3TPUE

42f3 p5e8/h2-ld complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
175
Chain Sequence
GPHSMRYYETATSRRGEPRYTSVGYVDDKEFVRFDSDAENPRYEPQVPWMEQEGPEYWERITQVAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQRMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLRTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T cell receptor signaling is limited by docking geometry to peptide-major histocompatibility complex.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords 42F3 alpha
total genus 49
structure length 175
sequence length 177
chains with identical sequence I, K, Q
ec nomenclature
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3tpuE00
3BH9A 4ZUUA 1DUYA 2X70A 3JTTA 1VADA 5C0AA 4WWKC 2VLKA 2P5WA 3P9MA 1HHGA 3FT2A 4D0CA 3BUYA 3KPRA 1ED3A 3PWLA 3GMPA 5C0JA 3MRBA 4U1JA 3O3AA 4U1KA 3GSXA 4LCWA 1T7YA 4ZUTA 2C7UA 3M1BA 3S6CA 4NQVA 5FKPA 4S0UC 4F7PA 1T7XA 3U0PA 3QEQA 3MRIA 4F7EA 1FFOA 2GTWA 3QFDA 3BXNA 1S9WA 5ACZA 3GSQA 5C0BA 4MNGA 3VFOA 1A9EA 2FIKA 3BGMA 1FFNA 1FZOA 1HYRC 2FWOA 3KXFA 5EOTA 4GKNA 3HLAA 1I7TA 1M05A 2YPLA 2HJKA 5DEFA 4G59A 5SWZA 4PJCA 3LKNA 1JF1A 3WLBA 5IEHA 4G43A 5L2KA 3HCVA 5E8NA 4O2FA 1ZT4A 4PREA 3QDMA 3T8XA 2BNQA 4IRJA 4PJ9A 3ROLA 3H9HA 4JQVA 5L2JA 3P77A 4ZFZA 3ILQC 4PJIA 4WW2C 3OV6A 4O2EA 1EEZA 4D0DA 3CZFA 5E6IC 1Z5LA 2HJLA 1T7ZA 4LHUA 4HUUA 2NW3A 1K5NA 1TVHA 4PJGA 3WL9A 3UBXA 3RWGA 3P4MA 1OGAA 3RWFA 3HUJA 5BJTA 4PGBA 4LCYA 3RWIA 4WUUA 1CD1A 3GJFA 3GMLA 3BEVA 3GSNH 3OXSA 3BVNA 2F74A 1KTLA 2ZOLA 2XFXA 1DDHA 1X7QA 4NO3A 1AKJA 3DX8A 4I4WA 4U1LA 4G8GA 3GMMA 3X12A 3KWWA 1T1WA 4JRYA 1LK2A 3ARGA 3C8KA 5IB5A 4PJDA 1QQDA 3X11A 2X4QA 2AXGA 3MRMA 1INQA 1S7XA 5BS0A 1HHIA 1K8DA 3E3QA 1JGDA 3I6KA 5MERA 4PJXA 3RL2A 5BXFA 3VFMA 4U6YA 2BVQA 5H94A 1QLFA 4K7FA 3SKOA 1TMCA 3MRDA 5HHOA 3MRRA 3BH8A 3GMQA 3FQNA 3VXMA 3ERYA 2VLRA 3RWDA 2Q7YA 3RWHA 3P4OA 3PWUA 1VGKA 2PYEA 1OSZA 3RWEA 3VCLA 3DMMA 1LP9A 3KPOA 3REWA 3QQ4A 3MRCA 4QRTA 4QRRA 3L3GA 3QQ3A 3PQYA 5HGBA 1HHKA 5EO0A 1I4FA 2XPGA 4NSKA 1T1YA 1KCGC 1MWAH 3TO2A 1YDPA 4PR5A 4JFEA 3MRJA 1N2RA 3UTSA 3X13A 2A83A 4G42A 4LCCC 1EEYA 1LQVA 3KYNA 2GTZA 4PGCA 1SYVA 5C0CA 1XZ0A 4PJEA 2BNRA 3QUZA 5FDWA 3QDGA 2F53A 1S7QA 5E9DA 3SKMA 1L8JA 3SDDA 5C0FA 2GT9A 3I6LD 1RJYA 3M17A 1EXUA 1S9XA 3O8XA 1AGFA 4GUPA 1KJ2H 3QUXA 1AGBA 4ZUSA 5MEQA 4HUVA 1QR1A 3BZFA 2AV1A 5C9JA 1N59A 3FQUA 1BIIA 1LD9A 3LV3A 3O3EA 3VXPA 4U1MA 5HGHA 5DEGA 4PJ7A 4UQ2A 3AU1A 1KJMA 1HHJA 1G6RH 2CKBH 5IB3A 5MEPA 4HWZA 1T7VA 1KJ3H 4WJ5A 4XXCA 1ZS8A 3B6SA 1ZT7A 3ARFA 2GAZA 3P4NA 4NNXA 5C08A 3CVHA 5B38A 1RK1A 4QRUA 4PP8C 3DX6A 3VWJA 4V3EB 5EO1A 5INDA 1JUFA 5C09A 3V5KA 1T80A 3RL1A 3WUWA 5AD0A 1QRNA 2BSRA 4MJ5A 1T0MA 4EI5A 4E0RA 4EUPA 5GSRA 4X6DA 5HGAA 1S7UA 3VFWA 3TFKA 5IB4A 4PRHA 3FT3A 4N5EA 1FG2A 4PG2A 4L4TA 3LKRA 1EFXA 3FQTA 3QZWA 5MENA 3LKSA 1B0GA 3KPSA 4Y4FA 4PDCE 4EN3C 4L8BA 4U1NA 1QEWA 3NFNA 1IM3A 1S7SA 2X4RA 3GMNA 1B0RA 4PG9A 2CLZA 1DUZA 4PJ8A 2X4OA 4QRPA 4L4VA 2AV7A 3KYOA 3MRHA 3RWJA 2CIIA 4HUWA 3L3JA 3FOMA 3TBWA 4PV9A 1PQZA 3BEWA 3GMOA 3GSUA 1E27A 5HHQA 3OXRA 2HN7A 3VXNA 3X14A 3V5HA 3TBYA 1G7QA 4MJ6A 1NEZA 5HHMA 2AK4A 2X4NA 4PGDA 5C0EA 3L3IA 3PWPA 1W0WA 4LNRA 5SWQA 4Z78A 3P73A 1XH3A 1T0NA 4ZAKA 5IROA 3RWCA 4L8CA 3FQRA 4X6FA 5ENWA 2J8UA 1KPVA 3ECBA 3LKPA 3QDJA 2VAAA 2GJ6A 1XR9A 1ZHNA 2YPKA 3L3KA 4WO4A 3TIDA 1KPUA 5FA4A 1VACA 4NNYA 4MVBA 1IM9A 5J6GA 3MREA 3MRGA 1AGCA 5D7JC 1ZAGA 3VFNA 4PRNA 1ZT1A 2F54A 4U6XA 2DYPA 4N0UA 4NQXA 3D18A 1ZSDA 3W0WA 3RTQA 1JHTA 2FZ3A 2AKRA 4HUXA 3ROOA 1I7UA 5EU3A 3TBSA 3GSRA 3ARDA 1S8DA 3QULA 1JPGA 3BP4A 4Y16A 2RFXA 3FQXA 3VFPA 5J1AA 1CE6A 3SDCA 1U58A 3VRJA 4IHOA 3SPVA 3IXAA 1T1XA 4PRAA 4NO0A 1QSEA 4ZUVA 3MV8A 5EFIA 3HG1A 4CW1A 3G08A 1P1ZA 2MHAA 4WDIA 2HLAA 5HHPA 2V2XA 4JFDA 3KPMA 1MHEA 4NO5A 3BWAA 3KPLA 4HX1A 1AGEA 3IT8D 5EU5A 1KBGH 3KPQA 2X4SA 4F7CA 1ONQA 4JFPA 4U1IA 3LN4A 1FZMA 5MEOA 2VABA 3D3VA 5J6HA 3DTXA 4Y2DA 5IB2A 1BQHA 4L3EA 2BVPA 3TBTA 1JE6A 2VLJA 4UQ3A 5GSVA 5IB1A 4JFQA 4PRDA 5HHNA 2E7LE 4MNQA 1LEKA 1T1ZA 4WU7A 1GZQA 1R3HA 3MRNA 4G9FA 4JFFA 1NAMH 1KJVA 3KPNA 5FA3A 5EU4A 3QUYA 4IRSA 1QSFA 3VFSA 3E6HA 1GZPA 3D25A 2ESVA 4N0FA 3KPPA 4HV8A 3MRQA 3V5DA 1HSAA 4F7TA 3SCMA 4L8SC 3SDAA 1JFMA 1B3JA 1S7TA 5F1IA 3TIEA 3VFTA 4G9DA 3GSOA 3TBVA 4Z76A 4PV8A 3MRPA 4PJFA 3VFVA 4GKSA 1ZHBA 5IVXA 4NO2A 1RJZA 1T22A 3BW9A 4NQDA 3VH8A 5F9JA 1WBYA 4V3DB 2BSTA 1WBZA 4L29A 4WU5A 4ZUWA 4N0CA 1N5AA 1P7QA 2GUOA 1A1NA 1OGTA 5D5MA 3VXRA 3DBXA 3D39A 3TJHA 2VE6A 2ZOKA 4PRBA 4X6EA 3CPLA 1FZJA 1BD2A 5E8OA 3MGOA 3VRIA 3FT4A 4PRIA 4JQXA 3GMRA 3O3DA 3FONA 1OF2A 1ZHKA 3GSWA 1I1FA 3HE6A 4IIQC 5D2LA 1S7WA 3AREA 3I6GA 5C07A 1YN7A 1W72A 3QFJA 4MS8A 4ONOA 4QRQA 5C0IA 2CLVA 2UWEA 1S7VA 3JTCA 4NHUE 3TF7A 5IEKA 2V2WA 3RUGA 4MQ7A 5EU6A 3OX8A 3PABA 1S9YA 3TVMA 3JVGA 2FO4A 3TO4A 5DDHA 5SWSA 3LKOA 1C16A 2X4PA 1RK0A 4K71B 3FTGA 1YN6A 3TZVC 4N8VA 3BHBA 3FFCA 1WBXA 5D7IA 1TVBA 4QOKA 5E8PA 4QRSA 3VXSA 3ILPA 1FFPA 1G7PA 2BSSA 3H9SA 4L9LC 2H6PA 4Z77A 4E5XA 1S7RA 4X6CA 1P4LA 5E00A 3MYJA 5IM7A 4L3CA 4D0BA 4PJ5A 3UTQA 1MHCA 2OI9A 3HAEA 2H26A 1UXSA 1HOCA 4CVZA 3RZCA 4U1SA 3O4LA 3MV7A 5C0DA 3HE7A 3MR9A 4MJIA 1FZKA 1KPRA 4JFOA 4I48A 3MA7A 4FTVA 4MX7A 4PJAA 2GITA 4MXQA 1ZVSA 1ZHLA 1YPZA 3AM8A 2X4UA 1I1AA 3D2UA 3O3BA 2VLLA 1E28A 4G8IA 