7LA 5C0JA 3FT3A 5C9JA 1B3JA 3P9LA 3HAEA 3RWDA 3VFMA 3QZWA 1T7VA 4HWZA 4V3EB 4CW1A 1M6OA 4MJIA 1SYVA 3ROLA 3MRBA 1JGDA 4NQDA 1KJ2H 1BIIA 3QFJA 2YEZA 1ZHBA 1BD2A 4S0UC 3HE7A 3RWJA 3HE6A 3RL1A 3KXFA 2X4RA 3VXSA 5B38A 1S7TA 1I7TA 1N3NA 1OF2A 1W72A 2Q7YA 4D0CA 3VFTA 5BXFA 2PYEA 3D2UA 1HYRC 2V2XA 4PP8C 3RL2A 3SDXA 4L8SC 1AKJA 3ARDA 1KTLA 3RWIA 2PO6A 2X4QA 1GZPA 3O3AA 4ELMA 4PJAA 1E27A 5C0GA 4WW2C 1A1OA 3MA7A 3MRIA 5IB3A 2FZ3A 1HHJA 3PABA 3GSVA 3SPVA 2ZOKA 3JTCA 5HHNA 4BKWA 3MRMA
chains in the Genus database with same CATH topology
3L3HA 4ZUUA 3QUZA 3JVGA 2BVOA 3MR9A 3MRLA 3VRJA 2BVQA 3BO8A 5ACZA 4U6XA 3HPJA 1A6ZA 2XFXA 5D2LA 3T8XA 4EI5A 4X6FA 2CKBH 3O8XA 2NW3A 3M1BA 3L3IA 3VFOA 4ZUTA 5BS0A 2CIKA 2H6PA 3QDJA 4QRPA 1T1YA 3TBSA 3DXAA 1K8DA 2NX5A 3BVNA 1Z5LA 3GMQA 1ZHNA 5MERA 1G7QA 3WL9A 1FZJA 4JFFA 5GSVA 4XXCA 3S6CA 4ONOA 3NFNA 3UTQA 3MREA 3AM8A 3JTTA 4Y4HA 3MGTA 4G9FA 1ED3A 4FFEX 3X13A 3P73A 5D7IA 4PJ8A 3JTSA 3O3EA 3ECBA 4I48A 5IEHA 5IVXA 1Q94A 2OI9A 1UXWA 3P4NA 3MRKA 5HGHA 2FWOA 2P5WA 1DE4A 4PJGA 4PJBA 3TIDA 2BCKA 3FOMA 1A1NA 5BRZA 4G42A 4D0BA 2CLRA 3VRIA 5F1NA 3PWVA 3FQNA 3DX7A 4HKJA 3GSUA 3RWGA 4U1MA 5H94A 3H7BA 4Z78A 3PWUA 4U1NA 2HN7A 5E00A 1BQHA 3MRCA 5E8OA 5GSRA 1KJMA 3TJHA 4Y4KA 1AO7A 3LV3A 3QEQA 3BH8A 4NO2A 3FONA 2XPGA 3BW9A 4PJ9A 1FG2A 3MRRA 3MRGA 2CIIA 4PR5A 3RGVC 2VABA 5D2NA 4GKNA 1RK1A 1WBYA 4PG2A 3V5DA 2P5EA 1XR9A 3FT2A 3UPRA 3W39A 4L29A 1ZVSA 5SWZA 3MRHA 3KWWA 2GITA 3M17A 1T80A 3VCLA 4O2CA 3ERYA 3SCMA 4EUPA 4JFEA 1ZSDA 3TBYA 3GMRA 5EU5A 4L8BA 5DEGA 3WUWA 3FQXA 3OXSA 3VXMA 1OGTA 4QRQA 4MNGA 3UBXA 1HSAA 1K5NA 4MVBA 3BHBA 5IEKA 2FO4A 1KCGC 1I4FA 4X6CA 4Z76A 3BP7A 1RJYA 4G9DA 4MJ6A 2BNRA 3HG1A 4NO0A 1KPRA 3QUXA 4N0UA 1E28A 5F7DA 4ZFZA 3MRFA 1KPUA 1HOCA 3BGMA 3RWFA 5HGBA 1I1YA 4N5EA 5EU3A 1KPVA 3AREA 4HUVA 3GSXA 3VFRA 4L3CA 3VFWA 5ENWA 3GMPA 5INDA 3RWEA 1PQZA 4NQXA 1G7PA 5B39A 3TPUE 1UQSA 4MNQA 3LKRA 3TO2A 1YDPA 3BZFA 4MJ5A 5EO1A 4HUUA 4U1KA 3QDGA 1JFMA 4HS3A 4PRDA 3B3IA 5C08A 1B0GA 2AXGA 3DTXA 3E3QA 3VXPA 5MEOA 4NQCA 2GTWA 3UTTA 1LDPH 4N8VA 5AD0A 3CPLA 2D31A 2WY3A 2J8UA 1T0NA 1CE6A 1QRNA 1W0WA 3GMNA 3KPSA 3QQ4A 4EN3C 1W0VA 1T7YA 3MRDA 1N5AA 3O9WA 3DBXA 4N0FA 3VFSA 4MXQA 1S7WA 4PV9A 1INQA 3GJFA 3QQ3A 3BWAA 1T1WA 4F7MA 1FFPA 3I6GA 1S7RA 2X70A 2HJKA 3HCVA 1FFNA 5IB5A 3FQTA 4NHUE 3FQRA 1OSZA 2AKRA 5MENA 1RJZA 2BSTA 4GKSA 3BP4A 4HUWA 4LHUA 3D3VA 3PQYA 4LCCC 4WO4A 1CD1A 3SDCA 2YPLA 3VXNA 3GMLA 1I1FA 4PJ7A 3MRJA 5HHMA 3L9RA 3ILQC 4QRSA 1FO0H 1A1MA 2VLLA 1QEWA 5EO0A 3TBVA 4JQVA 1U58A 3VH8A 4L4VA 3KPOA 4PRPA 5F1IA 3X14A 4Y16A 3D18A 3L3JA 4HX1A 1ZHLA 3H9SA 3C8KA 5HHOA 1FZKA 4NO3A 4PGDA 4QRTA 5L2KA 3KLAA 3D25A 3L3GA 4JFQA 4LCYA 1LEKA 1AGDA 5FA3A 1JPGA 4WU7A 2BNQA 1HHIA 1S7VA 2GUOA 4K71B 2X4PA 3AU1A 3HLAA 2FYYA 4ZUSA 2ZSVA 5EUOA 3VXOA 5MEQA 3TFKA 4ZAKA 1LP9A 3KPRA 5D5MA 1I7UA 1VGKA 3LKSA 4JRXA 4U1JA 4WU5A 4X6EA 3FOLA 3VFVA 3BZEA 1A9BA 3L3DA 4K7FA 3TA3A 4E5XA 4NT6A 3RZCA 4GUPA 3RUGA 5IB1A 3QDMA 4F7CA 1FZMA 3FQWA 3KPNA 1DUZA 1T7WA 2AXFA 5FKPA 1SYSA 1QSEA 1LK2A 3L3KA 3E2HA 4G8IA 3ROOA 3TBWA 5J6GA 1VADA 4N0CA 3ARBA 1KBGH 3OV6A 3PWPA 4WDIA 3QUKA 3TBTA 3IT8D 3MRNA 5INCA 4PJDA 3SDDA 3MGOA 1ONQA 5IM7A 1XZ0A 5DDHA 1FFOA 1KJ3H 5HGDA 2HLAA 1HHKA 1S7SA 3VFUA 3GMMA 3U0PA 4WWKC 1LQVA 5D9SA 5EFIA 4PJ5A 2E7LE 4NNXA 2AK4A 4ZUVA 4QRUA 3MV8A 5IB4A 5C0DA 1S8DA 3BEVA 1S7XA 3BH9A 4UQ3A 1EEYA 2CLZA 5FA4A 3KPQA 1JUFA 3FTGA 3PWNA 3MRQA 3VWJA 3C9NA 2F74A 2F54A 3DMMA 5E8PA 3D39A 4L8CA 3TIEA 3REWA 1EFXA 1NEZA 1TVBA 4I4WA 1JF1A 3SDAA 3MV9A 2X4OA 1EEZA 2FIKA 1FZOA 1S7QA 2VLJA 4PJFA 4PJXA 5DEFA 1VACA 1T0MA 4PJHA 3LKPA 1QQDA 4IIQC 5HYJA 1LD9A 3X11A 4PRAA 5ISZA 4JFOA 1P4LA 2VLRA 2C7UA 3MROA 1MHEA 5C0AA 2ZOLA 4HUXA 4JFPA 3VFPA 3ARGA 1EXUA 1XH3A 1ZT4A 4Y4FA 1HHGA 3SKOA 3HUJA 3BXNA 3O4LA 5F9JA 1S9YA 3E6HA 3QFDA 3KPMA 1JE6A 3LKOA 3O3DA 5JHDA 1XR8A 3PWJA 4U1HA 4Z77A 