3TQFA

Structure of the hpr(ser) kinase/phosphatase from coxiella burnetii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
165
structure length
165
Chain Sequence
KQTWHANFLVIDKMGVLITGEANIGKSELSLALIDRGHQLVCDDVIDLKQENNQLIGSCPSVANGYILITGIGIIDVPKLFGLDAVVNQHEVHLSISLVKPEKMPLLDDPLNPLYRTEIILGINVPKILFPIHPGRNLPLLIETLVRNHRLKMEGYDSSHHFHEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hpr(Ser) kinase
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase, hydrolase
total genus 36
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.7.1.-:
pdb deposition date 2011-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tqfA00
1N6LA 2WKQA 4KSBA 3VKWA 1N25A 1OPXA 2BKUA 1JI0A 1KYIA 1X3SA 4O25A 2HV8A 1IY2A 3ETLA 4A2QA 1XEFA 1SVSA 3B1YA 3B5JA 4V0OA 3VFDA 4DDTA 1EWQA 1VCMA 4KSCA 5J40A 1S0UA 2ZI5A 4ZCMA 2X2EA 4D0GA 2BMEA 3ADDA 2XOKA 2WSSA 2ZJAA 1DARA 1PUJA 2GWHA 2CDNA 3SBDA 1Z0IA 2X1VA 3SYKA 1DAKA 4DKXA 3P4YA 1R0WA 3VKHA 1Z5ZA 3SZRA 4GSYA 2EWWA 5CLLA 3BFXA 5GJBA 3EZ6A 4FCTA 3RABA 4TMTA 2QTVB 2BVNA 2V9PA 3SI7A 2IT1A 4HAYA 5J47A 4R71A 5TV2A 3RVBA 3C41J 3EW9A 3W5JA 2UVQA 1KMHA 1J7KA 4C2TA 1F6BA 1BYUA 5B30A 1N0UA 5L3SB 3T1VA 4I1UA 1UKVY 1Q21A 4DEYA 1DS6A 2ZM5A 2YINC 4ABYA 5GVRA 2ZU6A 4F4IA 3GLFA 2V7QD 2O8BB 1G9XA 3ZLJA 2F43B 2BKEA 2IUSA 3KDSE 2JLSA 1N6RA 1D5CA 2ZUCA 1GNRA 4LOAA 3OAAA 1IONA 1KIMA 1ZCBA 3Q5EA 3KQKA 4MYUA 2BMDA 4Q1FA 3AGQA 3SQXA 4NZYA 3SQWA 1ANKA 4NDZA 5AJXA 2OE2A 3PUVA 1KJZA 1MV5A 1XDBA 3IKJA 4LJ4A 4UQOA 4D2IA 5HKKD 4NHOA 5FUVA 3PV0A 5HZHA 1UEJA 2J1LA 2H18A 1KI3A 1Z2CA 4OK3A 3FMFA 4RD4A 4N0EA 4HB2A 2H57A 1NIPA 1UKEA 1GITA 4HAUA 5J4YA 1MO5A 1U0LA 2QP4A 4HLCA 1NMXA 3OEHA 2J45A 3QVVA 4F7WA 1E0JA 1VKJA 1FZQA 2J59A 3L43A 2J87A 1DEKA 4RZ3A 2EQBA 4OQFA 2G88A 4MYHA 1GL6A 1HQCA 1ZD1A 1NJFA 1HQYE 2AFHE 2PH1A 3A1TA 3K09A 4LC1A 2ZRIA 4TLBA 2HF8A 3AVXA 1X8KA 2IXEA 1NN3A 3LQQA 2P6RA 1S2MA 4DCUA 3CZPA 1IJFA 2FE4A 3EZ2A 1GFIA 4RFSA 3U7FB 1U0JA 3QG5A 2EFEB 5HCNA 3J81k 3A58B 4CEHA 4Y0AA 1CBUA 2F3TA 3LX8A 4B47A 3TVTA 3EPLA 4W7SA 3GJ5A 4KBFA 3FMIA 1SXJC 1IXRC 1QHSA 1BS1A 1TUEA 1NBMD 2VSXA 3GPLA 1R0YA 4BLPA 1GKIA 1GUAA 4H9GA 3HDTA 4TYWA 4URUR 4ZDIA 5KSYA 4L9WA 3BB1A 3P1JA 4RCZA 5B58C 3M0EA 1AS2A 1GP2A 3ZDQA 4IOLA 1JJ7A 3DO6A 1PLLA 2DYKA 2GVDC 3B1XA 3GEIA 4QM6A 2X8AA 4EQ6A 3CWZA 1C1YA 4A0FA 1JECA 5AK0A 5JWHA 1JBKA 2G9NA 3UG7A 2AXPA 3GLHA 2OLKA 4IDPA 4QG7A 1AS0A 4L8GA 3CPEA 4B3BA 4TTPA 3D7MA 1Z0DA 621PA 2OT3B 4RD6A 3UXMA 3NBYC 1OB2A 1W36B 2QT0A 3IIMA 1GNPA 1PVOA 3PEVA 5G3YA 2C96A 2O8DA 1P60A 3PUZA 2ZRCA 2WM9B 5EE5B 1MABB 1E2FA 3ZVRA 2GJ9A 3B78A 3DZDA 1TF7A 3QNUA 3QG1A 3EC1A 4I4LA 1JR3E 5EXXA 1CU1A 2ZE6A 3TUIC 4GFDA 2GVZC 3O8BA 4OI0A 3IIJA 3CH5A 1G3RA 1YJ5A 1T4GA 3HP1A 5IHPA 2ZUDA 5TB5A 1EFTA 2ZRMA 4Z8XA 2P3SA 3BERA 1GKYA 4DC9A 3U7GA 1TF5A 3K70C 3BXZA 5EUMA 1D2EA 2NO0A 2VF7A 3KJIA 1T8UA 1YR8A 4LBWA 1ZIPA 1AA9A 2P0EA 2OV2A 4M22A 1P73A 1NN1A 1NVVQ 5CK4A 3P26A 4W5JA 5BQ5A 4EAQA 4FCVA 5KNCA 5GADl 3SDZA 2OHFA 1Z6TA 2BJWA 1E2JA 1S1MA 2K5UA 4DDUA 4DLUA 5HCIA 3A8TA 4JKYA 2VP4A 3VX4A 1ETUA 4IVRA 4PFSA 4QJ3A 4DUGD 1C9KA 2EFHB 2GK7A 4BFSA 3BC1A 1UBCA 1E9RA 1YKSA 2PMDA 4PPGA 4RD2A 3PUWA 3QXCA 3RSOA 1KKLA 1DAMA 1H8HA 1KY2A 5JSZA 4DSOA 1T0JB 3G5UA 4F92B 4V0LA 4DLVA 2ZI7A 1SVKA 1T3SA 4M1SA 1W2HA 3KKMA 4XOIA 3WRYC 5CYPA 4C0SA 2VBCA 1QVAA 5AUQA 5FOUA 4I1VA 1GAJA 2PEZA 3PUYA 3T1QA 3QPUA 2CK3D 4NCIA 1YZTA 4XVUA 4OJKA 3THXA 4WZAE 3SHWA 3GLFE 2XGJA 3AF1A 1XEWX 1KI7A 2IS6A 3KFVA 3NXSA 4OHWA 2JDID 4KFRA 1Q44A 4JZKA 1EFRA 1EK0A 3GJ6A 4B35A 1GILA 4DLRA 1KK2A 4EDHA 1E0SA 3W8RA 2BJVA 3A1UA 1MR3F 3KXKA 3D31A 3BH0A 4TMWA 4Q7LA 1W4BA 3I32A 1NVUQ 2H16A 3V00A 4PPQA 1CF4A 4PQFA 1WDTA 3WYFA 1S8FA 2LKDA 4JSTA 2GBLC 2OILA 1LVGA 3CF0A 4M9SA 2FH5B 1IN7A 3FWYA 3GFTA 3U7HB 4AWXA 4YMSA 3PJRA 3AVYA 2ZYVX 2QBYA 4JLMA 5AUPB 4FMDB 2V4ZA 3P20A 2V6IA 2UKDA 2HDNB 2O0JA 2ZEJA 5K8IA 5SZJA 2A3RA 1E1QA 2QAGC 5DSZA 1WBBA 4TT3D 1A5TA 2CHQA 3QIAA 4XSHA 2ODEA 5M04A 2RGXA 2QSZA 4GOJA 1K8RA 2BM1A 1E9AA 2ZJOA 2JASA 3CIOA 1US8A 2A30A 5TMPA 2ZAOA 4URWR 1O3YA 2PCLA 5CB6A 3MLEA 3SR0A 2XSZD 5EP2A 1CR2A 1P2UA 4X8OA 2DWOA 2F1HA 4ZDWA 2V7QA 1SXJD 1EFHA 2FFQA 1ZM2A 3IPYA 3ZZ0A 4G01B 2ZXUA 4JLVA 5KTYA 1JQLB 4TLAA 1R8SA 1KMHB 1XJQA 5L3VA 3KXIA 4WIAA 1FUUA 2IX3A 1BH2A 2XB4A 1Z8FA 1KOFA 4L15A 1NKTA 3W5IA 1RKBA 5JHHB 2ZI9A 2CCKA 1IN8A 3GLFB 4JVMA 5JCZA 4RD1A 3T1OA 4C7OA 1NLFA 4AI6A 3GLHE 5JRZA 1IXSB 1FL9A 5DH9A 2GEUA 5BWMA 2ZRNA 2C77A 3TR5A 2YVUA 3WMEA 1DE0A 2ZYUX 3WP0A 3QUSA 4HYYA 5TY0A 4DCSA 3FMPB 4C0HA 4YQFA 3TLXA 3WY9A 2FZLA 2JCSA 5F98A 4TSFD 4IFEA 2FFBA 4BLQA 1OSNA 1ZM4A 3LY5A 2NG1A 2CHGA 4QM7A 2WJVA 4LJ8A 1YZLA 2GEDA 4D4KA 4PZLA 2Z6VA 5UKDA 3F8TA 1CLUA 4LWZA 3WBJA 2BCJQ 3R9XA 4EFMA 3EPJA 1OE0A 2ECKA 2IYYA 4BZPA 2BOVA 4BPBA 1NLZA 1OIWA 3K70D 3OIUA 4FIDA 2ODBA 4JIMA 4HLDA 1R10A 3VAAA 3TH5A 4CEJA 4RFSB 4UXJA 3EX7C 1SHKA 3NVAA 4CEHB 2IYLD 3ZVNA 2VHQA 4A9AA 1G7SA 4TL6A 4K81B 4DLYA 1WF3A 1ZU5A 5ANRB 1OFTA 4WOPA 5J4HA 5CM9C 1D9ZA 3LRPA 5BYJA 1KMQA 4KCGA 3IQWA 3Q9LA 1MOZA 3ADKA 3DOFA 5EP4A 1IOZA 3QE0A 5KU1A 2QTHA 4V0NA 2EFCB 3GJXC 1JXOA 