3TQFA

Structure of the hpr(ser) kinase/phosphatase from coxiella burnetii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
165
structure length
165
Chain Sequence
KQTWHANFLVIDKMGVLITGEANIGKSELSLALIDRGHQLVCDDVIDLKQENNQLIGSCPSVANGYILITGIGIIDVPKLFGLDAVVNQHEVHLSISLVKPEKMPLLDDPLNPLYRTEIILGINVPKILFPIHPGRNLPLLIETLVRNHRLKMEGYDSSHHFHEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase, hydrolase
molecule keywords Hpr(Ser) kinase
total genus 36
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.7.1.-:
pdb deposition date 2011-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tqfA00
4AWXA 2WWFA 3NIBA 1OW3B 2RAPA 4OK5A 1M7HA 2MSCB 4ZPXA 5JLJA 3QI2A 4IHQA 3A4NA 2IS4A 1R6BX 1VMAA 2Q6TA 4IOKA 4HSEA 5JJKA 4IKEA 5TB5A 4BFWA 1Q21A 3EXAA 2BIFA 3A4MA 3THYA 4PQRA 1DELA 1G18A 1VIAA 5DGXA 2ZE6A 2XAUA 1JQLB 5CITA 5G41A 2OUKA 1OXVA 1E2HA 2VA8A 1HT2E 3FGNA 5HKKA 2ZU6A 1KI2A 3EWAA 3KFVA 2JLWA 4IDOA 2GILA 4AY2A 1KI3A 2GA8A 2J7PA 3C14C 1LVGA 1G1MA 3IIMA 4PZLA 3P1JA 2JLXA 4RKEA 3PJRA 1OYWA 3EZ2A 3VKHA 1COWA 3QKSB 2P6NA 4BECA 2CXXA 2CE7A 1KMQA 2QM8A 1D2NA 3DDCA 1AKEA 1G7CA 2OV2A 1S2MA 4AURA 4QRHA 5FBQB 1GL6A 1G6HA 5FTLA 1ZM7A 3UPUA 1NIPA 2W6JA 4KU4A 4I1VA 2CK3D 3NH9A 1I2DA 4TTQA 2KWIA 2JJ1A 2BM0A 3U2QA 5D3MA 4URXR 2VLIA 2NMVA 1G8GA 3ZJYA 5FI0B 3BAFA 4MGZR 4Q1EA 2YNMA 3T1TA 2A30A 2GEVA 3B9PA 1VHLA 4XOIA 4PC7A 2ZYTX 5KU1A 1W5TA 1HQCA 3IBGA 2O5VA 4GOJA 1M1YE 4NYMQ 4QHTA 2Y8EA 4F93B 1ETUA 1QHNA 4BFYA 4LYFA 4PC1A 2DFLA 3QXSA 4TMXA 2Z4RA 1E79D 3RABA 2BC9A 3M6AA 1KK3A 2VHJA 1U0HC 2AR7A 4JJZA 2OILA 2PH1A 3DMDA 3ZVNA 4QGGA 2NQ2C 2P6UA 3LW8A 4ESHA 1E9BA 3THWB 2F43A 3LBNA 5A5GA 5FPYA 2PCJA 1G8FA 1OH6A 1MOZA 2MMCA 3GLHA 4IOMA 3HDTA 2GCNA 2DPXA 2WSSD 4TQAA 4RZ2A 5JECA 5KTYA 1K6MA 4DLZA 4HB2A 1JXOA 3MJRA 3B6EA 4LSGA 3GLFA 3LW7A 4PFSA 1ZC3A 2WWWA 4TMZA 1XMVA 2RB4A 1DPFA 1N6HA 4C0QC 2L0XA 2BV3A 2ZRBA 3LVQE 1CS4C 1NG1A 1W36D 3T06B 4B71A 4BASA 2C99A 4MYUA 4L9WA 4QOSA 1XTJA 1XNJA 2PT5A 2LCFA 1NLZA 4PTLA 5A4JA 3FHTA 2O8CB 1DAHA 2AHOA 2X8AA 4NYJQ 3IO3A 4OJQA 1WMSA 2RGNC 1TNDA 4F92B 2AXNA 1ZNZA 4DKXA 4EJSA 2IK8A 4TSFA 2HLDD 5EQTA 2C9OA 3SU8A 5J4LA 2DY1A 3CNLA 4LV6A 1BIFA 2VRWA 2E9SA 4PO9A 1OIVA 3TVDA 4IFBA 1Q22A 1FQJA 3HR7A 2HT1A 3KUDA 1NNEA 4AKIA 3WYGA 4L15A 1T0JB 3AVOA 4CF7A 5J47A 4DB4A 4BQSA 4CEIB 2DFNA 1UDWA 3K0AB 3RRNA 2XX3A 3HYTA 3R7WB 3ECCA 3B85A 3U4QB 1JPJA 1KO7A 1XD2B 1E2JA 4B3XA 2HT6A 3M1IA 1OFHA 5C1BA 4F4JA 1CIPA 2ZI4A 3B7GA 5AUPB 2ZU0C 5EE1A 2FNAA 1R0XA 5JRZA 4Q4HA 3BS4A 4M8NE 4TYNA 3KDSE 2FEMA 3FVQA 4UNPA 5CB6A 1E6CA 2BJVA 1DAEA 3CWQA 4KHZA 3U7FB 4KI0A 2CHQA 4N0DA 3RDPA 1E9DA 4ZDJA 5FH9A 5GADl 2XOKA 4GRAA 4AYWA 3HPRA 2ZS7A 1W0JA 2ZRIA 4B3DA 3DM9B 2PX3A 2PZGA 4Q7LA 4C0BA 2IF2A 3LXRA 5GVSA 1L7VC 4XSHA 1R2QA 3BFXA 1P73A 2HXYA 1ESMA 2DWQA 4FMBB 4AD8A 3LVRE 1UFQA 4LJ5A 2QQEA 4PQFA 1GIAA 1R5NA 1G17A 3K0CA 4RSGA 2V6JA 2G0TA 4JIMA 2BBTA 1XXHB 1CJUC 1GL7A 2PEZA 1JR3D 4D0GA 5B57C 4P4SA 2YHSA 4Q03A 1Q57A 4ZIRA 5BN3A 5JZVA 1SXJD 3SOPA 3I92A 1BS1A 4BZPA 4BPBA 3HU3A 1IBRA 1OHHD 1NP6A 5DSZA 4LGMA 1JJ7A 1KOFA 1RC8A 1NJFA 3IIKA 3TUJC 5EXTA 5GVRA 1ZRHA 4C2UA 3ZVRA 5HE8A 5FUXA 4Q9KA 3TE6A 4LBWA 4URYR 3L8YA 1E96A 4CT4B 1LB1B 2G83A 1S0UA 4OYHA 2A2ZA 2ZI6A 4MKGA 4V0KA 5KSPA 1XTSA 2J0UB 4X8OA 3RSOA 1F5NA 5D3MB 1JXMA 2ZRLA 2GEDA 4EDHA 1TADA 4W9MC 2ZJOA 3K0CC 4OHVA 4NCIA 4B3FX 5JS7A 2VIIA 4P4SB 1FP6A 5FBWB 2QI9C 2OFXA 3MAAC 2BMDA 4QJ3A 2QP3A 2ZROA 2OFWA 2UZIR 1R4AA 2F7SA 3QKRB 4TQUS 4QHSA 3T1QA 4LOAA 2RH5A 4ACAA 2FU5C 2Q9AA 3AP1A 4PO8A 5FUYA 1ZAKA 1XBTA 4B43A 4RZUA 1P2VA 5SZHB 3SJBA 3CRRA 2IS1A 3FKSA 1N6RA 3GJXC 2V3CC 2KJQA 3CZQA 3A1SA 4HAUA 4M21A 4C0HA 1UAAA 2QMUA 3E70C 1YRAA 2G6BA 4BFXA 2FZ4A 1KSHA 1XX6A 1F2UB 4BFZA 2R65A 5EZ6B 1F6BA 5FL3A 3EG5A 2PMDA 2SHKA 3LRPA 4CEHA 4CEIA 2ZRNA 3AUXA 1AZSC 3PENA 2IYWA 4NDZA 1YZQA 3IQXA 2WKPA 4DCTA 3AKDA 1EGAA 1LV7A 4XD7A 2IEYA 4XTRA 3RS0A 4DUGA 1UDXA 2VEDA 5J4KA 4QGAA 2BEJA 2XJ9A 3AUYA 1CJVC 5CIQA 5JWRA 2FFBA 2ZE8A 4DIEA 4OHZA 2AN9A 3QIAA 2OZEA 2QG6A 3SNHA 2W6ID 3B1XA 1KSFX 3FMIA 1TTTA 3R9IA 2FSFA 1KKLA 1ODFA 4M22A 2FMXA 3GJ7A 4TMKA 3A1TA 1GG2A 3IQWA 4OI2A 4X8MA 4EUNA 1OKKA 2REOA 2XZPA 3OF5A 4LK2A 1XPRA 1JR3A 4CDGA 1G6OA 3W5IA 2O8BB 2WPDA 5KNBA 1NMZA 4UKDA 3OHMA 2P0EA 2OE2A 3GLGB 3IIJA 5FUWA 1ZYUA 3QOFA 3TNFA 3P27A 4ZI2A 1J90A 3PG5A 2WOOA 4Q02A 1CR4A 3DMNA 1JAHA 2Q3MA 3QXXA 4LY6A 1X8JA 3NG1A 2BKUA 5L3QB 3KXLA 2CCJA 4EJSC 5TDHA 2N46A 1M2OB 3ZD6A 4KAXA 2F1IA 1UKVY 4C0LA 3QPUA 4JYCA 1XMIA 2ASEA 1X1RA 4JLBA 2ZJBA 1VCIA 3OIYA 5EXSA 1GL9B 4B2IA 1BKDR 4TMVA 2WZQA 1M74A 4GFDA 4WZAE 1NG9A 2QP9X 1IHUA 1H8ED 4RD4A 5L3SB 1XTIA 1Q1EA 2QE7D 1N5KA 3SDZA 3GQBA 4EFNA 4KFSA 5IHPA 3FKSD 3K9NA 1HV8A 3C4JA 2IYQA 2N1BA 1Z2AA 2J0VA 2ZVPX 4KBFA 1U81A 2G1KA 3KKMA 2WIBA 1ZIPA 2ZSEA 1ZNYA 3IBYA 4US2R 2KE5A 1DE0A 1EFCA 1II0A 1BMFD 2GJ9A 4WAUA 5JRJA 1WF3A 3D7MA 2ZUBA 4KSCA 3SBDA 4CW7A 2E1RA 4V03A 5HCNA 3MWKA 1E2NA 3KXKA 4UQOA 3NXSA 3WBJA 4B44A 4ZDIA 1G7TA 3CNOA 2G3YA 1KJWA 2W2VA 3AVYA 2A5YB 4GOKA 1N6IA 1Z6AA 2R62A 2ZRHA 2BBOA 5M04A 5H8WA 1RRFA 2PZFA 4UNQA 2I4IA 3WYAA 1CXZA 