3TQFA

Structure of the hpr(ser) kinase/phosphatase from coxiella burnetii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
165
structure length
165
Chain Sequence
KQTWHANFLVIDKMGVLITGEANIGKSELSLALIDRGHQLVCDDVIDLKQENNQLIGSCPSVANGYILITGIGIIDVPKLFGLDAVVNQHEVHLSISLVKPEKMPLLDDPLNPLYRTEIILGINVPKILFPIHPGRNLPLLIETLVRNHRLKMEGYDSSHHFHEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural genomics for drug design against the pathogen Coxiella burnetii.
pubmed doi rcsb
source organism Coxiella burnetii
molecule tags Transferase, hydrolase
molecule keywords Hpr(Ser) kinase
total genus 36
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 2.7.1.-:
pdb deposition date 2011-09-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3tqfA00
2B8TA 2Z83A 2C9CA 4JLMA 4CEJB 2NMVA 1SKQA 4D4JA 1KJZA 2ZROA 2AHOA 1W1WA 1VYUA 4D0LB 4M1YA 2ZU6A 4OI4A 3ECCA 3LLUA 3NBXX 1FQKA 5E4FA 4TWZA 3U3RA 1A5TA 1T6NA 1UPTA 4P32A 5E95A 5KPDA 4HEJA 4BLOA 1NSTA 1S9DA 3TIFA 4BLPA 2CL7X 2ONKA 5C1BA 3T35A 2RMKA 2FSFA 2QUZA 2IUUA 3QF4A 4G5QA 4F4JA 3A1TA 4W5WA 4M1WA 1Z08A 2O0HA 3BORA 2YOGA 4ILEA 4PHFA 1OXUA 2G77B 2IYZA 4UXJA 2AK3A 3RS7A 4B3BA 4URXR 3VR4A 5L8VA 3EPHA 1P3JA 1H65A 1XEXB 2OCAA 2XOKD 4OK5A 1ELOA 1CJUC 1WDTA 4QGGA 3BAFA 4M2LA 2VIIA 1NNEA 1GNQA 2ZE6A 4KAXA 4RFSA 2D74A 2QPOA 1OFUX 1E9DA 1GKIA 2BM0A 3P27A 3QPUA 4UXIA 1NVVQ 4WXPA 1YZUA 1U8YA 5SZIA 3SI7A 2QRZA 4DUGD 4JLAA 1FP7A 2FOLA 5AJWA 1E79A 1EFCA 2CCJA 2G0TA 3A6PC 5JSZB 1FL9A 1II8B 3U60B 1A82A 4A82A 3V4RA 3ZS8A 1XFAA 4UXHA 1KY2A 2BCJQ 3RRNA 1Z6YA 2JIZA 2P5SA 1A4RA 3KKPA 1E2GA 1C4OA 1W4CA 4Q47A 4A1FA 4L15A 4URVR 3KX2A 4HAUA 1MR3F 4PSAA 4TL7A 3CM0A 4LY6A 4QGFA 1CXZA 2C99A 1GRRA 4D6PA 3GD7A 4PPGA 4OJKA 2ZS8A 