4NT6A 4PJHA 1CG9A 3DX7A 1QO3A 3L3HA 3LKQA 5D7LA 3W39A 5B39A 3MRLA 3QI9A 4O2CA 1NANH 5BRZA 2ZSWA 5HYJA 1A1MA 5F1NA 3RGVC 5EUOA 1SYSA 3GSVA 3VXUA 2P5EA 3QUKA 5F7DA 3CC5A 3CCHA 1T7WA 4JRXA 1UQSA 3TN0A 3TA3A 1A9BA 3C9NA 3KLAA 4F7MA 4NQEA 3O9WA 3T1FA 1T20A 3BP7A 1T21A 4CVXA 5INCA 4Y4KA 3LN5A 1QVOA 3SJVA 3VFUA 3WS6A 3GIVA 2AXFA 1MI5A 4APQA 3TPUE 2NX5A 2ZSVA 3BO8A 3VFRA 4PRPA 3L3DA 3CH1A 4PJBA 3UPRA 4ELMA 1HSBA 3FRUA 3MRFA 2PO6A 1HHHA 3E6FA 1A1OA 5HGDA 3FOLA 2CLRA 3VXOA 4HKJA 3HPJA 2FYYA 2YEZA 1N3NA 4L8DA 3PWVA 1LDPH 5D2NA 1LEGA 2OL3H 3E2HA 3JTSA 1I1YA 1FO0H 2JCCA 1A6ZA 2WY3A 3DXAA 4FFEX 4NQCA 2BVOA 3B3IA 3MGTA 2D31A 1AO7A 3FQWA 4U1HA 1XR8A 1I7RA 2X4TA 3SDXA 5D9SA 1W0VA 5ISZA 5JHDA 3BZEA 3MROA 3MV9A 4HS3A 3PWJA 4Y4HA 3CDGA 3H7BA 2CIKA 3ES6A 3ARBA 1JGEA 1AGDA 3VJ6A 1BZ9A 3L9RA 1UXWA 1JPFA 1M6OA 2BCKA 3WS3A 3VWKA 1DE4A 3UTTA 5C0GA 4PGEA 3MRKA 3PWNA 3P9LA 1Q94A
chains in the Genus database with same CATH superfamily
3BH9A 4ZUUA 1DUYA 2X70A 3JTTA 1VADA 5C0AA 4WWKC 2VLKA 2P5WA 3P9MA 1HHGA 3FT2A 4D0CA 3BUYA 3KPRA 1ED3A 3PWLA 3GMPA 5C0JA 3MRBA 4U1JA 3O3AA 4U1KA 3GSXA 4LCWA 1T7YA 4ZUTA 2C7UA 3M1BA 3S6CA 4NQVA 5FKPA 4S0UC 4F7PA 1T7XA 3U0PA 3QEQA 3MRIA 4F7EA 1FFOA 2GTWA 3QFDA 3BXNA 1S9WA 5ACZA 3GSQA 5C0BA 4MNGA 3VFOA 1A9EA 2FIKA 3BGMA 1FFNA 1FZOA 1HYRC 2FWOA 3KXFA 5EOTA 4GKNA 3HLAA 1I7TA 1M05A 2YPLA 2HJKA 5DEFA 4G59A 5SWZA 4PJCA 3LKNA 1JF1A 3WLBA 5IEHA 4G43A 5L2KA 3HCVA 5E8NA 4O2FA 1ZT4A 4PREA 3QDMA 3T8XA 2BNQA 4IRJA 4PJ9A 3ROLA 3H9HA 4JQVA 5L2JA 3P77A 4ZFZA 3ILQC 4PJIA 4WW2C 3OV6A 4O2EA 4BKWA 1EEZA 4D0DA 3CZFA 5E6IC 1Z5LA 2HJLA 1T7ZA 4LHUA 4HUUA 2NW3A 1K5NA 1TVHA 4PJGA 3WL9A 3UBXA 3RWGA 3P4MA 1OGAA 3RWFA 3HUJA 5BJTA 4PGBA 4LCYA 3RWIA 4WUUA 1CD1A 3GJFA 3GMLA 3BEVA 3GSNH 3OXSA 3BVNA 2F74A 1KTLA 2ZOLA 2XFXA 1DDHA 1X7QA 4NO3A 1AKJA 3DX8A 4I4WA 4U1LA 4G8GA 3GMMA 4JO8A 3KWWA 3X12A 1T1WA 4JRYA 1LK2A 3ARGA 3C8KA 5IB5A 4PJDA 1QQDA 3X11A 2X4QA 2AXGA 3MRMA 1INQA 1S7XA 5BS0A 1HHIA 1K8DA 3E3QA 1JGDA 3I6KA 5MERA 4PJXA 3RL2A 5BXFA 3VFMA 4U6YA 2BVQA 5H94A 1QLFA 4K7FA 3SKOA 1TMCA 3MRDA 5HHOA 3MRRA 3BH8A 3GMQA 3FQNA 3VXMA 3ERYA 2VLRA 3RWDA 2Q7YA 3RWHA 3P4OA 3PWUA 1VGKA 2PYEA 1OSZA 3RWEA 3VCLA 3DMMA 1LP9A 3KPOA 3REWA 3QQ4A 3MRCA 4QRTA 4QRRA 3L3GA 3QQ3A 3PQYA 5HGBA 1HHKA 5EO0A 1I4FA 2IA1A 2XPGA 4NSKA 1T1YA 1KCGC 1MWAH 3TO2A 1YDPA 4PR5A 4JFEA 3MRJA 1N2RA 3UTSA 3X13A 2A83A 4G42A 4LCCC 1EEYA 1LQVA 3KYNA 2GTZA 4PGCA 1SYVA 5C0CA 1XZ0A 4PJEA 2BNRA 3QUZA 5FDWA 3QDGA 2F53A 1S7QA 5E9DA 3SKMA 1L8JA 3SDDA 5C0FA 2GT9A 3I6LD 1RJYA 3M17A 1EXUA 1S9XA 3O8XA 1AGFA 4GUPA 1KJ2H 3QUXA 1AGBA 4ZUSA 5MEQA 4HUVA 1QR1A 3BZFA 2AV1A 5C9JA 1N59A 3FQUA 1BIIA 1LD9A 3LV3A 3O3EA 3VXPA 4U1MA 5HGHA 5DEGA 4PJ7A 4UQ2A 3AU1A 1KJMA 1HHJA 1G6RH 2CKBH 5IB3A 5MEPA 4HWZA 1T7VA 1KJ3H 4WJ5A 4XXCA 1ZS8A 3B6SA 1ZT7A 3ARFA 2GAZA 3P4NA 4NNXA 5C08A 3CVHA 5B38A 1RK1A 4QRUA 4PP8C 3DX6A 3VWJA 4V3EB 5EO1A 5INDA 1JUFA 5C09A 3V5KA 1T80A 3RL1A 3WUWA 5AD0A 1QRNA 2BSRA 4MJ5A 1T0MA 4EI5A 4E0RA 4EUPA 5GSRA 4X6DA 5HGAA 1S7UA 3VFWA 3TFKA 5IB4A 4PRHA 3FT3A 4N5EA 1FG2A 4PG2A 4L4TA 3LKRA 1EFXA 3FQTA 3QZWA 5MENA 3LKSA 1B0GA 3KPSA 4Y4FA 4PDCE 2NYKA 4EN3C 4L8BA 4U1NA 1QEWA 3NFNA 1IM3A 1S7SA 2X4RA 3GMNA 1B0RA 4PG9A 2CLZA 1DUZA 4PJ8A 2X4OA 4QRPA 4L4VA 2AV7A 3KYOA 3MRHA 3RWJA 2CIIA 4HUWA 3L3JA 3FOMA 3TBWA 4PV9A 1PQZA 3BEWA 3GMOA 3GSUA 1E27A 5HHQA 3OXRA 2HN7A 3VXNA 3X14A 3V5HA 3TBYA 1G7QA 4MJ6A 1NEZA 4G59C 5HHMA 2AK4A 2X4NA 4PGDA 5C0EA 3L3IA 3PWPA 1W0WA 4LNRA 5SWQA 4Z78A 3P73A 1XH3A 1T0NA 4ZAKA 5IROA 3RWCA 4L8CA 3FQRA 4X6FA 5ENWA 2J8UA 1KPVA 3ECBA 3LKPA 3QDJA 2VAAA 2GJ6A 1XR9A 1ZHNA 2YPKA 3L3KA 4WO4A 3TIDA 1KPUA 5FA4A 1VACA 4NNYA 4MVBA 1IM9A 5J6GA 3MREA 3MRGA 1AGCA 5D7JC 1ZAGA 3VFNA 4PRNA 1ZT1A 2F54A 4U6XA 2DYPA 4N0UA 4NQXA 3D18A 1ZSDA 3W0WA 3RTQA 1JHTA 2FZ3A 2AKRA 4HUXA 3ROOA 1I7UA 5EU3A 3TBSA 3GSRA 3ARDA 1S8DA 3QULA 1JPGA 3BP4A 4Y16A 2RFXA 3FQXA 3VFPA 5J1AA 1CE6A 3SDCA 1U58A 3VRJA 4IHOA 3SPVA 3IXAA 1T1XA 4PRAA 4NO0A 1QSEA 4ZUVA 3MV8A 5EFIA 3HG1A 4CW1A 3G08A 1P1ZA 3I0TA 2MHAA 4WDIA 2HLAA 5HHPA 2V2XA 4JFDA 3KPMA 1MHEA 4NO5A 3BWAA 3KPLA 4HX1A 1AGEA 3IT8D 5EU5A 1KBGH 3KPQA 2X4SA 4F7CA 1ONQA 4JFPA 4U1IA 3LN4A 1FZMA 5MEOA 2VABA 3D3VA 5J6HA 3DTXA 4Y2DA 5IB2A 1BQHA 4L3EA 2BVPA 3TBTA 1JE6A 2VLJA 4UQ3A 5GSVA 5IB1A 4JFQA 4PRDA 5HHNA 2E7LE 4MNQA 1LEKA 1T1ZA 4WU7A 1GZQA 1R3HA 3MRNA 4G9FA 4JFFA 1NAMH 1KJVA 3KPNA 5FA3A 5EU4A 3QUYA 4IRSA 1QSFA 3VFSA 3E6HA 1GZPA 3D25A 2ESVA 4N0FA 3KPPA 4HV8A 3MRQA 3V5DA 1HSAA 4F7TA 3SCMA 4L8SC 3SDAA 1JFMA 1B3JA 1S7TA 5F1IA 3TIEA 3VFTA 4G9DA 3GSOA 3TBVA 4Z76A 4PV8A 3MRPA 4PJFA 3VFVA 4GKSA 1ZHBA 5IVXA 4NO2A 1RJZA 1T22A 3BW9A 4NQDA 3VH8A 5F9JA 1WBYA 4V3DB 2BSTA 1WBZA 4L29A 4WU5A 4ZUWA 4N0CA 1N5AA 1P7QA 2GUOA 1A1NA 1OGTA 5D5MA 3VXRA 3DBXA 3D39A 3TJHA 2VE6A 2ZOKA 4PRBA 4X6EA 3CPLA 1FZJA 1BD2A 5E8OA 3MGOA 3VRIA 3FT4A 4PRIA 4JQXA 3GMRA 3O3DA 3FONA 1OF2A 1ZHKA 3GSWA 1I1FA 3HE6A 4IIQC 5D2LA 1S7WA 3AREA 3I6GA 5C07A 1YN7A 1W72A 3QFJA 4MS8A 4ONOA 4QRQA 5C0IA 2CLVA 2UWEA 1S7VA 3JTCA 4NHUE 3TF7A 5IEKA 2V2WA 3RUGA 4MQ7A 5EU6A 3OX8A 3PABA 1S9YA 3TVMA 3JVGA 2FO4A 3TO4A 5DDHA 5SWSA 3LKOA 1C16A 2X4PA 1RK0A 4K71B 3FTGA 1YN6A 3TZVC 4N8VA 3BHBA 3FFCA 1WBXA 5D7IA 1TVBA 4QOKA 5E8PA 4QRSA 3VXSA 3ILPA 1FFPA 1G7PA 2BSSA 3H9SA 4L9LC 2H6PA 4Z77A 4E5XA 