1YZLA 2QTHA 1KI4A 4US1R 3TK1A 3VNVA 5EE3A 1HE8B 5LB2A 3A1WA 1Y63A 5DYIA 5B2ZA 1RFLA 3FWYA 3SHFA 4I81A 4HUQB 4Q1FA 3GFPA 2QENA 3PUYA 3AKYA 1Z0AA 4NYMR 1SVLA 4LUCA 1SVSA 3QSYA 2D06A 3K9GA 4GT1A 3KQHA 1VCNA 1X86B 1IJFA 3EC1A 3K0FA 4LHXA 3NHAA 2Z43A 3UXMA 3DOFA 1GWNA 3W8RA 4QNMA 2J0UA 1GNRA 3UMFA 1FQKA 1CTQA 1Q3HA 4CGZA 1HE1C 1QZXA 2C77A 4DEXA 1N5LA 5KSOA 1WBBA 2MSEB 2IUTA 3SFVA 1CP2A 1KJZA 4HB4A 1IQPA 2ANCA 2IYTA 1GZSA 3G5UA 4A2QA 5JHHB 4GL2A 3RS2A 3ASZA 3BH6A 4EPYA 2QBYA 3F3YA 3TSZA 2JEOA 4BFSA 5H68A 4H1VA 5UKDA 2OCBA 1OF1A 2FGKA 4TT3D 3SYLA 2O0KA 2A7QA 4JJKA 4AK9A 1E1RA 3KQNA 5FOSA 1CLUA 2GAOA 1YZTA 1ZNXA 2ZETA 4A0GA 1LS6A 5AR1A 4DRZA 3O8DA 1O3YA 1SULA 1R8QA 1IJEA 3VHXA 3M4YA 3SI7A 1YZGA 2HJVA 5EP3A 3VTKA 3N5CA 2WJVA 4GBMA 2RHDA 4LJ8A 3VR4A 1CEEA 1RIFA 4MQBA 3BFKA 4GMDA 2O0JA 4GPTA 4RD3A 3T12A 1DAKA 2JJ1D 2WHXA 4PC3A 4QG7A 3ND9A 3RRMA 1WRBA 3ZIAD 4RZ3A 3DL0A 4Q18A 4YQFA 1RW4A 1S3GA 4OKSA 3QG5A 4ACBA 3EZ6A 5TY0A 2IYUA 1TQ6A 4JL5A 5DE3A 1ZINA 1FUUA 1YU9A 3BB3A 3ADKA 4PAOA 3EZ7A 3U3OA 1OLOA 1OXSC 2CBZA 1FX0B 2GCOB 2H92A 4LRWA 4MRPA 3GLHB 3FMPB 1W0KD 4KYUA 1KO4A 5HZKA 3BORA 2W83A 4OK3A 2FSGA 3L0SA 3PR1A 3VR6A 1AIPA 1LNZA 2W00A 3EAQA 1E9RA 2WWXA 2H57A 5L3QA 3BH7A 2BEKA 3F0TA 3QXCA 5L3RA 1OFUX 4PHGA 2VPPA 4Q19A 5FTKA 2QRZA 1JEDA 1SVMA 1VYVA 3CO5A 4HAWA 1DTSA 1SVIA 3I62A 5ANRB 1N0VC 3FTQA 2QMEA 5CJPA 2OXRA 5JBQA 1E2KA 5KPJA 4YC7A 2QMOA 4A82A 5DHFA 4V0OA 5SZIA 4A2PA 2OHFA 2XXAB 1Z06A 4MDFA 3FKQA 4Y0AA 1KYIA 1W1WA 2FSIA 2WTUA 3AVWA 3AP3A 4Q1CA 2DWPA 1P9RA 4LWZA 5KDLA 1XWIA 4KCGA 1VG8A 2GVZC 5EZ5A 1IXSB 2MMGA 4MYTA 1RYFA 3DOEA 4TLCA 2GTPA 1CBUA 4FMDB 3OESA 3G0HA 4ZCLA 1GITA 2NZ8A 2QGZA 4NYIQ 4Q5IA 4IDHA 3PQCA 2V6IA 1H8HA 4JLJA 2G0NA 4TLEA 5H1YA 3RAPR 3ETLA 5TXGA 3W6NA 3B78A 3KTAB 2QM7A 4ITRC 1MR3F 1US8A 4ERNA 1B23P 5CDFE 4B6EA 4UNNA 2EFHB 1HEIA 2A5FA 2ZXUA 2ZRJA 5FPTA 2XXAA 1MO6A 3TSOA 1MO3A 5L8VA 1E3MA 4DCSA 3L8ZA 3EPHA 1UKZA 4CIDA 1SVKA 2EVWX 2FPKA 5CM8B 3L82B 1WE2A 3OIWA 4DZZA 1KNQA 3TMKA 4CEHB 2CVFA 1RRGA 2ECKA 2RHMA 1Q12A 1OSNA 3FMFA 2AK3A 2ERXA 1MRNA 1BYIA 4B32A 3UG7A 5JSZB 5IF9A 4V0LA 5J5CA 5K8TA 4FCWA 4Q00A 3I72A 4PX9A 2NO6A 2IX3A 4HB3A 3CLVA 4QHYA 5DIFA 3V9PA 2XZLA 1RJ9B 1ZM2A 4KXFB 3TVTA 3SR0A 4BEJA 2JATA 4WA7A 3I8XA 4B73A 2GZHA 1A2KC 1PJRA 1OH8A 2JIZD 1Q44A 2XNDD 2ZRKA 4TL7A 4OBEA 3NKVA 2DFKB 3CONA 2ZJ8A 1S96A 1F48A 3LQQA 4PQYA 2ORWA 4PZZA 3PCRB 4KFUA 4LC1A 1KAOA 3VHLB 4MRRA 4II7A 3ZQ6A 4AI6A 1P6XA 5AJVB 4YXWA 5F98A 4IDQA 1W0KA 3CR8A 4BEBA 1P2TA 3TR0A 1J70A 3SZRA 1GVNB 2VO1A 4Q4LA 2HV8A 4DCVA 3OEHD 3I73A 2XB2A 3F8TA 4O25A 5JI2E 3K70B 1VG1A 2ODBA 2O8EB 1X6VA 2A3RA 3MWJA 1DOAA 5FPHA 3H1TA 4PPFA 1II8B 4X8HA 5EUMA 3X1ZA 4XWOA 5DN6A 3B1YA 2FF7A 3FDIA 3O8CA 3ZGXA 1PLJA 1E2IA 2J59A 3D6TB 5AUNB 3Q9LA 3GPLA 2O8EA 4A8JA 3B13B 1G3IA 3L0IB 3NWJA 3HPQA 1E0AA 4DLSA 3MMPA 1YR6A 1KO1A 4CZ2A 1P72A 2FEOA 2GEUA 2ZR9A 5FOXA 2R44A 1ZCAA 4V0NA 2CNWD 1WB9A 2VBCA 3JVUA 5SZJA 2REBA 1G5RA 2VSFA 2IYZA 2VF7A 4Q21A 1CJMA 5BWMA 1QHHA 2QNRA 3UWOA 1H8HD 3IPXA 1DAFA 1A5TA 4IDPA 4RKFA 2ZAOA 1JBKA 1TEVA 3MRSA 2CCKA 3I32A 4D4KA 3I5XA 1G21E 3P4XA 1SHKA 2IS2A 3UKDA 5LD2C 4DLWA 3MJHA 3VU9A 2NIPA 2A5JA 2V4ZA 1GKIA 3E1SA 2FN4A 2ZRCA 4QBGB 2IYSA 2X77A 3KUCA 4FD2A 2F3RA 4A8JB 5BN5A 2XEXA 4ZIRB 2HYDA 1C1YA 5B58C 4G5RA 1JECA 4RD0A 3PEUA 3KTAA 3VFDA 3THXB 2IXEA 4Z54A 2REXB 3A4LA 4G1UC 3R20A 1ZVQA 1QRAA 2NPIA 4QL3A 2YOFA 1AGRA 3CWZA 3LX5A 2Z6VA 2LKDA 2V7QA 2GCPA 3X1WA 5EP4A 1RZ3A 2QROA 2O52A 2MSDB 3K1JA 4ZKEA 4E22A 3W9YA 4S2EA 3GLGA 4Q47A 2CEAA 4NYJR 3GFTA 1N6PA 2VP5A 2IBMA 2CLSA 4M1YA 4JBWA 1Z6GA 3TH5A 3BE4A 4OK6A 3VR2A 5EXXA 3GJ0A 4YMUA 1OB5A 4D4LA 4OQFA 4DBLC 4LBVA 1J2JA 5HR5A 4IW3B 2VHTA 4R98A 3RC8A 4YMTA 1XJ0A 5LBIA 3GP8A 2H5EA 1BH2A 1U9IA 3OZXA 3HU1A 2K5UA 4C9BA 1AQYA 4TYQA 2YC2C 2EFDB 2ZJ2A 4HLCA 3RRZA 1KDOA 5E7JA 2PL3A 2EFGA 2Q0HA 4IJMA 3TUIC 5IRCD 1YRBA 1VG9B 3K9HA 1XTRA 3GLFB 3B8HA 3SJAA 5DI3A 4PHHA 2JLYA 4P0TA 5CK4A 2F9LA 2GF0A 1CR1A 1E0JA 1UF9A 4E5UA 4B3CA 4WZBE 1R0WA 1Z08A 3HP1A 3U44B 1IXZA 1G64A 1KZ7B 4M1KA 3O8BA 1W44A 3IGFA 3B1VA 4TT3A 4KODA 3U61B 2O8CA 4JLKA 3VX3A 1F2TB 5BN4A 4MH0R 1QHYA 2Q9BA 4Q7JB 1NSTA 1G16A 4NTZA 2VSXA 3N2IA 4JLVA 3SBEA 1D5CA 3VU9B 3I1FA 3KX2A 2QRNA 4PR0A 1RYHA 5EE0A 3I61A 2F1RA 4TN1A 1NMXA 2W2XA 2QQ0A 1WDTA 1NLFA 2DBYA 2GKSA 4JLOA 3ZS9A 1NVUQ 2H18A 2ORVA 3LX8A 4M1WA 4QBIA 5FBLB 4EQ6A 3S1AB 4LX0A 4RJLA 4A6PA 5E3HA 4CEJA 1AA9A 1HA3A 1YR7A 4FMDF 1DADA 3X1XA 3ZIAA 4UJ3A 1P9NA 2J9RA 1W46A 1L4UA 2IEZA 4D81A 4FMCB 1E9CA 4U00A 2FZLA 4JLMA 4BFUA 3AM1A 2B92A 4Q7KA 2F6RA 5FTJA 1AGPA 2E87A 1T9HA 3AVVA 3KJGA 1NBMA 3MLEA 3QEJA 3TJZA 3AVTA 3MCAA 2NPFA 1X3SA 2HF8A 2DYKA 4US0R 1JEEA 2IXGA 1HUQA 1D9XA 3KJIA 2PJZA 4RFSB 3U7HB 1EFHA 1ZJ6A 5FL7A 3WNBA 2GXSA 1LF5A 4MGIR 1EFTA 1E2PA 5SZKB 3CRQA 1XB2A 4H9GA 4OL0A 1UKYA 1U90A 1YZNA 2NG1A 1S1CA 2J3EA 4C3ZA 4IEEA 1F2TA 5E7IA 1E2EA 1FMLA 4AKEA 3H0KA 3P20A 1DO0A 1XEXB 4ZO4A 3AH8A 3TKLA 3A8TA 1OT3A 1SXJA 2BCJQ 3D8BA 1E9SA 1XXHA 3AGPA 4N1AA 4NKRA 5F3WB 2B8TA 1FOEB 3AF3A 1XD9A 2HEIA 4IDNA 4NPHA 1KY2A 4IFEA 2OESA 2AFHE 3KB2A 2J7PD 