2GT9A 3CCHA 4G8GA 3VXRA 4NQVA 4LCWA 4L3EA 3V5KA 1DUYA 2A83A 3CVHA 4PJIA 1CG9A 2RFXA 4PG9A 3I6LD 3LN4A 4NQEA 2MHAA 5HHQA 1T1XA 2F53A 2X4NA 2BSRA 4FTVA 1QO3A 4IRSA 5HHPA 1T20A 3IXAA 2VAAA 1S9XA 5C0CA 3GSQA 1JGEA 4PV8A 5J6HA 1DDHA 4PRNA 4NSKA 4U1SA 3X12A 4PJEA 3CZFA 3QULA 4O2EA 5E6IC 3TO4A 1RK0A 3ARFA 4JRYA 3TVMA 3ES6A 3GSWA 3P4MA 5C07A 1R3HA 5IROA 4JFDA 4PGEA 3FRUA 2HJLA 5BJTA 4F7TA 3V5HA 3QUYA 4LNRA 3P9MA 1TMCA 1P1ZA 5EU6A 1T7ZA 4APQA 1N2RA 1I7RA 3I6KA 3BEWA 2X4TA 4O2FA 4D0DA 1X7QA 5EU4A 5HGAA 4MS8A 4PRIA 3WS6A 1GZQA 3G08A 1QSFA 3QI9A 3OXRA 3KPPA 1ZT7A 4F7PA 4G59A 1G6RH 3P4OA 1N59A 1S7UA 3LN5A 5E9DA 1L8JA 3W0WA 4QRRA 3MYJA 1HHHA 1YN7A 3RTQA 5L2JA 1ZHKA 4WJ5A 4U1LA 1AGFA 1C16A 3MRPA 4G43A 3T1FA 4NNYA 1LEGA 1HSBA 5C0IA 1NANH 1M05A 3VWKA 4JQXA 3ILPA 5C09A 4E0RA 2UWEA 1T22A 1JHTA 1A9EA 1NAMH 3TN0A 4PGBA 4X6DA 2X4SA 3OX8A 3UTSA 2AV7A 2VE6A 3VFNA 4CVXA 5C0FA 4PDCE 3WS3A 1UXSA 1WBZA 2YPKA 1QR1A 4IHOA 2GAZA 5SWQA 2ZSWA 3FFCA 1BZ9A 1ZAGA 1ZT1A 3GIVA 5EOTA 1JPFA 4UQ2A 2CLVA 3WLBA 5C0EA 3CC5A 1S9WA 3LKNA 3VXUA 3GSRA 1AGCA 1I1AA 5FDWA 3VJ6A 1WBXA 3RWHA 3FT4A 1IM3A 3RWCA 1MI5A 3GSNH 4PGCA 4U1IA 4F7EA 2H26A 3H9HA 4PJCA 1T1ZA 5J1AA 3PWLA 2BSSA 1MHCA 2X4UA 1TVHA 4L8DA 4WUUA 2ESVA 5E8NA 4V3DB 2GJ6A 3P77A 2V2WA 1YN6A 3DX8A 1P7QA 2AV1A 3FQUA 3KYNA 4PREA 5C0BA 3SJVA 5IB2A 1KJVA 3TZVC 1B0RA 3MV7A 4L9LC 4CVZA 1MWAH 3BUYA 3TF7A 4MX7A 1T21A 2OL3H 4MQ7A 5SWSA 2GTZA 1IM9A 3KYOA 4PRHA 3KPLA 2VLKA 4PRBA 5MEPA 4ZUWA 1QLFA 4U6YA 1QVOA 2DYPA 1AGEA 3GMOA 4HV8A 1OGAA 3DX6A 3CH1A 3B6SA 3SKMA 3LKQA 3E6FA 4L4TA 1AGBA 4QOKA 4Y2DA 3GSOA 3CDGA 4IRJA 3O3BA 5D7JC 4NO5A 2JCCA 1YPZA 1T7XA 1ZS8A 2BVPA 5D7LA 5C0JA 3FT3A 5C9JA 1B3JA 3P9LA 3HAEA 3RWDA 3VFMA 3QZWA 1T7VA 4HWZA 4V3EB 4CW1A 1M6OA 4MJIA 1SYVA 3ROLA 3MRBA 1JGDA 4NQDA 1KJ2H 1BIIA 3QFJA 2YEZA 1ZHBA 1BD2A 4S0UC 3HE7A 3RWJA 3HE6A 3RL1A 3KXFA 2X4RA 3VXSA 5B38A 1S7TA 1I7TA 1N3NA 1OF2A 1W72A 2Q7YA 4D0CA 3VFTA 5BXFA 2PYEA 3D2UA 1HYRC 2V2XA 4PP8C 3RL2A 3SDXA 4L8SC 1AKJA 3ARDA 1KTLA 3RWIA 2PO6A 2X4QA 1GZPA 3O3AA 4ELMA 4PJAA 1E27A 5C0GA 4WW2C 1A1OA 3MA7A 3MRIA 5IB3A 2FZ3A 1HHJA 3PABA 3GSVA 3SPVA 2ZOKA 3JTCA 5HHNA 3MRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L3H A;  4ZUU A;  3QUZ A;  3JVG A;  2BVO A;  3MR9 A;  3MRL A;  3VRJ A;  2BVQ A;  3BO8 A;  5ACZ A;  4U6X A;  3HPJ A;  1A6Z A;  2XFX A;  5D2L A;  3T8X A;  4EI5 A;  4X6F A;  2CKB H;  3O8X A;  2NW3 A;  3M1B A;  3L3I A;  3VFO A;  4ZUT A;  5BS0 A;  2CIK A;  2H6P A;  3QDJ A;  4QRP A;  1T1Y A;  3TBS A;  3DXA A;  1K8D A;  2NX5 A;  3BVN A;  1Z5L A;  3GMQ A;  1ZHN A;  5MER A;  1G7Q A;  3WL9 A;  1FZJ A;  4JFF A;  5GSV A;  4XXC A;  3S6C A;  4ONO A;  3NFN A;  3UTQ A;  3MRE A;  3AM8 A;  3JTT A;  4Y4H A;  3MGT A;  4G9F A;  1ED3 A;  4FFE X;  3X13 A;  3P73 A;  5D7I A;  4PJ8 A;  3JTS A;  3O3E A;  3ECB A;  4I48 A;  5IEH A;  5IVX A;  1Q94 A;  2OI9 A;  1UXW A;  3P4N A;  3MRK A;  5HGH A;  2FWO A;  2P5W A;  1DE4 A;  4PJG A;  4PJB A;  3TID A;  2BCK A;  3FOM A;  1A1N A;  5BRZ A;  4G42 A;  4D0B A;  2CLR A;  3VRI A;  5F1N A;  3PWV A;  3FQN A;  3DX7 A;  4HKJ A;  3GSU A;  3RWG A;  4U1M A;  5H94 A;  3H7B A;  4Z78 A;  3PWU A;  4U1N A;  2HN7 A;  5E00 A;  1BQH A;  3MRC A;  5E8O A;  5GSR A;  1KJM A;  3TJH A;  4Y4K A;  1AO7 A;  3LV3 A;  3QEQ A;  3BH8 A;  4NO2 A;  3FON A;  2XPG A;  3BW9 A;  4PJ9 A;  1FG2 A;  3MRR A;  3MRG A;  2CII A;  4PR5 A;  3RGV C;  2VAB A;  5D2N A;  4GKN A;  1RK1 A;  1WBY A;  4PG2 A;  3V5D A;  2P5E A;  1XR9 A;  3FT2 A;  3UPR A;  3W39 A;  4L29 A;  1ZVS A;  5SWZ A;  3MRH A;  3KWW A;  2GIT A;  3M17 A;  1T80 A;  3VCL A;  4O2C A;  3ERY A;  3SCM A;  4EUP A;  4JFE A;  1ZSD A;  3TBY A;  3GMR A;  5EU5 A;  4L8B A;  5DEG A;  3WUW A;  3FQX A;  3OXS A;  3VXM A;  1OGT A;  4QRQ A;  4MNG A;  3UBX A;  1HSA A;  1K5N A;  4MVB A;  3BHB A;  5IEK A;  2FO4 A;  1KCG C;  1I4F A;  4X6C A;  