3TE6A 1E2QA 3SFVA 2R6GA 2WJHA 3SDZA 3ZQJA 1KHTA 2AR7A 2J1LA 4C7OB 1U94A 3I32A 2BBWA 3FB4A 3CX8A 5B58C 4LJ6A 4GOXA 3CF6R 3FVQA 3BIFA 2OCPA 4F93B 5HZHA 3CLVA 1DAIA 2EWVA 1Z47A 2ZR7A 1DE0A 3TMKA 2ZTSA 3K8YA 3W90A 1NKTA 4B6FA 1Z06A 4MYTA 2NO7A 4BECA 3FKSD 3SYNA 1W4BA 4PZLA 4EUNA 1RC8A 3AGPA 4QGHA 1XDBA 5A0FA 4TL6A 1XMJA 1VG8A 5FPKA 3NHAA 1P5ZB 1Q0UA 1X1SA 2QP9X 2HLDD 2F1IA 2D3WA 5FOWA 2IW3A 3MLEA 5EP4A 4GSYA 5FH9A 3EARA 4MUBA 3KTAB 4FWIB 3KL4A 1MOZA 1UKYA 4ZDJA 3TSWA 1T91A 1E9BA 4AG6A 3A37A 4H1VA 3B9PA 1TF7A 1GDDA 3ZYCA 3ND8A 1E2FA 2OLKA 4DDWA 4ZO4A 4FMCF 3EPLA 3FMOB 1A7JA 1XWIA 4JLKA 3FHTA 4CT5A 4A0RA 5J4HA 3IIJA 3A58B 3Q5DA 4BLSA 2QG6A 3QPWA 1OHHD 1P62B 2H5EA 1ZNXA 1NIJA 2QY9A 3RS4A 3BWDD 1G3UA 4UQOA 2JLRA 3GJ7A 1WF3A 1JBKA 3DKPA 4UNRA 2QPAA 1MH1A 1KI8A 2KJQA 3A1WA 5ELXA 4LX0A 1IONA 2V54A 1Z6AA 1KI4A 4OI2A 3PJRA 4Q9JA 3TGPA 2OFOA 5HZKA 5G40A 4C0BA 2V55B 2YWHA 3T1QA 3R7WB 2O0KA 1IOZA 4JBYA 3EZFA 3AVUA 2G1JA 3WHLA 3HPRA 4RKFA 3OIWA 5EUMA 5FTLA 2IUTA 2OHFA 1N6OA 1YR7A 2ZIAA 2GDJA 2VL7A 2HXSA 1F3OA 4AURA 1E96A 3TQFA 3L82B 4JT4A 4QHTA 3U4QB 3KDSE 4PC2A 1NMZA 5FFMA 4B71A 4TMXA 1FTSA 4JS0A 3VHXA 1IY0A 1EK0A 1Q22A 2R6DA 3CX7A 3VNVA 1V43A 1NMXA 4OBEA 3KJIA 2VPPA 2ZRKA 1JXMA 4TYQA 1S1CA 4RY2A 2VEDA 4URZR 2DBYA 3SYLA 3GEHA 4AYXA 2FF7A 2VLIA 1LVGA 3F5FA 1N6PA 1Z63A 1G3QA 3MAAC 1B0UA 1G1MA 2D62A 2CCKA 3LAWA 3TVDA 4ACAA 2V1UA 2GJAA 4AKGA 1OF1A 3CRW1 3K9LA 3C4JA 4RFSB 1PJRA 5BYKA 3VQTA 5E7JA 3K1JA 2CMKA 1EX6A 4JKIA 5A4JA 3KKNA 4RD6A 3BFVA 2JLQA 5FBQB 4C0AC 3U7GA 4G3XA 1AKEA 1HY3A 1FNMA 1UF9A 2JJ1A 3L0PA 4DLUA 4RVCA 3NKVA 5D3MA 4EDHA 4OQXA 3IQWA 3SJZA 2IHBA 2YOFA 4B2LA 3U7HB 4C0KA 2XTMA 2DWQA 3EWSA 5HE8A 3R9IA 3PUVA 2Z5FA 2NTYC 3H84A 2JJ1D 1E9SA 