4MYHA 4EAQA 1N6LA 3BGWA 1TPZA 1GKYA 4BLTA 4DWJA 4B2PA 3AVUA 5P21A 1NVWQ 3WMGA 4URVR 2D3WA 4PSKA 3WBKA 2ZEJA 3PVSA 1OXXK 3OIVA 2LWIA 2AX4A 1P9WA 4AYXA 4ON9A 3ZVMA 2JCSA 2WMNB 4MUAA 5CK5A 2H8KA 1AZTA 3TUZC 1G8HA 1QHSA 3BERA 1UADA 1T5LA 2HYIC 4U02A 3QBVA 5E95A 3PEYA 3OE7D 5KSYA 2R6DA 4F38A 2O8BA 4A0RA 2NGRA 2OO7A 1Z2CA 4Q1BA 1YR9A 3LXXA 4CEJB 5E4FA 2X2FA 5F9HA 1HY3A 2B8WA 4LDJA 4QKQA 1W36B 2FJUA 3NVAA 3LBHA 5AJYA 1LFDB 1KDTA 2ZM5A 3Q72A 1ESNA 4DLTA 4PXAA 3LFUA 2FWRA 4MKHA 2R2AA 5C2JB 4M0LA 5ELXA 5JSZA 3IO5A 1SGWA 1DVRA 1O87A 2ZANA 3AF1A 1FP7A 3CRMA 3PITA 3RSLA 2ZJAA 3ZQJA 1VDZA 4LI0A 1JALA 2DCUA 4IVQA 2IC5A 2UZ3A 1CJTC 3CRVA 4LC0A 1XU4A 1J7KA 1XXHE 2RGNA 2DB3A 1GFIA 4A0HA 4DUGD 2WJHA 4JS0A 2F3TA 2R6AA 5J40A 1NBMD 4YMWA 4P4TA 1G3RA 3SYNA 2V8OA 3ZVLA 3GLHE 1KDRA 4FWTA 1IY1A 1XPUA 1NVVQ 2RGDA 2IYVA 3K0SA 2GETA 5J4HA 1D2MA 1IOZA 2WKRA 1EX7A 1FPMA 1P4SA 1US8B 1GNQA 1XP8A 2YV5A 5EJEA 3EARA 2RGEA 4JVLA 4QJ5A 2GVDC 3QF4B 3L43A 3E2IA 5GJCA 5B64A 3EW9A 1NN0A 4DDTA 2IUUA 2FV8A 4Q9IA 4XWKA 4Z1MD 3I3SR 4TYYA 2QEQA 4R9UC 1G5TA 3H4MA 3L0PA 4URZR 4AYTA 1E94E 2HLDA 1RRCA 3RWOA 2CK3A 4EPXA 4W5JA 3GEIA 4G0NA 2X1VA 4KITB 1ZP6A 3FFBA 3IHWA 4EPWA 2A5GA 3AVQA 4DIDA 1Z6YA 3KB1A 1G9XA 3JVVA 1X8LA 2G88A 2JA1A 3BIFA 3QQ5A 4JLDA 4DHEA 2D4HA 2F43B 4ASUD 2WJIA 2OT3B 2R9VA 1FX0A 2GCOA 4PAMA 1A1VA 5LPNA 4G5SA 1U9IC 5AJZA 3LBIA 3SFZA 3QF4A 1PUIA 1VKJA 3SC3A 2IW3A 1AM4D 3CB4A 1VCMA 1E1QA 4WW0A 2YZ2A 1XCGB 2AL7A 4PHTA 3GEEA 3FFAA 4A8JC 4FINA 3PUWA 1WA5A 2GXQA 4H1UA 1C4OA 3TW4A 3MFYA 4TYPA 3EIQA 1QDEA 2G9NA 3QKUA 4JLPA 3PXGA 521PA 2PCLA 5FTNA 3WY9A 2J41A 1QG4A 2XOKD 2EW1A 3A1VA 4HZUB 2BHRA 4MYCA 5G53C 3VKWA 3T1VA 2J5XA 5C4MA 1ZIOA 3T5GA 2G1JA 1TQ4A 1Z83A 4YMSA 2OXCA 1F60A 3QUSA 3W8NA 4C0JA 4IOJA 4DJTA 2CHVA 3K53A 2C9CA 3CX7A 4BLPA 3B60A 3EPKA 2BBSA 2HCJB 4NONA 1G19A 3LAWA 3M0EA 821PA 2JLSA 2JLRA 2QZ4A 5L3SA 3UANA 4MKFA 2YWGA 2VP6A 3NDBB 1W4BA 2GF9A 2C98A 5HCIA 3NHBA 4M9QA 1TF5A 1Q1QA 3NEJA 1W48A 1YKSA 1W36C 4FWIB 4HB0A 4LYAA 1CRQA 1E0KA 1TF2A 4DSOA 4R2IA 4JT2A 5EP1A 1BYUA 1OHHA 2WWHA 4B2LA 4BLOA 1NVXQ 1HQYE 4XTCS 8OHMA 2I1VB 4RCZA 4FCTA 1L4YA 1XPOA 1VCOA 1TQDA 3LWNA 4BFTA 2I3BA 4G5GA 5GJBA 2NO9A 2OEPA 3WRYC 4CVNA 4MKIA 4V02A 3BJIC 4U5XA 3FOZA 3U4QA 2VP4A 4LHYA 1IXRC 1GUAA 1DAGA 5CB8A 2J1LA 3CH4B 3L2OB 2EU8A 1KSJA 4EPRA 4XSGA 4QM7A 1XCMA 2ZR7A 2J0QA 1S8FA 2FSHA 4KSBA 2C2HA 1NLYA 4TMTA 4DB2A 5KO2A 2JDID 2UVQA 3LQRA 3R9XA 1E2LA 2ODNA 4LJ7A 3CUEF 1QHIA 4GI7A 2JGNA 4MITA 5AK0A 1DAMA 3O8RA 3EX7C 1DARA 2HDNB 2WKQA 3NC0C 4JBXA 4EQ6B 5FOUA 3C16C 4ZKDA 3WNDA 1NKTA 2PEYA 4B48A 4TTPA 4D6PA 1E9FA 4MGYR 1ZW6A 1N3BA 3MG9A 4Q4HB 2JJ2A 2CDNA 3LD9A 5GJVC 4BGDA 4HATA 1NI3A 3DVLA 1FNMA 2IYXA 3NBZC 1LS1A 1KSGA 3SHWA 3E5HA 3IEVA 2XGJA 1ZNWA 2Q9CA 4DC9A 4KFRA 1N2CE 1UM8A 1EWRA 1JI0A 4POAA 4V0ME 3I4LA 4D4JA 4BRUA 4AG5A 2WWGA 1Z29A 1QG2A 3FYHA 2QORA 1J8MF 3AQ4A 1FFHA 1PVOA 1E98A 1XJQA 3QVUA 1T3SA 2QY9A 3DM5A 2YOGA 3F5FA 2GXUA 2ODWA 2OAP1 2IWRA 1YVDA 3FB4A 4IXNA 3EIEA 2F55A 2BCGY 3W6PA 1FL9A 1KI8A 1U98A 3AP2A 4P31A 4TQ9A 2QPOA 4QNRA 1D2EA 4NE2A 4XIGS 1SKYE 3K70D 5HKKD 1R5OA 4S35A 2BWJA 1A82A 2ZE5A 1K8RA 2ODEA 3H86A 5JWOA 1ZMXA 3MWLA 3PEVA 3T1OA 5BQ5A 4AKHA 3K0EA 4P3YA 2WICA 3U6KA 1W4RA 5A0FA 2XTZA 3BB1A 4EKDA 1T5IA 4K8OA 2DHRA 2XJ4A 4HZUA 4FI3C 5JEEA 1XD2A 4DSTA 4R71A 3GLIB 1OB2A 3BOSA 2JJ8A 3C5CA 1M6NA 4RFVA 3WYFA 2J45A 4TMWA 2ZIAA 3OFNA 5FR2A 1OKKD 4KFTA 4ZDWA 4C0KA 5LDDC 1KKMA 1UBCA 4MA4A 2Z4SA 1YR8A 4LHVA 4NZYA 4LJAA 1T4GA 4IVRA 4JMPA 2WPDD 3QEOA 4QFMA 2CL7X 1QHXA 2VP2A 4DT1B 1NY6A 2A78A 1NJGA 3ZLJA 3HJNA 2OFOA 2IT1A 2P2LA 4D25A 4OQXA 4NL4H 2OM2A 4B47A 2QN6A 1EFRA 1P60A 2VYFA 2IA5A 3BK7A 2QAGC 3W6OA 3P26A 1CJKC 2QT1A 4M9SA 5G3ZA 3QKSA 3R8CA 3QKRA 2PZEA 4NHOA 1F3OA 1SXJC 5AUQA 4DLRA 2Z83A 4KLZA 4Q01A 3B1ZA 1V5WA 5FI1B 1HH4A 1LTQA 4JVMA 1E2MA 1PV4A 1ZBDA 2QT0A 5FFMA 5DISB 4BWYA 3Q5DA 1RPZA 2ATVA 1MO5A 2C04A 2IXFA 4IEIA 1Q0UA 4JT4A 4C30A 2XSZA 4DT1A 2GXAA 2B21A 3GCGA 3K9LA 2ZI9A 4N0EA 4M1MA 3W34A 3AKEA 3K70C 4PAQA 3CW2A 2CJWB 2C96A 3WNCA 3MWYW 2BKEA 1TX4B 2QE7A 3K09A 4LJ6A 4EIWA 2YYZA 2ZITA 3TQCA 1PLLA 1GDDA 1SQ5A 3EA0A 1E79A 4FCVA 3Q5EA 3QY0A 1IN6A 2GDJA 1UEIA 4PSVA 4LPSA 4B33A 4F91B 2V1XA 4C0AC 1OE0A 5C4GB 3A6PC 1ZM4A 1FTNA 3NBFA 5G3YA 1BMFA 1E2DA 1OH5A 3OEED 1Z0JA 4UXJA 2EQBA 4NCKA 2ZTSA 2VHUA 5HZHA 4O2RA 3PUZA 4GZLA 2Z0MA 2KI5A 1G4AE 4LCBA 1DBSA 2PX0A 3ADDA 1E2QA 4Q7MB 3THYB 1ZD9A 2XNDA 1Z3IX 3LH5A 1KK0A 5TARA 2GBLA 2AK2A 1Z07A 3NDPA 3TGPA 4TZ6A 1N0UA 1W4AA 1C9KA 5G40A 2QTFA 2V55B 1R0YA 2EWWA 2P67A 1U8ZA 4MUBA 3RNLA 1FTSA 3NH6A 1DO2A 4KBGA 3RS5A 2AD1A 4TL9A 2O0HA 2PLFA 4Q9JA 3U60B 2ZVQX 4B3GA 3H2YA 4YXWD 1G3QA 4AC9A 3EZ9A 2ANBA 2NZJA 4JLNA 5EE9A 1OFTA 4HZIA 3UWKA 1U0JA 4Z1MA 2R8RA 1M7BA 5JHGB 1IN8A 1SVOA 3ZYCA 4Q1DA 2BOVA 2GBLC 2CJWA 5TVKA 1P7CA 3OFND 4YONB 2GWHA 2H7VA 2YKGA 3U3KA 4DDVA 1A7JA 4OI0A 1HURA 3AVXA 4KYIB 3UMRA 3WP0A 4NCHA 3LNCA 3KQLA 1Z0IA 2RGCA 1Z22A 1ELOA 4R7ZA 1NBME 4RD1A 1E9EA 1IY0A 3QXHA 1FUKA 1ZUIA 4Q66C 1P2UA 2AKAB 2XB4A 4O0MA 1LW7A 4PC2A 4AKGA 1B0UA 4Q4JB 1NRJB 2CNWA 3BRWD 