4Z76 A;  3BP7 A;  1RJY A;  4G9D A;  4MJ6 A;  2BNR A;  3HG1 A;  4NO0 A;  1KPR A;  3QUX A;  4N0U A;  1E28 A;  5F7D A;  4ZFZ A;  3MRF A;  1KPU A;  1HOC A;  3BGM A;  3RWF A;  5HGB A;  1I1Y A;  4N5E A;  5EU3 A;  1KPV A;  3ARE A;  4HUV A;  3GSX A;  3VFR A;  4L3C A;  3VFW A;  5ENW A;  3GMP A;  5IND A;  3RWE A;  1PQZ A;  4NQX A;  1G7P A;  5B39 A;  3TPU E;  1UQS A;  4MNQ A;  3LKR A;  3TO2 A;  1YDP A;  3BZF A;  4MJ5 A;  5EO1 A;  4HUU A;  4U1K A;  3QDG A;  1JFM A;  4HS3 A;  4PRD A;  3B3I A;  5C08 A;  1B0G A;  2AXG A;  3DTX A;  3E3Q A;  3VXP A;  5MEO A;  4NQC A;  2GTW A;  3UTT A;  1LDP H;  4N8V A;  5AD0 A;  3CPL A;  2D31 A;  2WY3 A;  2J8U A;  1T0N A;  1CE6 A;  1QRN A;  1W0W A;  3GMN A;  3KPS A;  3QQ4 A;  4EN3 C;  1W0V A;  1T7Y A;  3MRD A;  1N5A A;  3O9W A;  3DBX A;  4N0F A;  3VFS A;  4MXQ A;  1S7W A;  4PV9 A;  1INQ A;  3GJF A;  3QQ3 A;  3BWA A;  1T1W A;  4F7M A;  1FFP A;  3I6G A;  1S7R A;  2X70 A;  2HJK A;  3HCV A;  1FFN A;  5IB5 A;  3FQT A;  4NHU E;  3FQR A;  1OSZ A;  2AKR A;  5MEN A;  1RJZ A;  2BST A;  4GKS A;  3BP4 A;  4HUW A;  4LHU A;  3D3V A;  3PQY A;  4LCC C;  4WO4 A;  1CD1 A;  3SDC A;  2YPL A;  3VXN A;  3GML A;  1I1F A;  4PJ7 A;  3MRJ A;  5HHM A;  3L9R A;  3ILQ C;  4QRS A;  1FO0 H;  1A1M A;  2VLL A;  1QEW A;  5EO0 A;  3TBV A;  4JQV A;  1U58 A;  3VH8 A;  4L4V A;  3KPO A;  4PRP A;  5F1I A;  3X14 A;  4Y16 A;  3D18 A;  3L3J A;  4HX1 A;  1ZHL A;  3H9S A;  3C8K A;  5HHO A;  1FZK A;  4NO3 A;  4PGD A;  4QRT A;  5L2K A;  3KLA A;  3D25 A;  3L3G A;  4JFQ A;  4LCY A;  1LEK A;  1AGD A;  5FA3 A;  1JPG A;  4WU7 A;  2BNQ A;  1HHI A;  1S7V A;  2GUO A;  4K71 B;  2X4P A;  3AU1 A;  3HLA A;  2FYY A;  4ZUS A;  2ZSV A;  5EUO A;  3VXO A;  5MEQ A;  3TFK A;  4ZAK A;  1LP9 A;  3KPR A;  5D5M A;  1I7U A;  1VGK A;  3LKS A;  4JRX A;  4U1J A;  4WU5 A;  4X6E A;  3FOL A;  3VFV A;  3BZE A;  1A9B A;  3L3D A;  4K7F A;  3TA3 A;  4E5X A;  4NT6 A;  3RZC A;  4GUP A;  3RUG A;  5IB1 A;  3QDM A;  4F7C A;  1FZM A;  3FQW A;  3KPN A;  1DUZ A;  1T7W A;  2AXF A;  5FKP A;  1SYS A;  1QSE A;  1LK2 A;  3L3K A;  3E2H A;  4G8I A;  3ROO A;  3TBW A;  5J6G A;  1VAD A;  4N0C A;  3ARB A;  1KBG H;  3OV6 A;  3PWP A;  4WDI A;  3QUK A;  3TBT A;  3IT8 D;  3MRN A;  5INC A;  4PJD A;  3SDD A;  3MGO A;  1ONQ A;  5IM7 A;  1XZ0 A;  5DDH A;  1FFO A;  1KJ3 H;  5HGD A;  2HLA A;  1HHK A;  1S7S A;  3VFU A;  3GMM A;  3U0P A;  4WWK C;  1LQV A;  5D9S A;  5EFI A;  4PJ5 A;  2E7L E;  4NNX A;  2AK4 A;  4ZUV A;  4QRU A;  3MV8 A;  5IB4 A;  5C0D A;  1S8D A;  3BEV A;  1S7X A;  3BH9 A;  4UQ3 A;  1EEY A;  2CLZ A;  5FA4 A;  3KPQ A;  1JUF A;  3FTG A;  3PWN A;  3MRQ A;  3VWJ A;  3C9N A;  2F74 A;  2F54 A;  3DMM A;  5E8P A;  3D39 A;  4L8C A;  3TIE A;  3REW A;  1EFX A;  1NEZ A;  1TVB A;  4I4W A;  1JF1 A;  3SDA A;  3MV9 A;  2X4O A;  1EEZ A;  2FIK A;  1FZO A;  1S7Q A;  2VLJ A;  4PJF A;  4PJX A;  5DEF A;  1VAC A;  1T0M A;  4PJH A;  3LKP A;  1QQD A;  4IIQ C;  5HYJ A;  1LD9 A;  3X11 A;  4PRA A;  5ISZ A;  4JFO A;  1P4L A;  2VLR A;  2C7U A;  3MRO A;  1MHE A;  5C0A A;  2ZOL A;  4HUX A;  4JFP A;  3VFP A;  3ARG A;  1EXU A;  1XH3 A;  1ZT4 A;  4Y4F A;  1HHG A;  3SKO A;  3HUJ A;  3BXN A;  3O4L A;  5F9J A;  1S9Y A;  3E6H A;  3QFD A;  3KPM A;  1JE6 A;  3LKO A;  3O3D A;  5JHD A;  1XR8 A;  3PWJ A;  4U1H A;  4Z77 A;  2GT9 A;  3CCH A;  4G8G A;  3VXR A;  4NQV A;  4LCW A;  4L3E A;  3V5K A;  1DUY A;  2A83 A;  3CVH A;  4PJI A;  1CG9 A;  2RFX A;  4PG9 A;  3I6L D;  3LN4 A;  4NQE A;  2MHA A;  5HHQ A;  1T1X A;  2F53 A;  2X4N A;  2BSR A;  4FTV A;  1QO3 A;  4IRS A;  5HHP A;  1T20 A;  3IXA A;  2VAA A;  1S9X A;  5C0C A;  3GSQ A;  1JGE A;  4PV8 A;  5J6H A;  1DDH A;  4PRN A;  4NSK A;  4U1S A;  3X12 A;  4PJE A;  3CZF A;  3QUL A;  4O2E A;  5E6I C;  3TO4 A;  1RK0 A;  3ARF A;  4JRY A;  3TVM A;  3ES6 A;  3GSW A;  3P4M A;  5C07 A;  1R3H A;  5IRO A;  4JFD