1S7RA 4X6CA 1P4LA 5E00A 3MYJA 5IM7A 4L3CA 4D0BA 4PJ5A 3UTQA 1MHCA 2OI9A 2O5NA 3HAEA 2H26A 1UXSA 1HOCA 4CVZA 3RZCA 4U1SA 3O4LA 3MV7A 5C0DA 3HE7A 3MR9A 4MJIA 1FZKA 1KPRA 4JFOA 4I48A 3MA7A 4FTVA 4MX7A 4PJAA 2GITA 4MXQA 1ZVSA 1ZHLA 1YPZA 3AM8A 2X4UA 1I1AA 3D2UA 3O3BA 2VLLA 1E28A 4G8IA 4NT6A 4PJHA 1CG9A 3DX7A 1QO3A 3L3HA 3LKQA 5D7LA 3W39A 5B39A 3MRLA 3QI9A 4O2CA 1NANH 5BRZA 2ZSWA 5HYJA 1A1MA 5F1NA 3RGVC 5EUOA 1SYSA 3GSVA 3VXUA 2P5EA 3QUKA 5F7DA 3CC5A 3CCHA 1T7WA 4JRXA 1UQSA 3TN0A 3TA3A 1A9BA 3C9NA 3KLAA 4F7MA 4NQEA 3O9WA 3T1FA 1T20A 3BP7A 1T21A 4CVXA 5INCA 4Y4KA 3LN5A 1QVOA 3SJVA 3VFUA 3WS6A 3GIVA 2AXFA 1MI5A 4APQA 3TPUE 2NX5A 2ZSVA 3BO8A 3VFRA 4PRPA 3L3DA 3CH1A 4PJBA 3UPRA 4ELMA 1HSBA 3FRUA 3MRFA 2PO6A 1HHHA 3E6FA 1A1OA 5HGDA 3FOLA 2CLRA 3VXOA 4HKJA 3HPJA 2FYYA 2YEZA 1N3NA 4L8DA 3PWVA 1LDPH 5D2NA 1LEGA 2OL3H 3E2HA 3JTSA 1I1YA 1FO0H 2JCCA 1A6ZA 2WY3A 3DXAA 4FFEX 4NQCA 2BVOA 3B3IA 3MGTA 2D31A 1AO7A 3FQWA 4U1HA 1XR8A 1I7RA 2X4TA 3SDXA 5D9SA 1W0VA 5ISZA 5JHDA 3BZEA 3MROA 3MV9A 4HS3A 3PWJA 4Y4HA 3CDGA 3H7BA 2CIKA 3ES6A 3ARBA 1JGEA 1AGDA 3VJ6A 1BZ9A 3L9RA 1UXWA 1JPFA 1M6OA 2BCKA 3WS3A 3VWKA 1DE4A 3UTTA 5C0GA 4PGEA 3MRKA 3PWNA 3P9LA 1Q94A
chains in the Genus database with same CATH topology
3BH9A 4ZUUA 1DUYA 2X70A 3JTTA 1VADA 5C0AA 4WWKC 2VLKA 2P5WA 3P9MA 1HHGA 3FT2A 4D0CA 3BUYA 3KPRA 1ED3A 3PWLA 3GMPA 5C0JA 3MRBA 4U1JA 3O3AA 4U1KA 3GSXA 4LCWA 1T7YA 4ZUTA 2C7UA 3M1BA 3S6CA 4NQVA 5FKPA 4S0UC 4F7PA 1T7XA 3U0PA 3QEQA 3MRIA 4F7EA 1FFOA 2GTWA 3QFDA 3BXNA 1S9WA 5ACZA 3GSQA 5C0BA 4MNGA 3VFOA 1A9EA 2FIKA 3BGMA 1FFNA 1FZOA 1HYRC 2FWOA 3KXFA 5EOTA 4GKNA 3HLAA 1I7TA 1M05A 2YPLA 2HJKA 5DEFA 4G59A 5SWZA 4PJCA 3LKNA 1JF1A 3WLBA 5IEHA 4G43A 5L2KA 3HCVA 5E8NA 4O2FA 1ZT4A 4PREA 3QDMA 3T8XA 2BNQA 4IRJA 4PJ9A 3ROLA 3H9HA 4JQVA 5L2JA 3P77A 4ZFZA 3ILQC 4PJIA 4WW2C 3OV6A 4O2EA 1EEZA 4D0DA 3CZFA 5E6IC 1Z5LA 2HJLA 1T7ZA 4LHUA 4HUUA 2NW3A 1K5NA 1TVHA 4PJGA 3WL9A 3UBXA 3RWGA 3P4MA 1OGAA 3RWFA 3HUJA 5BJTA 4PGBA 4LCYA 3RWIA 4WUUA 1CD1A 3GJFA 3GMLA 3BEVA 3GSNH 3OXSA 3BVNA 2F74A 1KTLA 2ZOLA 2XFXA 1DDHA 1X7QA 4NO3A 1AKJA 3DX8A 4I4WA 4U1LA 4G8GA 3GMMA 3X12A 3KWWA 1T1WA 4JRYA 1LK2A 3ARGA 3C8KA 5IB5A 4PJDA 1QQDA 3X11A 2X4QA 2AXGA 3MRMA 1INQA 1S7XA 5BS0A 1HHIA 1K8DA 3E3QA 1JGDA 3I6KA 5MERA 4PJXA 3RL2A 5BXFA 3VFMA 4U6YA 2BVQA 5H94A 1QLFA 4K7FA 3SKOA 1TMCA 3MRDA 5HHOA 3MRRA 3BH8A 3GMQA 3FQNA 3VXMA 3ERYA 2VLRA 3RWDA 2Q7YA 3RWHA 3P4OA 3PWUA 1VGKA 2PYEA 1OSZA 3RWEA 3VCLA 3DMMA 1LP9A 3KPOA 3REWA 3QQ4A 3MRCA 4QRTA 4QRRA 3L3GA 3QQ3A 3PQYA 5HGBA 1HHKA 5EO0A 1I4FA 2XPGA 4NSKA 1T1YA 1KCGC 1MWAH 3TO2A 1YDPA 4PR5A 4JFEA 3MRJA 1N2RA 3UTSA 3X13A 2A83A 4G42A 4LCCC 1EEYA 1LQVA 3KYNA 2GTZA 4PGCA 1SYVA 5C0CA 1XZ0A 4PJEA 2BNRA 3QUZA 5FDWA 3QDGA 2F53A 1S7QA 5E9DA 3SKMA 1L8JA 3SDDA 5C0FA 2GT9A 3I6LD 1RJYA 3M17A 1EXUA 1S9XA 3O8XA 1AGFA 4GUPA 1KJ2H 3QUXA 1AGBA 4ZUSA 5MEQA 4HUVA 1QR1A 3BZFA 2AV1A 5C9JA 1N59A 3FQUA 1BIIA 1LD9A 3LV3A 3O3EA 3VXPA 4U1MA 5HGHA 5DEGA 4PJ7A 4UQ2A 3AU1A 1KJMA 1HHJA 1G6RH 2CKBH 5IB3A 5MEPA 4HWZA 1T7VA 1KJ3H 4WJ5A 4XXCA 1ZS8A 3B6SA 1ZT7A 3ARFA 2GAZA 3P4NA 4NNXA 5C08A 3CVHA 5B38A 1RK1A 4QRUA 4PP8C 3DX6A 3VWJA 4V3EB 5EO1A 5INDA 1JUFA 5C09A 3V5KA 1T80A 3RL1A 3WUWA 5AD0A 1QRNA 2BSRA 4MJ5A 1T0MA 4EI5A 4E0RA 4EUPA 5GSRA 4X6DA 5HGAA 1S7UA 3VFWA 3TFKA 5IB4A 4PRHA 3FT3A 4N5EA 1FG2A 4PG2A 4L4TA 3LKRA 1EFXA 3FQTA 3QZWA 5MENA 3LKSA 1B0GA 3KPSA 4Y4FA 4PDCE 4EN3C 4L8BA 4U1NA 1QEWA 3NFNA 1IM3A 1S7SA 2X4RA 3GMNA 1B0RA 4PG9A 2CLZA 1DUZA 4PJ8A 2X4OA 4QRPA 4L4VA 2AV7A 3KYOA 3MRHA 3RWJA 2CIIA 4HUWA 3L3JA 3FOMA 3TBWA 4PV9A 1PQZA 3BEWA 3GMOA 3GSUA 1E27A 5HHQA 3OXRA 2HN7A 3VXNA 3X14A 3V5HA 3TBYA 1G7QA 4MJ6A 1NEZA 5HHMA 2AK4A 2X4NA 4PGDA 5C0EA 3L3IA 3PWPA 1W0WA 4LNRA 5SWQA 4Z78A 3P73A 1XH3A 1T0NA 4ZAKA 5IROA 3RWCA 4L8CA 3FQRA 4X6FA 5ENWA 2J8UA 1KPVA 3ECBA 3LKPA 3QDJA 2VAAA 2GJ6A 1XR9A 1ZHNA 2YPKA 3L3KA 4WO4A 3TIDA 1KPUA 5FA4A 1VACA 4NNYA 4MVBA 1IM9A 5J6GA 3MREA 3MRGA 1AGCA 5D7JC 1ZAGA 3VFNA 4PRNA 1ZT1A 2F54A 4U6XA 2DYPA 4N0UA 4NQXA 3D18A 1ZSDA 3W0WA 3RTQA 1JHTA 2FZ3A 2AKRA 4HUXA 3ROOA 1I7UA 5EU3A 3TBSA 3GSRA 3ARDA 1S8DA 3QULA 1JPGA 3BP4A 4Y16A 2RFXA 3FQXA 3VFPA 5J1AA 1CE6A 3SDCA 1U58A 3VRJA 4IHOA 3SPVA 3IXAA 1T1XA 4PRAA 4NO0A 1QSEA 4ZUVA 3MV8A 5EFIA 3HG1A 4CW1A 3G08A 1P1ZA 2MHAA 4WDIA 2HLAA 5HHPA 2V2XA 4JFDA 3KPMA 1MHEA 4NO5A 3BWAA 3KPLA 4HX1A 1AGEA 3IT8D 5EU5A 1KBGH 3KPQA 2X4SA 4F7CA 1ONQA 4JFPA 4U1IA 3LN4A 1FZMA 5MEOA 2VABA 3D3VA 5J6HA 3DTXA 4Y2DA 5IB2A 1BQHA 4L3EA 2BVPA 3TBTA 1JE6A 2VLJA 4UQ3A 5GSVA 5IB1A 4JFQA 4PRDA 5HHNA 2E7LE 4MNQA 1LEKA 1T1ZA 4WU7A 1GZQA 1R3HA 3MRNA 4G9FA 4JFFA 1NAMH 1KJVA 3KPNA 5FA3A 5EU4A 3QUYA 4IRSA 1QSFA 3VFSA 3E6HA 1GZPA 3D25A 2ESVA 4N0FA 3KPPA 4HV8A 3MRQA 3V5DA 1HSAA 4F7TA 3SCMA 4L8SC 3SDAA 1JFMA 1B3JA 1S7TA 5F1IA 3TIEA 3VFTA 4G9DA 3GSOA 3TBVA 4Z76A 4PV8A 3MRPA 4PJFA 3VFVA 4GKSA 1ZHBA 5IVXA 4NO2A 1RJZA 1T22A 3BW9A 4NQDA 3VH8A 5F9JA 1WBYA 4V3DB 2BSTA 1WBZA 4L29A 4WU5A 4ZUWA 4N0CA 1N5AA 1P7QA 2GUOA 1A1NA 1OGTA 5D5MA 3VXRA 3DBXA 3D39A 3TJHA 2VE6A 2ZOKA 4PRBA 4X6EA 3CPLA 1FZJA 1BD2A 5E8OA 3MGOA 3VRIA 3FT4A 4PRIA 4JQXA 3GMRA 3O3DA 3FONA 1OF2A 1ZHKA 3GSWA 1I1FA 3HE6A 4IIQC 5D2LA 1S7WA 3AREA 3I6GA 5C07A 1YN7A 1W72A 3QFJA 4MS8A 4ONOA 4QRQA 5C0IA 2CLVA 2UWEA 1S7VA 3JTCA 4NHUE 