1OH7A 1IONA 1Q1ZA 3D31A 3EC2A 2P5TB 4Q9HA 1U0LA 2YVUA 2P6RA 2GESA 4URUR 3X1YA 4DSUA 2HXSA 3IILA 3Q7QA 3SJCA 3A58B 5CM9C 1DAIA 5JEDA 2ONJA 4C7OA 4MRVA 1TU4A 1S4QA 1KHTA 2FG5A 2B6HA 5BYKA 4UXHA 1VECA 2N42A 3CRW1 3W3AA 3K8YA 1R10A 4C4PA 5KUTA 3WHLA 4LBYA 4LHWA 2QBYB 2XSZD 3LV8A 5IT5A 2QU8A 4ARZA 4IRUB 1G291 3TAUA 3J81k 3PUVA 2WSMA 4XVQA 4DLVA 3P4YA 4O3MA 3ICQB 2V7QD 1OXTA 1SKYB 2YWHA 3DHWC 1GILA 221PA 1CR0A 2ZRPA 1IM2A 2CVHA 4E09A 3AGQA 4M9ZA 1ANKA 4JL8A 2OSBA 3R7WA 3A37A 2NO0A 1NF3A 3SQWA 4QC2A 2JLZA 5KNDA 3T34A 5TMPA 4GMXA 1JB1A 1S9HA 2GRJA 4W5HA 3GLIE 1Z6XA 1W4CA 5CYOA 2FX3A 2IYYA 4RCYA 2R6FA 2AD5A 1L8QA 2OBMA 3EPJA 3JZAA 3I8SA 5CLLA 3DO6A 3FHOA 3KKQA 4WXRA 3LLUA 2GK7A 1XTQA 2BMFA 1EK0A 3OAAA 1X1SA 2G77B 3DEFA 3K09C 3KFXA 1MO4A 5DI9A 3T5DA 4NP6A 2BVNA 1GTVA 2WWIA 4BFVA 1NVVR 2WMOB 3RRYA 2BMEA 2CL0X 2BM1A 4HI0E 1F2UA 3QVVA 4DCUA 2KBEA 1N6KA 4V0MA 5BXQC 2W2TA 1DS6A 2XTMA 1AQUA 2JASA 4MRSA 1NIJA 1RKBA 4E03A 4NU0A 4B76A 2Z5FA 4XVRA 3TRFA 3HWSA 3KXIA 4WOPA 2ZRDA 2OCAA 2ZREA 4Q4JA 4F4IA 4MGKR 2JDIA 1QBKC 3KKPA 2VHQA 1ZM3A 1VYTA 2CLDX 2PMKA 5FPSA 2GZAA 3SYKA 4K46A 1ZC4A 2OAQ1 1D9ZA 4DLXA 2PT7A 2NOAA 1E4VA 3U7GA 3GFOA 4M2LA 2ORIA 5AJXA 1SHZA 1QHHB 4FW9A 3LDAA 5DI3B 3B1WA 5CIWA 5FR1A 4A1FA 1T0HB 1JR6A 2ZYVX 1G3MA 2A9KA 3HYRA 5CDFA 5AWFC 2EFEB 3LA6A 5JMTA 1S1MA 1G8YA 1G8PA 2QAGA 1GKUB 1UBEA 3KQUA 5LD2B 3ASYA 3CX6A 3DZ8A 1KAGA 4FIDA 3AF2A 1NSFA 1FZQA 4Q1AA 3N70A 3CF0A 4GP7A 5DYGA 1AJEA 4E07A 4TYWA 3V00A 4B6FA 5C18A 3VNUA 2QSZA 3NBYC 4WBSA 4HDCA 2ONKA 2GJKA 2J46A 1T6NA 4WVFA 2WIAA 3GJ3A 1KDPA 4KV9A 5K8LA 2BDTA 3NBXX 1J8YF 3CR7A 4C7OB 4KLNA 4TTRA 5FOVA 2W0SA 4OHWA 2KB0A 4NBSA 1U8AA 2YJTD 1IY2A 2OG2A 4X8LA 2CCGA 5FL7D 1OPXA 1AKYA 1M7GA 1ONBA 4Q48A 4PHFA 2TMKA 3KL4A 3U3MA 1TMKA 5AJWA 2ZQ5A 3T61A 1T8TA 4LBZA 4A0FA 1DEKA 5H70A 4BZQA 1Z6TA 1EWQA 2WM9B 2ZAMA 1WXQA 1XEXA 1KO8A 2RGXA 1ZUNB 2V1UA 4EJSB 4LV5B 3Q85A 4HDOB 4A92A 4ZCIA 4URWR 2OBLA 3KJHA 4WXPA 3VAAA 2IUSA 5KNCA 1R0ZA 3CM0A 4OHXA 2H16A 3GEHA 2ZI5A 2FFHA 3QPWA 5KSZA 3RS4A 2IF0A 2O8FA 1JJVA 1D6JA 1GSIA 1RJ9A 1VG0B 4RFSA 1Z47A 3BB4A 1S9DA 3IHLA 3L0OA 4JVNA 1CRPA 121PA 3K0FB 4XJXA 1XJCA 2IWHA 4EFMA 1H65A 3MUFA 3W5JA 3IPYA 1CR2A 2QGNA 4BE7B 4C2TA 2QMHA 4HUTA 5KYKA 1Z0FA 1E0SA 5GJWC 1Z0DA 4LV8B 4TZ0A 2F1HA 3HU2A 2VQSA 3QXJA 2YC4C 4KO8A 2RGGA 3ZH9B 1M8PA 1XCPA 2C9YA 2ZI3A 3SJZA 1TU3A 4PZYA 3THOA 2J7KA 1P2SA 4DSNA 1T8UA 1NN3A 4FMCF 4I99A 3B5JA 2D2EA 3THWA 2JAQA 2WOJA 4NH0A 4D0NA 5K8IA 2ZSBA 4LHZA 3REGA 2OCYC 2QAGB 1E2FA 3NTUA 1VIYA 2CLCX 1P5ZB 2GNOA 1Z8FA 4QXAA 4JBYA 1AN0A 2RKOA 1Z5ZA 4BZXA 3V4FA 4JSYA 4P4UA 3Q7PA 4L9SA 4OJKA 3H84A 1ZCBA 3ND8A 1M34E 1YZUA 1K5DA 2C03A 1PUJA 1HT1E 2UKDA 4JLAA 2H1LA 2Q3FA 2IHYA 1XF9A 1W7AA 1QF9A 2VL7A 4TSFD 1N6OA 4Q4AA 3RS3A 4ILEA 2GAAA 2H17A 3TBKA 3GLGE 5FPKA 1BO6A 1RRPA 5FTMA 3MSXA 3GLIA 2RGAA 3DKPA 1E1RD 4LZZA 1AS0A 3LY5A 5EE5B 3EPLA 3TQFA 3W90A 5CLQA 4XWAA 2QUZA 1TQ2A 4OQMA 1V43A 3LLMA 2Q21A 1KI9A 3LO5A 3WXMA 1CKEA 1OJLA 2ZUDA 1ZM9A 1R7RA 3OEHA 4A36A 4M1TA 3VQTA 1HTWA 4KJZA 2WJJA 2F9MA 2ZJYA 3VR5A 1IAQA 3PEWA 1U94A 3GLFE 4PPGA 2JLQA 3A36A 3IEUA 1DG1G 1GM5A 1SXJE 2PLRA 3ONWA 1J99A 3V4RA 3BXZA 4UNSA 2X19A 5IK2A 1VPLA 4OQNA 1WBDA 4J0QA 5CYPA 4ZV4A 4U7DA 3CBQA 4HDQB 2QP4A 1EFRD 3C15C 4ASUA 1MH1A 1NMYA 1UEJA 1JPNA 2NO7A 1GNPA 3GJ6A 3WHKA 4GDFA 4PC6A 4M1SA 1HYQA 3P32A 4XH9B 1E1QD 3UK6A 4QGHA 1OXUA 3KJEA 4B35A 2ZS8A 3CPHA 2V54A 2FPLA 4Z8XA 621PA 2QPTA 3CPEA 2ZRAA 2ZUCA 1R8SA 2O8FB 5IDVA 2GJSA 3X2SA 2ZRFA 3R8FA 5HTKA 4HLQB 5EXPA 4A9AA 4L16A 2IS6A 1I4LD 2ZI7A 1LY1A 2ZRGA 3Q8XB 1I4TD 4F7WA 3EWSA 5KOYA 1IN7A 3GJ8A 4DEYA 2R6CA 2HJGA 2FA9A 5JCPA 2WJGA 1UPTA 3BFVA 2P65A 2FPMA 4Z51A 1AK2A 1NN1A 2FGJA 3GJ4A 4CRWB 1SKQA 1P3JA 1FMJA 2DWOA 4KVGA 1GRRA 3EZFA 3QKTA 2QPAA 3AB3A 4OI4A 1G41A 2ZSAA 4UJ5A 3OEEA 1MABB 2FFQA 1EX6A 4A2WA 1G20E 3BC1A 4UNRA 5FOWA 1XD8A 4OQLA 1FNNA 1KTVA 1A2BA 1Z28A 4HUQA 3X1DA 4YDSA 1II9A 2W58A 4MRNA 4LJ4A 1QHGA 2FOLA 1SXJB 1XMJA 3PV0A 4JZKA 4HAYA 5EUQB 3W3ZB 5BYJA 4DVGA 3TR5A 3Q3JB 5DNYB 1A4RA 3U5ZB 4GSYA 1G7RA 4BLQA 5J4YA 1TEXA 2OCPA 3RANA 4B75A 2QSYA 5FBVB 4D0LB 1EESA 4A4DA 3C41J 5B30A 2WAXA 4BLRA 2AXPA 3C7KA 1N25A 4D80A 2NTYC 1MABA 2AWOA 5KDOA 1KGDA 2PBRA 5D3QA 3QJYA 1NKSA 5LB4A 2O8DB 1Q3TA 4DCNA 3CZPA 3U6BA 1U2RA 1YHNA 4D4MA 3QENA 4JKIA 3AKCA 4F4CA 3C5HA 2VSOA 3ZZTA 5TV2A 4OHYA 2Q3HA 4LJYA 4Q4AB 3QF7A 4GZMA 2WWYA 2IYRA 5KDDA 4PO1A 3TAHA 3S1AA 4MDEA 1OYYA 3U44A 4P32A 4WIAA 1NL3A 1OIXA 3EA5A 3B2EA 3SS8A 4HEJA 3K0AA 4Q9LA 4Y0VA 1UBGA 1Q20A 2F1JA 4TL6A 3RS7A 1KMHA 4HLUC 2X2EA 1WP9A 3AV0B 1KI6B 3QNUA 2PJRA 4I1UA 2EFCB 1VHTA 4RZXA 5DH9A 4K81B 4TLAA 1EG7A 1U99A 2YINC 4LYJA 4JVSB 2C8VA 2JLUA 1JAIA 1KY3A 4GOXA 1PZNA 4NYIR 1SZPA 4EPTA 5DLQC 2CE2X 1UJ2A 1UBFA 1CULC 2QTVB 1T3HA 4HAXA 1I2MA 3BD9A 1GRNA 1KZGB 1FW6A 1G5PA 4W7SA 4ZDKA 1W2GA 2BMJA 4AG6A 3RHFA 1ZU4A 4BLSA 2XZOA 3R9WA 4FN5A 1CU1A 1KMHB 1OIWA 1COWD 2HF9A 2WVJA 2CHGA 1P62B 2HUPA 4NMMA 1XEWY 1X8KA 5DN6D 5JJLA 3TIFA 1EFUA 1WQ1R 1VYUA 2C95A 1JQJC 6Q21A 4HAVA 3MGCA 4LJ9A 2W6JD 2GHIA 1Q1BA 2P5SA 3HR8A 4M9XA 4O2LA 1XTKA 3VKGA 