A;  4PGE A;  3FRU A;  2HJL A;  5BJT A;  4F7T A;  3V5H A;  3QUY A;  4LNR A;  3P9M A;  1TMC A;  1P1Z A;  5EU6 A;  1T7Z A;  4APQ A;  1N2R A;  1I7R A;  3I6K A;  3BEW A;  2X4T A;  4O2F A;  4D0D A;  1X7Q A;  5EU4 A;  5HGA A;  4MS8 A;  4PRI A;  3WS6 A;  1GZQ A;  3G08 A;  1QSF A;  3QI9 A;  3OXR A;  3KPP A;  1ZT7 A;  4F7P A;  4G59 A;  1G6R H;  3P4O A;  1N59 A;  1S7U A;  3LN5 A;  5E9D A;  1L8J A;  3W0W A;  4QRR A;  3MYJ A;  1HHH A;  1YN7 A;  3RTQ A;  5L2J A;  1ZHK A;  4WJ5 A;  4U1L A;  1AGF A;  1C16 A;  3MRP A;  4G43 A;  3T1F A;  4NNY A;  1LEG A;  1HSB A;  5C0I A;  1NAN H;  1M05 A;  3VWK A;  4JQX A;  3ILP A;  5C09 A;  4E0R A;  2UWE A;  1T22 A;  1JHT A;  1A9E A;  1NAM H;  3TN0 A;  4PGB A;  4X6D A;  2X4S A;  3OX8 A;  3UTS A;  2AV7 A;  2VE6 A;  3VFN A;  4CVX A;  5C0F A;  4PDC E;  3WS3 A;  1UXS A;  1WBZ A;  2YPK A;  1QR1 A;  4IHO A;  2GAZ A;  5SWQ A;  2ZSW A;  3FFC A;  1BZ9 A;  1ZAG A;  1ZT1 A;  3GIV A;  5EOT A;  1JPF A;  4UQ2 A;  2CLV A;  3WLB A;  5C0E A;  3CC5 A;  1S9W A;  3LKN A;  3VXU A;  3GSR A;  1AGC A;  1I1A A;  5FDW A;  3VJ6 A;  1WBX A;  3RWH A;  3FT4 A;  1IM3 A;  3RWC A;  1MI5 A;  3GSN H;  4PGC A;  4U1I A;  4F7E A;  2H26 A;  3H9H A;  4PJC A;  1T1Z A;  5J1A A;  3PWL A;  2BSS A;  1MHC A;  2X4U A;  1TVH A;  4L8D A;  4WUU A;  2ESV A;  5E8N A;  4V3D B;  2GJ6 A;  3P77 A;  2V2W A;  1YN6 A;  3DX8 A;  1P7Q A;  2AV1 A;  3FQU A;  3KYN A;  4PRE A;  5C0B A;  3SJV A;  5IB2 A;  1KJV A;  3TZV C;  1B0R A;  3MV7 A;  4L9L C;  4CVZ A;  1MWA H;  3BUY A;  3TF7 A;  4MX7 A;  1T21 A;  2OL3 H;  4MQ7 A;  5SWS A;  2GTZ A;  1IM9 A;  3KYO A;  4PRH A;  3KPL A;  2VLK A;  4PRB A;  5MEP A;  4ZUW A;  1QLF A;  4U6Y A;  1QVO A;  2DYP A;  1AGE A;  3GMO A;  4HV8 A;  1OGA A;  3DX6 A;  3CH1 A;  3B6S A;  3SKM A;  3LKQ A;  3E6F A;  4L4T A;  1AGB A;  4QOK A;  4Y2D A;  3GSO A;  3CDG A;  4IRJ A;  3O3B A;  5D7J C;  4NO5 A;  2JCC A;  1YPZ A;  1T7X A;  1ZS8 A;  2BVP A;  5D7L A;  5C0J A;  3FT3 A;  5C9J A;  1B3J A;  3P9L A;  3HAE A;  3RWD A;  3VFM A;  3QZW A;  1T7V A;  4HWZ A;  4V3E B;  4CW1 A;  1M6O A;  4MJI A;  1SYV A;  3ROL A;  3MRB A;  1JGD A;  4NQD A;  1KJ2 H;  1BII A;  3QFJ A;  2YEZ A;  1ZHB A;  1BD2 A;  4S0U C;  3HE7 A;  3RWJ A;  3HE6 A;  3RL1 A;  3KXF A;  2X4R A;  3VXS A;  5B38 A;  1S7T A;  1I7T A;  1N3N A;  1OF2 A;  1W72 A;  2Q7Y A;  4D0C A;  3VFT A;  5BXF A;  2PYE A;  3D2U A;  1HYR C;  2V2X A;  4PP8 C;  3RL2 A;  3SDX A;  4L8S C;  1AKJ A;  3ARD A;  1KTL A;  3RWI A;  2PO6 A;  2X4Q A;  1GZP A;  3O3A A;  4ELM A;  4PJA A;  1E27 A;  5C0G A;  4WW2 C;  1A1O A;  3MA7 A;  3MRI A;  5IB3 A;  2FZ3 A;  1HHJ A;  3PAB A;  3GSV A;  3SPV A;  2ZOK A;  3JTC A;  5HHN A;  3MRM A; 
#chains in the Genus database with same CATH topology
 3L3H A;  4ZUU A;  3QUZ A;  3JVG A;  2BVO A;  3MR9 A;  3MRL A;  3VRJ A;  2BVQ A;  3BO8 A;  5ACZ A;  4U6X A;  3HPJ A;  1A6Z A;  2XFX A;  5D2L A;  3T8X A;  4EI5 A;  4X6F A;  2CKB H;  3O8X A;  2NW3 A;  3M1B A;  3L3I A;  3VFO A;  4ZUT A;  5BS0 A;  2CIK A;  2H6P A;  3QDJ A;  4QRP A;  1T1Y A;  3TBS A;  3DXA A;  1K8D A;  2NX5 A;  3BVN A;  1Z5L A;  4JO8 A;  3GMQ A;  1ZHN A;  5MER A;  1G7Q A;  3WL9 A;  1FZJ A;  4JFF A;  5GSV A;  4XXC A;  3S6C A;  4ONO A;  3NFN A;  3UTQ A;  3MRE A;  3AM8 A;  3JTT A;  4Y4H A;  3MGT A;  4G9F A;  1ED3 A;  4FFE X;  3X13 A;  3P73 A;  5D7I A;  4PJ8 A;  3JTS A;  3O3E A;  3ECB A;  4I48 A;  5IEH A;  5IVX A;  1Q94 A;  2OI9 A;  1UXW A;  3P4N A;  3MRK A;  5HGH A;  2FWO A;  2P5W A;  1DE4 A;  4PJG A;  4PJB A;  3TID A;  2BCK A;  3FOM A;  1A1N A;  5BRZ A;  4G42 A;  4D0B A;  2CLR A;  3VRI A;  5F1N A;  3PWV A;  3FQN A;  3DX7 A;  4HKJ A;  3GSU A;  3RWG A;  4U1M A;  5H94 A;  3H7B A;  4Z78 A;  3PWU A;  4U1N A;  2HN7 A;  5E00 A;  1BQH A;  3MRC A;  5E8O A;  5GSR A;  1KJM A;  3TJH A;  4Y4K A;  1AO7 A;  3LV3 A;  3QEQ A;  3BH8 A;  4NO2 A;  3FON A;  2XPG A;  