3TF7A 5IEKA 2V2WA 3RUGA 4MQ7A 5EU6A 3OX8A 3PABA 1S9YA 3TVMA 3JVGA 2FO4A 3TO4A 5DDHA 5SWSA 3LKOA 1C16A 2X4PA 1RK0A 4K71B 3FTGA 1YN6A 3TZVC 4N8VA 3BHBA 3FFCA 1WBXA 5D7IA 1TVBA 4QOKA 5E8PA 4QRSA 3VXSA 3ILPA 1FFPA 1G7PA 2BSSA 3H9SA 4L9LC 2H6PA 4Z77A 4E5XA 1S7RA 4X6CA 1P4LA 5E00A 3MYJA 5IM7A 4L3CA 4D0BA 4PJ5A 3UTQA 1MHCA 2OI9A 3HAEA 2H26A 1UXSA 1HOCA 4CVZA 3RZCA 4U1SA 3O4LA 3MV7A 5C0DA 3HE7A 3MR9A 4MJIA 1FZKA 1KPRA 4JFOA 4I48A 3MA7A 4FTVA 4MX7A 4PJAA 2GITA 4MXQA 1ZVSA 1ZHLA 1YPZA 3AM8A 2X4UA 1I1AA 3D2UA 3O3BA 2VLLA 1E28A 4G8IA 4NT6A 4PJHA 1CG9A 3DX7A 1QO3A 3L3HA 3LKQA 5D7LA 3W39A 5B39A 3MRLA 3QI9A 4O2CA 1NANH 5BRZA 2ZSWA 5HYJA 1A1MA 5F1NA 3RGVC 5EUOA 1SYSA 3GSVA 3VXUA 2P5EA 3QUKA 5F7DA 3CC5A 3CCHA 1T7WA 4JRXA 1UQSA 3TN0A 3TA3A 1A9BA 3C9NA 3KLAA 4F7MA 4NQEA 3O9WA 3T1FA 1T20A 3BP7A 1T21A 4CVXA 5INCA 4Y4KA 3LN5A 1QVOA 3SJVA 3VFUA 3WS6A 3GIVA 2AXFA 1MI5A 4APQA 3TPUE 2NX5A 2ZSVA 3BO8A 3VFRA 4PRPA 3L3DA 3CH1A 4PJBA 3UPRA 4ELMA 1HSBA 3FRUA 3MRFA 2PO6A 1HHHA 3E6FA 1A1OA 5HGDA 3FOLA 2CLRA 3VXOA 4HKJA 3HPJA 2FYYA 2YEZA 1N3NA 4L8DA 3PWVA 1LDPH 5D2NA 1LEGA 2OL3H 3E2HA 3JTSA 1I1YA 1FO0H 2JCCA 1A6ZA 2WY3A 3DXAA 4FFEX 4NQCA 2BVOA 3B3IA 3MGTA 2D31A 1AO7A 3FQWA 4U1HA 1XR8A 1I7RA 2X4TA 3SDXA 5D9SA 1W0VA 5ISZA 5JHDA 3BZEA 3MROA 3MV9A 4HS3A 3PWJA 4Y4HA 3CDGA 3H7BA 2CIKA 3ES6A 3ARBA 1JGEA 1AGDA 3VJ6A 1BZ9A 3L9RA 1UXWA 1JPFA 1M6OA 2BCKA 3WS3A 3VWKA 1DE4A 3UTTA 5C0GA 4PGEA 3MRKA 3PWNA 3P9LA 1Q94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH9 A;  4ZUU A;  1DUY A;  2X70 A;  3JTT A;  1VAD A;  5C0A A;  4WWK C;  2VLK A;  2P5W A;  3P9M A;  1HHG A;  3FT2 A;  4D0C A;  3BUY A;  3KPR A;  1ED3 A;  3PWL A;  3GMP A;  5C0J A;  3MRB A;  4U1J A;  3O3A A;  4U1K A;  3GSX A;  4LCW A;  1T7Y A;  4ZUT A;  2C7U A;  3M1B A;  3S6C A;  4NQV A;  5FKP A;  4S0U C;  4F7P A;  1T7X A;  3U0P A;  3QEQ A;  3MRI A;  4F7E A;  1FFO A;  2GTW A;  3QFD A;  3BXN A;  1S9W A;  5ACZ A;  3GSQ A;  5C0B A;  4MNG A;  3VFO A;  1A9E A;  2FIK A;  3BGM A;  1FFN A;  1FZO A;  1HYR C;  2FWO A;  3KXF A;  5EOT A;  4GKN A;  3HLA A;  1I7T A;  1M05 A;  2YPL A;  2HJK A;  5DEF A;  4G59 A;  5SWZ A;  4PJC A;  3LKN A;  1JF1 A;  3WLB A;  5IEH A;  4G43 A;  5L2K A;  3HCV A;  5E8N A;  4O2F A;  1ZT4 A;  4PRE A;  3QDM A;  3T8X A;  2BNQ A;  4IRJ A;  4PJ9 A;  3ROL A;  3H9H A;  4JQV A;  5L2J A;  3P77 A;  4ZFZ A;  3ILQ C;  4PJI A;  4WW2 C;  3OV6 A;  4O2E A;  1EEZ A;  4D0D A;  3CZF A;  5E6I C;  1Z5L A;  2HJL A;  1T7Z A;  4LHU A;  4HUU A;  2NW3 A;  1K5N A;  1TVH A;  4PJG A;  3WL9 A;  3UBX A;  3RWG A;  3P4M A;  1OGA A;  3RWF A;  3HUJ A;  5BJT A;  4PGB A;  4LCY A;  3RWI A;  4WUU A;  1CD1 A;  3GJF A;  3GML A;  3BEV A;  3GSN H;  3OXS A;  3BVN A;  2F74 A;  1KTL A;  2ZOL A;  2XFX A;  1DDH A;  1X7Q A;  4NO3 A;  1AKJ A;  3DX8 A;  4I4W A;  4U1L A;  4G8G A;  3GMM A;  3X12 A;  3KWW A;  1T1W A;  4JRY A;  1LK2 A;  3ARG A;  3C8K A;  5IB5 A;  4PJD A;  1QQD A;  3X11 A;  2X4Q A;  2AXG A;  3MRM A;  1INQ A;  1S7X A;  5BS0 A;  1HHI A;  1K8D A;  3E3Q A;  1JGD A;  3I6K A;  5MER A;  4PJX A;  3RL2 A;  5BXF A;  3VFM A;  4U6Y A;  2BVQ A;  5H94 A;  1QLF A;  4K7F A;  3SKO A;  1TMC A;  3MRD A;  5HHO A;  3MRR A;  3BH8 A;  3GMQ A;  3FQN A;  3VXM A;  3ERY A;  2VLR A;  3RWD A;  2Q7Y A;  3RWH A;  3P4O A;  3PWU A;  1VGK A;  2PYE A;  1OSZ A;  3RWE A;  3VCL A;  3DMM A;  1LP9 A;  3KPO A;  3REW A;  3QQ4 A;  3MRC A;  4QRT A;  4QRR A;  3L3G A;  3QQ3 A;  3PQY A;  5HGB A;  1HHK A;  5EO0 A;  1I4F A;  2XPG A;  4NSK A;  1T1Y A;  1KCG C;  1MWA H;  3TO2 A;  1YDP A;  4PR5 A;  4JFE A;  3MRJ A;  1N2R A;  3UTS A;  3X13 A;  2A83 A;  4G42 A;  4LCC C;  1EEY A;  1LQV A;  3KYN A;  2GTZ A;  4PGC A;  1SYV A;  5C0C A;  1XZ0 A;  4PJE A;  2BNR A;  3QUZ A;  5FDW A;  3QDG A;  2F53 A;  1S7Q A;  5E9D A;  3SKM A;  1L8J A;  3SDD A;  5C0F A;  2GT9 A;  3I6L D;  1RJY A;  3M17 A;  1EXU A;  1S9X A;  3O8X A;  1AGF A;  4GUP A;  1KJ2 H;  3QUX A;  1AGB A;  4ZUS A;  5MEQ A;  4HUV A;  1QR1 A;  3BZF A;  2AV1 A;  5C9J A;  1N59 A;  3FQU A;  1BII A;  1LD9 A;  3LV3 A;  3O3E A;  3VXP A;  4U1M A;  5HGH A;  5DEG A;  4PJ7 A;  4UQ2 A;  3AU1 A;  1KJM A;  1HHJ A;  1G6R H;  2CKB H;  5IB3 A;  5MEP A;  4HWZ A;  1T7V A;  1KJ3 H;  4WJ5 A;  4XXC A;  1ZS8 A;  3B6S A;  1ZT7 A;  3ARF A;  2GAZ A;  3P4N A;  4NNX A;  5C08 A;  3CVH A;  5B38 A;  1RK1 A;  4QRU A;  4PP8 C;  3DX6 A;  3VWJ A;  4V3E B;  5EO1 A;  5IND A;  1JUF A;  5C09 A;  3V5K A;  1T80 A;  3RL1 A;  3WUW A;  5AD0 A;  1QRN A;  2BSR A;  4MJ5 A;  1T0M A;  4EI5 A;  4E0R A;  4EUP A;  5GSR A;  4X6D A;  5HGA A;  1S7U A;  3VFW A;  3TFK A;  5IB4 A;  4PRH A;  3FT3 A;  4N5E A;  1FG2 A;  4PG2 A;  4L4T A;  3LKR A;  1EFX A;  3FQT A;  3QZW A;  5MEN A;  3LKS A;  1B0G A;  3KPS A;  4Y4F A;  4PDC E;  4EN3 C;  4L8B A;  4U1N A;  1QEW A;  3NFN A;  1IM3 A;  1S7S A;  2X4R A;  3GMN A;  1B0R A;  4PG9 A;  2CLZ A;  1DUZ A;  4PJ8 A;  2X4O A;  4QRP A;  4L4V A;  2AV7 A;  3KYO A;  3MRH A;  3RWJ A;  2CII A;  4HUW A;  3L3J A;  3FOM A;  3TBW A;  4PV9 A;  1PQZ A;  3BEW A;  3GMO A;  3GSU A;  1E27 A;  5HHQ A;  3OXR A;  2HN7 A;  3VXN A;  3X14 A;  3V5H A;  3TBY A;  1G7Q A;  4MJ6 A;  1NEZ A;  5HHM A;  2AK4 A;  2X4N A;  4PGD A;  5C0E A;  3L3I A;  3PWP A;  1W0W A;  4LNR A;  5SWQ A;  4Z78 A;  3P73 A;  1XH3 A;  1T0N