1E9EA 1KSJA 1R4AA 1S4QA 5HR5A 3SQWA 5F2EA 2O8EA 1TL7C 1E1RA 3BBPA 4OQLA 3MWLA 3VFDA 1E2LA 1P4SA 2FZ4A 2BJVA 3H4MA 4TQUS 1VPLA 1NN3A 2NZ8A 4LYHA 3KQHA 1JEDA 2ZITA 3P20A 4QBIA 5KUTA 3IPYA 4DBLC 1TQ4A 1CRPA 3IIMA 1JPJA 1R5NA 3QXHA 3RS2A 5L3QB 4MDEA 4F4IA 3NTUA 1GIAA 3E5HA 4V0NA 3ZVNA 1JR6A 3GLFA 1U90A 2OM2A 3VU9A 4QJ3A 4BEBA 4A8JA 521PA 3OIVA 4DLSA 3RNLA 1D9ZA 3ZH9B 1GL9B 3N70A 1FP6A 2Q21A 1SXJB 2EYQA 5SZHB 1IN7A 1HUQA 3MWJA 3U3JA 1X1RA 4TLDA 2Q0HA 4XWKA 3DOEA 2F1HA 4XIGS 3IGFA 1G17A 3FPAA 1QRAA 2H57A 3E2IA 4IDHA 1J99A 2R62A 1KDRA 2ZRPA 4ASUD 4TSFA 1KTVA 2W2XA 4ARZA 2ZI9A 3KXLA 2REXB 1LFDB 4LCBA 1JR3E 2FPMA 1F2TA 1KMQA 3VMFA 5AJXA 1ZNWA 1FUKA 2A7QA 3ZZTA 1Z5ZA 4P0TA 2JEOA 4RD1A 2F1JA 4HAVA 4QJ4A 1FX0A 4Q00A 1D2MA 4ZDKA 2HUPA 4Q4AA 1Z2CA 4Y0AA 2VSFA 4WVFA 1MV5A 1TUIA 3AKYA 1KMHB 1Z6TA 2QTVB 3RHFA 3WBJA 4NTZA 2V8OA 4TN1A 3VR6A 4MDFA 2QAGB 2Z4SA 4YQFA 2HYIC 1Q3TA 1QHYA 2FWRA 3OESA 5JCPA 2J3EA 2KBFA 3FMPB 3L8YA 2UKDA 1OFIA 3LD9A 4TTRA 5EZ6B 3Q7PA 5EP1A 1TADA 2W0MA 3B6EA 4M21A 2QP3A 3C5HA 4V0OA 2IL1A 2GEDA 1WRBA 5EE1A 4W9MC 4FCVA 3TNFA 4TMTA 1Z0FA 1G18A 4XTRA 1MABB 1NSFA 1GKUB 2DY1A 2H8KA 4URYR 3W34A 4II7A 1RRFA 2F9MA 2WTUA 1VYVA 1W5TA 4NHOA 3WP0A 3GPLA 1NI3A 2CHVA 3PUZA 3K70B 1IY2A 5L3VA 1JB1A 4Q1BA 5SZJA 3T1OA 2PEYA 4G1UC 4HB4A 5FOTA 1HH4A 4R7ZA 2PLFA 1DEKA 1CJMA 4JLJA 5FBLB 1WBBA 3O47A 5J4LA 1CKEA 4OHYA 4QGAA 1NBME 2CLDX 1KK3A 1SXJA 4DEYA 4YMSA 2B7CA 1G3MA 4DT1A 2MMGA 2CDNA 1RZ3A 2CK3A 3UWKA 2GWHA 3I3SR 1LF0A 4Q4HA 5BWMA 4A0HA 3AB3A 3CZQA 4EJSA 2C98A 2FSIA 3PFIA 1QVRA 4MGIR 4Q9HA 1E9RA 4RD4A 3BRWD 2NO1A 2W6IA 3SJAA 2A5GA 2VHJA 1R7RA 3B1WA 5K8UA 3GLHA 3KB1A 3I72A 2OT3B 5B57C 3RLFA 4EQ6B 3TSOA 4EJSB 4A36A 2CK3D 1XTJA 2OLJA 5FUYA 1AS2A 