3BW9 A;  4PJ9 A;  1FG2 A;  3MRR A;  3MRG A;  2CII A;  4PR5 A;  3RGV C;  2VAB A;  5D2N A;  4GKN A;  1RK1 A;  1WBY A;  4PG2 A;  3V5D A;  2P5E A;  1XR9 A;  3FT2 A;  3UPR A;  3W39 A;  4L29 A;  1ZVS A;  5SWZ A;  3MRH A;  3KWW A;  2GIT A;  3M17 A;  1T80 A;  3VCL A;  4O2C A;  3ERY A;  3SCM A;  4EUP A;  4JFE A;  1ZSD A;  3TBY A;  3GMR A;  5EU5 A;  4L8B A;  5DEG A;  3WUW A;  3FQX A;  3OXS A;  3VXM A;  1OGT A;  4QRQ A;  4MNG A;  3UBX A;  1HSA A;  1K5N A;  4MVB A;  3BHB A;  5IEK A;  2FO4 A;  1KCG C;  1I4F A;  4X6C A;  4Z76 A;  3BP7 A;  1RJY A;  4G9D A;  4MJ6 A;  2BNR A;  3HG1 A;  4NO0 A;  1KPR A;  3QUX A;  4N0U A;  1E28 A;  5F7D A;  4ZFZ A;  3MRF A;  1KPU A;  1HOC A;  3BGM A;  3RWF A;  5HGB A;  1I1Y A;  4N5E A;  5EU3 A;  1KPV A;  3ARE A;  4HUV A;  3GSX A;  3VFR A;  4L3C A;  3VFW A;  5ENW A;  3GMP A;  5IND A;  3RWE A;  1PQZ A;  4NQX A;  1G7P A;  5B39 A;  3TPU E;  1UQS A;  4MNQ A;  3LKR A;  3TO2 A;  1YDP A;  3BZF A;  4MJ5 A;  5EO1 A;  4HUU A;  4U1K A;  3QDG A;  1JFM A;  4HS3 A;  4PRD A;  3B3I A;  5C08 A;  1B0G A;  2AXG A;  3DTX A;  3E3Q A;  3VXP A;  5MEO A;  4NQC A;  2GTW A;  3UTT A;  1LDP H;  4N8V A;  5AD0 A;  3CPL A;  2D31 A;  2WY3 A;  2J8U A;  4G59 C;  1T0N A;  1CE6 A;  1QRN A;  1W0W A;  3GMN A;  3KPS A;  3QQ4 A;  4EN3 C;  1W0V A;  1T7Y A;  3MRD A;  1N5A A;  3O9W A;  3DBX A;  4N0F A;  3VFS A;  4MXQ A;  1S7W A;  4PV9 A;  1INQ A;  3GJF A;  3QQ3 A;  3BWA A;  1T1W A;  4F7M A;  1FFP A;  3I6G A;  1S7R A;  2X70 A;  2HJK A;  3HCV A;  1FFN A;  5IB5 A;  3FQT A;  4NHU E;  3FQR A;  1OSZ A;  2AKR A;  5MEN A;  1RJZ A;  2BST A;  4GKS A;  3BP4 A;  4HUW A;  4LHU A;  3D3V A;  3PQY A;  4LCC C;  4WO4 A;  1CD1 A;  3SDC A;  2YPL A;  3VXN A;  3GML A;  1I1F A;  4PJ7 A;  3MRJ A;  5HHM A;  3L9R A;  3ILQ C;  4QRS A;  1FO0 H;  1A1M A;  2VLL A;  1QEW A;  5EO0 A;  3TBV A;  4JQV A;  1U58 A;  3VH8 A;  4L4V A;  3KPO A;  4PRP A;  5F1I A;  3X14 A;  4Y16 A;  3D18 A;  3L3J A;  4HX1 A;  2NYK A;  1ZHL A;  3H9S A;  3C8K A;  5HHO A;  1FZK A;  4NO3 A;  4PGD A;  4QRT A;  5L2K A;  3KLA A;  3D25 A;  3L3G A;  4JFQ A;  4LCY A;  1LEK A;  1AGD A;  5FA3 A;  1JPG A;  4WU7 A;  2BNQ A;  1HHI A;  1S7V A;  2GUO A;  4K71 B;  2X4P A;  3AU1 A;  3HLA A;  2FYY A;  4ZUS A;  2ZSV A;  5EUO A;  3VXO A;  5MEQ A;  3TFK A;  4ZAK A;  1LP9 A;  3KPR A;  5D5M A;  1I7U A;  1VGK A;  3LKS A;  4JRX A;  4U1J A;  4WU5 A;  4X6E A;  3FOL A;  3VFV A;  3BZE A;  1A9B A;  3L3D A;  4K7F A;  3TA3 A;  4E5X A;  4NT6 A;  3RZC A;  4GUP A;  3RUG A;  5IB1 A;  3QDM A;  4F7C A;  1FZM A;  3FQW A;  3KPN A;  1DUZ A;  1T7W A;  2AXF A;  5FKP A;  1SYS A;  1QSE A;  1LK2 A;  3L3K A;  3E2H A;  4G8I A;  3ROO A;  3TBW A;  5J6G A;  1VAD A;  4N0C A;  3ARB A;  1KBG H;  3OV6 A;  3PWP A;  4WDI A;  3QUK A;  3TBT A;  3IT8 D;  3MRN A;  5INC A;  4PJD A;  3SDD A;  3MGO A;  1ONQ A;  5IM7 A;  1XZ0 A;  5DDH A;  1FFO A;  1KJ3 H;  5HGD A;  2HLA A;  1HHK A;  1S7S A;  3VFU A;  3GMM A;  3U0P A;  4WWK C;  1LQV A;  5D9S A;  5EFI A;  4PJ5 A;  2E7L E;  4NNX A;  2AK4 A;  4ZUV A;  4QRU A;  3MV8 A;  5IB4 A;  5C0D A;  1S8D A;  3BEV A;  1S7X A;  3BH9 A;  4UQ3 A;  1EEY A;  2CLZ A;  5FA4 A;  3KPQ A;  1JUF A;  3FTG A;  3PWN A;  3MRQ A;  3VWJ A;  3C9N A;  2F74 A;  2F54 A;  3DMM A;  5E8P A;  3D39 A;  4L8C A;  3TIE A;  3REW A;  1EFX A;  1NEZ A;  1TVB A;  4I4W A;  1JF1 A;  3SDA A;  3MV9 A;  2X4O A;  1EEZ A;  2FIK A;  1FZO A;  1S7Q A;  2VLJ A;  4PJF A;  4PJX A;  5DEF A;  1VAC A;  1T0M A;  2O5N A;  3LKP A;  1QQD A;  4IIQ C;  4PJH A;  5HYJ A;  1LD9 A;  3X11 A;  4PRA A;  5ISZ A;  4JFO A;  1P4L A;  2VLR A;  2C7U A;  3MRO A;  1MHE A;  5C0A A;  2ZOL A;  4HUX A;  4JFP A;  3VFP A;  3ARG A;  1EXU A;  1XH3 A;  1ZT4 A;  4Y4F A;  1HHG A;  3SKO A;  3HUJ A;  3BXN A;  3O4L A;  5F9J A;  1S9Y A;  3E6H A;  3QFD A;  3KPM A;  1JE6 A;  3LKO A;  3O3D A;  5JHD A;  1XR8 A;  3PWJ A;  4U1H