3CNLA 3U3KA 3AVTA 2PLRA 3FMOB 1KZGB 2P2LA 5E7MA 5JEEA 4HSEA 5JLJA 2ODWA 1RVDA 4DIDA 3EIEA 4FN5A 4DLZA 3W8NA 4EQ6B 1LNZA 1SVLA 3TVDA 1G4UR 1RFLA 3SYNA 4WXPA 2G0TA 3CNNA 5JI3E 2YKGA 1FP6A 4C3ZA 1CJTC 1P3JA 2ZI3A 2V6JA 1J2JA 3GCGA 4QKQA 3LVRE 4W9MC 1E2HA 5IK2D 3IDQA 3SJAA 4C4PA 1U9IA 1W5TA 4JLOA 4BZXA 2CVFA 4HLUC 2MSEB 3AQ4A 1MKYA 1N5KA 1HE8B 2O8DB 2R6AA 4WZBE 3B2EA 3LLMA 4Q7KA 4DCTA 2J0SA 1SVMA 3KKPA 2ZRDA 1EFCA 3OEED 3QBVA 4KO8A 4TL8A 2QRZA 3NG1A 4EKDA 2ZYTX 3AP3A 4HZIA 1CR0A 4R7ZA 2GAAA 2DWPA 5EE9A 1W0JD 4G1UC 4OQNA 4URZR 1E9EA 2WJJA 2IHBA 2H92A 2OLJA 2XZPA 3OESA 3FHOA 1NVWQ 1CJVC 1R2QA 1J8MF 2FGJA 1YHNA 2LCFA 4QNRA 3I92A 3OFND 5TXGA 2J5XA 2J9RA 3CF6R 4DUGA 5FBLB 3GP8A 2QROA 1E9CA 1HY3A 1COWA 4URYR 4KXFB 1G3QA 1QHYA 5FH9A 3BWDD 2XJ4A 1RC8A 4LJYA 4Q4JA 2W2VA 1II8A 1CULC 3ZYCA 4L4UA 1YZGA 1PJRA 3RS4A 3FHTA 2ZTSA 5DHFA 4MGKR 2ORIA 4V0KA 5ELXA 4DIEA 2XNSA 4RCYA 2BBWA 2YHSA 2Z83A 4PAOA 1HV8A 1QHHA 2D3WA 1MH1A 2ZAMA 2ZJ8A 3AVUA 4Q00A 5P21A 2CCJA 1UBGA 3TE6A 4DZZA 3QXHA 3QXSA 3QSYA 1PLJA 2WKRA 3SN6A 2BHRA 3KQUA 4JBYA 2DWQA 2YOFA 2IWRA 4KI0A 1F5NA 1Z07A 3ZD7A 2PJRA 3Q5DA 5KDLA 4X8LA 5JSZB 1RRCA 4US2R 5DISB 1OKKD 1FMJA 3I72A 3HU2A 2JDIA 4HUQA 4MUBA 4NPHA 1FTSA 1VDZA 2JJ8A 4O2LA 2FFAA 4M1KA 1RRPA 1GZSA 2OM2A 4M1TA 721PA 2QM7A 2PL3A 3FKSA 4LV5B 1XPRA 4MRVA 1P72A 3RRMA 5CDFE 1JALA 1E1RD 5FBWB 4JLDA 2ZRPA 1HEIA 3NEJA 4V0MA 4CRWB 1VG1A 2GK6A 4ARZA 3THXB 1Q1BA 2P5SA 4QL3A 1UDWA 4IKEA 3TK1A 3T61A 3L2OB 1VCIA 2ZI6A 3ND8A 4ZCLA 4B3CA 3GLIA 4URXR 2R2AA 3P4XA 3VHXA 4F38A 2H8KA 2WZQA 1DOAA 1AJEA 1BYIA 1WMSA 3RS3A 2D4HA 1VG9B 2AX4A 1XB2A 3UMFA 1P7CA 4NTZA 3U60B 1TAGA 1QHNA 1E4YA 1KJYA 1VHLA 3Q3JB 3ZIAD 3HR7A 2YC4C 1SHZA 2YWGA 1G8GA 4WVFA 2HYIC 1P6XA 1EGAA 5CIWA 1QHGA 1X1RA 4CEIA 1RPZA 3OIWA 1E79D 5FPHA 2YWFA 1XCMA 4CT5A 4FMDF 5CJPA 4A2WA 2XSZA 4YXWD 5BW8A 3U3OA 5EP1A 2QBYB 1AS3A 3THYA 3LBNA 1G5RA 2OXRA 4ZKDA 2JJ1D 1Q3HA 3DKPA 3KFXA 5F9FA 5HE8A 1SXJA 2A78A 2WWFA 4F4JA 1TPZA 5FFMA 3LNCA 3UANA 4CYMA 1NBME 3QKUA 4A8JC 3IBGA 2ZVPX 5TVKA 1WE2A 4Q7MB 1Q1QA 5DE3A 4Q4LA 1US8B 1YRBA 2NPIA 1TMKA 1XTJA 1GSIA 2WKPA 3MMPA 3RS2A 1G7TA 3H2YA 3R20A 3GMTA 4TMKA 1ZW6A 5IF9A 4JBWA 2C5LA 2HLDD 5B64A 2C9YA 4Q02A 2OCPA 5DLQC 1AZSC 5FTMA 4EUNA 1Z6XA 1CR4A 2NO1A 2E87A 1C4OA 1SULA 3UATA 2JGNA 3KQNA 1M2OB 2FX3A 2QNRA 4RVCA 4PC1A 2GJSA 3ZVMA 5JWOA 2OCYC 5KOYA 2OAQ1 1ZBDA 3SNHA 4B74A 1KI1A 4Q1DA 1FNMA 5FPKA 1LY1A 1DAHA 2FPKA 2WPDA 4IDQA 2WIAA 2IXFA 2W58A 3BFVA 3A37A 3CR8A 3K0FA 4RD3A 5E7IA 1VHTA 3AUYA 4DCVA 1LS1A 1YQTA 2ZUBA 4UNPA 4NYIR 5K8LA 4Q9LA 3SE0A 3CONA 4AIIA 3E2IA 4BQSA 1LV7A 1Z06A 5DHAA 4C7OB 2Z0MA 2ATVA 4JL5A 2QGZA 3RRNA 3CH4B 3BH6A 1CXZA 3X1YA 3A36A 4QNMA 4DVGA 3RLFA 2RHMA 3CUEF 2EW1A 1EG7A 1K5GA 5EZ6B 1XMIA 2R44A 3MWYW 3VNVA 2WIBA 3KUDA 4B3XA 3IHLA 4RKEA 1XPUA 2BBSA 2O0HA 2ZSEA 1OXUA 3VNUA 2JLUA 1R4AA 1I2MA 2ZSFA 2O5VA 3MJHA 3PG5A 4M1OA 3I62A 3FOZA 1ZUNB 1XRJA 2GTPA 1N6OA 2WMNB 1OH7A 1NSTA 3FDIA 4BRWA 3PFIA 3CRMA 3K9HA 4ON9A 5DI9A 2ZROA 3UMSA 1WCV1 2Z5FA 3RDPA 1YU9A 4NL4H 2WICA 2VEDA 1DAEA 5DYGA 3A4LA 2ZE7A 1OT3A 2QU8A 4KHZA 1HT1E 1M1YE 4FWIB 4CEJB 2JA1A 3EZ7A 5FTLA 1AKEA 1VYVA 1G8FA 4MH0R 3AH8A 1K5DA 4B44A 1I2DA 5AJZA 1KDOA 5LB2A 1BMFD 2QP9X 1S1CA 1NSFA 3HWSA 1NF3A 2IYQA 4G5GA 3K8YA 1IXZA 2ZRBA 4W5WA 4YMWA 2G1JA 5IK2A 3T35A 3ASYA 5CLQA 1R0ZA 3CX7A 3SHFA 2QPAA 4FI3C 4PC6A 3I73A 1DELA 1XCPA 2GHIA 2VHUA 1SZPA 3OEEA 1P2VA 2QG6A 2ANBA 1AN0A 3ZZUA 4FD2A 2GJKA 1G16A 2WVJA 2W0MA 4UXIA 3WMFA 3TIFA 4V0ME 1WXQA 2N46A 2VP9A 3PCRB 1E2LA 1I4LD 3CX8A 4BFZA 3C5HA 3VR5A 2GBLA 1IN6A 3GJ4A 4KYIB 4RY2A 5KNBA 1FQKA 3OFNA 2ZR7A 3X1WA 3GLIE 2WWWA 5KSOA 3R8FA 5FOSA 3ZS9A 2P5TB 1Z63A 3LWNA 2ODNA 4LI0A 4BECA 1W4AA 2XZLA 1D9XA 4I99A 1GM5A 4K46A 4G3XA 2JLXA 3LD9A 4MUAA 5K8TA 4IXNA 3VHLB 1KO4A 5LD2B 1RJ9A 3VKGA 4DSNA 2QMHA 4ACAA 2V3CC 2KBEA 4JLJA 1XP8A 2GNOA 5TDHA 3U5ZB 1W36C 4ZCIA 1OFUX 3I1FA 1GRQA 3SS8A 1WBDA 1BIFA 3DKVA 3T12A 1IBRA 4US0R 1ZNZA 3KKOA 2WV9A 4KAXA 4CF7A 2FA9A 2W6JD 4Q4JB 1SXJE 1OKKA 1N6IA 1II8B 1P5ZB 1UADA 2KWIA 2W6ID 1G18A 1VIAA 1VCNA 4BRUA 2OBNA 4LBYA 2ZE5A 4Q7JB 2ZRLA 3GQBA 2XTZA 3W90A 1U8ZA 1QHHB 1E1RA 4LBVA 5J4VA 3ICEA 2DHRA 2Q9AA 3CRVA 3LFUA 5FTKA 3DHWC 1LS6A 2OESA 4NBSA 3U6KA 5DN6A 1TEXA 1CTQA 1ZJ6A 2KB0A 4IHQA 4RZUA 4Q9IA 4DBLC 3RNLA 5JEDA 1A7JA 1LF0A 4G5SA 3RWOA 4EFNA 4WZ6A 3QPWA 1R0XA 3R7WA 3FKQA 5H70A 3OE7D 4XTCS 5CJ2A 2GJ8A 4YMTA 4HUQB 2YYZA 5A0FA 4XD7A 4PQRA 5FL7A 2F3RA 3C5CA 4AURA 3SYLA 1OH5A 2MMCA 3UKDA 2QP3A 4LCBA 1GVNB 3MWKA 2W83A 3WNCA 1RRGA 3DM9B 2QT1A 3ZIAA 3TKLA 1N5IA 4MRNA 4BEBA 2OCBA 3MWLA 1ESNA 5G41A 2F9LA 2VA8A 4IEIA 4ARZB 1CS4C 1W47A 2NO7A 3TSWA 1CP2A 3KKNA 3F0TA 3DMNA 2ORVA 3VU9A 5KDOA 1GWNA 2ZRGA 3IO3A 2UZIR 2GF0A 3GLIB 2BIFA 5JI2E 4ITRC 1E2KA 1CRQA 4UNRA 1E0KA 3QKSA 1Q12A 3MFYA 1ZC4A 2V54A 1R5OA 1A4RA 2WWIA 4IJMA 1E4VA 1Z29A 3V4FA 1U2RA 3AVWA 4LJ6A 4AG6A 5D3QA 1W2GA 2W2XA 1TQ6A 2X2FA 1G3MA 5E3HA 4CEIB 3REGA 3WHLA 4B2LA 421PA 3ZQJA 3KKQA 3O8CA 2ANCA 2QMEA 1KSHA 2HLDA 4OK6A 3THYB 1AIPA 2ZETA 1P62B 3BK7A 5GJCA 1T5IA 1ZU4A 1SXJB 2VIIA 3B13B 1F2UA 3O8RA 1R5BA 2FWRA 