A;  4ZAK A;  5IRO A;  3RWC A;  4L8C A;  3FQR A;  4X6F A;  5ENW A;  2J8U A;  1KPV A;  3ECB A;  3LKP A;  3QDJ A;  2VAA A;  2GJ6 A;  1XR9 A;  1ZHN A;  2YPK A;  3L3K A;  4WO4 A;  3TID A;  1KPU A;  5FA4 A;  1VAC A;  4NNY A;  4MVB A;  1IM9 A;  5J6G A;  3MRE A;  3MRG A;  1AGC A;  5D7J C;  1ZAG A;  3VFN A;  4PRN A;  1ZT1 A;  2F54 A;  4U6X A;  2DYP A;  4N0U A;  4NQX A;  3D18 A;  1ZSD A;  3W0W A;  3RTQ A;  1JHT A;  2FZ3 A;  2AKR A;  4HUX A;  3ROO A;  1I7U A;  5EU3 A;  3TBS A;  3GSR A;  3ARD A;  1S8D A;  3QUL A;  1JPG A;  3BP4 A;  4Y16 A;  2RFX A;  3FQX A;  3VFP A;  5J1A A;  1CE6 A;  3SDC A;  1U58 A;  3VRJ A;  4IHO A;  3SPV A;  3IXA A;  1T1X A;  4PRA A;  4NO0 A;  1QSE A;  4ZUV A;  3MV8 A;  5EFI A;  3HG1 A;  4CW1 A;  3G08 A;  1P1Z A;  2MHA A;  4WDI A;  2HLA A;  5HHP A;  2V2X A;  4JFD A;  3KPM A;  1MHE A;  4NO5 A;  3BWA A;  3KPL A;  4HX1 A;  1AGE A;  3IT8 D;  5EU5 A;  1KBG H;  3KPQ A;  2X4S A;  4F7C A;  1ONQ A;  4JFP A;  4U1I A;  3LN4 A;  1FZM A;  5MEO A;  2VAB A;  3D3V A;  5J6H A;  3DTX A;  4Y2D A;  5IB2 A;  1BQH A;  4L3E A;  2BVP A;  3TBT A;  1JE6 A;  2VLJ A;  4UQ3 A;  5GSV A;  5IB1 A;  4JFQ A;  4PRD A;  5HHN A;  2E7L E;  4MNQ A;  1LEK A;  1T1Z A;  4WU7 A;  1GZQ A;  1R3H A;  3MRN A;  4G9F A;  4JFF A;  1NAM H;  1KJV A;  3KPN A;  5FA3 A;  5EU4 A;  3QUY A;  4IRS A;  1QSF A;  3VFS A;  3E6H A;  1GZP A;  3D25 A;  2ESV A;  4N0F A;  3KPP A;  4HV8 A;  3MRQ A;  3V5D A;  1HSA A;  4F7T A;  3SCM A;  4L8S C;  3SDA A;  1JFM A;  1B3J A;  1S7T A;  5F1I A;  3TIE A;  3VFT A;  4G9D A;  3GSO A;  3TBV A;  4Z76 A;  4PV8 A;  3MRP A;  4PJF A;  3VFV A;  4GKS A;  1ZHB A;  5IVX A;  4NO2 A;  1RJZ A;  1T22 A;  3BW9 A;  4NQD A;  3VH8 A;  5F9J A;  1WBY A;  4V3D B;  2BST A;  1WBZ A;  4L29 A;  4WU5 A;  4ZUW A;  4N0C A;  1N5A A;  1P7Q A;  2GUO A;  1A1N A;  1OGT A;  5D5M A;  3VXR A;  3DBX A;  3D39 A;  3TJH A;  2VE6 A;  2ZOK A;  4PRB A;  4X6E A;  3CPL A;  1FZJ A;  1BD2 A;  5E8O A;  3MGO A;  3VRI A;  3FT4 A;  4PRI A;  4JQX A;  3GMR A;  3O3D A;  3FON A;  1OF2 A;  1ZHK A;  3GSW A;  1I1F A;  3HE6 A;  4IIQ C;  5D2L A;  1S7W A;  3ARE A;  3I6G A;  5C07 A;  1YN7 A;  1W72 A;  3QFJ A;  4MS8 A;  4ONO A;  4QRQ A;  5C0I A;  2CLV A;  2UWE A;  1S7V A;  3JTC A;  4NHU E;  3TF7 A;  5IEK A;  2V2W A;  3RUG A;  4MQ7 A;  5EU6 A;  3OX8 A;  3PAB A;  1S9Y A;  3TVM A;  3JVG A;  2FO4 A;  3TO4 A;  5DDH A;  5SWS A;  3LKO A;  1C16 A;  2X4P A;  1RK0 A;  4K71 B;  3FTG A;  1YN6 A;  3TZV C;  4N8V A;  3BHB A;  3FFC A;  1WBX A;  5D7I A;  1TVB A;  4QOK A;  5E8P A;  4QRS A;  3VXS A;  3ILP A;  1FFP A;  1G7P A;  2BSS A;  3H9S A;  4L9L C;  2H6P A;  4Z77 A;  4E5X A;  1S7R A;  4X6C A;  1P4L A;  5E00 A;  3MYJ A;  5IM7 A;  4L3C A;  4D0B A;  4PJ5 A;  3UTQ A;  1MHC A;  2OI9 A;  3HAE A;  2H26 A;  1UXS A;  1HOC A;  4CVZ A;  3RZC A;  4U1S A;  3O4L A;  3MV7 A;  5C0D A;  3HE7 A;  3MR9 A;  4MJI A;  1FZK A;  1KPR A;  4JFO A;  4I48 A;  3MA7 A;  4FTV A;  4MX7 A;  4PJA A;  2GIT A;  4MXQ A;  1ZVS A;  1ZHL A;  1YPZ A;  3AM8 A;  2X4U A;  1I1A A;  3D2U A;  3O3B A;  2VLL A;  1E28 A;  4G8I A;  4NT6 A;  4PJH A;  1CG9 A;  3DX7 A;  1QO3 A;  3L3H A;  3LKQ A;  5D7L A;  3W39 A;  5B39 A;  3MRL A;  3QI9 A;  4O2C A;  1NAN H;  5BRZ A;  2ZSW A;  5HYJ A;  1A1M A;  5F1N A;  3RGV C;  5EUO A;  1SYS A;  3GSV A;  3VXU A;  2P5E A;  3QUK A;  5F7D A;  3CC5 A;  3CCH A;  1T7W A;  4JRX A;  1UQS A;  3TN0 A;  3TA3 A;  1A9B A;  3C9N A;  3KLA A;  4F7M A;  4NQE A;  3O9W A;  3T1F A;  1T20 A;  3BP7 A;  1T21 A;  4CVX A;  5INC A;  4Y4K A;  3LN5 A;  1QVO A;  3SJV A;  3VFU A;  3WS6 A;  3GIV A;  2AXF A;  1MI5 A;  4APQ A;  3TPU E;  2NX5 A;  2ZSV A;  3BO8 A;  3VFR A;  4PRP A;  3L3D A;  3CH1 A;  4PJB A;  3UPR A;  4ELM A;  1HSB A;  3FRU A;  3MRF A;  2PO6 A;  1HHH A;  3E6F A;  1A1O A;  5HGD A;  3FOL A;  2CLR A;  3VXO A;  4HKJ A;  3HPJ A;  2FYY A;  2YEZ A;  1N3N A;  4L8D A;  3PWV A;  1LDP H;  5D2N A;  1LEG A;  2OL3 H;  3E2H A;  3JTS A;  1I1Y A;  1FO0 H;  2JCC A;  1A6Z A;  2WY3 A;  3DXA A;  4FFE X;  4NQC A;  2BVO A;  3B3I A;  3MGT A;  2D31 A;  1AO7 A;  3FQW A;  4U1H A;  1XR8 A;  1I7R A;  2X4T A;  3SDX A;  5D9S A;  1W0V A;  5ISZ A;  5JHD A;  3BZE A;  3MRO A;  3MV9 A;  4HS3 A;  3PWJ A;  4Y4H A;  3CDG A;  3H7B A;  2CIK A;  3ES6 A;  3ARB A;  1JGE A;  1AGD A;  3VJ6 A;  1BZ9 A;  3L9R A;  1UXW A;  1JPF A;  1M6O A;  2BCK A;  3WS3 A;  3VWK A;  1DE4 A;  3UTT A;  5C0G A;  4PGE A;  3MRK A;  3PWN A;  3P9L A;  1Q94 A; 
#chains in the Genus database with same CATH topology