A;  4Z77 A;  2GT9 A;  3CCH A;  4G8G A;  3VXR A;  4NQV A;  4LCW A;  4L3E A;  3V5K A;  1DUY A;  2A83 A;  3CVH A;  4PJI A;  1CG9 A;  2RFX A;  4PG9 A;  3I6L D;  3LN4 A;  4NQE A;  2MHA A;  5HHQ A;  1T1X A;  2F53 A;  2X4N A;  2BSR A;  4FTV A;  1QO3 A;  4IRS A;  5HHP A;  1T20 A;  3IXA A;  2VAA A;  1S9X A;  5C0C A;  3GSQ A;  1JGE A;  4PV8 A;  5J6H A;  1DDH A;  4PRN A;  4NSK A;  4U1S A;  3X12 A;  4PJE A;  3CZF A;  3QUL A;  4O2E A;  5E6I C;  3TO4 A;  1RK0 A;  3ARF A;  4JRY A;  3TVM A;  3ES6 A;  3GSW A;  3P4M A;  5C07 A;  1R3H A;  5IRO A;  4JFD A;  4PGE A;  3FRU A;  2HJL A;  5BJT A;  4F7T A;  3V5H A;  3QUY A;  4LNR A;  3P9M A;  1TMC A;  1P1Z A;  5EU6 A;  1T7Z A;  4APQ A;  1N2R A;  1I7R A;  3I6K A;  3BEW A;  2X4T A;  4O2F A;  4D0D A;  1X7Q A;  5EU4 A;  5HGA A;  4MS8 A;  4PRI A;  3WS6 A;  1GZQ A;  3G08 A;  1QSF A;  3QI9 A;  3OXR A;  3KPP A;  1ZT7 A;  4F7P A;  4G59 A;  1G6R H;  3P4O A;  1N59 A;  1S7U A;  3LN5 A;  5E9D A;  1L8J A;  3W0W A;  4QRR A;  3MYJ A;  1HHH A;  1YN7 A;  3RTQ A;  5L2J A;  1ZHK A;  4WJ5 A;  4U1L A;  1AGF A;  1C16 A;  3MRP A;  4G43 A;  3T1F A;  4NNY A;  1LEG A;  1HSB A;  5C0I A;  1NAN H;  1M05 A;  3VWK A;  4JQX A;  3ILP A;  5C09 A;  4E0R A;  2UWE A;  1T22 A;  1JHT A;  1A9E A;  1NAM H;  3TN0 A;  2IA1 A;  4PGB A;  4X6D A;  2X4S A;  3OX8 A;  3UTS A;  2AV7 A;  2VE6 A;  3I0T A;  3VFN A;  4CVX A;  5C0F A;  4PDC E;  3WS3 A;  1UXS A;  1WBZ A;  2YPK A;  1QR1 A;  4IHO A;  2GAZ A;  5SWQ A;  2ZSW A;  3FFC A;  1BZ9 A;  1ZAG A;  1ZT1 A;  3GIV A;  5EOT A;  1JPF A;  4UQ2 A;  2CLV A;  3WLB A;  5C0E A;  3CC5 A;  1S9W A;  3LKN A;  3VXU A;  3GSR A;  1AGC A;  1I1A A;  5FDW A;  3VJ6 A;  1WBX A;  3RWH A;  3FT4 A;  1IM3 A;  3RWC A;  1MI5 A;  3GSN H;  4PGC A;  4U1I A;  4F7E A;  2H26 A;  3H9H A;  4PJC A;  1T1Z A;  5J1A A;  3PWL A;  2BSS A;  1MHC A;  2X4U A;  1TVH A;  4L8D A;  4WUU A;  2ESV A;  5E8N A;  4V3D B;  2GJ6 A;  3P77 A;  2V2W A;  1YN6 A;  3DX8 A;  1P7Q A;  2AV1 A;  3FQU A;  3KYN A;  4PRE A;  5C0B A;  3SJV A;  5IB2 A;  1KJV A;  3TZV C;  1B0R A;  3MV7 A;  4L9L C;  4CVZ A;  1MWA H;  3BUY A;  3TF7 A;  4MX7 A;  1T21 A;  2OL3 H;  4MQ7 A;  5SWS A;  2GTZ A;  1IM9 A;  3KYO A;  4PRH A;  3KPL A;  2VLK A;  4PRB A;  5MEP A;  4ZUW A;  1QLF A;  4U6Y A;  1QVO A;  2DYP A;  1AGE A;  3GMO A;  4HV8 A;  1OGA A;  3DX6 A;  3CH1 A;  3B6S A;  3SKM A;  3LKQ A;  3E6F A;  4L4T A;  1AGB A;  4QOK A;  4Y2D A;  3GSO A;  3CDG A;  4IRJ A;  3O3B A;  5D7J C;  4NO5 A;  2JCC A;  1YPZ A;  1T7X A;  1ZS8 A;  2BVP A;  5D7L A;  5C0J A;  3FT3 A;  5C9J A;  1B3J A;  3P9L A;  3HAE A;  3RWD A;  3VFM A;  3QZW A;  1T7V A;  4HWZ A;  4V3E B;  4CW1 A;  1M6O A;  4MJI A;  1SYV A;  3ROL A;  3MRB A;  1JGD A;  4NQD A;  1KJ2 H;  1BII A;  3QFJ A;  2YEZ A;  1ZHB A;  1BD2 A;  4S0U C;  3HE7 A;  3RWJ A;  3HE6 A;  3RL1 A;  3KXF A;  2X4R A;  3VXS A;  5B38 A;  1S7T A;  1I7T A;  1N3N A;  1OF2 A;  1W72 A;  2Q7Y A;  4D0C A;  3VFT A;  5BXF A;  2PYE A;  3D2U A;  1HYR C;  2V2X A;  4PP8 C;  3RL2 A;  3SDX A;  4L8S C;  1AKJ A;  3ARD A;  1KTL A;  3RWI A;  2PO6 A;  2X4Q A;  1GZP A;  3O3A A;  4ELM A;  4PJA A;  1E27 A;  5C0G A;  4WW2 C;  1A1O A;  3MA7 A;  3MRI A;  5IB3 A;  2FZ3 A;  1HHJ A;  3PAB A;  3GSV A;  3SPV A;  2ZOK A;  3JTC A;  5HHN A;  4BKW A;  3MRM A; 
#chains in the Genus database with same CATH homology