4KBGA 3O8DA 2JLZA 4AK9A 4WXRA 4DB2A 2JEOA 1OIXA 3NIBA 2VP0A 4I1SA 4J0QA 4GZMA 3B9QA 1A2BA 3ONWA 4B43A 3CLVA 2WOOA 4HLQB 3GEHA 3HU3A 1E2PA 2CEAA 1SVOA 1KDTA 3UWOA 4ASUD 4DDWA 4WW0A 4JL8A 3WYGA 3VTKA 2GZDA 1E9FA 4CIDA 2LWIA 5F9HA 2RGNC 1RZ3A 2JLQA 2OO7A 1OHHD 4HLUA 3TQCA 2QPTA 5J4LA 1KZ7B 1G19A 2R6DA 3DZ8A 3K0FB 3TGPA 3B82A 1D8TA 1CJMA 1NKSA 1LB1B 4KLZA 2O8CA 3CW2A 4JLBA 2JJ2D 4OK5A 4JLNA 4OYHA 3X1XA 4YMUA 2RGBA 4LYAA 3SFVA 4JLAA 3DVLA 5KPJA 4LHYA 1DBSA 4MYTA 2SHKA 5BN5A 2R65A 3F5FA 3K0CC 5LBIA 4UNQA 2YC2C 4KODA 4QXAA 2LKCA 2CVHA 4B48A 4BFUA 2NO9A 3KJGA 4KU4A 4F93B 3THWA 2FEOA 2F6RA 2I1QA 3T5GA 2RGCA 1II0A 4EFLA 1R7RA 1HYQA 4US1R 4U00A 3AUXA 2RGAA 5AJWA 3SEAA 2ZJ5A 3A1WA 3A1VA 4NYIQ 4C0JA 1KY3A 4I81A 1XZQA 5EXTA 4DCNA 3NC1C 2DB3A 2FV8A 3KXLA 2PX3A 4HAXA 4PPNA 4ACBA 3KL4A 4TQ9A 4RZXA 2QENA 4B33A 5HZKA 4Q4HA 1FTNA 5L3QA 2D06A 1W36D 3EIHA 5TARA 1B0UA 1BMFA 1ZCAA 4CZ2A 3N2EA 3OIVA 2IYWA 4Q1AA 2I1VB 4H1VA 3WNBA 1DAGA 5JECA 3JZMA 3RS7A 4PC7A 4G5RA 4EJSA 4TZ6A 4AKHA 2VL7A 1OXVA 4LJ7A 4PTLA 4Z1MD 1VCOA 1T9HA 4WAUA 1JAIA 4E22A 3H0KA 2Z4SA 3CO5A 3BFKA 4PR0A 1KO8A 1YRAA 4FMCB 4D80A 5EE3A 1AK2A 3C15C 2MSCB 3SU8A 4U7DA 2GCPA 3LV8A 4IEEA 5CDFA 2CBZA 1RYFA 2UZ3A 1E69A 2VHTA 4BEJA 2ZI4A 3K9NA 5HKKA 3REFA 5BYKA 4LBZA 1NN5A 5JJLA 4ZIRA 4L5BA 4AKIA 2B21A 1Z2AA 3H86A 2WWHA 2GJAA 3L0IB 2X77A 2Z43A 3VX3A 1NNEA 2DFLA 3FTQA 2ZANA 3M6AA 3KJEA 4LDJA 4OL0A 3CPHA 4G5QA 2C2HA 4LZZA 3NEYA 4KVAA 1ONBA 1XD2A 3TJZA 4TYYA 1X86B 1QF9A 2ZSAA 3EWSA 1XWIA 5H1YA 1XEXA 3UIEA 4B2IA 1D2NA 5BXQC 2V1XA 4TLCA 3CPJB 4GP6A 3LH5A 2BMFA 2XNDD 1P2TA 3U3MA 1NN0A 2BC9A 3I4LA 1UAAA 2G77B 2W6IA 2IYZA 4Q4AA 4A8JA 4TLDA 5FOWA 1RJ9B 4MKFA 3QOFA 1NBMA 1NVXQ 3L8ZA 3EIQA 3NDPA 1WQ1R 4PHFA 2OFOA 3AF3A 2FFHA 2OXCA 5FI0B 1TQDA 4BFVA 1D2MA 3CRQA 2A7QA 4TYPA 1Q3TA 4A0GA 4BLSA 4R2HA 3MJRA 3ECCA 2O8EA 1ZC3A 2HT1A 5LPNA 4M1MA 5HPYB 1U99A 1E2GA 5FTNA 4NCKA 2WJGA 5L3RA 3RRZA 3BBPA 3NHBA 5CB8A 1R5NA 1XTKA 4TN1A 4Q18A 4HI0E 4CDGA 4RFVA 2EVWX 1A82A 4LPSA 3SJBA 2VTKA 4MGZR 1XU4A 1QBKC 4U02A 2KBFA 3O47A 5F3WB 1LW7A 2YOGA 3SJCA 4QOSA 2G1KA 4A2PA 3KQLA 4PQYA 1E2DA 4BLRA 2FF7A 1FMLA 2ZS7A 1NJGA 3QXXA 4Q9HA 1P75A 3HYRA 4XWOA 4ZI2A 3K0SA 1ELOA 2G3YA 1AQYA 4JLPA 2OEPA 4OQMA 5A4JA 4LUCA 5C2JB 1XXHA 3R7WB 4W5HA 1FQJA 3SJZA 3CB4A 1KK1A 1NI3A 3IEUA 2G83A 1G21E 5LDDC 1RE0A 3EPKA 3IBYA 2R9VA 4GRAA 1F3OA 3GLHB 1ZIOA 2A5GA 1TQ2A 3IIKA 5HTKA 1L4YA 4ZDKA 4QJ5A 4MDEA 1II9A 3K0AA 1ZD8A 5DYIA 3AKYA 3RRYA 4P4UA 3GJ3A 2DBYA 3DEFA 5FPTA 1OXSC 2Q21A 3B1ZA 5JCPA 2Q9BA 2PJZA 3QXJA 3VU9B 2XXAA 1GIAA 1CEEA 4DLSA 4NH0A 1DAIA 3QEJA 4PHGA 1AGPA 3IUYA 4BFYA 4FW9A 2IS2A 1MRSA 3NC0C 3JZAA 5E7JA 5FOVA 1UBFA 4IVPA 4C0KA 1KAGA 4GT1A 1T91A 4YMVA 1N6NA 3D6TB 4WBSA 1FW6A 3QKSB 2W00A 2WSMA 4XJXA 4KV9A 1R8QA 2FU5C 1ZINA 4D0LB 2RB4A 4IDHA 2AKAB 2IC5A 3K9GA 4QBHA 2F1IA 4FCWA 1YE8A 1UFQA 3BB4A 4U5XA 3U3JA 1QRAA 1E9SA 1KGDA 2FGKA 3U44A 3RWMB 3NBFA 3GLGE 4PSKA 3UK6A 3C14C 5FTJA 5JBQA 1ZUIA 3OZXA 1G8PA 3T1TA 2GXAA 4M53A 2XITA 4HAZA 3DPUA 3LW7A 3OAAD 1ZRHA 5FBRB 3AP1A 3BIFA 2GCOA 4Q19A 1JR6A 4LHWA 821PA 1KJWA 3QBTA 2WMOB 4ASUA 4NYJR 1L2TA 4P4TA 4YLGA 1F2UB 3B1WA 2AWOA 1HH4A 1L8QA 1JXMA 4C0LA 4QBGB 4XVQA 2YOHA 3W3AA 4PAQA 4C9BA 4Q03A 1AQUA 1OHHA 2A5JA 2CK3A 4GOXA 1NG1A 3BOSA 4R2IA 2J0QA 1E6CA 2BV3A 2C95A 2XAUA 4QGAA 3B7GA 4AG5A 2FSHA 5FPYA 221PA 1UF9A 5KYKA 1G64A 4EPRA 2IYVA 2ZVQX 1KSFX 4DLTA 2OFWA 2F1RA 2E9SA 3E5HA 3MGCA 4TMZA 5C46F 5C1BA 2BDTA 2EFGA 1XTSA 2JJ2A 1OIVA 2IA5A 3TR0A 4XWAA 2CXXA 4XWKA 4XIGS 3B8HA 1AZTA 3AM1A 1W49A 2ZRJA 4KFTA 4M2LA 1X8JA 5LB4A 1EWRA 3PEWA 4M0LA 3QEOA 3U3RA 1J99A 4QHSA 1LTQA 2I3BA 1Q57A 1ZD9A 3S1AA 1E99A 1UM8A 2GESA 3WHKA 4M1WA 4A4DA 2J46A 3KQHA 1X8LA 2A5FA 1EESA 4RJLA 1KO1A 1W1WA 4Q66C 1P61B 3U6BA 2REOA 2O8CB 1IY1A 4PX9A 2D2EA 1DADA 5E95A 1TL7C 4Q21A 4HZUA 2FJUA 1F2TA 2V1UA 2C03A 2ZU0C 1NP6A 1N0WA 2YZ2A 4TT3A 3RYTC 2NZJA 1XCGB 3AV0B 1NRJB 2AL7A 1Z28A 2GA8A 2GXUA 3NH9A 4RD0A 1KNXA 4MITA 1MO6A 3PVSA 2VRWA 3LW8A 3THWB 2KI5A 1NY6A 4IOKA 2IUUA 3X1DA 2B8TA 4Q1CA 1EFUA 3I8XA 4Q9KA 3WBKA 2BWJA 4DLXA 1QZXA 4Z1MA 3W9YA 4DWJA 1W7AA 2C99A 5G40A 4KYUA 2JIZD 3H4MA 4BUJA 3N5CA 1GRNA 1XMSA 2ZPTX 2XX3A 3AGPA 3DDCA 3LQRA 4Q4HB 1Y63A 2ZREA 3LBIA 4Q1EA 5EQTA 5L3QB 5H68A 3G0HA 1DVRA 2B92A 4B76A 4AY2A 3EASA 1FX0A 3PQCA 1OXTA 2PCJA 1S3GA 2CL6X 3PEUA 3L8YA 3TQFA 5H8WA 2QAJA 1UBEA 2TMKA 4OHVA 4S35A 4OI4A 4EJSB 1XF9A 4ZDJA 1ZM7A 2AR7A 1GNQA 3R9IA 1OH8A 2WJIA 4C30A 1U0HC 1FP7A 2BMJA 4E07A 2WWYA 3ZJYA 1G7RA 3TAUA 1AM4D 1CJKC 1I4TD 4FMCF 3AF4A 1W46A 3EC2A 1PZNA 1KKMA 3CR7A 4V03A 1KAOA 2VO1A 3LBHA 1KI4A 3C8UA 3K53A 4MGIR 3Q7QA 1BKDR 1E0AA 4B75A 2QUZA 1ZAKA 4I1OA 1VTKA 1YVDA 3BH7A 3CRRA 1XXHE 4LK2A 4GP7A 1BOFA 2R6CA 4TSFA 2J41A 3HPQA 4B3GA 4LGMA 1M6NA 4NE2A 3I3SR 5CITA 2ERXA 4G5OA 4ZKEA 2H5EA 3K9LA 3MUFA 3EG5A 3SBEA 2NO6A 2I4IA 2X19A 4MA4A 4YDHB 5B57C 2WTUA 2GAOA 4RKFA 3CWQA 5D3MA 4O2RA 2D74A 1XD2B 2OAP1 4IDNA 2HEIA 2VPPA 5IT5A 4HDQB 4IVQA 1YZKA 2XJ9A 1XEXB 3B6EA 1L4UA 4M9QA 4POAA 1T6NA 4X8MA 3ZVLA 1T5LA 4EPXA 1TUIA 3L0PA 1GKUB 4LV8B 4A6PA 4DRZA 3I5XA 4N1AA 4ERNA 