 3BH9 A;  4ZUU A;  1DUY A;  2X70 A;  3JTT A;  1VAD A;  5C0A A;  4WWK C;  2VLK A;  2P5W A;  3P9M A;  1HHG A;  3FT2 A;  4D0C A;  3BUY A;  3KPR A;  1ED3 A;  3PWL A;  3GMP A;  5C0J A;  3MRB A;  4U1J A;  3O3A A;  4U1K A;  3GSX A;  4LCW A;  1T7Y A;  4ZUT A;  2C7U A;  3M1B A;  3S6C A;  4NQV A;  5FKP A;  4S0U C;  4F7P A;  1T7X A;  3U0P A;  3QEQ A;  3MRI A;  4F7E A;  1FFO A;  2GTW A;  3QFD A;  3BXN A;  1S9W A;  5ACZ A;  3GSQ A;  5C0B A;  4MNG A;  3VFO A;  1A9E A;  2FIK A;  3BGM A;  1FFN A;  1FZO A;  1HYR C;  2FWO A;  3KXF A;  5EOT A;  4GKN A;  3HLA A;  1I7T A;  1M05 A;  2YPL A;  2HJK A;  5DEF A;  4G59 A;  5SWZ A;  4PJC A;  3LKN A;  1JF1 A;  3WLB A;  5IEH A;  4G43 A;  5L2K A;  3HCV A;  5E8N A;  4O2F A;  1ZT4 A;  4PRE A;  3QDM A;  3T8X A;  2BNQ A;  4IRJ A;  4PJ9 A;  3ROL A;  3H9H A;  4JQV A;  5L2J A;  3P77 A;  4ZFZ A;  3ILQ C;  4PJI A;  4WW2 C;  3OV6 A;  4O2E A;  4BKW A;  1EEZ A;  4D0D A;  3CZF A;  5E6I C;  1Z5L A;  2HJL A;  1T7Z A;  4LHU A;  4HUU A;  2NW3 A;  1K5N A;  1TVH A;  4PJG A;  3WL9 A;  3UBX A;  3RWG A;  3P4M A;  1OGA A;  3RWF A;  3HUJ A;  5BJT A;  4PGB A;  4LCY A;  3RWI A;  4WUU A;  1CD1 A;  3GJF A;  3GML A;  3BEV A;  3GSN H;  3OXS A;  3BVN A;  2F74 A;  1KTL A;  2ZOL A;  2XFX A;  1DDH A;  1X7Q A;  4NO3 A;  1AKJ A;  3DX8 A;  4I4W A;  4U1L A;  4G8G A;  3GMM A;  4JO8 A;  3KWW A;  3X12 A;  1T1W A;  4JRY A;  1LK2 A;  3ARG A;  3C8K A;  5IB5 A;  4PJD A;  1QQD A;  3X11 A;  2X4Q A;  2AXG A;  3MRM A;  1INQ A;  1S7X A;  5BS0 A;  1HHI A;  1K8D A;  3E3Q A;  1JGD A;  3I6K A;  5MER A;  4PJX A;  3RL2 A;  5BXF A;  3VFM A;  4U6Y A;  2BVQ A;  5H94 A;  1QLF A;  4K7F A;  3SKO A;  1TMC A;  3MRD A;  5HHO A;  3MRR A;  3BH8 A;  3GMQ A;  3FQN A;  3VXM A;  3ERY A;  2VLR A;  3RWD A;  2Q7Y A;  3RWH A;  3P4O A;  3PWU A;  1VGK A;  2PYE A;  1OSZ A;  3RWE A;  3VCL A;  3DMM A;  1LP9 A;  3KPO A;  3REW A;  3QQ4 A;  3MRC A;  4QRT A;  4QRR A;  3L3G A;  3QQ3 A;  3PQY A;  5HGB A;  1HHK A;  5EO0 A;  1I4F A;  2IA1 A;  2XPG A;  4NSK A;  1T1Y A;  1KCG C;  1MWA H;  3TO2 A;  1YDP A;  4PR5 A;  4JFE A;  3MRJ A;  1N2R A;  3UTS A;  3X13 A;  2A83 A;  4G42 A;  4LCC C;  1EEY A;  1LQV A;  3KYN A;  2GTZ A;  4PGC A;  1SYV A;  5C0C A;  1XZ0 A;  4PJE A;  2BNR A;  3QUZ A;  5FDW A;  3QDG A;  2F53 A;  1S7Q A;  5E9D A;  3SKM A;  1L8J A;  3SDD A;  5C0F A;  2GT9 A;  3I6L D;  1RJY A;  3M17 A;  1EXU A;  1S9X A;  3O8X A;  1AGF A;  4GUP A;  1KJ2 H;  3QUX A;  1AGB A;  4ZUS A;  5MEQ A;  4HUV A;  1QR1 A;  3BZF A;  2AV1 A;  5C9J A;  1N59 A;  3FQU A;  1BII A;  1LD9 A;  3LV3 A;  3O3E A;  3VXP A;  4U1M A;  5HGH A;  5DEG A;  4PJ7 A;  4UQ2 A;  3AU1 A;  1KJM A;  1HHJ A;  1G6R H;  2CKB H;  5IB3 A;  5MEP A;  4HWZ A;  1T7V A;  1KJ3 H;  4WJ5 A;  4XXC A;  1ZS8 A;  3B6S A;  1ZT7 A;  3ARF A;  2GAZ A;  3P4N A;  4NNX A;  5C08 A;  3CVH A;  5B38 A;  1RK1 A;  4QRU A;  4PP8 C;  3DX6 A;  3VWJ A;  4V3E B;  5EO1 A;  5IND A;  1JUF A;  5C09 A;  3V5K A;  1T80 A;  3RL1 A;  3WUW A;  5AD0 A;  1QRN A;  2BSR A;  4MJ5 A;  1T0M A;  4EI5 A;  4E0R A;  4EUP A;  5GSR A;  4X6D A;  5HGA A;  1S7U A;  3VFW A;  3TFK A;  5IB4 A;  4PRH A;  3FT3 A;  4N5E A;  1FG2 A;  4PG2 A;  4L4T A;  3LKR A;  1EFX A;  3FQT A;  3QZW A;  5MEN A;  3LKS A;  1B0G A;  3KPS A;  4Y4F A;  4PDC E;  2NYK A;  4EN3 C;  4L8B A;  4U1N A;  1QEW A;  3NFN A;  1IM3 A;  1S7S A;  2X4R A;  3GMN A;  1B0R A;  4PG9 A;  2CLZ A;  1DUZ A;  4PJ8 A;  2X4O A;  4QRP A;  4L4V A;  2AV7 A;  3KYO A;  3MRH A;  3RWJ A;  2CII A;  4HUW A;  3L3J A;  3FOM A;  3TBW A;  4PV9 A;  1PQZ A;  3BEW A;  3GMO A;  3GSU A;  1E27 A;  5HHQ A;  3OXR A;  2HN7 A;  3VXN A;  3X14 A;  3V5H A;  3TBY A;  1G7Q A;  4MJ6 A;  1NEZ A;  4G59 C;  5HHM A;  2AK4 A;  2X4N A;  4PGD A;  5C0E A;  3L3I A;  3PWP A;  1W0W A;  4LNR A;  5SWQ A;  4Z78 A;  3P73 A;  1XH3 A;  1T0N A;  4ZAK A;  5IRO A;  3RWC A;  4L8C A;  3FQR A;  4X6F A;  5ENW A;  2J8U A;  1KPV A;  3ECB A;  3LKP A;  3QDJ A;  2VAA A;  2GJ6 A;  1XR9 A;  1ZHN A;  2YPK A;  3L3K A;  4WO4 A;  3TID A;  1KPU A;  5FA4 A;  1VAC A;  4NNY A;  4MVB A;  1IM9 A;  5J6G A;  3MRE A;  3MRG A;  1AGC A;  5D7J C;  1ZAG A;  3VFN A;  4PRN A;  1ZT1 A;  2F54 A;  4U6X A;  2DYP A;  4N0U A;  4NQX A;  3D18 A;  1ZSD A;  3W0W A;  3RTQ A;  1JHT A;  2FZ3 A;  2AKR A;  4HUX A;  3ROO A;  1I7U A;  5EU3 A;  3TBS A;  3GSR A;  3ARD A;  1S8D A;  3QUL A;  1JPG A;  3BP4 A;  4Y16 A;  2RFX A;  3FQX A;  3VFP A;  5J1A A;  1CE6 A;  3SDC A;  1U58 A;  3VRJ A;  4IHO A;  3SPV A;  3IXA A;  1T1X A;  4PRA A;  4NO0 A;  1QSE A;  4ZUV A;  3MV8 A;  5EFI A;  3HG1 A;  4CW1 A;  3G08 A;  1P1Z A;  3I0T A;  2MHA A;  4WDI A;  2HLA A;  5HHP A;  2V2X A;  4JFD A;  3KPM A;  1MHE A;  4NO5 A;  3BWA A;  3KPL A;  4HX1 A;  1AGE A;  3IT8 D;  5EU5 A;  1KBG H;  3KPQ A;  2X4S A;  4F7C A;  1ONQ A;  4JFP A;  4U1I A;  3LN4 A;  1FZM A;  5MEO A;  2VAB A;  3D3V A;  5J6H A;  3DTX A;  4Y2D A;  5IB2 A;  1BQH A;  4L3E A;  2BVP A;  3TBT A;  1JE6 A;  2VLJ A;  4UQ3 A;  5GSV A;  5IB1 A;  4JFQ A;  4PRD A;  5HHN A;  2E7L E;  4MNQ A;  1LEK A;  1T1Z A;  4WU7 A;  1GZQ A;  1R3H A;  3MRN A;  4G9F A;  4JFF A;  1NAM H;  1KJV A;  3KPN A;  5FA3 A;  5EU4 A;  3QUY A;  4IRS A;  1QSF A;  3VFS A;  3E6H A;  1GZP A;  3D25 A;  2ESV A;  4N0F A;  3KPP A;  4HV8 A;  3MRQ A;  3V5D A;  1HSA A;  4F7T A;  3SCM A;  4L8S C;  3SDA A;  1JFM A;  1B3J A;  1S7T A;  5F1I A;  3TIE A;  3VFT A;  4G9D A;  3GSO A;  3TBV A;  4Z76 A;  4PV8 A;  3MRP A;  4PJF A;  3VFV A;  4GKS A;  1ZHB A;  5IVX A;  4NO2 A;  1RJZ A;  1T22 A;  3BW9 A;  4NQD A;  3VH8 A;  5F9J A;  1WBY A;  4V3D B;  2BST A;  1WBZ A;  4L29 A;  4WU5 A;  4ZUW A;  4N0C A;  1N5A A;  1P7Q A;  2GUO A;  1A1N A;  1OGT A;  5D5M A;  3VXR A;  3DBX A;  3D39 A;  3TJH A;  2VE6 A;  2ZOK A;  4PRB A;  4X6E A;  3CPL A;  1FZJ A;  1BD2 A;  5E8O A;  3MGO A;  3VRI A;  3FT4 A;  4PRI A;  4JQX A;  3GMR A;  3O3D A;  3FON A;  1OF2 A;  1ZHK A;  3GSW A;  1I1F A;  3HE6 A;  4IIQ C;  5D2L A;  1S7W A;  3ARE A;  3I6G A;  5C07 A;  1YN7 A;  1W72 A;  3QFJ A;  4MS8 A;  4ONO A;  4QRQ A;  5C0I A;  2CLV A;  2UWE A;  