1M34E 3ETLA 1OXVA 4YMTA 3PUWA 4LHXA 3NH9A 3AVQA 4B47A 2ZI7A 1IN4A 3RS3A 2YV5A 1KI7A 2ZYTX 4F91B 1PZNA 2FGKA 3C14C 5AUNB 2HJGA 3C7KA 2WWHA 4LBWA 2ORWA 1XPUA 1KSHA 1KI6A 2GXSA 4D4KA 1X86B 2A30A 1Q21A 4KLNA 3VKGA 2WJJA 1VMAA 1Z8FA 1CS4C 2ZS7A 4A0GA 4R2IA 3LW8A 1GM5A 4NYIR 2BV3A 2Z0MA 3RWMB 2OCYC 3PCRB 2H18A 3QBTA 3CRRA 2J45A 1I4TD 1Q12A 1ZD1A 2XGJA 1Q57A 1X8JA 3AKEA 1Q1ZA 3Q9LA 4U00A 1DAKA 3X1XA 3ICQB 2OCBA 2VHQA 4NCHA 3DL0A 4NYIQ 5DI9A 2KBEA 4Q1EA 1YVDA 4TT3D 4B3XA 4NCJA 3R8FA 1ZUNB 1YZGA 1ZM7A 2IS4A 1II8A 4WA7A 5AJZA 3U6KA 1XXHE 3CWZA 1AS3A 1ZCBA 3ASYA 3I62A 1SZPA 2ZRMA 4W5HA 4ZI2A 5KSYA 1OKKA 3ZJYA 4IVQA 4DDTA 3U3KA 4NP6A 3CH4B 2XXAA 5HTKA 3AP3A 2OE2A 5FI1B 1XTRA 1A1VA 1F2UB 1DVRA 1NLYA 2ZSEA 2F1RA 5AUPB 1Q20A 2WSSD 3UMRA 2YC4C 4C7OA 2QQEA 4NCIA 3QXJA 3A4LA 1N0WA 3EG5A 4V03A 1SKYB 1ZM3A 3BOSA 5FOXA 2FFQA 1GKYA 4HAZA 4NYMQ 1OT3A 3MGCA 2XITA 2ZI6A 1E2KA 3WNDA 1BYUA 3SHFA 1U81A 4N1AA 3R7WA 3PIRA 4CRWB 2CL0X 3MWKA 1OLOA 1D2NA 3AKDA 2WV9A 3GLGA 5L3SB 2IEYA 2ZSBA 2D2FA 5DE3A 4MQBA 1UDXA 1OXSC 4LBVA 1AS0A 1TNDA 3K53A 3QF7A 5EXTA 2PMDA 4JVSB 2EFHB 4E03A 1VIYA 1E0KA 3K09A 1UEJA 3LBNA 2BJWA 2Y8EA 3FDIA 4BLTA 4B32A 5IK2A 1T8UA 5DNYB 4OKSA 2O8BB 1TQ6A 4Z1MD 5AUQA 4RZ3A 4IHQA 5FOUA 2ZRNA 1YRAA 2CVFA 2DFLA 4IDNA 4TMWA 2J87A 3D6TB 1P75A 4RFVA 5FTKA 4B2IA 4MKGA 2GCNA 4JKYA 4L16A 4PR0A 2C77A 1LV7A 1OH5A 2ERYA 4KBGA 3TK1A 2V7QA 3GEIA 1HURA 2EVWX 3FTQA 3AF2A 3BK7A 3RYTC 1XBTA 2J7PA 4D0GA 2VP2A 4LPSA 1TMKA 3PVSA 1KKMA 1HE1C 1P2SA 5CB6A 2Q9BA 2BIFA 5DN6D 1QDEA 3ZVLA 2YINC 3CNLA 2GTPA 2FGJA 1M2OB 3WBKA 2J0VA 5FOVA 2AWOA 5CIQA 1EGAA 3RABA 4ESHA 221PA 2CEAA 3DHWC 1MO6A 4BEJA 2J46A 3QEJA 4A2WA 2XXAB 1JR3D 2E87A 1ZUIA 721PA 2LKCA 3LV8A 5JWRA 1W7AA 