2IYUA 3GFPA 1HURA 3TNFA 3V9PA 3TSOA 1UJ2A 2HXSA 1XJ0A 4C0QC 1G41A 2HJVA 4IXMA 2FMXA 2QEQA 4C0AC 3CM0A 4GMXA 1XX6A 4Q4AB 4A8JB 3DOEA 4E03A 3MRSA 3KTAA 3MWJA 2QRNA 2DY1A 4FXPA 4D81A 2IW3A 1U9IC 4DJTA 2FOLA 4KVGA 5FUXA 521PA 3QY0A 2IYTA 4UKDA 1G4AE 1EX7A 3NKVA 5EXPA 2O8EB 1G6HA 1EFRD 1N0VC 1OYWA 2JLRA 2C98A 2J7PD 4LYJA 4RSGA 1UPTA 1Q22A 3LAWA 4B73A 3TAHA 2RGNA 1EXMA 4A92A 1TU4A 3TRFA 3KB1A 1JJVA 4PHHA 4A0HA 3I5YA 5LD2C 2JLWA 4UXHA 3G82C 3M1IA 1QHIA 2KJQA 2DR3A 4BZQA 4HB4A 1G8YA 1KO7A 3NWJA 3RS5A 4N3NA 5FR2A 2PEYA 3UPUA 4QHTA 4A36A 2IEYA 4URVR 2IF0A 1TNDA 2JATA 3A1SA 3EZFA 3K0EA 3L82B 4HEJA 4QGHA 1NG9A 2D2FA 3PEYA 3SC3A 1XXHB 2DFTA 4QBFA 1E1QD 2FPMA 4TLEA 4MYCA 3L0OA 5DI3A 4ZI3A 1NIJA 5A5GA 1Z3IX 3AVVA 3FB4A 4DDVA 4Q5IA 2AD5A 5EJEA 1IJEA 3PITA 3Q7PA 1H8ED 3D3QA 2BBOA 1W0JA 4JJZA 1KHTA 1KI9A 3K0CA 5KPDA 3PXGA 3K0AB 5CIQA 2Q3HA 1KI6A 3OF5A 5FL3A 4OJQA 5DIFA 3VR1A 1ODFA 2H17A 2QGNA 5CK5A 2DPXA 2WOJA 2V55B 2RMKA 3U2QA 2VH5R 2XXAB 4Z8YA 4B2PA 2QTFA 4MKGA 3UWKA 3LXXA 2YJTD 4JKIA 4JLKA 1M8PA 1J8YF 1PUIA 2QAGA 1DG1G 1G3UA 2V8OA 1IHUA 4PPFA 5FR1A 2ZIAA 1G291 1QG4A 2CE7A 2CLSA 2FSIA 2IL1A 2H1LA 1ZYUA 2GZAA 2PBRA 4PANA 2P67A 2GDJA 5EXSA 3VR2A 4D6PA 3EARA 3CKLA 1G20E 3U44B 4PC3A 1XNJA 1E2QA 2XTNA 3Q8XB 3UMRA 4AD8A 2Z4RA 3AKCA 2FZ4A 4OQLA 1ZUHA 4ZV4A 2B7CA 3ICQB 1KK3A 1KNQA 1OXXK 1XMJA 3AVQA 1W4RA 3TSZA 3WNDA 1MT0A 6Q21A 2QZ4A 1SVWA 1Z0JA 2GCOB 2IHYA 2QQEA 2ZITA 4D4JA 1KSGA 3IILA 1S96A 1Y3AA 4K8OA 4UJ5A 2C8VA 3W34A 5HR5A 1E96A 4Q47A 1M7HA 3GD7A 4KFUA 4BFWA 1U94A 4LHVA 4DSUA 5IDVA 1KO5A 4TYNA 1XTQA 3A4MA 3N70A 4LSGA 2XB2A 1J70A 1E94E 1ZM3A 5JFGA 1MO4A 2REBA 4OQXA 2O0KA 4HUTA 2NQ2C 2IYSA 1CR1A 3C7KA 3ZH9B 4AYWA 3THOA 1VYUA 3AEZA 3RSLA 4JVSB 1Z22A 4QRHA 1FFHA 2RHDA 1TU3A 4HB3A 2VHCA 1S9HA 4UJ3A 1NMZA 4OHYA 1G5TA 3P27A 4BFTA 1OF1A 3QPVA 4CT4B 1OFHA 1ZM9A 1IN5A 5GJVC 4TMVA 2CLCX 1T0HB 2QPOA 2VP5A 4NYJQ 1OH6A 4GDFA 4JVNA 2GILA 1GOTA 2ZJBA 2GXQA 2C9CA 2MMGA 1KI2A 1ZMXA 5J5CA 5F2EA 1XFAA 4JVLA 2F9MA 4HAWA 3S1AB 4A6XA 3BJIC 2CJWA 3VR4A 4NYMR 1HTWA 1E79A 1OW3B 3ND9A 4X8HA 4YXWA 4M9XA 1ZNWA 3QKRA 4HZUB 2JJ1A 1F48A 1F2TB 2DFNA 4HAVA 4PC2A 1M7BA 2JIZA 1A2KC 3IGFA 2B8WA 1VIYA 2WWGA 3FE2A 2ZS9A 4PZYA 2CL0X 2AXNA 2ASEA 1B23P 3B1VA 4NCHA 2AHOA 2Y8EA 3MD0A 2CNWD 4NP6A 1W4CA 2WAYA 3X2SA 2VLIA 1YR9A 4DT1A 3PENA 4B71A 4XVRA 4D4LA 2HCJB 2CL7X 2J0UA 4WA7A 4HDOB 5JZVA 1DPFA 4MQBA 4QJ4A 4MRPA 5AJYA 4BE7B 3CNOA 3ZGXA 3ZS8A 2B6HA 3BAFA 5DO9A 4JYCA 3VMFA 5AR1A 5J4KA 4LHZA 1F60A 3U4QA 1PV4A 2EWVA 1VPLA 4BASA 1QHXA 1IAQA 3OHMA 4LPKA 2NOAA 5DGXA 2QE7D 1DG3A 1W0KD 1XBTA 1SVIA 1FX0B 3LDAA 4QGGA 4ZPXA 1X6VA 1GDDA 2XTMA 1SKQA 3LLUA 3RHFA 4BLTA 1WB9A 1GL7A 3CRW1 5AUNB 2FNAA 5BN4A 4GI7A 3AF0A 1JQJC 3W6PA 1TADA 4IW3B 4OBEA 3QF4A 2QM8A 4ZO4A 2HCBA 3AF2A 3AP2A 3HPRA 1E9BA 5GVSA 1NL3A 5SZKB 5KHOC 1N2CE 4A82A 3NTUA 2B7BA 2PX0A 2ZJYA 2R8RA 4C0BA 4NU0A 1S9DA 2PLFA 3HJNA 4M4SA 4Y0VA 1Q20A 1VECA 4TMXA 1FUKA 121PA 3RS0A 4QFMA 1COWD 3LO5A 5B2ZA 2FN4A 3VR6A 3U7EB 2D7CA 1P4SA 2IXGA 1KTVA 3LA6A 3R8CA 3PR1A 1Q1ZA 5AWFC 4MGYR 1N6PA 1YZNA 4GPTA 4V02A 1Z0FA 2KSQA 2OG2A 2F1JA 1KDPA 3GEEA 4EPYA 5D3MB 3GJ7A 5EE0A 4OHZA 4F91B 1XJCA 1W44A 2QQ0A 2BBTA 1XZPA 4GNKA 1T3LA 4G0NA 1E98A 2G0NA 1A1VA 1U81A 3FVQA 1JPNA 3C16C 4II7A 5C18A 5EP3A 3K70B 1N5LA 3GLGA 1OB5A 4CGZA 4PHTA 1KSJA 3WMGA 4FWTA 1BO6A 1OJLA 4PAMA 2J7PA 3B9PA 3FKSD 2VF8A 2R6GA 3RC3A 3KB2A 1Z08A 3F3YA 4QGFA 4EPTA 2D7DA 4EIWA 5KNDA 4P4SA 4BWYA 2WHXA 2WAXA 1CJUC 3KTAB 2ERYA 4XSGA 4LX0A 2J7KA 3QVUA 3T15A 2GXSA 4TYQA 3FGNA 1DAFA 2ZRAA 2FDCA 3JVVA 2EU8A 1CRPA 4B32A 3HU1A 2RGDA 2F55A 5JHGB 1RW4A 1S4QA 1UEIA 2IK8A 4LC0A 2C04A 5KDDA 4F4CA 2OBLA 1M7GA 4GL2A 1T3HA 1WRBA 3T5DA 2QL6A 2XZOA 1Z6GA 2EYUA 2R6FA 3BORA 5EZ5A 3TBKA 5KSZA 4AYTA 4LY6A 2EYQA 1HT2E 1U90A 2REXB 5JRJA 4C2UA 1H8EA 3IHWA 3U61B 1H65A 3FFBA 2IF2A 4DLWA 3BE4A 2O8FA 1UKZA 5FUYA 2GEVA 4LRWA 4N0DA 4DB4A 1QG2A 3ZD6A 1GTVA 3K09C 2NIPA 2A5DA 2HUPA 4ILEA 1RYHA 4OI2A 2A9KA 3LX5A 4NMMA 3AKDA 5FPSA 4EPVA 1P9NA 3E1SA 4ESVA 1IQPA 4TL9A 3ADCA 2AD1A 5DI3B 4QC2A 1E32A 2WBLC 2QORA 4AC9A 3EZ9A 4JMPA 3BD9A 2IS1A 5JS7A 4D4MA 4DHEA 2OFXA 4LJ5A 4MDFA 4NCNA 1NMYA 3CX6A 2VP2A 1KI6B 1JPJA 5FI1B 2PZFA 4PO1A 5GJWC 1P9WA 4E5UA 2Q3MA 5G53C 5G3ZA 2FSFA 2NZ8A 4MKHA 3KZ1E 2YWEA 4KJZA 1QVRA 3NHAA 4Q48A 1IY0A 1JAHA 3AB3A 5FBVB 1T8TA 2QAGB 2CHVA 2O52A 2W6JA 3RC8A 1VG0B 3ASZA 2IWHA 1Z6YA 3TW4A 4L16A 2WPDD 1XTIA 2P6UA 4Q1BA 3DMDA 3QJYA 1D6JA 4XTRA 4BFXA 2OBMA 3KJHA 1TQ4A 2FSGA 5IRCD 2QSYA 4CVNA 2VP6A 4O0MA 5BN3A 1NLYA 2CE2X 1G5PA 3TW8B 1YR6A 4NKRA 2MSDB 1E3MA 3NBZC 2VSOA 2HYDA 2W0SA 4JT4A 4BLOA 2IYXA 2GZHA 5K8UA 1Q0UA 4B6FA 1JR3D 1CIPA 3GJ0A 3OE7A 1HUQA 3C4JA 3VR3A 2IS4A 4RZ2A 4D25A 4OKSA 4P31A 1Z83A 4ESHA 2VHJA 3FPAA 1N6KA 4JS0A 1FOEB 3H1TA 4IFBA 2C78A 2QMOA 3TMKA 2ONKA 1YZQA 4HATA 1E2NA 2JAQA 1N6HA 4JL6A 4PO9A 1TF2A 2PT5A 4DEXA 2QN6A 2WJYA 2A2ZA 4FMBB 4A1FA 5KO2A 4B3FX 4LHXA 2ZSDA 4M9ZA 3QKTA 4S2EA 4JYBA 2CLDX 4LJAA 1RRFA 4PXAA 5KUTA 2VQSA 2BEKA 4LJ9A 1V5WA 5EUQB 4M8NE 2G6BA 1Q1EA 2RAPA 1S3SA 4E09A 4BGDA 2HF9A 2RGEA 1VG8A 4P0TA 4LV6A 2XOKD 2WSSD 