1S7V A;  3JTC A;  4NHU E;  3TF7 A;  5IEK A;  2V2W A;  3RUG A;  4MQ7 A;  5EU6 A;  3OX8 A;  3PAB A;  1S9Y A;  3TVM A;  3JVG A;  2FO4 A;  3TO4 A;  5DDH A;  5SWS A;  3LKO A;  1C16 A;  2X4P A;  1RK0 A;  4K71 B;  3FTG A;  1YN6 A;  3TZV C;  4N8V A;  3BHB A;  3FFC A;  1WBX A;  5D7I A;  1TVB A;  4QOK A;  5E8P A;  4QRS A;  3VXS A;  3ILP A;  1FFP A;  1G7P A;  2BSS A;  3H9S A;  4L9L C;  2H6P A;  4Z77 A;  4E5X A;  1S7R A;  4X6C A;  1P4L A;  5E00 A;  3MYJ A;  5IM7 A;  4L3C A;  4D0B A;  4PJ5 A;  3UTQ A;  1MHC A;  2OI9 A;  2O5N A;  3HAE A;  2H26 A;  1UXS A;  1HOC A;  4CVZ A;  3RZC A;  4U1S A;  3O4L A;  3MV7 A;  5C0D A;  3HE7 A;  3MR9 A;  4MJI A;  1FZK A;  1KPR A;  4JFO A;  4I48 A;  3MA7 A;  4FTV A;  4MX7 A;  4PJA A;  2GIT A;  4MXQ A;  1ZVS A;  1ZHL A;  1YPZ A;  3AM8 A;  2X4U A;  1I1A A;  3D2U A;  3O3B A;  2VLL A;  1E28 A;  4G8I A;  4NT6 A;  4PJH A;  1CG9 A;  3DX7 A;  1QO3 A;  3L3H A;  3LKQ A;  5D7L A;  3W39 A;  5B39 A;  3MRL A;  3QI9 A;  4O2C A;  1NAN H;  5BRZ A;  2ZSW A;  5HYJ A;  1A1M A;  5F1N A;  3RGV C;  5EUO A;  1SYS A;  3GSV A;  3VXU A;  2P5E A;  3QUK A;  5F7D A;  3CC5 A;  3CCH A;  1T7W A;  4JRX A;  1UQS A;  3TN0 A;  3TA3 A;  1A9B A;  3C9N A;  3KLA A;  4F7M A;  4NQE A;  3O9W A;  3T1F A;  1T20 A;  3BP7 A;  1T21 A;  4CVX A;  5INC A;  4Y4K A;  3LN5 A;  1QVO A;  3SJV A;  3VFU A;  3WS6 A;  3GIV A;  2AXF A;  1MI5 A;  4APQ A;  3TPU E;  2NX5 A;  2ZSV A;  3BO8 A;  3VFR A;  4PRP A;  3L3D A;  3CH1 A;  4PJB A;  3UPR A;  4ELM A;  1HSB A;  3FRU A;  3MRF A;  2PO6 A;  1HHH A;  3E6F A;  1A1O A;  5HGD A;  3FOL A;  2CLR A;  3VXO A;  4HKJ A;  3HPJ A;  2FYY A;  2YEZ A;  1N3N A;  4L8D A;  3PWV A;  1LDP H;  5D2N A;  1LEG A;  2OL3 H;  3E2H A;  3JTS A;  1I1Y A;  1FO0 H;  2JCC A;  1A6Z A;  2WY3 A;  3DXA A;  4FFE X;  4NQC A;  2BVO A;  3B3I A;  3MGT A;  2D31 A;  1AO7 A;  3FQW A;  4U1H A;  1XR8 A;  1I7R A;  2X4T A;  3SDX A;  5D9S A;  1W0V A;  5ISZ A;  5JHD A;  3BZE A;  3MRO A;  3MV9 A;  4HS3 A;  3PWJ A;  4Y4H A;  3CDG A;  3H7B A;  2CIK A;  3ES6 A;  3ARB A;  1JGE A;  1AGD A;  3VJ6 A;  1BZ9 A;  3L9R A;  1UXW A;  1JPF A;  1M6O A;  2BCK A;  3WS3 A;  3VWK A;  1DE4 A;  3UTT A;  5C0G A;  4PGE A;  3MRK A;  3PWN A;  3P9L A;  1Q94 A; 
#chains in the Genus database with same CATH homology
 3BH9 A;  4ZUU A;  1DUY A;  2X70 A;  3JTT A;  1VAD A;  5C0A A;  4WWK C;  2VLK A;  2P5W A;  3P9M A;  1HHG A;  3FT2 A;  4D0C A;  3BUY A;  3KPR A;  1ED3 A;  3PWL A;  3GMP A;  5C0J A;  3MRB A;  4U1J A;  3O3A A;  4U1K A;  3GSX A;  4LCW A;  1T7Y A;  4ZUT A;  2C7U A;  3M1B A;  3S6C A;  4NQV A;  5FKP A;  4S0U C;  4F7P A;  1T7X A;  3U0P A;  3QEQ A;  3MRI A;  4F7E A;  1FFO A;  2GTW A;  3QFD A;  3BXN A;  1S9W A;  5ACZ A;  3GSQ A;  5C0B A;  4MNG A;  3VFO A;  1A9E A;  2FIK A;  3BGM A;  1FFN A;  1FZO A;  1HYR C;  2FWO A;  3KXF A;  5EOT A;  4GKN A;  3HLA A;  1I7T A;  1M05 A;  2YPL A;  2HJK A;  5DEF A;  4G59 A;  5SWZ A;  4PJC A;  3LKN A;  1JF1 A;  3WLB A;  5IEH A;  4G43 A;  5L2K A;  3HCV A;  5E8N A;  4O2F A;  1ZT4 A;  4PRE A;  3QDM A;  3T8X A;  2BNQ A;  4IRJ A;  4PJ9 A;  3ROL A;  3H9H A;  4JQV A;  5L2J A;  3P77 A;  4ZFZ A;  3ILQ C;  4PJI A;  4WW2 C;  3OV6 A;  4O2E A;  1EEZ A;  4D0D A;  3CZF A;  5E6I C;  1Z5L A;  2HJL A;  1T7Z A;  4LHU A;  4HUU A;  2NW3 A;  1K5N A;  1TVH A;  4PJG A;  3WL9 A;  3UBX A;  3RWG A;  3P4M A;  1OGA A;  3RWF A;  3HUJ A;  5BJT A;  4PGB A;  4LCY A;  3RWI A;  4WUU A;  1CD1 A;  3GJF A;  3GML A;  3BEV A;  3GSN H;  3OXS A;  3BVN A;  2F74 A;  1KTL A;  2ZOL A;  2XFX A;  1DDH A;  1X7Q A;  4NO3 A;  1AKJ A;  3DX8 A;  4I4W A;  4U1L A;  4G8G A;  3GMM A;  3X12 A;  3KWW A;  1T1W A;  4JRY A;  1LK2 A;  3ARG A;  3C8K A;  5IB5 A;  4PJD A;  1QQD A;  3X11 A;  2X4Q A;  2AXG A;  3MRM A;  1INQ A;  1S7X A;  5BS0 A;  1HHI A;  1K8D A;  3E3Q A;  1JGD A;  3I6K A;  5MER A;  4PJX A;  3RL2 A;  5BXF A;  3VFM A;  4U6Y A;  2BVQ A;  5H94 A;  1QLF A;  4K7F A;  3SKO A;  1TMC A;  3MRD A;  5HHO A;  3MRR A;  3BH8 A;  3GMQ A;  3FQN A;  3VXM A;  3ERY A;  2VLR A;  3RWD A;  2Q7Y A;  3RWH A;  3P4O A;  3PWU A;  1VGK A;  2PYE A;  1OSZ A;  3RWE A;  3VCL A;  3DMM A;  1LP9 A;  3KPO A;  3REW A;  3QQ4 A;  3MRC A;  4QRT A;  4QRR A;  3L3G A;  3QQ3 A;  3PQY A;  5HGB A;  1HHK A;  5EO0 A;  1I4F A;  2XPG A;  4NSK A;  1T1Y A;  1KCG C;  1MWA H;  3TO2 A;  1YDP A;  4PR5 A;  4JFE A;  3MRJ A;  1N2R A;  3UTS A;  3X13 A;  2A83 A;  4G42 A;  4LCC C;  1EEY A;  1LQV A;  3KYN A;  2GTZ A;  4PGC A;  1SYV A;  5C0C A;  1XZ0 A;  4PJE A;  2BNR A;  3QUZ A;  5FDW A;  3QDG A;  2F53 A;  1S7Q A;  5E9D A;  3SKM A;  1L8J A;  3SDD A;  5C0F A;  2GT9 A;  3I6L D;  1RJY A;  3M17 A;  1EXU A;  1S9X A;  3O8X A;  1AGF A;  4GUP A;  1KJ2 H;  3QUX A;  1AGB A;  4ZUS A;  5MEQ A;  4HUV A;  1QR1 A;  3BZF A;  2AV1 A;  5C9J A;  1N59 A;  3FQU A;  1BII A;  1LD9 A;  3LV3 A;  3O3E A;  3VXP A;  4U1M A;  5HGH A;  5DEG A;  4PJ7 A;  4UQ2 A;  3AU1 A;  1KJM A;  1HHJ A;  1G6R H;  2CKB H;  5IB3 A;  5MEP A;  4HWZ A;  1T7V A;  1KJ3 H;  4WJ5 A;  4XXC A;  1ZS8 A;  3B6S A;  1ZT7 A;  3ARF A;  2GAZ A;  3P4N A;  4NNX A;  5C08 A;  3CVH A;  5B38 A;  1RK1 A;  4QRU A;  4PP8 C;  3DX6 A;  3VWJ A;  4V3E B;  5EO1 A;  5IND A;  1JUF A;  5C09 A;  3V5K A;  1T80 A;  3RL1 A;  3WUW A;  5AD0 A;  1QRN A;  2BSR A;  4MJ5 A;  1T0M