3EAQA 1XXHB 1KO8A 1BH2A 1RW4A 1F2UA 1P9RA 3Q3JB 4D81A 3FMFA 4M0LA 3CRMA 4UJ3A 3L8ZA 1LW7A 3B5JA 4TYNA 1UBEA 2JLWA 1SVMA 4M53A 1E9FA 4NL4H 1PLJA 2WJYA 2GA8A 1G4UR 1NBMD 4RZ2A 3TJZA 1LNZA 1DS6A 3I8XA 4MRSA 5KPJA 2BDTA 2GESA 3N2IA 1XF9A 1XTSA 3VX4A 4FN5A 1XCMA 1VG1A 1YHNA 2ZXUA 2L0XA 1NJFA 4M9QA 1DBSA 2YJTD 2WWWA 4DT1B 2NPIA 1YKSA 2VP6A 3H86A 3KQUA 1XEFA 4TLEA 4JL8A 3G0HA 2V4ZA 5UKDA 2J0SA 1NIPA 3OHMA 4KBFA 4KXFB 2V9PA 3DMNA 3IPXA 5J40A 2W6JD 2G83A 3CRQA 2C78A 2GKSA 2FN4A 4BGDA 1J70A 1PLKA 3FHCB 4G5OA 2ODNA 3RSOA 4ARZB 4Q01A 2YWEA 4IXNA 3A1UA 1G5TA 5B2ZA 5BN4A 1KDOA 3K9NA 1TQDA 3FYHA 4PSVA 4B34A 4ZKDA 2AKYA 2FFHA 2PCJA 2JJ8A 1L2TA 1LTQA 2WJIA 3EW9A 3M1IA 4YC7A 3I5XA 3TUIC 4TYPA 2IC5A 2Z43A 4GBMA 3DZDA 4EQ6A 4ZDWA 4Q02A 2VP9A 2NIPA 5CK5A 1VCOA 1YR8A 2WWFA 2IWHA 2FH5B 5J4KA 3AVYA 4QHYA 2WKRA 4LRWA 3TAUA 3LVQE 5K8IA 4LJ4A 4LI0A 4DLXA 2OXRA 2QP4A 2GF0A 4ZCLA 1ETUA 3CNOA 2ZJYA 4JL6A 5H68A 2Q3MA 2V3CC 1TX4B 1T3HA 1L4UA 3E1SA 2LWIA 2ZR9A 4RD2A 2AL7A 5DI3A 3EZ7A 3OEHD 3NG1A 4PHGA 3GQBA 2BKUA 1XTIA 4IDOA 1AGPA 2JLYA 3QE0A 3LH5A 4P4SB 3VKWA 4FMBB 1IN5A 2JDID 3THXB 2P5TB 1S2MA 4NCNA 3I8SA 4PFSA 2DFNA 4TT3A 5G3YA 3CR7A 1P6XA 2G88A 2ZR0A 5EE0A 4ZIRB 1T5IA 2BMEA 4Z8YA 3K0EA 2GBLC 4BFUA 1FW6A 3HR7A 3HR8A 3REGA 3ZZUA 4KVGA 5DIFA 3IIKA 3QKRB 5DISB 1KZGB 4JVNA 1P60A 4PO1A 4BZXA 4AKEA 1GZSA 4AD8A 2JASA 4LYFA 3UXMA 2BC9A 4Z54A 1D5CA 1XTQA 1YR9A 2GEUA 4BASA 2QN6A 2WPDA 3ZZ0A 2RGGA 4FMDF 2VHUA 2FU5C 3PQCA 5FPSA 1C9KA 5KDLA 4AY2A 1SXJC 1TUEA 1GFIA 3HYRA 1Q1QA 1XZPA 4D25A 1CJTC 3QIAA 3K0FB 3LLMA 4QOSA 3SJCA 3BJIC 2BM1A 1OFHA 4XWOA 3RRYA 1HQCA 3AKCA 1R2QA 1NG9A 4O2RA 3VX3A 4ZV4A 4TL8A 2QSYA 2ZYUX 3AVPA 1G21E 2IXGA 5H70A 2VTKA 1FX0B 2RGEA 3EX7C 1AK2A 4I1SA 