1ZU5A 1Z63A 2GJ8A 2IL1A 3QG1A 2AWNA 2ZJ5A 3OE7A 4N3NA 3RVBA 4CT5A 3B9QA 4NCJA 2B7BA 2XITA 3MD0A 3UATA 2GJAA 3EIHA 4PPNA 3TLXA 3QE0A 2D62A 3AF0A 3WMEA 2VF8A 5F2EA 1PLKA 1TAGA 4PPQA 721PA 1ZD8A 2ZYUX 4FXPA 1GP2A 5JWHA 3SN6A 4A15A 4CYMA 2R6GA 2FE4A 2WJYA 1RVDA 3PIRA 2OLJA 1KJYA 4G01B 1T3LA 1N6NA 2VHCA 4M53A 1P75A 5DHAA 1E99A 1JNYA 4HLDA 2WSSA 2B7CA 5JS8A 1G3UA 1E4YA 3AF4A 3PUXA 1W5SA 2ZS9A 1KI6A 3DZDA 1NN5A 2AKYA 1Y3AA 1XRJA 1NY5A 1CF4A 3TSWA 1U8YA 3RYTC 3I5YA 4D26A 4B34A 3CF6R 1YQTA 2BJWA 2EWVA 3ADCA 4D82A 2JLVA 1N0WA 3JZMA 1KI1A 1UKEA 1ZD1A 1N5IA 2EYUA 1R5BA 1MT0A 4DDUA 1WCV1 2A5DA 2D74A 4HYYA 4R2HA 4TLBA 2J87A 1MV5A 3SEAA 3CKLA 4XVUA 2RCNA 1EXMA 1KK1A 2KBFA 2WAYA 2VP0A 4HAZA 2D2FA 2YWFA 3CX8A 4DLYA 1E2GA 4D2IA 4YMVA 1AS2A 1I4DD 2YOHA 1TF7A 1TUIA 1BOFA 4KVAA 4QGFA 3U3JA 1QVRA 5CJ2A 4BRWA 4LYHA 4OI1A 3VMFA 4B3BA 5HPYB 4DDWA 3SQXA 5L3VA 3ZD7A 2FFAA 1XEFA 3IDQA 5FOTA 1QVAA 3BH0A 4UXIA 3CF2A 3TW8B 2ZPTX 4I1SA 2D7DA 3QBTA 1OV4A 4ESVA 2YWEA 2GZDA 2QAJA 3FE2A 1Z0KA 4RY2A 1LF0A 5F9FA 3CPJB 3ZS8A 1XDBA 3VR3A 1K5GA 5KPDA 1JR3E 3DKVA 4M1OA 5AUOB 4XD7D 2BBWA 2ERYA 2AFIE 1N5JA 1IN4A 1AS3A 3U3RA 3FPAA 3G82C 1GOTA 5KHOC 3GD7A 4JKYA 1W0JD 1IN5A 4IVPA 3WP1B 5FBRB 3WRXC 2ATXA 4AIIA 2WV9A 4A6XA 4JYBA 2FH5B 2W6IA 4TLDA 4I4LA 2DFTA 1G7SA 4TWZA 1W47A 1ZUHA 4WZ6A 4L5BA 2RGBA 3FHCB 4G3XA 4RD2A 3ZZUA 5K8UA 1W49A 3PFIA 2EYQA 4BUJA 3NEYA 4G5OA 3FMOB 1E9AA 1KIMA 1E69A 4TL8A 3GMTA 4EFLA 3BWDD 5DO9A 3VX4A 3DPUA 4ABYA 3RWMB 3UG6A 4HLUA 421PA 2VH5R 3CIOA 1T91A 1GAJA 3D3QA 3SE0A 1P61B 5J4VA 3UMSA 2XNSA 3AVPA 3RC3A 1KK2A 2IYLD 4I1OA 4L4UA 3ZDQA 3CH5A 4RVCA 3B82A 4RD6A 3O47A 4YDHB 2W0MA 4L8GA 1XZPA 4M4SA 2I1QA 1S3SA 2CMKA 3KZ1E 2ZSDA 3BBPA 2RMKA 3U7EB 4DXAA 4LPKA 3ICEA 4YLGA 2KSQA 3KQKA 5JI3E 4EPVA 3IKJA 1VTKA 4PSAA 4B74A 1E32A 3C8UA 4C0SA 3NC1C 2J0SA 5JCZA 4ZCMA 4JSTA 4Z8YA 3RLFA 2DR3A 2VP9A 2LKCA 4IXMA 3OAAD 3AEZA 2ZSFA 1L2TA 2GK6A 2XTNA 2P3SA 3GJ5A 2QL6A 4DLUA 1MKYA 4QM6A 2ZJZA 2D7CA 1XZQA 1G4UR 2NO1A 3CNNA 5HE9A 4ARZB 2C5LA 1KNXA 1YJ5A 3VR1A 1H8EA 3QPVA 2O8DA 1KO5A 4JL6A 5JFGA 2ZR0A 1MRSA 2ZE7A 2OLKA 1YZKA 2ZRMA 3ZZ0A 4PANA 4ZI3A 3A1UA 5EP2A 5BW8A 1XFAA 2HCBA 2JJ2D 3KKNA 1YE8A 1DG3A 5C46F 3REFA 3THXA 1TUEA 2QA5A 2FDCA 1W2HA 2C78A 2CL6X 1KI7A 4IOLA 5E7MA 2JIZA 3UIEA 5JJIA 5IK2D 3WMFA 1RE0A 3OIUA 4QBFA 1XMSA 4QBHA 4GP6A 3ADBA 1GRQA 2VTKA 1D8TA 1SVWA 3EASA 1XEWX 3IUYA 1II8A 1TL7C 4P33A 2IHBA 2ZYWX 4NCNA 3KKOA 2WBLC 2V9PA 5FUVA 4G5QA 3N2EA 4GNKA 4W5WA 3T15A 1OFIA 4QJ4A 3T35A 2OBNA
chains in the Genus database with same CATH superfamily
1NVTA 2AQHA 3NIBA 1OW3B 4CR8A 3I45A 1M7HA 4ZPXA 1EK6A 5JLJA 1BGXT 3W7VA 4P36A 2VCEA 5AYVA 3KG2A 1JIUA 4R3UC 5ERXA 4YBZA 5ISMA 3GLTA 4B0PA 3WIEA 1A5BB 3THYA 3OQOA 4UHDA 1H94A 1WB6A 1M0SA 4P32A 1VIAA 6GPBA 3W6ZA 2ZE6A 2YV3A 5EQFA 5EWJA 2XIJA 4BQIA 2HSEA 2WVGA 4MVJE 2OUKA 1Y98A 1X2EA 1E2HA 2VA8A 4OAOA 4JQCA 3L7DA 3TQTA 1K9SA 1BD3A 3ZQ4A 1NNUA 1Y3FE 3KFVA 4M60A 3VBCA 4E5SA 2JLWA 5HIJA 5THXA 2PSFA 4AY2A 4BNJA 4UEKA 2J7PA 3C14C 2FX5A 3KDPA 1G1MA 1P1JA 1T5HX 3PICA 4KSYA 4QG3A 2HGZA 1N57A 5JSUA 3PJRA 5HMMA 4I1RA 2VYCA 2P6NA 4J0CA 4B6GA 3CLSC 3EIFA 5B1IA 3TFWA 2ZT5A 2X14A 2ZAYA 3PYLA 1S2MA 3HCPA 3QUCA 1OREA 5DF1A 4AURA 8AT1A 3FOWA 2DX7A 5FTLA 1E7MA 1TE2A 1ZM7A 2XYGA 4QELA 1CQJB 3AYZB 2CK3D 3NH9A 1I2DA 4X7RA 5BOSB 4DJAA 3WAGA 1KMIY 2BM0A 3U2QA 1PYGA 1IJKA 1A8UA 1PJ4A 2XQIA 2YWJA 4URXR 5IG2A 2RC6A 4WLFA 5FI0B 2IDMA 1R66A 2FETA 3WE7A 2A30A 1SPBS 1M1YB 3AERA 1D2HA 4NS1A 4YRBA 2HK9A 3Q9NA 3QELB 1NPYA 5FKJA 3IBGA 4P3OA 4CF3A 1YNOA 4QHTA 3NWOA 2VAVA 4NYMQ 4UHEA 4F93B 4A6DA 2FEKA 3ONVA 4XYGA 3RU3A 2E82A 1QGZA 1KFBB 3DNFA 3EDQA 4WACA 2DFLA 4QDOA 4X1YB 4ZCSA 1KDZA 3KK0A 2Z4RA 3RABA 1L1RA 3E2MA 3HUFA 3D6AA 3M6AA 2BTEA 1CEQA 2HLPA 1U0HC 3BQMB 2AR7A 3IQIX 2NXCA 2PH1A 2ZWIA 1SUBA 3SK0A 2WYWA 4QGGA 4ESHA 3LW8A 1EB8A 2P8SA 3UJ8A 2F43A 3NHYA 4R41A 4HLNA 5F3RA 1NR7A 4DQ0A 1Y7PA 5IDYA 3SD7A 1VGRA 4CN9A 1MOZA 1V5GA 3GLHA 1OLSB 3VU3A 1ZL2A 4MPPA 2GCNA 4G0WA 2DPXA 4D3DA 5AKYA 4JH0A 1ADJA 1CZOA 4RZ2A 2Q8PA 2Z3WA 3CEAA 4WT7A 1K6MA 1XDWA 3TWOA 4WZBA 5J2UB 4ZEMA 1T4BA 2F90A 5KTYA 5LQNA 3DL2A 4RMHA 3WQSB 1RWMA 1NQUA 4A8HA 1Q17A 1L8LA 1QQTA 3I9MA 2C0CA 1U0TA 3M81A 2ZW9A 1XMVA 5KQMA 1HNXB 2PUDA 4HD8A 1OXMA 1OQAA 5F5LA 4A6EA 3D6VA 1HE4A 3P9PA 2BV3A 2ZRBA 4MPDA 4JV5B 2KLBA 1F8GA 2HOQA 3HCCA 4L9WA 4P7FA 2ZULA 5L6MB 1PTKA 1C8LA 2FQWA 3F9IA 1UANA 2PT5A 2X9VA 1F9AA 2P5YA 2XMPA 4XLTA 4FM9A 3VI4B 3I2YX 3L7AA 2Q45A 2PUHA 3PPVA 3C70A 3FGOA 3WL6A 3KOWA 4RZSA 1Z17A 4KVFA 4F56A 3IO3A 3ROEA 4OJQA 5K45A 1TNDA 1PK9A 4MV7A 2ZBDA 4U3JB 5I7AA 3TAXA 3VPBA 4AZVA 3D6HA 3NTOA 3D7KA 3HVKA 3ICCA 4HFJA 2IK8A 1XZ8A 2WYVA 4R2XA 5EKXA 4H31A 3ACCA 5GM2A 2C9OA 1QH8A 1NYRA 4MMXB 1EMDA 5BQOA 3TXAA 5K8CA 1LX7A 1I7DA 4LV6A 1PHRA 1VGVA 3IAS1 3IE0A 4XJVA 1BIFA 1RCUA 1DMRA 2J3QA 4PO9A 1YRLA 1OGJA 2PZLA 3RUFA 3SKYA 2AFIB 4L08A 1PJCA 2A7XA 4CDRA 4ZPJA 1QDUA 3KUDA 2YNMC 4ZRMA 4AKIA 3MGKA 4JYPA 3ETEA 4L15A 4F3YA 4G5XA 4B80A 1MW8X 1XDDA 2DFNA 2ZTUA 1Z7GA 2QJTA 3HYTA 3NBQA 3ACDA 4UW9A 1DKLA 1CUBA 3LLCA 4KLRA 2GH1A 3ZWYA 