2HJGA 5L3SA 4D26A 1SKYE 3Q85A 1KI8A 2JLVA 1AGRA 2ZRHA 3P32A 2OUKA 1OV4A 2CNWA 1YR7A 2YWHA 3RANA 2CJWB 3I61A 2O8BA 2F43A 4A15A 1GRRA 3QI2A 2RCNA 4L9SA 4KLNA 1CKEA 2PMKA 4IOMA 3DM5A 3A4NA 3QKRB 3OIYA 1SQ5A 2VYFA 3E70C 2F7SA 3B85A 1P9RA 2AK2A 4YC7A 1G7CA 1E9DA 1OLOA 1XMVA 4P3YA 4TL7A 2QE7A 1DO2A 1W0KA 4R9UC 2QA5A 3FFAA 4CW7A 1VMAA 2AK3A 5DNYB 2ZQ5A 4TTQA 4NONA 5L8VA 5FBQB 3IO5A 1W48A 2C9OA 5C4GB 1U8AA 3CBQA 1M34E 2RGGA 4DT1B 2AFIE 1WP9A 1ZVQA 4MRSA 2W2TA 3M4YA 2OSBA 2NMVA 3HR8A 4NCJA 2J0UB 3EAQA 4NYMQ 5FUWA 3EWAA 4OHXA 4TZ0A 1R6BX 4GBMA 4Z51A 4IOJA 3IQXA 3MAAC 3LVQE 4FINA 3U4QB 3BS4A 4B6EA 5JJKA 2OZEA 2OCAA 4M21A 1ESMA 1IN4A 2GKSA 3QQ5A 1V43A 4LYHA 2DCUA 1Z0AA 2CMKA 2H7VA 2GETA 1XD9A 2GF9A 1JEDA 3IEVA 4PO8A 4PSVA 3GJ8A 1XD8A 3CZQA 2KE5A 5HE9A 2NTYC 4HB0A 2ATXA 3QF4B 4AKEA 1O87A 3NBXX 1UDXA 2PT7A 2VSFA 3OEHD 4TTRA 2HXYA 3BB3A 2E1RA 1MRNA 1JNYA 3BRWD 5AUOB 3QF7A 3B60A 2ORWA 2BM0A 2Q0HA 2QMUA 3HYTA 2L0XA 4QBIA 4OI1A 2ZYWX 3AKEA 2N42A 1Z47A 2CCGA 2NPFA 3AVPA 2ZRFA 1SKYB 3V4RA 4KFSA 1E2MA 2P6NA 2ONJA 1HA3A 1XEWY 4B34A 1M74A 1P2SA 4EJSC 2A5YB 2WWXA 3QENA 1G8HA 3KX2A 1W5SA 1G6OA 2RKOA 2AN9A 1TTTA 3EXAA 2GCNA 4B3DA 1AKYA 4QHYA 1X1SA 1ZP6A 1L7VC 4Q01A 3ZZTA 1KK0A 1E2EA 3T34A 2ZJZA 3ADBA 5AJVB 5DN6D 5FOTA 5CYOA 3VQTA 2EFDB 1N5JA 2Q9CA 1GL9B 1NY5A 4TQAA 1MABA 1Z6AA 3EA5A 3MCAA 4YDSA 2FEMA 3Q72A 3GLGB 1NVVR 4LYFA 2ZE8A 1QDEA 4XD7D 5FL7D 3FYHA 3W6NA 5JWRA 3PUXA 4JJKA 3WXMA 1G3IA 3TUZC 2WJHA 3SFZA 2PZGA 1G17A 4TWZA 4P32A 1N3BA 1MO3A 1U8YA 1Z0KA 2JLYA 4AKGA 4P4SB 2ZS8A 3X1ZA 1I4DD 1LF5A 3I8SA 2AWNA 5CM8B 1TEVA 1FNNA 4O3MA 4PZZA 2J0VA 3N2IA 3DL0A 3PIRA 4PSAA 3SOPA 4D0NA 1OYYA 1K6MA 2QY9A 3RAPR 2NGRA 3H84A 4M1YA 2J3EA 3TUJC 5EE1A 2FPLA 3MG9A 4Q9JA 1YZUA 4IRUB 1ZNXA 1KDRA 2ZR9A 1XTRA 4UNSA 1DO0A 1JEEA 2BCGY 3UG6A 1RIFA 2IEZA 4XH9B 2ZRKA 3W6OA 3A6PC 2FG5A 5C4MA 2Q6TA 3JVUA 4UNNA 1UKYA 1TX4B 2O8FB 2BEJA 1JB1A 2R62A 2ZJ2A 4Z54A 2AKYA 1GG2A 3GFOA 4GOKA 5E4FA 4GMDA 1LFDB 5KSPA 3WYAA 4JT2A 4ZIRB 4MRRA 3BGWA 4KITB 3AVOA 4TQUS 5JS8A 2XNDA 1WA5A 4IDOA 3L0SA 2P65A 3MSXA 4MKIA 4AYXA 1VYTA 1J90A 2PZEA 3NH6A 3W3ZB 4R98A 3CF2A 1EX6A 1OFIA 4JBXA 4D82A 2N1BA 5JMTA 2IUTA 4GZLA 3D8BA 3T06B 2IYRA 1SGWA 1H8HD 1FPMA 4JSYA 2QI9C 5SZHB 3FHCB 2ZR0A 8OHMA 1ZNYA 4HDCA 1U98A 4H1UA 3K1JA 3LXRA 3WP1B 3WRXC 3R9WA 5JJIA 3KUCA 1DTSA 3EPHA 1JR3A 2YV5A 4P33A 2IBMA 3EA0A 2HT6A 2YNMA 2RH5A 4A0RA 1IM2A 2ZSBA 3IPXA 4DSTA 4DXAA 4EPWA 1PLKA 3NDBB 2DFKB 1XPOA 1E2IA 5FOXA 2GRJA 1G1MA 1HE1C 2XEXA 5SZIA 3ZQ6A 2Q3FA 4YONB 2D62A
chains in the Genus database with same CATH superfamily
3JYHA 1QE3A 2WKQA 1V1MA 2X6QA 1XI2A 2E3JA 2QTNA 3A0RB 3QPDA 2HB6A 5G4KB 1N25A 4BKRA 4BXOA 2BKUA 1KYIA 1X3SA 4X1IA 1Q0TA 3GRFA 1YACA 2X8WA 2CNNA 3CEAA 3VSEA 4A2QA 1WR8A 2QN1A 3Q98A 4Z9FA 1T0UA 2P8SA 4F4HA 5EKUA 4DR5B 3P2JA 4X62B 4JXKA 2XUKA 1CQPA 1N8SA 4M8LA 4YROA 1Y9EA 1S0UA 2ZI5A 5AKLA 3BE6A 1JH8A 1CJSA 2XXJA 3JATA 3SIPA 1RVV1 2WSSA 3DUWA 3GYGA 4J1TA 1XZCA 3PJDA 5E1BA 3EUEA 5KS2A 4YCLA 2CDNA 4L72A 5F2NA 1DU4A 3U1TA 1EVYA 1DAKA 3GGPA 1G9TA 1R0WA 4HC4A 3SEQA 4ZT5A 3SZRA 4PY2A 2CNLA 4C43A 3DZKA 1T9ZA 1XMXA 2ZLBA 4U7GA 3SYTA 1B74A 5EFOA 5IX8A 4K9OA 2INGX 4TUYA 3EF1A 2BLLA 4TMTA 1GJRA 2V9PA 4TYMA 3UGQA 2GBIA 2ZB8A 2BR3A 3PNVA 3SI7A 1LSOA 1EVLA 3C41J 3PQ8A 2TYSB 1JX6A 4ZD6A 2OB2A 4R2JA 4EG0A 5KOJA 3AEUA 2AG0A 4IWXA 1JNXX 1LVHA 1BYUA 5B7QA 4F9TA 2XZTA 3NAQA 4EB3A 5B4UA 5CB4B 4V1CI 3G2OA 4G41A 5A5EA 2H6EA 3D8SA 1NR5A 4KAAA 1MAVA 1Q21A 2PA0A 2X9GA 2ZB4A 4Q15A 2ZWVA 3BBLA 3R3SA 4WZAA 4BNFA 4AP6A 3GLSA 3JTMA 2WFLB 3WFIA 5MFPA 2BYTA 1MQ9A 2HMWA 2NXWA 3ELYA 4ABYA 4C4AA 1OC4A 1UH5A 2ONCA 2V7QD 5FLKA 3ZLJA 2O8BB 1KMNA 1DRVA 2A35A 3EOBI 4FN4A 4LOAA 2XQFA 1B2LA 1KIMA 5JQGF 1MJGA 1IEXA 1DKPA 2MYUA 3ROTA 3AGQA 4KQFA 5CYFA 5ILQA 3SQXA 5KYUA 5I4IA 2R79A 4K0KB 5AP9A 1NPDA 5AICA 5K1ZA 1K2WA 1Y8AA 1Y6GA 5AJXA 4CI0B 4ZI5A 1X87A 4HNRA 1ZDMA 3KSMA 4NHOA 3AO0B 1DIRA 1PEYA 1MIOB 1UEJA 4KREA 2DTDA 1HRDA 3DYBA 1DQRA 1V9LA 4PLTA 4RD4A 4XB1A 2JIQA 5IXYA 1NIPA 2C54A 3WWZA 1YDHA 3LCCA 3BJMA 2TMGA 4BP9A 1FRZA 3WWDA 3OEHA 3IFSA 2J45A 1E0JA 3SG0A 2ZG6A 1X38A 2BFBB 3D2AA 2SCUA 2QY6A 2J87A 3BRWA 1Z7EA 2Z95A 4YQEA 1Y7TA 2EQBA 4OQFA 1ILWA 4TKZA 2O6HA 1GL6A 1SUPA 3IB3A 1W5BA 2AFHE 2PH1A 3IEKA 3QVTA 5AM3A 3C6YA 2HF8A 3DLPX 1X8KA 1VIVA 1NN3A 3KYDB 4J43A 2PGAA 2B36A 1Y9DA 3CZPA 4MP8A 1IJFA 2NM0A 5FULA 2FE4A 1GPMA 1Z15A 3NYQA 3JRNA 1P4JA 3I23A 2YUTA 4GX0A 3O92A 5ULLA 1RQLA 1I6KA 4RFSA 1U0JA 4R8SA 3QG5A 2EFEB 5BR7A 4BB0A 1J9ZA 2C29D 2CDBA 4UE2A 3SXPA 5KYXB 4YPVA 1Q15A 3LX8A 1UBHS 3V4ZA 2X5OA 2XKAA 2PBZA 1X39A 4W7SA 4F86A 1SXJC 4J6EA 4NZPA 2C1ZA 1PTKA 1YOVB 2IUFA 5CW1A 3GPLA 4FBMA 1R0YA 1UBUS 4Y2UA 1GUAA 3ZEIA 4BLPA 5LLDA 1E62A 5DM60 2JCVA 2JK1A 1B14A 1F0YA 1NVTA 2QRMA 4YJDA 5AK6A 4BTLA 2P2CA 1JLHA 4B6QA 2W6CX 5U1PA 3P1JA 5B58C 1U8FO 2FSUA 3M0EA 4K6OA 4C4OA 2PXHA 3HC7A 2HSEA 1NHWA 4EB8A 4IOLA 2YHUA 1GHTA 4H4DA 2HU8A 1QQTA 3EGOA 3GFRA 1PLLA 1QB8A 4L8YA 1ZS9A 4NOLA 4C88A 5KQRA 3B1XA 4BO1A 1BC5A 4PYQA 3UW1A 1EE9A 1C1YA 3L06A 2K7ZA 5A3SA 1JECA 5BP7A 1YMQA 2P40A 1NYQA 2AXPA 