2Q9AA 4A92A 4HUQA 4BUJA 4TYYA 3DMDA 2OBNA 1EFTA 2IK8A 3EXAA 3U7EB 5L3RA 2GZDA 3I4LA 4ZDIA 4GL2A 2EW1A 2IF2A 2QA5A 1U0HC 2WM9B 3WNCA 1ZC3A 2O8BA 3EC2A 2CHGA 3R20A 1R5OA 4PQFA 2XAUA 3MJHA 3V4FA 1UKVY 4WOPA 1RRPA 1KMHA 2X19A 4AIIA 2DHRA 2ZEJA 4YDHB 3RC3A 5FPTA 1NY6A 3W3ZB 1Q1EA 4LC0A 2RKOA 3MD0A 3LWNA 5EXPA 1G8YA 3TBKA 3TUJC 1TAGA 3NC0C 5KOYA 2P6RA 2ZRGA 1UM8A 2JAQA 2IYSA 3R9XA 2RGXA 2ZM5A 2FV8A 2FPKA 1N6KA 2CCGA 3BH0A 2PBRA 2AKAB 1SHZA 1HEIA 1YE8A 2RCNA 2PZFA 5JS7A 2KB0A 5KYKA 1MKYA 1QHIA 4H1UA 4Q7JB 4Q48A 3NVAA 3C41J 5LDDC 2PMKA 2WZQA 3AF3A 2AFIE 5EXSA 4EPXA 1Z0JA 1G3IA 2ZUBA 1QHGA 1QHHA 1IM2A 2H92A 4OHXA 2MMCA 2XX3A 3AGQA 3OFNA 5C2JB 1OV4A 3RANA 1N5JA 2UZ3A 1UDWA 5TXGA 3W8RA 4Y0VA 4HLDA 2IS6A 2QZ4A 1VCIA 2ZJAA 3S1AA 1UBFA 2XSZA 4PX9A 2OZEA 3KUDA 3C16C 3EA0A 3F3YA 4KU4A 4CVNA 1P7CA 1GAJA 1N0UA 1ONBA 3DM9B 4KVAA 5E7MA 3T1VA 4EJSC 4C2UA 3NEYA 2H17A 4ZCMA 1IAQA 5GJCA 3PEYA 3FFBA 2VRWA 5EP2A 1E2JA 3ASZA 1S0UA 2HXYA 3K0CA 4EPVA 4M9ZA 4D4MA 1Q44A 2DB3A 4DLYA 2YWGA 3NXSA 3LBHA 2ZI5A 4Q9LA 1G6OA 2AD5A 4Q4JB 1XMSA 1BO6A 4JLPA 1II0A 3WHKA 1R8SA 2QGZA 2X8AA 1M7GA 4HUQB 1XJQA 2RGAA 1RJ9A 3F8TA 1VTKA 1KI6B 1ZNZA 5KDDA 2QPTA 1AN0A 3HU1A 2OFWA 4MKFA 2OAQ1 1JQJC 2GCOA 4YDSA 4A9AA 2FNAA 2NPFA 3QKTA 2W2TA 1EX7A 2OG2A 3MMPA 1G16A 2ZRJA 3C5CA 2ORIA 4NBSA 3AV0B 1H8EA 3V9PA 5TARA 1XD8A 1VG0B 2ZE8A 1G8HA 5HE9A 4ERNA 2CJWB 1N0VC 2QMEA 4L9SA 4YMWA 4CEIA 3ICEA 2NO0A 5JFGA 3HU3A 1SVWA 5TVKA 1GG2A 3LNCA 2BBTA 2IYVA 4U02A 1G8PA 2ODEA 1EXMA 1QHHB 4B76A 4NE2A 4HB2A 4YXWA 3W5JA 3W8NA 1XPOA 4FMDB 2ZJ8A 3P26A 4IOLA 2QSZA 5AK0A 1F60A 1D9XA 2CLCX 3QVVA 4IXMA 3RWOA 1IXZA 4CGZA 3EZ2A 4PC6A 1T4GA 5BN5A 1AA9A 2DFTA 4A15A 4M1OA 4JLVA 2SHKA 4N0EA 4EPWA 2Q6TA 2EYUA 1Z3IX 