3U4QB 4G0XA 5J43A 5HWSA 1E2JA 2FYTA 3TTUA 3W5AA 2VYVA 3BMQA 3GR6A 2W98A 2SICE 3M1IA 5IANA 1OFHA 3A70A 4CL2A 2HPVA 4HQ6A 4M8LA 4E6EA 3B7GA 5I45A 5FADA 5JTUA 3WGVA 2PFSA 5JRZA 5D8DA 3NHLA 2FXIA 4TYNA 4RKQA 2CMFA 3UWPA 5BNIA 1ETHA 1XZCA 3LPNA 4KIJA 4AG3A 4GOMD 3BL8A 2XUOA 4EGJA 2V7BA 4KI0A 1MCZA 4LRYA 5KVAA 1E9DA 1LBTA 1U4SA 5GADl 3VRHA 5FFNA 4ZQFA 5KWEA 1VZ3A 4K9DA 4P98A 1TA9A 4PCAA 4HH4A 1C3LA 2H4FA 3E7FA 3OKCA 3DE0X 4R16A 1PL8A 1T10A 5AOVA 4EHBA 3FAKA 1KH3A 2WG1A 4FBMA 5LSAA 2R7AA 3X1KA 4ALIA 1YAJA 1YBAA 1XTPA 4RVUA 4DR1B 4MV3A 2HXYA 3AR3A 3HFSA 4NK4A 4AD8A 4CUKA 2FTKE 2JAPA 4L57A 4NBNA 1EP3B 4Y2SA 3LVRE 1MZVA 1UFQA 5WRFA 3F7OA 3VPSA 4D8WA 1SU4A 3PCXA 4O33A 4LJ5A 2LXNA 4IY1A 4MRMA 3T9CA 2HX1A 4BUZA 1PZGA 2IXTA 4QXOA 4U9IS 3B6IA 1G17A 3K0CA 2Z9CA 2XKJE 2BBTA 1RC0A 3A3NA 4B40A 1M34A 1ZOIA 1E59A 4I0WB 3SBOA 1I7NA 3TDKA 3T3GA 5BN3A 1AB5A 1L8OA 4Z0NA 5LXTA 3FTFA 1N33B 2ZBUA 1YOBA 1GYRA 1Y6QA 3HU3A 5B6PA 4E2WA 4YRRA 1NP6A 3GLKA 9GPBA 5IF3A 3ODPA 4GXQA 1GN9A 5LP1A 1GG5A 2ES4A 2I4RA 2PRJA 3KD2A 4ICIA 5GVRA 2BH9A 4GR9A 1RWNA 1ZRHA 3ZVRA 3ZGZA 2ZBPA 1MFZA 3B89A 4Q9KA 2LV8A 4LBWA 5FUXA 3WI7A 1XALA 4CG3A 1YC5A 1ZN7A 2VF4X 2XBMA 2G83A 2E89A 1S89A 5IZCC 2A2ZA 1MENA 1LEHA 3DEZA 4V0KA 4QUIA 3H2BA 4X65B 1EE9A 1M6WA 2GRAA 3TX2A 4JC0A 3UJ7A 5B1HA 1BN7A 1JXMA 4D1YA 1T13A 2ZRLA 3AETA 4YJKA 3W2EA 1UODA 2HB6A 4W9MC 1CS0B 3K0CC 4FN4A 4X0EA 4FSHA 2VIIA 3ROPA 3P71T 1FP6A 4M83A 5JS7A 1MMFB 4BVJA 2BMDA 4A16A 1YGPA 4QJ3A 4TQUS 1FX1A 2N3ZA 2UZIR 2VXCA 3QKRB 1KP9A 1CFJA 4X6UA 5KNCD 1ZSNA 1QGUA 1WNFA 2JFZA 1A1SA 3AP1A 3GW8A 5IC6A 1HM5A 1TC1A 4B43A 4B3TB 1OZHA 2VRBA 3VVMA 3AFOA 3HCRA 1U5BB 1V8DA 3L79A 1T9CA 4JLSA 2R1TA 4WOBA 3CZQA 1BE1A 2WF9A 3A1SA 3L6UA 4HAUA 4CDMA 4RVNA 3K2BA 4CLXA 1KEEA 2C3UA 4C0HA 4CMEC 1MFPA 2QMUA 2QVGA 5CDTA 4K9RA 1UAAA 3RV4A 3EVEA 2G6BA 1N0HA 1JH8A 3DFIA 2FSSA 5JFTA 5IDXA 3FSEA 4QUGA 5LYJF 2XAAA 1DC6A 2R65A 4GM4A 4JAVC 5EZ6B 1Z68A 3EG5A 2PMDA 3KSRA 1S8OA 3LRPA 1BX0A 3AUXA 4YAOA 1TAUA 2P69A 3ROQA 4NDZA 3QYJA 4U7WA 3PYXA 1GSHA 3EGDB 4A7PA 1DX9A 4BNYA 3I1JA 3HCDA 2IPMA 4AX8A 4XD7A 4IJ6A 3LSTA 3RS0A 1IHDA 2A35A 3JYPA 1GZ6A 1X15A 4L8YA 4B6RA 1ZK2A 1QC5B 2FP3A 4Y2GA 5CA0F 2BEJA 1TMOA 7MHTA 4RPJA 1M6HA 3I3OA 1GPAA 2ATEA 4W63A 5JSYA 2AN9A 4X7BA 3QIAA 1VSUA 2VPIA 3EPRA 3ICWA 2VDOB 5KHLB 4CIXA 2X15A 2M1XA 4X1IA 3N0VA 4I19A 3B1XA 1KSFX 3LKBA 4BNVA 3I0MA 5ALJA 1NMQA 1P0CA 1TM5E 3OO0A 4CL0A 1QQ7A 3PGMA 3LUGA 4IYJA 3A1TA 2P75A 4K88A 4LK3A 2VHYA 5JSHA 1SBQA 2ZYRA 3O4HA 4LK2A 1XPRA 1R8JA 1G6OA 1T5DX 5A5EA 1JT2A 5KJ1A 3E7PA 2O8BB 5FV7A 4XB6B 4CMBA 5KNBA 4D9FA 1LK7A 5DXJA 3NFYA 1TJYA 3MBIA 1YQXA 1SQGA 2OE2A 3U0BA 3AHEA 3IVCA 1V3QE 4XRGA 4WECA 4KB5A 3EEOA 1ZNQO 2ZYDA 3N2LA 3B9RA 2RC5A 3NAQA 1ZYUA 2A0XA 1ECGA 3KSUA 3TNFA 3P27A 4OGWA 1LJLA 4GKJB 2BMWA 4Q02A 1HDGO 1XU9A 3VHXB 5DHQA 4LY6A 1HG0A 3VZBA 4ZZIA 3HKEB 4QOFA 2FQQA 5ALIA 1H1LA 3Q7RA 5ALPA 2G9ZA 3L41A 4UCFA 4E13A 1YSCA 2CCJA 3X2FA 3OT1A 4LNUA 3H99A 2I6GA 3BXFA 2Y1GA 2AW5A 4D41A 3LK7A 2Y1DA 1DLJA 4BVKA 2OOKA 4C0LA 1UKVY 5C1IA 3VO8A 4B5KA 1OFUA 5JAIA 4WQMA 2PGAA 4JLBA 3BKWA 2V5UA 4HYEA 3NPAA 4EJMA 1YVUA 3MUOA 3ZE8A 3GGPA 4TKMA 1K68A 2X42A 5CD1A 2C2OA 5CFPA 4B3HA 4PFJA 1NUTA 3DTTA 2QE7D 3NEPX 2I1WA 1GTMA 3CKKA 2ZKLA 2OMEA 2I8LA 4YUXA 9LDBA 1H85A 2IYQA 4QD3A 1XSEA 2QTMA 2ZVPX 3R6DA 1SOVA 1BA3A 2VJNA 3KKMA 4KBFA 4QJIA 1N4AA 3U26A 5ES3A 5I9TA 1A27A 1DE0A 3B1FA 3OKAA 4II3A 1BMFD 2GJ9A 1E7RA 1J33A 4G9EA 1TPYA 2YFYA 4EY5A 8ABPA 4KSCA 2ZWAA 2E1RA 3FAZA 4V03A 5HCNA 4CQNA 1A4IA 2Y68A 3VZQA 2BM9A 1WX1A 3RADC 2A1UB 3MOGA 1YCHA 3OBIA 3R3HA 2BLLA 3CNOA 2W2VA 5FUMA 1RI3A 5LKAA 4GOKA 4Y2YA 1Z6AA 3EXIB 3BAZA 3KPYA 3VJKA 1RRFA 4ROTA 2QRQA 4CLOA 1GPDG 2NAPA 4NFLA 4MO9A 4ENWA 3TK1A 3ZHQA 4N8DA 3N58A 2VC2B 1HE8B 3OCVA 1EBBA 5K6RA 2TYSB 3A1WA 1Y63A 5DYIA 2R97A 1T24A 5DM1A 1A8IA 5LU9A 3AKYA 2WJ6A 1Z0AA 3LCRA 4P34A 1IM8A 3RFXA 1X7XB 1VL1A 1XLVA 3QSYA 1J9GA 3EC1A 1NW7A 1IJFA 1PR0A 3UXMA 3RVMA 4BJ1A 3PGVA 4HY3A 1SBZA 4LXHA 4J0KA 4YJFA 3W8RA 2J0UA 1QOZA 3Q2KA 4V0SA 1CTQA 5EQDA 5A03A 2C77A 1HE1C 2H59A 5E1BA 5TQJA 3I42A 5HZGA 3NGXA 1JDPA 1A5SB 3D4BA 3UPDA 1S2NA 5AOCA 2X86A 4Y2XA 2JHGA 3L7CA 5ARCA 3VUFA 4L28A 4YRDA 3PGLA 2IYTA 3AZOA 3G5UA 2AA3A 5E6SB 4F5EA 4MPTA 3BH6A 3F74A 4OP2A 4E15A 1EFPB 1HNNA 1M33A 3C3AA 5LP6F 4PZDA 2COKA 2QTTA 1OF1A 3ECAA 5M5BA 3GVPA 2EGHA 5B1SA 3SYLA 3DUWA 4R8SA 5JXGA 3C7CB 4D56A 3LT1A 5H3LA 1CD5A 2R7KA 3ASUA 1YMQA 4AICA 1ABEA 2JBAB 4JWKA 4LWQA 1P33A 3I12A 1ULBA 2ZETA 4HVCA 5AR1A 1MQAA 2I4OA 3O8DA 1O3YA 2DH5A 1SULA 5TRTA 4HVAA 3ESXA 2D0IA 3M4YA 2R11A 1ZKMA 4OFZA 3SI7A 2X4DA 5JFOA 1YZGA 2VDRB 3BZWA 3N5CA 1A8HA 3IUSA 1ZKDA 5CAEB 3LZCA 1RIFA 2INGX 3KS9A 1D6MA 2WUVA 3E7WA 2HADA 2O0JA 3RTCA 3ROXA 2JJ1D 4K87A 4G56A 1NAIA 3ND9A 5DRYA 3NUZA 4O4LF 3TGWA 2VZ9A 3GB9A 3ZIAD 4RZ3A 4Q18A 4EHDA 5LQAA 1RW4A 2IZ0A 2JK1A 4OKSA 4U63A 1UJNA 4ACBA 4YYZA 3OFKA 3ZCPA 4RHTA 1HQKA 4Q7QA 2B2XA 4YUVA 2IYOA 4XVHA 5JPCA 3GCWA 3EEFA 3BL5A 4HZGA 4BEVA 2X3FA 3O3NB 4I3GA 2AX3A 4RH3A 2W9XA 1GAEO 2NU9A 3F3SA 3UHOA 3OZIA 3GEPA 1IQUA 5HZKA 5JO0A 3O4VA 4WADA 