2E4ZA 1AS0A 4QYIA 1Q0QA 2AYYA 2QRLA 1OFVA 3CPEA 2XNCA 4TTPA 1U9CA 3VJMA 2CB9A 2FKNA 4CG2A 3W5CA 4RD6A 2XE4A 3WDLA 4UTXA 1W36B 2QT0A 3IIMA 1GNPA 3ZHXA 4J1QA 3VYUB 1WTCA 1PVOA 3PEVA 5CH5A 1BFKA 2XA1A 3C1OA 2C96A 3GJQA 1K68A 1WMFA 2RHLA 3D81A 1RHUA 3O3MB 1J07A 1MABB 4PZUA 4L0QA 1E2FA 2JAHA 3RU3A 4Z49A 4EJ2A 3VC7A 2ODTX 3NWBA 3B78A 4IDCA 4YUXA 5E6RA 4G5FA 2JRLA 3DZDA 3MINB 3QNUA 5AI5A 1R9GA 2O2CA 4IO0A 1URPA 1CU1A 1E5XA 2ZE6A 2W11A 5G0TA 2OM6A 1YULA 3EEQA 3NC4A 2PD3A 2R60A 1KYVA 4O2AB 3X1JA 1GUDA 1REQB 1R4NB 1ZAYA 2BH9A 5AXDA 3UJDA 3HP1A 3RSCA 5IHPA 2VWQA 4NBVA 4GR9A 4EYQA 3IMGA 1R3DA 5ALGA 1KRHA 3SMQA 3WB1A 3WVNA 2E4AA 5HIJA 2Z4TA 3O83A 4Z8XA 3L6DA 3F6PA 3U7GA 4Y6RA 1ULZA 2X5KO 2X8LA 3IELA 1XQYA 2D0OB 1PT6A 1O89A 3A9VA 3BXZA 2VF7A 4KXUA 1A71A 1W85B 3GRAA 3ZDZB 4DCPA 1AA9A 2OV2A 3H5LA 4E2WA 1AKNA 1P73A 1QIKA 2NVBA 4NQRA 2FPGB 5CK4A 5AVJA 1L8XA 4PGAA 5BQ5A 3HS3A 5KQMA 1JXAA 5I48A 3HCPA 3CRZA 3M83A 5LQSA 4MPPA 1S1MA 1KA9H 1Z6QA 2GPYA 5HCIA 4YIHA 4R81A 3TM4A 4DLLA 3OD5A 3GA0A 2ACWA 1N2EA 4ZYVA 1ISIA 4INZA 4DL9A 1HF3A 2GK7A 4GECA 4PRLA 3LT4A 4O2BA 1O08A 2H4YA 1MAAA 4JYZA 2C57A 3RSOA 2V7PA 3DMTC 4TOIA 4BBJA 3QXCA 3HYLA 4LISA 2O4CA 4EF6A 4R4JA 1KZ4A 4F92B 1NKVA 4MW2A 1AKWA 3E84A 3SQDA 1Z2NX 2F9FA 2ZI7A 3GJSA 4I55A 2G80A 4MVJM 4WKCA 5H83A 5H9WA 4XOIA 4ZVKA 3FMVA 3CJRA 1Z7GA 2VBCA 3AUUA 3OTWA 2PEZA 4IJKA 3RBZA 3WLJA 3MMNA 4PX3A 4C5CA 2AI1A 2WUEA 1OU4A 1EB9A 4TWIA 1MZPA 3M4ZA 2Y71A 5EN4A 2GYYA 4WZAE 1P5FA 4OAOA 5HUHA 1XZBA 1BRMA 2RH4A 3DQZA 3GNSA 4PNHA 5B6IA 1UPUA 1ZD3A 3AF1A 4IIDA 2EP5A 3EIXA 1KI7A 5ALRA 3WIDA 1YU6A 2XXBA 3NXSA 2IS6A 4OHWA 1U0GA 3O4HA 3GJ6A 4DLRA 1UUFA 4WD3A 3EDYA 3CNEA 1PL6A 4KQWA 1MR3F 1YFLA 4F8JA 2X3UA 2GRAA 2IY7A 5I4BA 1Y3HA 2IBSA 1A76A 1GPH1 2W6PA 4J07A 4Q7LA 4WERA 2FUG1 2V0CA 4UM8B 3RUCA 2IOHA 3R0XA 1XQ9A 3I32A 1YJBA 2VAMA 3DEKA 1VSVA 4INAA 3T5TA 4PQFA 4UPEA 1S8FA 3BD6A 3Q88A 4NNOA 2NPOA 1SCDA 3JARA 3UOAB 2EOAA 1EK2A 4ONEA 1SK9A 1UANA 2AVNA 4YMSA 1XA4A 4O0LA 2QBYA 4FMDB 5C5DA 2PT9A 1KU0A 1NQXA 1M2KA 2V6IA 3RVQA 2UKDA 3ZC3A 4F6CA 1E1QA 1EXNA 3SQNA 1NR7A 4H2DA 2CHQA 2W8BA 2XY4A 5M04A 2FUG6 2PDAA 1ECPA 3K35A 3LXMA 3GLQA 2BM1A 2ZSIA 2AF3C 4MV6A 4CLDA 2YCBA 2IVZA 5K3CA 2ZJOA 4X9XA 2Y1WA 4MR9B 4ZOEA 3VVMA 5M2QA 4MMXB 2F3PA 3GOHA 4URWR 2D0IA 1IG0A 7MHTA 3OZTA 1UOOA 3DKKA 2XSZD 3KQVA 1CR2A 2PX4A 3UJ7A 2J3MA 1ND6A 3G0OA 3CNBA 3IA7A 1B43A 1ODKA 1OYVA 4KE7A 2WUWE 1H2WA 4NOJA 1SXJD 2PM8A 3LL4A 5JBNA 1EFHA 2Z2JA 2YIMA 2FFQA 3NEPX 4MTLA 1T6BY 4X7BA 4G01B 2WDPA 4CMJA 1Z17A 1ZD5A 4M8KA 5KTYA 1JQLB 2IHKA 3N6XA 4J1NA 1U5BB 1XJQA 4JYAB 1U7DA 1TLTA 4P36A 5CB4F 1G98A 1SKBA 1XTUA 2BFCB 1GNTA 1BX3A 3ELBA 4ND3A 2IX3A 2J30A 5M7EA 4P58A 3ZTYA 3TD6A 5DZSA 1Z8FA 2YH2A 5B53A 1NASA 4TS1A 4V3BA 1DWQA 5CBPB 2BLNA 2G5CA 2OLEA 3CX4A 3PL1A 5I45A 3AJEA 3UJPA 3CINA 4AJLA 4JVMA 2QUHA 3NFRA 3UMJA 3K5HA 4B7AA 1QRDA 4G5YA 3L6RA 2NXJA 3DFKA 4RKYA 1XRSB 1R74A 4ZC1A 2YUIA 1IXSB 2TECE 4LSWA 3N0RA 2HAEA 2ASVA 4RHTA 5J63A 3IBTA 1T8SA 1V26A 4LOIA 4DSAA 1UPXA 4GKAA 4ZVQA 4MKRA 2LVBA 3NTVA 3QU5A 5DDIP 4ZVNA 3OZGA 3WMEA 2OBYA 2ZYUX 3ASVA 5KWEA 1QS0B 4KR0A 1L4LA 3ZWAA 3ZCUA 3A2LA 3DLIA 4CTMA 2HJSA 2R11A 4H35A 2B4YA 2DPGA 3G17A 5AVUA 5INTA 4HADA 1U3CA 2HLHA 4C0HA 2CXUA 2FOXA 2RI6A 2VJOA 2BI4A 2FFBA 3KXDA 3UJ6A 1DC3A 4BLQA 3LY5A 2R8ZA 2NG1A 4XARA 3W5VA 1YQEA 1WCIA 2CD7A 4NS4A 4QXRA 3P5BA 4NECA 4CKEB 1YZLA 5KYYB 2LRHA 1K0FA 1MLDA 1CERA 1IULA 4B6OA 3FYUC 4YRRA 4KR7A 5ECGC 3R9XA 2I9PA 3V48A 2ECKA 1I51A 2FK7A 2IYYA 3TQQA 3VR0A 1UAYA 5DX1A 1FS6A 3N8IA 1ULBA 4OQQA 1L7MA 1ZBQA 4I6JA 1RYNA 4O63O 5JNLA 4NHEA 1NLZA 1MW9X 4A0QA 2M6LA 3DLBA 2ZB2A 4FIDA 4LZJA 2Y1CA 4H16A 2I1LA 2J6BA 3CLKA 3NHJA 4JIGA 4KUEA 1Y89A 2O07A 4W9NA 4XVHA 2BFEB 4HLDA 2ECQA 2BZ1A 2P6MA 2OYSA 4UXJA 4RVGA 3UMCA 1M2EA 1OT5A 2IYLD 3NVAA 4NG4A 4CDRA 2OCIA 3IYLW 4LXGA 1VLQA 2BKAA 4HAOA 4A9AA 1G7SA 5JO0A 2PMCA 2BF4A 2G8NA 1Y4AE 1ZU5A 4MXDA 5ANRB 1V6AA 3VPDA 1OFTA 4DC1A 1WOYA 3BREA 2DH6A 3F3KA 1N3LA 5G0WA 1NUSA 2QN2A 4BBPA 5J4HA 3HKCB 3OUUA 3ZHZA 1FVXA 5LJLA 1RYBA 2A9FA 1AGXA 3WJ1A 2GEFA 3Q9LA 3DOFA 2X4GA 1FFXB 1UOEA 2XB8A 1JXOA 3U3KA 1BS2A 4US1R 3I0NA 3AVTA 3FMOB 1B8OA 2R5NA 2P2LA 5JEEA 2VRCA 3WLQA 4CGYA 5EC8A 1T34A 2ODWA 4LRSB 5C5CA 3EIEA 4FN5A 5JLJA 4E7OA 1OV6A 3TVDA 1G4UR 3SYNA 3IAAA 3MA0A 4BRSA 2VHYA 3E0XA 3I6YA 3A06A 5CLJA 5JI3E 2CMDA 2NU7A 2YRXA 4C3ZA 4EEXA 5K6AC 2ZI3A 2RHOA 3U7IA 5ALUA 2XCUA 3S68A 5C1PA 4ZT6A 1SVNA 4QKQA 4QYWA 1KMCA 5ALNA 4QEKA 5IK2D 2FMFA 3IDQA 4YGXB 1W5TA 3P2IA 3T0IA 2CUKA 1OBOA 2MSEB 2IX9A 1YDGA 1MKYA 1N5KA 2QRKA 4ZODA 4KAJA 3B2EA 3LDGA 1X80A 3KKPA 4B6JA 1U6KA 4R5HA 3EH1A 2P9CA 5J43A 3QBVA 4TL8A 3ROKA 5CVUA 1I7QB 2ZYTX 3ZI7A 3VYWA 3ZG6A 4CMIB 2GZ1A 4QFBA 4LWQA 4G56A 4XGRA 1KC1A 1P0PA 3IUMA 4MS1B 3I6IA 3KZMA 4D9NA 1SZJG 5K2MA 1QK5A 1ZXLA 3DL7A 3GT7A 2YVLA 4MP3A 2I2BA 5KNBD 2V45A 1NVWQ 1R2QA 2HZ7A 1RP1A 2RHTA 4QNRA 4ENQA 1LCIA 1MOSA 3U4HA 3K8OE 4X41A 4TKVB 4YV7A 1F2DA 2QROA 2Q1YA 1COWA 2RG7A 2WMDA 5JS1A 2H51A 4RACA 1EXDA 2E4YA 4FU0A 1RKQA 1HG0A 5H82A 1II8A 2WVHA 3G1TA 2XVXA 2GS9A 3OOEA 5B6PA 1YZGA 1TVKA 3FLEA 