 3L3H A;  4ZUU A;  3QUZ A;  3JVG A;  2BVO A;  3MR9 A;  3MRL A;  3VRJ A;  2BVQ A;  3BO8 A;  5ACZ A;  4U6X A;  3HPJ A;  1A6Z A;  2XFX A;  5D2L A;  3T8X A;  4EI5 A;  4X6F A;  2CKB H;  3O8X A;  2NW3 A;  3M1B A;  3L3I A;  3VFO A;  4ZUT A;  5BS0 A;  2CIK A;  2H6P A;  3QDJ A;  4QRP A;  1T1Y A;  3TBS A;  3DXA A;  1K8D A;  2NX5 A;  3BVN A;  1Z5L A;  3GMQ A;  1ZHN A;  5MER A;  1G7Q A;  3WL9 A;  1FZJ A;  4JFF A;  5GSV A;  4XXC A;  3S6C A;  4ONO A;  3NFN A;  3UTQ A;  3MRE A;  3AM8 A;  3JTT A;  4Y4H A;  3MGT A;  4G9F A;  1ED3 A;  4FFE X;  3X13 A;  3P73 A;  5D7I A;  4PJ8 A;  3JTS A;  3O3E A;  3ECB A;  4I48 A;  5IEH A;  5IVX A;  1Q94 A;  2OI9 A;  1UXW A;  3P4N A;  3MRK A;  5HGH A;  2FWO A;  2P5W A;  1DE4 A;  4PJG A;  4PJB A;  3TID A;  2BCK A;  3FOM A;  1A1N A;  5BRZ A;  4G42 A;  4D0B A;  2CLR A;  3VRI A;  5F1N A;  3PWV A;  3FQN A;  3DX7 A;  4HKJ A;  3GSU A;  3RWG A;  4U1M A;  5H94 A;  3H7B A;  4Z78 A;  3PWU A;  4U1N A;  2HN7 A;  5E00 A;  1BQH A;  3MRC A;  5E8O A;  5GSR A;  1KJM A;  3TJH A;  4Y4K A;  1AO7 A;  3LV3 A;  3QEQ A;  3BH8 A;  4NO2 A;  3FON A;  2XPG A;  3BW9 A;  4PJ9 A;  1FG2 A;  3MRR A;  3MRG A;  2CII A;  4PR5 A;  3RGV C;  2VAB A;  5D2N A;  4GKN A;  1RK1 A;  1WBY A;  4PG2 A;  3V5D A;  2P5E A;  1XR9 A;  3FT2 A;  3UPR A;  3W39 A;  4L29 A;  1ZVS A;  5SWZ A;  3MRH A;  3KWW A;  2GIT A;  3M17 A;  1T80 A;  3VCL A;  4O2C A;  3ERY A;  3SCM A;  4EUP A;  4JFE A;  1ZSD A;  3TBY A;  3GMR A;  5EU5 A;  4L8B A;  5DEG A;  3WUW A;  3FQX A;  3OXS A;  3VXM A;  1OGT A;  4QRQ A;  4MNG A;  3UBX A;  1HSA A;  1K5N A;  4MVB A;  3BHB A;  5IEK A;  2FO4 A;  1KCG C;  1I4F A;  4X6C A;  4Z76 A;  3BP7 A;  1RJY A;  4G9D A;  4MJ6 A;  2BNR A;  3HG1 A;  4NO0 A;  1KPR A;  3QUX A;  4N0U A;  1E28 A;  5F7D A;  4ZFZ A;  3MRF A;  1KPU A;  1HOC A;  3BGM A;  3RWF A;  5HGB A;  1I1Y A;  4N5E A;  5EU3 A;  1KPV A;  3ARE A;  4HUV A;  3GSX A;  3VFR A;  4L3C A;  3VFW A;  5ENW A;  3GMP A;  5IND A;  3RWE A;  1PQZ A;  4NQX A;  1G7P A;  5B39 A;  3TPU E;  1UQS A;  4MNQ A;  3LKR A;  3TO2 A;  1YDP A;  3BZF A;  4MJ5 A;  5EO1 A;  4HUU A;  4U1K A;  3QDG A;  1JFM A;  4HS3 A;  4PRD A;  3B3I A;  5C08 A;  1B0G A;  2AXG A;  3DTX A;  3E3Q A;  3VXP A;  5MEO A;  4NQC A;  2GTW A;  3UTT A;  1LDP H;  4N8V A;  5AD0 A;  3CPL A;  2D31 A;  2WY3 A;  2J8U A;  1T0N A;  1CE6 A;  1QRN A;  1W0W A;  3GMN A;  3KPS A;  3QQ4 A;  4EN3 C;  1W0V A;  1T7Y A;  3MRD A;  1N5A A;  3O9W A;  3DBX A;  4N0F A;  3VFS A;  4MXQ A;  1S7W A;  4PV9 A;  1INQ A;  3GJF A;  3QQ3 A;  3BWA A;  1T1W A;  4F7M A;  1FFP A;  3I6G A;  1S7R A;  2X70 A;  2HJK A;  3HCV A;  1FFN A;  5IB5 A;  3FQT A;  4NHU E;  3FQR A;  1OSZ A;  2AKR A;  5MEN A;  1RJZ A;  2BST A;  4GKS A;  3BP4 A;  4HUW A;  4LHU A;  3D3V A;  3PQY A;  4LCC C;  4WO4 A;  1CD1 A;  3SDC A;  2YPL A;  3VXN A;  3GML A;  1I1F A;  4PJ7 A;  3MRJ A;  5HHM A;  3L9R A;  3ILQ C;  4QRS A;  1FO0 H;  1A1M A;  2VLL A;  1QEW A;  5EO0 A;  3TBV A;  4JQV A;  1U58 A;  3VH8 A;  4L4V A;  3KPO A;  4PRP A;  5F1I A;  3X14 A;  4Y16 A;  3D18 A;  3L3J A;  4HX1 A;  1ZHL A;  3H9S A;  3C8K A;  5HHO A;  1FZK A;  4NO3 A;  4PGD A;  4QRT A;  5L2K A;  3KLA A;  3D25 A;  3L3G A;  4JFQ A;  4LCY A;  1LEK A;  1AGD A;  5FA3 A;  1JPG A;  4WU7 A;  2BNQ A;  1HHI A;  1S7V A;  2GUO A;  4K71 B;  2X4P A;  3AU1 A;  3HLA A;  2FYY A;  4ZUS A;  2ZSV A;  5EUO A;  3VXO A;  5MEQ A;  3TFK A;  4ZAK A;  1LP9 A;  3KPR A;  5D5M A;  1I7U A;  1VGK A;  3LKS A;  4JRX A;  4U1J A;  4WU5 A;  4X6E A;  3FOL A;  3VFV A;  3BZE A;  1A9B A;  3L3D A;  4K7F A;  3TA3 A;  4E5X A;  4NT6 A;  3RZC A;  4GUP A;  3RUG A;  5IB1 A;  3QDM A;  4F7C A;  1FZM A;  3FQW A;  3KPN A;  1DUZ A;  1T7W A;  2AXF A;  5FKP A;  1SYS A;  1QSE A;  1LK2 A;  3L3K A;  3E2H A;  4G8I A;  3ROO A;  3TBW A;  5J6G A;  1VAD A;  4N0C A;  3ARB A;  1KBG H;  3OV6 A;  3PWP A;  4WDI A;  3QUK A;  3TBT A;  3IT8 D;  3MRN A;  5INC A;  4PJD A;  3SDD A;  3MGO A;  1ONQ A;  5IM7 A;  1XZ0 A;  5DDH A;  1FFO A;  1KJ3 H;  5HGD A;  2HLA A;  1HHK A;  1S7S A;  3VFU A;  3GMM A;  3U0P A;  4WWK C;  1LQV A;  5D9S A;  5EFI A;  4PJ5 A;  2E7L E;  4NNX A;  2AK4 A;  4ZUV A;  4QRU A;  3MV8 A;  5IB4 A;  5C0D A;  1S8D A;  3BEV A;  1S7X A;  3BH9 A;  4UQ3 A;  1EEY A;  2CLZ A;  5FA4 A;  3KPQ A;  1JUF A;  3FTG A;  3PWN A;  3MRQ A;  3VWJ A;  3C9N A;  2F74 A;  2F54 A;  3DMM A;  5E8P A;  3D39 A;  4L8C A;  3TIE A;  3REW A;  