1Y7IA 1YJQA 1WP4A 2XBUA 2X0JA 2WWXA 2P4QA 3EAQA 4HMPA 1JEJA 2OBFA 2Q29A 3B48A 3BH7A 5L3RA 4TUYF 1A9ZA 4JOSA 1VYVA 1SVMA 3CO5A 3EF3A 2WFLB 4MEAA 5TEWA 5IAKA 1KKUA 2OXRA 2WA1A 5H80A 2QE6A 3DULA 3WO0A 2G7MC 4A82A 1TD9A 2WDPA 3V1TC 4J4HA 1ONSA 1Z06A 1WULS 1JWAB 1JI3A 1W1WA 1WXDA 3H3JA 3IUBA 3M6MD 2F8TA 2WTUA 1CRWG 2JVIA 2ZIXB 4HYQA 4HDAA 1FU4A 1W25A 1F4LA 1YBMA 2H4HA 4IP0A 4INAA 4QWWA 4RLFA 3AI7A 1XWIA 4ROSA 1PYOA 5EZ5A 2MMGA 1GU1A 3FWZA 1A96A 4MYTA 1RYFA 3DOEA 7REQA 2GTPA 2PGOA 4O08A 1CBUA 1OCEA 1UJCA 3F3KA 4FMDB 1JSCA 3G0HA 1EH5A 4ZCLA 2NZ8A 3D4IA 4DNXA 1NGSA 5DCLA 1GA4A 4NYIQ 5JD5A 4Q5IA 4IDHA 2Z2IA 1P8AA 1ZGGA 2UYQA 3PQCA 4K1LA 1T5TA 2X5NA 2XUDA 4JLJA 1SQ0A 2BFBB 3RAPR 1SG0A 1MPXA 3G23A 1TFUA 3ESZA 1FNSA 3D3NA 3OM0A 3QU7A 1B23P 4TV8A 2WD8A 4WNYA 2EFHB 1HEIA 1GGJA 3AUSA 1TAQA 4P4GA 1GU0A 2O0LA 4ECAA 1OAAA 5A3VA 5F7ZA 5HZMA 1I36A 3ELDA 2AFRA 4X3OA 4JI0B 1B00A 3HXTA 4FEAA 4KN5A 4LY3A 4O4IF 2XOEA 4QTYA 4I55A 1AV6A 5AI4A 4GGOA 1Y5LA 2QMZA 3PFCA 4X41A 1A88A 3WBBA 1JTFA 3EPHA 4BPRA 1LD3A 1JDJA 3COSA 1WE2A 3L82B 1NBOA 1TUBB 1KNQA 3OIWA 1SKBA 3HVUA 1AQNA 1RZRA 4GMKA 2CVFA 2ECKA 2SNIE 4AMYA 5KTNA 2XUQA 1Q12A 3KYJB 1OSNA 3K4QA 1D1PA 4H17A 3JU3A 2ZBQA 3FMFA 4YJDA 5EIBD 4B32A 1Z73A 2CMGA 1KQPA 3M4NA 4GRIA 3OLYA 1P77A 5KIAA 1YL6A 4C7KA 2WE7A 2XGOA 5AW9A 4F71A 5I9MA 3I72A 4PX9A 1QS0B 1CY6A 2NO6A 2IX3A 2JA2A 2W6NA 3CLVA 2X0DA 1YI1A 1OYVA 1J5XA 3TVTA 3PNSA 1RCTE 1VB3A 2KPOA 2JATA 2YHUA 1QTNA 3KYDA 2LPMA 4PFQA 2ERCA 4WA7A 3RQSA 4OSEA 2GZHA 5DHTA 1FCJA 2XNDD 2ZRKA 1RZVA 1KAHA 3MFQA 4OBEA 2Q7DA 3CONA 1HPLA 3TZ6A 2P11A 1S96A 1UKCA 3MB5A 3ZC3A 4D02A 2Y99A 1XA3A 4X85A 1EXVA 2ORWA 1AC5A 1IZYA 2OB1A 4KFUA 1LKZA 2EERA 4N5DA 4ETWA 1KAOA 1NASA 1NVBA 1ZOOA 4II7A 1P6XA 4RTKA 5HRAA 1AB6A 1DXHA 4IS2A 4NENB 5D1HA 2MIIA 5ENDA 3TR0A 2PO5A 3L4BC 1D3AA 3JQ6A 3SZRA 1HYBA 3AEQA 3TLGA 4FQ7A 2PJUA 4XKJA 1NRXA 1VG1A 5HOQA 2QD4A 3AERB 3SZOA 4EX6A 1RXIA 1NZJA 1XP5A 5EUMA 3H4TA 1II8B 2B1QA 4X8HA 4HWGA 3MA0A 3NP9A 1E18A 5DN6A 1JJIA 1CQPA 1XXLA 3B1YA 3SDSA 3V42A 4BQRA 2O1SA 3ZQKA 1UFRA 1L4EA 3ISVA 2VQEB 3AM4A 3U80A 2O1XA 4KBYA 1UZMA 2OA0A 3MF4A 2QXYA 3NWJA 3L4JA 1E0AA 1EYZA 1YIOA 4Q3NA 5JDCC 4H3HB 4HN4B 5EEGA 2XA9A 4Y8VA 4H08A 1P72A 3SQDA 2GEUA 4JHLA 4HAIA 5EUBA 1NI4A 1WB9A 5E8JA 5A9SB 4JODA 3SY8A 4OAQA 1M0TA 5ILGA 5JH7A 3KQWA 2VF7A 3UK0A 1MP0A 5BSKA 3DV0A 1CJMA 2WZDA 1K98A 5HIAA 4IDPA 3IPXA 3SYTA 4D4KA 1O58A 1QJCA 1XZLA 3I32A 1G21E 3A3OA 4X20B 4DV4B 3LKDA 3DBOB 4GVPA 4UHCA 5LD2C 4DLWA 3MJHA 1DOHA 2B1IA 5C1PA 2NIPA 1S5PA 4AKSA 1FFEA 2FN4A 2ZRCA 3T7CA 3KV1A 4H6PA 2F3RA 1BHO1 4ZIRB 1C1YA 3QUQA 5B37A 2BZSA 3INNA 5B58C 1SIUA 1JECA 1LBSA 1QO0A 3A1FA 3PEUA 4RD0A 5D5QA 5DT2A 2W8ZA 1FDRA 3GAFA 2REXB 4A3SA 1TJ5A 3AZQA 3LCMA 1ZVKA 1TJ4A 3BGDA 3R20A 1QRAA 2NPIA 4QL3A 1JLSA 4OHFA 1XWWA 3D3EA 2G71A 1MG0A 2LKDA 3DDHA 4PRLA 1IEQA 5J63A 3EYWA 4BJ5A 5JDCA 1LI5A 1ESEA 1RZ3A 2QROA 4FYPA 1KYZA 3N53A 4LOHA 1HLGA 2XLCA 1BQ4A 3WJ1A 3IP1A 3W9YA 4UDXX 1UKAA 4ENQA 2XVXA 3WLRA 4LZAA 4G1FA 2FPIB 4FFBA 4JOCA 3GFTA 3WTCA 5IMBA 2CLSA 5K05A 1LXCA 4EI9A 1LRKA 3U4QA 1Z6GA 5E9JA 2A94A 1DC4A 1RQ7A 4OK6A 3VR2A 3GJ0A 3JATB 3QFHA 4C06A 1OB5A 5KREA 3F7TA 2C9ZA 2EARA 2VBGA 4CKBB 5I9LA 4LBVA 4P2GA 1J2JA 3EVGA 2B8EA 4IW3B 3PDHA 4DNFA 1BAPA 5BSRA 3V4OA 1W8DA 4JZYA 3UJAA 1OLUA 3DE5X 1GPMA 3HU1A 3DW1X 2K5UA 2W7TA 3PFBA 2NXJA 4NI5A 2VK8A 1FDIA 4TYQA 4X20A 3DAOA 4KV7A 5CH5A 4RCVA 2EFDB 2FR8C 4REQB 1YA6A 1KDOA 1D0VA 2I87A 4Q6BA 4IJMA 3TUIC 5T57A 1TIBA 4BNZA 4BO5A 4QVGA 1VG9B 3OF3A 3GLFB 4R4JA 3B52X 3D2BA 5KOHA 1Z82A 1MQ9A 1Z6ZA 3FI0A 3ZU5A 4GMHA 4MV0A 4NPCA 3QK7A 4LVOA 1C4XA 5K0TA 4NXMB 4ZVPA 1ZIDA 3BE5A 2QX8A 3TLAA 2R5WA 4WNAA 4QLBA 5KNDH 1R0WA 2JARA 1XQXA 3GUYA 3R5JA 1UDCA 3RK4A 1G64A 1NJ6A 3ANMA 1EWVA 1KZ7B 1N8NA 2WHYA 3DT9A 2FRVA 4G84A 3UGTA 1E5QA 1W44A 3N7TA 4BNDA 4BQFA 4FB4A 4KODA 2O8CA 3FUTA 9MHTA 1YCDA 4Q4CA 2M1ZA 2ZBFA 3WLMA 5BYAA 1S6YA 3L40A 5IW8A 4RIFA 3LHKA 4ZVKA 1G5IA 5CAEA 1G16A 5IULC 2FJPA 3UM9A 5G2OA 1RKXA 3V9AA 3DT8A 5DYYA 4BIMA 1QX4A 1J1UA 4PR0A 1ZAYA 2Y6UA 3WQRA 1H22A 2DBQA 4N39A 4TN1A 2YCBA 2QQ0A 4HGRA 4E32A 2H1SA 3JWHA 5D51S 5DJ5A 2DBYA 4MRAA 5JC1A 4DV5B 2Z9DA 4JLOA 3HL4A 2ORVA 1S2LA 2BUBA 4M1WA 4QBIA 4EI7A 2YX1A 2J09A 3CCBA 3FPJA 2ZWPA 2X1MA 5CTAA 3T54A 4A6PA 1NDQA 2A3NA 4EABA 1HA3A 1DADA 1N2IA 5KYUA 2J9RA 2B94A 4N40A 3S2GA 3KVOA 3OOSA 1E9CA 1NQ5A 3GA7A 1M54A 2BDUA 1NVDA 2B92A 4TWAA 5FTJA 2K2QB 4RPIA 1CEXA 2E87A 4NSNA 3AVVA 1CUZA 3QEJA 3AVTA 2O07A 2EOAA 3SMQA 2G07A 4PV7A 2NPFA 2HF8A 2WU8A 3JQ7A 1ZWLA 5EQJB 4MS4A 3RRFA 3PX2A 1D1SA 3OZUA 4US0R 3MT0A 3OX2A 1JMYA 4X5OA 2IXGA 4XR9A 5GZ6A 3KJIA 1IZ7A 1NONA 4RLHA 3WNZA 4B82A 5A0TA 3HZZA 1EFHA 1ZJ6A 3OQIB 4LYDA 1E6KA 2W70A 4DJFC 4V1CI 4PYKA 4MUIA 4U0KA 3WNBA 1J7JA 3JASB 2PYIA 2JLAA 3PHIA 4H9GA 1GPLA 3A9CA 2NG1A 4QFCA 3NIDB 1F2TA 3WGHA 2CUTA 2ZT6A 4AKEA 4C1BA 5JNLA 2BR4A 1XEXB 5ALEA 3G1WA 3GN1A 3TKLA 1EIWA 1DV2A 3FD8A 4ZJUA 1AA6A 3AB8A 3ETHA 1E9SA 4NKRA 5F3WB 5LXTB 1CZNA 2B8TA 3K31A 4UMFA 1U5AA 5ELLA 2RGWA 1YA4A 3V3KA 1XD9A 1WTCA 1U1DA 2OESA 3H8SA 4X1KB 3WYBA 4KMSA 