3PRHA 4QOFA 3RV3A 1DJPA 2QS9A 3Q87B 4MGHA 2OP1A 1LSJA 4AFNA 3MXTA 4JB0A 4AZSA 4RCYA 4DIEA 4X0EA 4DQKA 5K45A 5G4LA 2XODA 4F5ZA 3W8EA 1MH1A 2ZAMA 4BNLA 2KM1A 4Q00A 3N07A 2XQGA 3O8QA 5JNVA 1U11A 3TE6A 3QXHA 2HRBA 4GC9A 4JJAA 4RZQA 4YWHA 4MGEA 3QXSA 1CRLA 5GZ3A 4HQLA 4H3SA 1FYEA 2QW8A 2I4RA 2AH5A 1WNTA 2XBLA 1YNSA 1I6WA 1RI4A 3A26A 4UCXA 4YS6A 5JU6A 3DWFA 1LGYA 3Q5DA 5JSZB 2R8OA 4UPDA 2E55A 3V4OA 4CM1A 3T3MB 4YBRA 1FTSA 1VDZA 5KC9A 2Q5OA 3ZDXB 5CNMA 4P38A 2FFAA 3ZX4A 2OM2A 1GZSA 3DE4X 4UEJA 4Z7NB 2PZ8A 4AP5A 5DNYB 4F9FA 3ZJTA 5FNVB 2ABWA 3DMGA 3ZDRA 1Q0SA 3CF4A 3RRMA 2HY7A 2GZ3A 1YH3A 5FBWB 4JLDA 3HLKA 3NEJA 1UK9A 3G2NA 1FRNA 4CRWB 4ARZA 1CVRA 9MHTA 3M4JA 4D56A 5K0LA 1J1IA 2IP4A 4IGAA 2HQOA 4QL3A 2VJQA 2RKWA 2VC2B 4IKEA 4K87A 4R1OA 1SH7A 1XGKA 3L0CA 4K6GA 3SF8B 1XVVA 2HRZA 2W5UA 3OTQA 4B3CA 3WGIA 5DMHA 3RS3A 1AO3A 2GKGA 2AX4A 3PGMA 4FR0A 5K20A 2WT4A 3Q10A 4NDNE 3UMFA 3W8DA 2V6BA 1RD4A 2CUNA 2XA9A 3G2PA 3ZGVA 3M9XA 3QY9A 5BV8A 4MI1A 2CYBA 5EWLB 1WXEA 1QHNA 3PUJA 2OENG 2OAGA 1A97A 4OQLA 4PHCA 4EM6A 4KUHA 3TNJA 4WLNA 3TIGA 4ZEWA 4OB7A 2I2DA 3E7PA 2PGOA 3LGAA 2E5WA 3OETA 2Q5CA 4IIVA 4NZZA 1EGAA 4WESB 3BPSA 2XMRA 3DW3X 3OPXA 2BEWA 5CIWA 2R7LA 3VR4D 4BCCA 2H3HA 2WHPA 4GMGA 4PBSA 1KTIA 2YWFA 1E1NA 4FMDF 4IJUA 4WFIA 2JBAA 3U3OA 5M5BA 5EP1A 4C7JA 1RYZA 1AS3A 4PYNA 5G02A 3LBNA 3LT2A 1IVSA 5F9FA 4C5AA 4DMLA 1C1DA 4G67A 3RYFA 1W34A 1K6EA 1B8UA 1PGQA 3VO8A 1NBME 2Z56A 3EF3A 2QZPA 3NI2A 1R0LA 2I4OA 3SZLA 4N49A 1RI5A 3C74A 2QWXA 4AN0A 4WOJA 1US8B 3C3MA 4AZ0A 2SECE 2O5CA 3HB1A 4TV8B 1XALA 2VUHB 3EXG2 3WK4A 1AHPA 1TMKA 1GSIA 2WKPA 3ZZ1A 5BMVA 4V3CA 2Z5GA 1G7TA 1XNHA 3R20A 5JY6A 5KKNB 3V7UA 1ZW6A 4QTTB 4GKKB 4JBWA 1M2WA 3FF1A 5ALJA 5FTMA 1JHOA 1V8DA 1Y6ZA 2NO1A 4QQFA 2Y4OA 1SULA 4J0IA 5CLIA 5L9AA 1M2OB 2FX3A 1L4NA 1DIOB 4RVCA 2G6TA 2UYQA 4HGYA 4QNNA 5CLGA 1RTTA 4M9CA 5A04A 5JWOA 2ZYHA 3FBTA 1GCOA 1SWVA 2OAQ1 3O3OB 4EF4A 5C5IA 4WLFA 4RMHA 2OORA 2WKSA 1V11A 3SNHA 1J22A 3HP7A 1FNMA 4TQGA 3ITKA 3T9EA 4AQDA 4B6PA 5JJBA 3DJYA 1AK1A 4M98A 1XRLA 4QO8A 2WIAA 4YJHB 3CR8A 5E7IA 1D4OA 1DC7A 3K0FA 1VHTA 5JFTA 2GQ0A 4DMHA 1LS1A 5K2OA 1YQTA 3KR1A 3NBKA 5KNLA 4NYIR 2ZBUA 4MW5A 1V8FA 1K66A 1R8XA 3E2IA 1FS4A 3KALA 1Y3BE 4R1PA 2ATVA 4JL5A 1WNFA 2MTBA 3CH4B 4QD3A 3WAKA 2UUAB 1CXZA 4LGYA 5HOQA 4GX5A 4AG3A 1XL1A 3DS8A 4FDMA 3GPIA 3UXYA 1K9SA 2NU9A 4W1PA 3HCFA 4LMRA 3A36A 1HDYA 5B2FA 3O8OA 2LW7A 1JHZA 5CNJA 4QODA 4ZV7A 3RFFA 3MWYW 3A32A 2WIBA 4KYTA 3BWVA 3IHLA 3IR7A 4DFDA 1V3QE 3G02A 2BBSA 1G6Q1 3R7LA 5CDTA 3UV7A 1BN7A 2A0XA 8GPBA 1J0DA 1UDCA 5B3JC 3F73A 1HNZB 1HTTA 1XVLA 1GFWA 1SMKA 2ZSFA 3RYHA 4N8DA 1SBZA 5L4LA 2ZCJA 1XRJA 2GTPA 1UBTS 2WMNB 4BMYA 3U7JA 3G6WA 5JDCA 3TFOA 4DV2B 4I9GA 3EUWA 4H4EA 3CRMA 2IUYA 2ZQZA 4RA6B 4GWKA 5E6SA 2P9JA 5SICE 4B09A 4GYWA 5DI9A 1HL7A 3PT9A 5JALA 3QVJA 1KE2A 1WCV1 4AKSA 2JFNA 2Q0XA 4EKNB 3RS8A 5EJ5A 1S7CA 2CLOB 2YWXA 1IHYA 3I04M 3C4QA 2VEDA 4C14A 1FA9A 1KU6A 1WUKS 5JAMA 2ZE7A 1OT3A 1K9VF 3KL2A 4G0PA 2X23A 5CR9A 4ZOLB 1VZ2A 1Z16A 3KK0A 3GT4A 3SC6A 2HL6A 4DV0B 4FWIB 1HSZA 2JHGA 4OY3A 4YRMA 4PINA 3M5PA 5FWXB 1O8BA 1RE1A 3SC2B 4BNHA 2FRXA 1N5RA 2OK7A 1M8JA 3EZ7A 3KYBA 2QG9A 3MPOA 1AKEA 1MC4A 5E3JA 4ZOQI 3WAJA 3O84A 1G5HA 1PGOA 1V1RB 4KVZA 1IAVA 1K5DA 1P31A 2IDJA 1DJMA 5JUWA 2AB0A 1X92A 4EB6A 2P77A 1RTKA 2QP9X 3OOWA 1NFFA 3ERCA 3RPEA 4YMWA 3T35A 4W5WA 2Q2QA 4EI2A 5KJEA 4ZJYA 1DBPA 1TC1A 1R0ZA 2D59A 5CMLA 4R1SA 3SZUA 3NNSA 5C7OO 3E35A 1UZUA 2OD2A 4C01A 2NTVA 4EGCB 5BN1A 1TJ5A 1DELA 1CEXA 3MTDA 4J0DA 4QLAA 4WCFC 5TPWB 2FN3A 4YRIA 4MEJA 1IJKA 3OEEA 1P2VA 1UXOA 2QG6A 2CFSA 4RK5A 1ZD2P 3DCNA 3GRZA 4F56A 3ZZUA 3G2HA 2X76A 2XOEA 1THZA 4FD2A 5IJ9A 3VPBA 4QUAA 3ZD8A 2IJGX 3OLZA 4BVEA 3ZHQA 3HBNA 4N8SA 3WMFA 1ODTC 1Y8QA 5KIAA 4RZHA 1DAPA 1CUWA 1RQ2A 3CQ9A 2N46A 1JTVA 2GUGA 3OECA 4YRKA 1NW9B 1HLFA 3C5HA 3VR5A 1IN6A 3R6GA 3X1WA 1TFUA 2XQKA 5KTMA 4I5DA 1JFRA 4IYJA 5DGCA 4BMXA 2B4QA 1XZEA 5FOSA 3R3YA 2AZXA 3C3YA 4J4BA 3GK3A 1HMYA 4BECA 2XGMA 1ULUA 4CTNA 2OD9A 2XZLA 1GAXA 5EKSA 2WJWA 3TLEA 2C9MA 4I99A 3X44A 4K46A 3Q8LA 3TBFA 4Z4FA 1H4QA 2WB2A 1NI4B 1UFKA 5B1HA 4LOHA 3HLTA 2XDAA 5ER9A 3ZWQA 1TXGA 4IXNA 1HGXA 3A1DA 1ZMTA 1NBIA 1ZEJA 3OLCX 4DSNA 2QMHA 3E27A 2ILVA 1G5IA 1JSCA 3DTYA 2KBEA 1Z5VA 4NJMB 5HIAA 3ENWA 4ZCIA 2I4NA 2D5LA 3FFTA 4Y2GA 3GX1A 3DFIA 2I2WA 3PF8A 4AY5A 4WK0B 1BIFA 4RTRA 1WBDA 5EYPB 4KJXA 1IBRA 1CS0B 4US0R 1ZLXA 1ZNZA 4CCYA 2R8XA 1X7WA 4D3DA 5KWSA 5FXMA 1KEEA 1A95A 2FA9A 3JPWA 1BCRA 4R9VA 3HXMA 5D84A 4Q4JB 3IL2A 1G60A 2O2HA 2YZMA 4FQ5A 4CU5A 4W8OA 1OKKA 2JG3A 4M7WA 3OKAA 1ZWKA 4GZ5A 3UZUA 5EFZA 1NX9A 4WNAB 1PW7A 1VIAA 1WL8A 3IP1A 2OBNA 3KZXA 2G08A 3I2JA 1H2EA 1QHHB 1E1RA 3J7TA 4LBVA 2WJAA 2A9RA 4P82A 3CRVA 2Q9AA 5F1PA 3RQSA 1GG5A 3DHWC 1LS6A 3EXIA 4BNXA 4E1BA 4R41A 1ZJ6A 1SCUB 4IHQA 4U0JA 5DXAA 5EUBA 2R4UA 3V8PA 1GKKA 3AERB 3WG9A 3EOZA 5KVQA 3TKAA 3VZQA 3FKQA 1P2GA 3OQ1A 2BMAA 3AONB 3P96A 2P75A 2YYZA 1J56A 3V7YA 2F3RA 2XGGA 5FNVF 3N1UA 2MMCA 5E2IA 4O4IF 2CSUA 4Y9SA 4P4GA 3WNCA 2O7VA 1RRGA 5B1EA 3NP7A 2QT1A 3TTVA 3RVJA 1AQJA 4GPD1 1JHUA 2XUZA 1ODCA 3F6YA 5G41A 