1EFX A;  1NEZ A;  1TVB A;  4I4W A;  1JF1 A;  3SDA A;  3MV9 A;  2X4O A;  1EEZ A;  2FIK A;  1FZO A;  1S7Q A;  2VLJ A;  4PJF A;  4PJX A;  5DEF A;  1VAC A;  1T0M A;  4PJH A;  3LKP A;  1QQD A;  4IIQ C;  5HYJ A;  1LD9 A;  3X11 A;  4PRA A;  5ISZ A;  4JFO A;  1P4L A;  2VLR A;  2C7U A;  3MRO A;  1MHE A;  5C0A A;  2ZOL A;  4HUX A;  4JFP A;  3VFP A;  3ARG A;  1EXU A;  1XH3 A;  1ZT4 A;  4Y4F A;  1HHG A;  3SKO A;  3HUJ A;  3BXN A;  3O4L A;  5F9J A;  1S9Y A;  3E6H A;  3QFD A;  3KPM A;  1JE6 A;  3LKO A;  3O3D A;  5JHD A;  1XR8 A;  3PWJ A;  4U1H A;  4Z77 A;  2GT9 A;  3CCH A;  4G8G A;  3VXR A;  4NQV A;  4LCW A;  4L3E A;  3V5K A;  1DUY A;  2A83 A;  3CVH A;  4PJI A;  1CG9 A;  2RFX A;  4PG9 A;  3I6L D;  3LN4 A;  4NQE A;  2MHA A;  5HHQ A;  1T1X A;  2F53 A;  2X4N A;  2BSR A;  4FTV A;  1QO3 A;  4IRS A;  5HHP A;  1T20 A;  3IXA A;  2VAA A;  1S9X A;  5C0C A;  3GSQ A;  1JGE A;  4PV8 A;  5J6H A;  1DDH A;  4PRN A;  4NSK A;  4U1S A;  3X12 A;  4PJE A;  3CZF A;  3QUL A;  4O2E A;  5E6I C;  3TO4 A;  1RK0 A;  3ARF A;  4JRY A;  3TVM A;  3ES6 A;  3GSW A;  3P4M A;  5C07 A;  1R3H A;  5IRO A;  4JFD A;  4PGE A;  3FRU A;  2HJL A;  5BJT A;  4F7T A;  3V5H A;  3QUY A;  4LNR A;  3P9M A;  1TMC A;  1P1Z A;  5EU6 A;  1T7Z A;  4APQ A;  1N2R A;  1I7R A;  3I6K A;  3BEW A;  2X4T A;  4O2F A;  4D0D A;  1X7Q A;  5EU4 A;  5HGA A;  4MS8 A;  4PRI A;  3WS6 A;  1GZQ A;  3G08 A;  1QSF A;  3QI9 A;  3OXR A;  3KPP A;  1ZT7 A;  4F7P A;  4G59 A;  1G6R H;  3P4O A;  1N59 A;  1S7U A;  3LN5 A;  5E9D A;  1L8J A;  3W0W A;  4QRR A;  3MYJ A;  1HHH A;  1YN7 A;  3RTQ A;  5L2J A;  1ZHK A;  4WJ5 A;  4U1L A;  1AGF A;  1C16 A;  3MRP A;  4G43 A;  3T1F A;  4NNY A;  1LEG A;  1HSB A;  5C0I A;  1NAN H;  1M05 A;  3VWK A;  4JQX A;  3ILP A;  5C09 A;  4E0R A;  2UWE A;  1T22 A;  1JHT A;  1A9E A;  1NAM H;  3TN0 A;  4PGB A;  4X6D A;  2X4S A;  3OX8 A;  3UTS A;  2AV7 A;  2VE6 A;  3VFN A;  4CVX A;  5C0F A;  4PDC E;  3WS3 A;  1UXS A;  1WBZ A;  2YPK A;  1QR1 A;  4IHO A;  2GAZ A;  5SWQ A;  2ZSW A;  3FFC A;  1BZ9 A;  1ZAG A;  1ZT1 A;  3GIV A;  5EOT A;  1JPF A;  4UQ2 A;  2CLV A;  3WLB A;  5C0E A;  3CC5 A;  1S9W A;  3LKN A;  3VXU A;  3GSR A;  1AGC A;  1I1A A;  5FDW A;  3VJ6 A;  1WBX A;  3RWH A;  3FT4 A;  1IM3 A;  3RWC A;  1MI5 A;  3GSN H;  4PGC A;  4U1I A;  4F7E A;  2H26 A;  3H9H A;  4PJC A;  1T1Z A;  5J1A A;  3PWL A;  2BSS A;  1MHC A;  2X4U A;  1TVH A;  4L8D A;  4WUU A;  2ESV A;  5E8N A;  4V3D B;  2GJ6 A;  3P77 A;  2V2W A;  1YN6 A;  3DX8 A;  1P7Q A;  2AV1 A;  3FQU A;  3KYN A;  4PRE A;  5C0B A;  3SJV A;  5IB2 A;  1KJV A;  3TZV C;  1B0R A;  3MV7 A;  4L9L C;  4CVZ A;  1MWA H;  3BUY A;  3TF7 A;  4MX7 A;  1T21 A;  2OL3 H;  4MQ7 A;  5SWS A;  2GTZ A;  1IM9 A;  3KYO A;  4PRH A;  3KPL A;  2VLK A;  4PRB A;  5MEP A;  4ZUW A;  1QLF A;  4U6Y A;  1QVO A;  2DYP A;  1AGE A;  3GMO A;  4HV8 A;  1OGA A;  3DX6 A;  3CH1 A;  3B6S A;  3SKM A;  3LKQ A;  3E6F A;  4L4T A;  1AGB A;  4QOK A;  4Y2D A;  3GSO A;  3CDG A;  4IRJ A;  3O3B A;  5D7J C;  4NO5 A;  2JCC A;  1YPZ A;  1T7X A;  1ZS8 A;  2BVP A;  5D7L A;  5C0J A;  3FT3 A;  5C9J A;  1B3J A;  3P9L A;  3HAE A;  3RWD A;  3VFM A;  3QZW A;  1T7V A;  4HWZ A;  4V3E B;  4CW1 A;  1M6O A;  4MJI A;  1SYV A;  3ROL A;  3MRB A;  1JGD A;  4NQD A;  1KJ2 H;  1BII A;  3QFJ A;  2YEZ A;  1ZHB A;  1BD2 A;  4S0U C;  3HE7 A;  3RWJ A;  3HE6 A;  3RL1 A;  3KXF A;  2X4R A;  3VXS A;  5B38 A;  1S7T A;  1I7T A;  1N3N A;  1OF2 A;  1W72 A;  2Q7Y A;  4D0C A;  3VFT A;  5BXF A;  2PYE A;  3D2U A;  1HYR C;  2V2X A;  4PP8 C;  3RL2 A;  3SDX A;  4L8S C;  1AKJ A;  3ARD A;  1KTL A;  3RWI A;  2PO6 A;  2X4Q A;  1GZP A;  3O3A A;  4ELM A;  4PJA A;  1E27 A;  5C0G A;  4WW2 C;  1A1O A;  3MA7 A;  3MRI A;  5IB3 A;  2FZ3 A;  1HHJ A;  3PAB A;  3GSV A;  3SPV A;  2ZOK A;  3JTC A;  5HHN A;  3MRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...