4DLNA 4EAQA 4WN9A 2NVUA 4XQCA 4XXHA 1N6LA 1ONOA 2EZ9A 2QSJA 3BGWA 3H3XA 1TPZA 1D1TA 2XMQA 3QLEA 4AJ2A 4DWJA 2MWMA 4B2PA 3S81A 4HWSA 4RADA 3VU1A 1LK0A 2CHUA 1NVWQ 4ZVOA 1ATZA 1RM3A 1X92A 1C3OA 3OE5A 3QBDA 4WY2A 4URVR 3EYAA 1X1EA 2ZEJA 3I2FA 6YASA 3OIVA 2LWIA 2AX4A 1P9WA 2L42A 3UAOA 3IP8A 1EM8B 4FT4A 1ABFA 3HUDA 4TTAA 2VTBA 2ACWA 4X60A 3TUZC 1P18A 3M8KA 4JN6B 4L5IA 1UADA 1T5LA 4QEDA 2J6BA 4LE0A 4U02A 3QBVA 3PEYA 1RM0A 1I4WA 3OE7D 4AXBA 2HQOA 4DIBA 5KSYA 4HWTA 3MSCA 4DA0A 1V47A 2A4KA 4G8JA 3HY4A 4GKAA 5ABPA 3MGAA 2OO7A 3BHMA 3PNYA 1YR9A 3NUQA 5E4FA 5JRDS 4ENUA 5F9HA 1HY3A 2G8NA 3CURA 1FDWA 4XEUA 3ZDBA 1JA9A 3BZBA 3NVAA 1K6IA 3G8YA 5REQA 3PF8A 3SNKA 1Y6GA 3I53A 1DT3A 1LFDB 1UAYA 3CRNA 2ZM5A 3Q72A 4DLTA 3E82A 4G81A 4H7HA 2UZ0A 2FWRA 4P84A 3WICA 3ND7A 1YK1A 2PIAA 3DZFA 5C2JB 4G2TA 3C3DA 4ZVLA 2ZVJA 3PT5A 3R7FA 2ZANA 1KU0A 3AF1A 1FP7A 2WR8A 4QPCA 1A8QA 2WNSA 5D00A 3GP3A 3LCUA 2OBYA 1VDZA 5JISA 2IC5A 1USWA 3QUBA 4YH1A 2EZ8A 3D8TA 2FB9A 3BG5A 2W71A 2F8MA 1XXHE 1M1NA 1HDEA 1YUNA 2PQMA 3FLMA 3NB0A 5AI5A 2QLBA 3T9DA 1LRLA 4D9KA 1PDOA 2OD7A 1Z7BA 2WJHA 3LA8A 3OOJA 4PWYA 4BVEA 1XTBA 1DJQA 3IOEA 2EXXA 1D4FA 4HTFB 2C2ZA 2V8OA 3ZVLA 4FWTA 3W77A 1IY1A 1Q7CA 4B6SA 3QXGA 1VRVA 2IYVA 3BIOA 2VT3A 4IGIA 2VEOA 1Z88A 1R6UA 2ZB2A 1EX7A 1P4SA 2YV5A 3OZGA 4HOYA 5EY5B 4REOA 4CL3A 4QJ5A 5HQ3A 2Z5VA 1IHXA 3PR2B 3LYAA 5DLYA 1N2GA 3UYKA 1N2SA 4GWGA 3B2NA 4DDTA 3ILVA 4NZMA 3U7QA 1EVQA 3RVRA 4D4IA 4H15A 4J0EA 4XYMA 2FWMX 3CA8A 5FI3A 3RCBA 3UW1A 4TYYA 3SQMA 4E2ZA 4OY3A 2XB6A 2PYDA 3L0PA 3BIWA 3KKKA 4FBLA 1E94E 3PKZA 2PVSA 4KGVA 2E6UX 4XCXA 4BQEA 5YASA 4I08A 2XYQA 3ESYA 3RWOA 1WPQA 3R7SA 5KNBD 1R15A 3RUPA 1ZUWA 5AOAA 3TTYA 4DMFA 4BUCA 2X1VA 4KITB 1ZP6A 3IULA 3MINA 3Q87B 3SKXA 1FDSA 4HBZA 4PN3A 1G9XA 1AZWA 5CBKA 4FZ5A 2QRGA 4JLDA 4OHPA 1B6GA 4DHEA 3JSXA 1A1VA 5K3AA 4I4NA 4PIPA 3R6WA 3TN7A 1O5IA 4G5SA 3SFZA 3GA0A 3NQ41 1B42A 1ZVJA 2Z2XA 1AM4D 1M0EA 1XLWA 2EBWA 3RROA 2P7IA 1JIJA 2YR0A 3AJEA 3PC4A 2ZTLA 2QMQA 4JXJA 4L5YA 5DFAA 4RHCA 3PNMA 4JQOA 2B20A 1ZMTA 2A9VA 2GN1A 4Y1RB 4FOTA 1KJNA 4CM7A 4MLCA 1RQXA 2G9NA 3KVNA 4O59O 1MPTA 1Z8HA 4KJXA 4F6RA 2DH6A 5FTNA 3A2LA 3VHQA 1QG4A 2CN1A 2HZ7A 2EW1A 2OHJA 2H1OA 3NRJA 4HAOA 2XUFA 3T1VA 4EAAA 5EI5A 1J5PA 4BVBA 1V7ZA 4K1XA 3L8GA 1RTTA 2V6GA 1Y3CE 4ENRA 1KJIA 3QUSA 1V1JA 2OKCA 3JASA 3MUNA 2NN3C 1ORVA 3OD5A 4I9NA 3AEQB 1G0OA 2AG1A 4AB1A 2DOKA 3HS3A 4IV8A 1NR5A 4JBNA 2OG1A 3FMVA 1ODJA 2JLRA 3PA8A 3GPDG 1LH0A 4FFSA 5L3SA 2G28A 3DOOA 3T3PB 3C85A 3UANA 1KS9A 2I22A 4U7TB 4BQQA 4WHMA 2OHOA 4ATNA 5GINE 5HCIA 3R7AA 2I6TA 3WSWA 1LX6A 5KJ6A 3K1AB 1W36C 1YKSA 4FWIB 3PRYA 4HB0A 4LYAA 2RK4A 1JF8A 5JALA 3N7AA 1OHHA 1GEEA 5BMVA 1KYWA 2B3DA 5IZCA 4NBWA 3ESRA 4U2CA 4WA8A 8OHMA 4IPTA 1ULUA 1Y3DE 2BUAA 3O74A 1RC1A 5AMXA 4A0SA 1TQDA 4EG8A 4MYRA 4AS3A 1O54A 1J0BA 1NJ2A 2VWHA 3WRYC 4C6HA 3TMAA 1JZTA 2ZB3A 1E9VA 4G1BA 3MS4A 4KQ9A 1SUPA 4IEFB 4PEVA 3HJCA 2AG6A 3LPCA 2VP4A 3EUWA 3MK31 4QYXA 4FR0A 2PSJA 1SCUA 1GUAA 1DAGA 4G0OA 4LHYA 5ESXA 4QE3A 3OTHA 2J1LA 1A9XB 1IG0A 2VJPA 1SBYA 5BT8A 3HV0A 5FULA 1WM1A 3MHPA 4XB1A 5DSTA 4QM7A 1KRXA 1Y9EA 1RJDA 3DAGA 4I6JA 3NJRA 4KSBA 2FPUA 3STTA 3COPA 3V7NA 3LQRA 1NW9B 2ODNA 2JVKA 1B0ZA 4TS1A 3RIHA 1QGAA 2OAEA 4GI7A 1MA0A 2JGNA 4J2TA 5AK0A 3EX7C 2IDKA 3OD1A 3AHGA 4JBXA 5IXSA 2LTAA 5FWXB 3MJVA 1NKTA 2PEYA 1VLMA 3GGOA 3NBUA 4UARA 1RP1A 1ZONA 4IHJA 1H2XA 2P3LA 3CGGA 4GQBA 4MGYR 1U7HA 2QZSA 1N3BA 4F4UA 3MG9A 4U6QA 3DEKA 1NI3A 2YN2A 2IYXA 5ALWA 1LS1A 3IEVA 4YASA 4E6PA 2CC2A 1RZUA 4QATA 1P39A 1NU6A 2R60A 1EWRA 1EJ6A 4V0ME 3F9RA 3I4LA 2EDCA 4D4JA 1KEVA 3DKKA 1BD4A 4MVJF 1JV2B 1Z29A 3VYUB 3ZR4B 2AH5A 3G5LA 2QTVA 4MNTA 3NIWA 1J8MF 3E22B 1FFHA 3HJTA 1E98A 1UOOA 3DYVA 5NLLA 2Y3IA 2V6BA 1T3SA 3MYRA 1JYSA 2YOGA 1P4JA 4JU9A 3F5FA 5JZBA 3NETA 2IWRA 1YASA 4HXGA 5GONB 5J9FA 1DUVG 3EIEA 1KMCA 3QE3A 4YCSA 4TXNA 1NVAA 4BHTA 4PX3A 4B85A 2BEUB 1Q0ZA 5DYWA 1SKYE 3QFRA 4J3FA 3ROFA 4QUBA 2ZQYA 3C43A 3JVDA 3IQHX 2ODEA 3PEVA 3B3QA 4AKHA 4FE7A 4P3YA 1XCJA 1LDMA 3U49A 2G5CA 3EXHB 3U7QB 5A0FA 3V1MA 3BB1A 1ADBA 3FZNA 1QIFA 4XQ0A 3W5CA 2ST1A 3DLCA 3HDQA 3INTA 4H0CA 4KLAA 1M6NA 3G0BA 3VDRA 3GGGA 3WYFA 4BVLA 5EJIA 4YALA 4LX8A 4U6SA 1FSSA 1AXGA 2LVBA 1OKKD 4KFTA 4C0KA 5LDDC 1YDWA 1LJ8A 3LY8A 4MA4A 1J5EB 2Z4SA 4LHVA 4LJAA 1T4GA 1PS8A 2Q0SA 5FEMA 3PB3A 4QFMA 1U8UA 2CL7X 2VP2A 1DIAA 1VPVA 3PI7A 1NY6A 4XSVA 3RFVA 4F2DA 1DIOB 2WFZA 4ZARA 3RFUA 3HJNA 1RHRA 5JW6A 2OO3A 2P2LA 2HPAA 3B53X 3EG9A 2GS9A 2OM2A 4RW0A 1D0IA 1EFRA 5CHYA 3BD7A 2AVDA 2IA5A 4TV9A 3KHUA 3VTAA 3WNQA 3NOVA 2AUNA 4HQRA 1PEAA 3KJZA 2A14A 2PA3A 1DIRA 4ZT2A 3P26A 3W6OA 3WA6A 5IN4A 2QT1A 1MOSA 1C80A 3T1YB 3WLTA 3MCUA 4KO1S 1RZRD 4DUPA 3QKSA 1XGKA 2MHCA 3WKDA 5ADUS 1J20A 2D6FA 4IIBA 1F3OA 4NHOA 1A8PA 2PGIA 5AUQA 3DHYA 4MVJD 4BMOB 1SUAA 4Q01A 2V6MA 1I80A 3B1ZA 1J56A 3OTQA 3UV7A 1HH4A 1LTQA 1NV8A 1E2MA 1RXSA 2VJBA 3N75A 3CG4A 1RQNA 4D5GA 1RPZA 2O8EB 1UC5B 4IEIA 4BV3A 4OP1A 2JFNA 2C31A 4KRGA 4ZI7B 2ZI9A 1EU1A 3W34A 2JBWA 2OO5C 3S3TA 1GDTA 3K70C 2CJWB 2C96A 2O2GA 4I6GA 3LU1A 2JCXA 1WU8A 4LJ6A 2BKEA 2QE7A 3Q6MA 2YYZA