4EQZA 2F9LA 3RVOA 3USES 1L7QA 3TSWA 1ISSA 1CP2A 3KKNA 3A1EA 5T3YA 3U19A 3DMNA 1GZHB 3JQAA 1JSLA 1VC2A 4GR5A 1PJ3A 5DTMA 1KDZA 1ZRMA 2UZIR 1H2XA 2H1VA 4P08A 2HK9A 2DPLA 2FVXA 2PMWB 4OSOA 4MYDA 3G0BA 4DMKA 1IVNA 3Q1KA 4O29A 2ZKIA 3KQSA 1E0KA 3DOHA 3AL2A 2YYYA 3QKSA 4YPOA 1DWOA 2Z8ZA 2VYVA 4AQYB 2WA2A 4Y1GA 5T8KC 3N8DA 1XL0A 1E4VA 4IJMA 3QZUA 4KE6A 3KSDO 4W4TA 3UHOA 5GMOA 4BJHB 2FQQA 3TSAA 5CB8A 2Q8QA 1NRWA 1YB7A 3BK1A 1DT3A 4ITUA 5D3QA 4I4TB 4A73A 2IYOA 2X2FA 1FSGA 1G3MA 2BGIA 4OJMX 4CEIB 5H5JA 1DC8A 4NU6A 1DB3A 1N8NA 2V5UA 3L7YA 2V0NA 1U2SA 3ESYA 3HY6A 4XW2A 3QVMA 1KSHA 5AHWA 2HLDA 4DIMA 4DMRA 2PRZA 4YMLA 4IWNA 3BK7A 1P62B 5IABA 3B9RA 1T5IA 5LQJA 5LZ9A 2QUAA 3EMKA 1A8UA 1SXJB 2BHTA 4OHCA 2VIIA 1F2UA 3O8RA 1R5BA 2DH5A 1AX9A 1IOVA 2HADA 3WGQA 4TV8F 4UDYX 4XYLA 4FR5A 5HMMA 5BWCA 3SY8A 4CCWA 4W5OA 4YXFA 2FXIA 2VAWA 1EAYA 4GZMA 3B9QA 4YALA 5JNTA 2P9BA 2VDMB 4G23A 4CL3A 2OBFA 3KYCB 3MWFA 4O1HA 2GHQA 2D1FA 3GEHA 4FHGA 4HLQB 3HU3A 1I94B 1PU2A 4GGOA 4ND8A 2CEAA 2OMEA 1SVOA 2PGXA 2Y0DA 3RF6A 2NZUG 4C87A 4F97A 2ZOSA 1D0IA 1E9FA 3LPMA 3S2GA 4XQ9A 4ZCPA 2XWPA 2BFFB 1U28A 1A8PA 3OIDA 4F6RA 1ZICA 5K3EA 4WA8A 1QGED 2WIKA 3N2KA 5BV1A 4UQPA 4I8IA 4OLFA 4Y9TA 3UB2A 3C98A 3TOZA 1XLTA 3P2MA 4HWPA 4IV8A 4JB8A 4DQVA 1G19A 1YS7A 3DZ8A 2B37A 4LF8B 4J1TC 1BWQA 2R6R1 5FBHA 1WV0A 3CRNA 4NU5A 1CJMA 3WLOA 2QTTA 2Y3IA 3D6UA 4WZBA 4AJKA 4EMSA 4P7JA 3FYCA 2VQ6A 4BZZA 2JJ2D 4OK5A 3ZXXA 3ZBQA 3QWAA 4OYHA 2NSYA 4U6NA 4LVOA 3F4KA 5HBRA 5LBUA 4LNHA 1DBSA 1JIJA 4LA4A 4MYTA 1EJ2A 4G0QA 5BN5A 2I7DA 3C43A 5LDHA 4JUDX 1BN6A 1KEZA 1MNAA 4CKWA 4KODA 2B6NA 2NO9A 5C8VA 2C9DA 4F93B 1HYGA 3NDIA 4OFBA 3IPRA 2C4VA 2H7YA 2OL4A 3ZY5A 1PNOA 2OB1A 2QNBA 4BP3A 4O59O 3KWMA 2WTAA 4FPXA 3D0KA 3HVRA 5D6NA 1EMDA 4NYIQ 4UMEA 3RHZA 4C0JA 1E5VA 2J07A 4QOGA 5EXTA 3S7TA 2ISSD 4DCNA 2HUNA 3DL2A 2DB3A 2ACVA 3NGLA 5SYMA 3KXLA 2PX3A 3HBLA 1V25A 2ZTHA 4KE8A 3LU1A 4Q93A 4TQ9A 3MWEB 1YAHA 2MINA 2W2KA 1YR3A 5HZKA 4Z86A 3A4TA 3CISA 1X7YA 1P0IA 1ZJJA 1R16A 4QRIA 1E3SA 4ZOLF 4Q1AA 2LDXA 2UYOA 2I62A 2YHBA 3NB0A 3DYVA 4Q6WA 1G59A 3GD5A 2A94A 3KKZA 4AKHA 1ZJZA 3WGVA 4PTLA 4F4UA 2RBKA 4JXJA 4LXIA 1NXSA 2W90A 3T9AA 5LN1A 4EB0A 3KAJA 3H0KA 4INOA 3AILA 4GP9A 1BHQ1 4LMAA 3BFKA 2D54A 2Z9BA 1C3VA 2HNAA 3A6KA 4LYGA 3HXKA 4XUEA 1N2SA 2PG3A 3WMWA 4D80A 3RROA 4U7DA 1VGRA 3LV8A 3I37X 2R1ZA 3UEOA 1YB6A 3SBXA 5CDFA 4L2IA 2JRCA 3GA7A 2NU6A 3TRKA 2RGYA 3PFHA 4GF5A 2O14A 5AD1A 1UK6A 4IIYA 3AW8A 5BYKA 4XRRA 4OV6B 4BGEA 1Y7PA 4MMYB 3D7KA 3L1UA 2NN3C 2B21A 2B3TA 4FS8A 1B3BA 5C7YA 2GJAA 2VAXA 3KVNA 2EF1A 4Z0HO 4BV3A 5L53A 1NNEA 3I1JA 4ESEA 3RRBA 1KAMA 1YS9A 1J23A 1WABA 3KJEA 3MK31 1PWZA 2I7CA 2VZ8A 2C2HA 4OATA 3NEYA 4HQ0A 4KVAA 3NEAA 1ONBA 1QH1B 1W5EA 4WKBA 1RT9A 2AQ8A 1E7YA 5AVYA 1GUZA 4TYYA 2QZZA 3KD3A 1KEWA 1QF9A 2NTJA 4WOKA 5CEEA 4QARA 1F8UA 2RK4A 3T3PB 3UC9A 4QT4A 5L4NA 1NPTO 5EMJA 4F3TA 3W4JA 3CLSC 2V1XA 2I22A 2H8GA 5DHTA 1T3ZA 3CSUA 3WL5A 2HI0A 2HSJA 3M4XA 1FYDA 3CPJB 3LH5A 5BNFA 2BMFA 1N2OA 2XNDD 3HRHA 2C4WA 1UPAA 3U3MA 4DLBA 5EZSA 2BC9A 2AR0A 2H5JA 1TGVA 2OHJA 1IUNA 4JP2A 1NONA 4YP5A 5B5SA 3UHPA 2WQ6A 1TCCA 3G7SA 3GFBA 3I4LA 1U7WA 2G77B 2QN8A 1EWTA 4ZYUA 3U16A 4Q4AA 1GQSA 1WKBA 4TLDA 1W75A 4DG8A 4G84A 1AQ6A 4MKFA 2VPXA 3L8ZA 1JDBC 4QUBA 3KOUA 4JI1B 3C3DA 4HQNA 3HYCA 3AUJB 3NZEA 1TQDA 4CLOA 1D2MA 4NMXB 4GQIA 2Y77A 5FD8A 3ZU5A 1ZVKA 2FEPA 4KWIA 3LFTA 1PO7A 1V2HE 1ZC3A 4R5MA 2RAFA 4M1MA 3ZHUA 1U99A 2CVQA 3E3OA 5CUQA 2EJWA 3RRZA 2YV2A 2V5VA 3N6RA 3NHBA 4KLAA 4TTIA 4TN1A 4BKMA 5D7BA 1FNBA 2IPAB 4Q18A 3RFTA 4RV4A 4GWGA 3DV9A 4RFVA 2EVWX 1A82A 3L0YA 3R6LA 2Z6AA 4YVFA 1NDHA 2FTKE 4CPDA 1SUFA 1EXVA 1M6VA 2D3TA 2D1TA 2YOGA 2CXRA 4Y2TA 3G5AA 3N39C 1ECJA 1DP4A 4PQYA 4JV5B 5IT9A 3MBKA 3LIPA 4BLRA 2M32A 3UKJA 3BXPA 4XWOA 1YJ8A 4NJOA 1U7XA 1SD1A 1VPVA 2G3YA 3DEHA 3H5TA 5AKGA 1WQ4A 3S5UA 4OQMA 5C2JB 1MA3A 1N7IA 4KNWA 4LUCA 2JPDA 3TUZC 1YL6A 1RXUA 2HQBA 3K5WA 1NU8A 3SJZA 3CB4A 3PI7A 3FUTA 1VHDA 3TCXB 2HO5A 3SQMA 3IBYA 1F9EA 3D6FA 2R9VA 1G9SA 3EFBA 5IYZB 3KLOA 3DZIA 5LQKA 1JSZA 1L4YA 4QJ5A 3G49A 2FP3A 5DP1A 1II9A 3JPYA 5AVKA 3K0AA 1LXCA 3ABIA 2OV8A 1PT5A 2BGRA 3AUAA 3GJYA 3QLVC 4G1FA 5JC1A 2E4VA 3K9FC 3EDOA 3RRYA 3UUEA 5HZMA 4BL5A 3I9NA 4PONA 5FPTA 5CCXA 1GDTA 1M2JA 2Q9BA 2CHFA 3UYKA 1U5AA 4K3UA 3N58A 2X40A 3VU9B 1GIAA 3LDUA 4CL2A 4DLSA 2XXAA 3QEJA 4PHGA 4BFYA 1RLIA 2NYVA 2WSBA 3N2LA 1NTRA 5FOVA 1UBFA 3DUFA 3KJQA 4IVPA 4J29A 1A1SA 2GD1O 3UPTA 4U7HA 4B3MB 3T3NA 2WSMA 1P2DA 1VFNA 4KV9A 5JNUA 1S7GA 5I7EA 3DF7A 2P2SA 5EIXA 2RB4A 4MV3A 4XYMA 2D5AA 2Q4OA 4OHMA 4QBHA 3KTDA 1YMUA 4PICA 1YE8A 4I4TF 3BB4A 4U5XA 3F1KA 4XLZA 5I9IA 1H6CA 2FGKA 2LUOA 2WUVA 4DC0A 1T9CA 4JQOA 1CUVA 3UK6A 4MLCA 1PSWA 2NW6A 5LKRA 4NBRA 4EW2A 2JEYA 2XDQA 3GFVA 3T1TA 3QYPA 1M1YA 1E20A 3DPUA 4PNPA 3AM5A 3FZEA 1THGA 2V6FA 1K7XB 3BIFA 3F97A 4LHWA 2C2YA 2H0AA 1DEHA 4MVXA 3KHTA 4FTWA 4ASUA 2VZEA 1VE6A 1L2TA 2AWOA 3JD4A 5FFFA 1L8QA 1H93A 1X9IA 1G2PA 3GZ4A 4S1WA 1XN4A 4QBGB 1YQQA 4XVQA 2VDPB 2OYCA 3W3AA 3VH4A 3DOCA 4RPCA 2P7HA 1OHHA 5CA1B 4GOXA 1O95A 3JQ9A 4E13A 3BDIA 1FFGA 3B38A 3A3YA 4J0HA