A;  4EI5 A;  4E0R A;  4EUP A;  5GSR A;  4X6D A;  5HGA A;  1S7U A;  3VFW A;  3TFK A;  5IB4 A;  4PRH A;  3FT3 A;  4N5E A;  1FG2 A;  4PG2 A;  4L4T A;  3LKR A;  1EFX A;  3FQT A;  3QZW A;  5MEN A;  3LKS A;  1B0G A;  3KPS A;  4Y4F A;  4PDC E;  4EN3 C;  4L8B A;  4U1N A;  1QEW A;  3NFN A;  1IM3 A;  1S7S A;  2X4R A;  3GMN A;  1B0R A;  4PG9 A;  2CLZ A;  1DUZ A;  4PJ8 A;  2X4O A;  4QRP A;  4L4V A;  2AV7 A;  3KYO A;  3MRH A;  3RWJ A;  2CII A;  4HUW A;  3L3J A;  3FOM A;  3TBW A;  4PV9 A;  1PQZ A;  3BEW A;  3GMO A;  3GSU A;  1E27 A;  5HHQ A;  3OXR A;  2HN7 A;  3VXN A;  3X14 A;  3V5H A;  3TBY A;  1G7Q A;  4MJ6 A;  1NEZ A;  5HHM A;  2AK4 A;  2X4N A;  4PGD A;  5C0E A;  3L3I A;  3PWP A;  1W0W A;  4LNR A;  5SWQ A;  4Z78 A;  3P73 A;  1XH3 A;  1T0N A;  4ZAK A;  5IRO A;  3RWC A;  4L8C A;  3FQR A;  4X6F A;  5ENW A;  2J8U A;  1KPV A;  3ECB A;  3LKP A;  3QDJ A;  2VAA A;  2GJ6 A;  1XR9 A;  1ZHN A;  2YPK A;  3L3K A;  4WO4 A;  3TID A;  1KPU A;  5FA4 A;  1VAC A;  4NNY A;  4MVB A;  1IM9 A;  5J6G A;  3MRE A;  3MRG A;  1AGC A;  5D7J C;  1ZAG A;  3VFN A;  4PRN A;  1ZT1 A;  2F54 A;  4U6X A;  2DYP A;  4N0U A;  4NQX A;  3D18 A;  1ZSD A;  3W0W A;  3RTQ A;  1JHT A;  2FZ3 A;  2AKR A;  4HUX A;  3ROO A;  1I7U A;  5EU3 A;  3TBS A;  3GSR A;  3ARD A;  1S8D A;  3QUL A;  1JPG A;  3BP4 A;  4Y16 A;  2RFX A;  3FQX A;  3VFP A;  5J1A A;  1CE6 A;  3SDC A;  1U58 A;  3VRJ A;  4IHO A;  3SPV A;  3IXA A;  1T1X A;  4PRA A;  4NO0 A;  1QSE A;  4ZUV A;  3MV8 A;  5EFI A;  3HG1 A;  4CW1 A;  3G08 A;  1P1Z A;  2MHA A;  4WDI A;  2HLA A;  5HHP A;  2V2X A;  4JFD A;  3KPM A;  1MHE A;  4NO5 A;  3BWA A;  3KPL A;  4HX1 A;  1AGE A;  3IT8 D;  5EU5 A;  1KBG H;  3KPQ A;  2X4S A;  4F7C A;  1ONQ A;  4JFP A;  4U1I A;  3LN4 A;  1FZM A;  5MEO A;  2VAB A;  3D3V A;  5J6H A;  3DTX A;  4Y2D A;  5IB2 A;  1BQH A;  4L3E A;  2BVP A;  3TBT A;  1JE6 A;  2VLJ A;  4UQ3 A;  5GSV A;  5IB1 A;  4JFQ A;  4PRD A;  5HHN A;  2E7L E;  4MNQ A;  1LEK A;  1T1Z A;  4WU7 A;  1GZQ A;  1R3H A;  3MRN A;  4G9F A;  4JFF A;  1NAM H;  1KJV A;  3KPN A;  5FA3 A;  5EU4 A;  3QUY A;  4IRS A;  1QSF A;  3VFS A;  3E6H A;  1GZP A;  3D25 A;  2ESV A;  4N0F A;  3KPP A;  4HV8 A;  3MRQ A;  3V5D A;  1HSA A;  4F7T A;  3SCM A;  4L8S C;  3SDA A;  1JFM A;  1B3J A;  1S7T A;  5F1I A;  3TIE A;  3VFT A;  4G9D A;  3GSO A;  3TBV A;  4Z76 A;  4PV8 A;  3MRP A;  4PJF A;  3VFV A;  4GKS A;  1ZHB A;  5IVX A;  4NO2 A;  1RJZ A;  1T22 A;  3BW9 A;  4NQD A;  3VH8 A;  5F9J A;  1WBY A;  4V3D B;  2BST A;  1WBZ A;  4L29 A;  4WU5 A;  4ZUW A;  4N0C A;  1N5A A;  1P7Q A;  2GUO A;  1A1N A;  1OGT A;  5D5M A;  3VXR A;  3DBX A;  3D39 A;  3TJH A;  2VE6 A;  2ZOK A;  4PRB A;  4X6E A;  3CPL A;  1FZJ A;  1BD2 A;  5E8O A;  3MGO A;  3VRI A;  3FT4 A;  4PRI A;  4JQX A;  3GMR A;  3O3D A;  3FON A;  1OF2 A;  1ZHK A;  3GSW A;  1I1F A;  3HE6 A;  4IIQ C;  5D2L A;  1S7W A;  3ARE A;  3I6G A;  5C07 A;  1YN7 A;  1W72 A;  3QFJ A;  4MS8 A;  4ONO A;  4QRQ A;  5C0I A;  2CLV A;  2UWE A;  1S7V A;  3JTC A;  4NHU E;  3TF7 A;  5IEK A;  2V2W A;  3RUG A;  4MQ7 A;  5EU6 A;  3OX8 A;  3PAB A;  1S9Y A;  3TVM A;  3JVG A;  2FO4 A;  3TO4 A;  5DDH A;  5SWS A;  3LKO A;  1C16 A;  2X4P A;  1RK0 A;  4K71 B;  3FTG A;  1YN6 A;  3TZV C;  4N8V A;  3BHB A;  3FFC A;  1WBX A;  5D7I A;  1TVB A;  4QOK A;  5E8P A;  4QRS A;  3VXS A;  3ILP A;  1FFP A;  1G7P A;  2BSS A;  3H9S A;  4L9L C;  2H6P A;  4Z77 A;  4E5X A;  1S7R A;  4X6C A;  1P4L A;  5E00 A;  3MYJ A;  5IM7 A;  4L3C A;  4D0B A;  4PJ5 A;  3UTQ A;  1MHC A;  2OI9 A;  3HAE A;  2H26 A;  1UXS A;  1HOC A;  4CVZ A;  3RZC A;  4U1S A;  3O4L A;  3MV7 A;  5C0D A;  3HE7 A;  3MR9 A;  4MJI A;  1FZK A;  1KPR A;  4JFO A;  4I48 A;  3MA7 A;  4FTV A;  4MX7 A;  4PJA A;  2GIT A;  4MXQ A;  1ZVS A;  1ZHL A;  1YPZ A;  3AM8 A;  2X4U A;  1I1A A;  3D2U A;  3O3B A;  2VLL A;  1E28 A;  4G8I A;  4NT6 A;  4PJH A;  1CG9 A;  3DX7 A;  1QO3 A;  3L3H A;  3LKQ A;  5D7L A;  3W39 A;  5B39 A;  3MRL A;  3QI9 A;  4O2C A;  1NAN H;  5BRZ A;  2ZSW A;  5HYJ A;  1A1M A;  5F1N A;  3RGV C;  5EUO A;  1SYS A;  3GSV A;  3VXU A;  2P5E A;  3QUK A;  5F7D A;  3CC5 A;  3CCH A;  1T7W A;  4JRX A;  1UQS A;  3TN0 A;  3TA3 A;  1A9B A;  3C9N A;  3KLA A;  4F7M A;  4NQE A;  3O9W A;  3T1F A;  1T20 A;  3BP7 A;  1T21 A;  4CVX A;  5INC A;  4Y4K A;  3LN5 A;  1QVO A;  3SJV A;  3VFU A;  3WS6 A;  3GIV A;  2AXF A;  1MI5 A;  4APQ A;  3TPU E;  2NX5 A;  2ZSV A;  3BO8 A;  3VFR A;  4PRP A;  3L3D A;  3CH1 A;  4PJB A;  3UPR A;  4ELM A;  1HSB A;  3FRU A;  3MRF A;  2PO6 A;  1HHH A;  3E6F A;  1A1O A;  5HGD A;  3FOL A;  2CLR A;  3VXO A;  4HKJ A;  3HPJ A;  2FYY A;  2YEZ A;  1N3N A;  4L8D A;  3PWV A;  1LDP H;  5D2N A;  1LEG A;  2OL3 H;  3E2H A;  3JTS A;  1I1Y A;  1FO0 H;  2JCC A;  1A6Z A;  2WY3 A;  3DXA A;  4FFE X;  4NQC A;  2BVO A;  3B3I A;  3MGT A;  2D31 A;  1AO7 A;  3FQW A;  4U1H A;  1XR8 A;  1I7R A;  2X4T A;  3SDX A;  5D9S A;  1W0V A;  5ISZ A;  5JHD A;  3BZE A;  3MRO A;  3MV9 A;  4HS3 A;  3PWJ A;  4Y4H A;  3CDG A;  3H7B A;  2CIK A;  3ES6 A;  3ARB A;  1JGE A;  1AGD A;  3VJ6 A;  1BZ9 A;  3L9R A;  1UXW A;  1JPF A;  1M6O A;  2BCK A;  3WS3 A;  3VWK A;  1DE4 A;  3UTT A;  5C0G A;  4PGE A;  3MRK A;  3PWN A;  3P9L A;  1Q94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...