1M1YE 3KXIA 1E1RD 3OEHA 4OHZA 5C18A 3UWOA 1DARA 2R8RA 1EESA 2R9VA 2VBCA 1AQYA 4GNKA 2XOKA 2EQBA 1P61B 5LB4A 4CYMA 1G6HA 2ZYWX 4R2HA 1ZVQA 5EXXA 4QKQA 3IILA 4HUTA 1G7CA 3QSYA 1UADA 3U7FB 4IVRA 4QM7A 2YZ2A 1KKLA 1D2EA 2ZUCA 5BN3A 2G6BA 2JA1A 2QM7A 5LPNA 5L3QA 4O2LA 1IQPA 1KJYA 4LPKA 1S1MA 4UKDA 5CM9C 4GZLA 4B2PA 1W36D 3U44A 4C2TA 1CLUA 2IYYA 5JHGB 4QM6A 2CE7A 3UMSA 1KNQA 1COWD 1UAAA 4JMPA 1ZD9A 4PHTA 2P67A 4P4TA 1O87A 3B1VA 2RGDA 1E9AA 2AX4A 1U0LA 2J41A 2ZAOA 2CNWD 4PAMA 1CR4A 4ESVA 4FCWA 4PSKA 1XJ0A 4LV8B 1CRQA 3K9HA 2ZRHA 1ZBDA 2VP4A 4AKHA 4BFZA 3VNUA 4LHZA 1X8LA 3QKSB 3GMTA 1U9IA 3R9WA 2XJ9A 1E3MA 3GLIE 1EG7A 1ESNA 2CE2X 2X2EA 4BPBA 2NG1A 3NBFA 1QHXA 3CW2A 4Q9KA 1KO5A 2QGNA 2W6ID 3TR0A 1ZU5A 3DM5A 5KSZA 2ZJOA 3O8BA 1GP2A 1A2KC 2QT1A 1GILA 4HI0E 4I1VA 4TL9A 3HPQA 2YC2C 1IHUA 4RCYA 3B13B 1PUIA 3OF5A 2B6HA 4NONA 1N6NA 4UNNA 3GLFE 3ZS9A 1YZKA 3IHWA 1B23P 1SXJD 4OQFA 2MSCB 2QNRA 1NLFA 4MRRA 1FUUA 4BZPA 1ZJ6A 3CPEA 4V0LA 3WYAA 5EE5B 4CT4B 2ZRFA 3GJ8A 3GP8A 1ZC4A 2PJRA 2PJZA 5BXQC 1EFRA 1VHLA 4JLDA 3UG7A 2ERXA 5C4GB 3T5GA 2CNWA 3L0OA 4Z51A 5EUQB 2KE5A 1VYTA 4OI0A 1BIFA 3IHLA 2F9LA 4DEXA 3TUZC 4C3ZA 4X8OA 4O3MA 1SQ5A 1TPZA 2WKQA 4Q1FA 3B9QA 2XJ4A 1SGWA 2JCSA 4JLOA 1BMFD 3QXXA 3NDBB 1Y63A 1L7VC 2WHXA 3CUEF 2XZOA 1HT1E 2GBLA 5FR2A 1W46A 4IFBA 4DIDA 1KDPA 2F3RA 5JSZA 3BB4A 1OYYA 1W47A 1Z0IA 2OESA 2DCUA 4HDCA 4HZUB 1XMIA 3VR3A 4ACBA 1U2RA 1E98A 1RRGA 4BZQA 5FBWB 2A5YB 3X2SA 3SJBA 2PX0A 1G8FA 2F6RA 2QROA 3AF0A 5DN6A 3DKVA 2BVNA 5FUVA 2R65A 1F2TB 1MO3A 4R98A 1US8B 4ZPXA 4HDOB 4Q9IA 2ONJA 3T1TA 2GJKA 3PEVA 2IYUA 4KO8A 1P9NA 2XB4A 1XCPA 1KO7A 3GFOA 5FTMA 4BE7B 2C04A 4URUR 1CBUA 1NY5A 5SZKB 2WVJA 1T5LA 5KSPA 1YZQA 1YJ5A 3C15C 2IHYA 5GVRA 2J0QA 3U3OA 3PR1A 2C95A 2HEIA 1F6BA 1P2UA 3AF1A 1RFLA 2P6NA 4Z1MA 3LXXA 1ZM4A 2QM8A 1DAMA 4HLCA 4G5GA 4TTPA 4ABYA 2FFAA 4P3YA 4RKEA 1XPRA 1IBRA 4WZBE 3SEAA 2IYWA 2WAYA 3IUYA 4C0LA 2WSSA 1WA5A 1I2MA 4WAUA 1GTVA 4Z8XA 4DKXA 2GAAA 5FPHA 1OSNA 1IXRC 3VR1A 3CONA 1AIPA 5CK4A 1ESMA 1Z6XA 2W2VA 2LCFA 3REFA 2YWFA 4TZ6A 4M9XA 4DCNA 3BH7A 3OFND 3QOFA 4MGYR 3B78A 2QAJA 2YKGA 1KNXA 3MWYW 5A5GA 2IX3A 5TV2A 3WY9A 3ZVMA 3BERA 4FWTA 4X8HA 3WP1B 5JI3E 4B6EA 5IF9A 2QBYB 1W0JD 2N1BA 3DVLA 1U8ZA 3SU8A 1ZNYA 2HF9A 3NWJA 4A6XA 6Q21A 2GVZC 1NVWQ 1TF2A 5K8TA 4PZZA 2QTHA 3JVVA 2Q9CA 2WWIA 3AH8A 3QI2A 3O8RA 3QEOA 2R6AA 3KFVA 2O8FA 2B8WA 1R6BX 4A2PA 1E2PA 3QBVA 4B48A 3IEUA 4MYUA 1HE8B 3KQLA 2HV8A 2NQ2C 1US8A 4BLRA 1W0KD 2ZE5A 4NMMA 2FEMA 2I4IA 2WIBA 1R0ZA 2EFGA 1YZNA 2VF8A 3PV0A 1N6LA 5JZVA 3EIEA 1HV8A 3WMEA 421PA 2DYKA 4DCSA 1J8MF 1GRNA 2YHSA 4B44A 3GLGB 3AVTA 2P2LA 1JEEA 3L0IB 2B21A 4IEEA 2GRJA 1KO1A 3ZIAD 2VF7A 4HATA 1TU3A 1L8QA 1N6RA 3KJHA 1N25A 4N0DA 2FEOA 3PEWA 3Q72A 4YONB 2GCPA 1M7HA 2V1XA 3NEJA 4IOMA 2OBLA 1KIMA 2W6JA 1EWQA 2GJ9A 3DO6A 3H0KA 1R8QA 2CHQA 2W83A 4GZMA 4HLUA 4ZCIA 2IYTA 2ZVPX 1RKBA 4C9BA 3RDPA 1IJFA 1E79D 4E5UA 2XB2A 2FJUA 3B7GA 5FPYA 4DUGA 5JWOA 4QNRA 2X1VA 2OBMA 3THOA 1W4RA 1BKDR 1GNPA 1W4AA 3IO5A 4XJXA 2WOOA 4KSBA 3KB2A 3W3AA 4DIEA 5AJYA 1WCV1 4B3GA 1GWNA 4L5BA 3EC1A 4GP6A 5HPYB 4EKDA 1WMSA 2GZHA 3ONWA 1P72A 2JATA 2XZPA 3CKLA 1OXTA 1Z83A 1N5IA 1TU4A 2QMUA 1VCMA 2D7CA 4Q18A 5GJBA 4FXPA 3TLXA 4DSTA 1E2DA 3C8UA 3LW7A 4AYWA 5CITA 4DLZA 4G0NA 3THYA 5J4VA 4QHSA 2VO1A 4AG5A 2HJVA 2F43B 3F0TA 3LFUA 4DWJA 3U6BA 5EP3A 3SFZA 3KJGA 1OE0A 4UNQA 5AWFC 2PZGA 2XZLA 3QNUA 4BFVA 3CH5A 4IW3B 1E4YA 1E2EA 2WPDD 2GXUA 4W5JA 4CW7A 4DLRA 3I92A 3K0AB 4L4UA 1AJEA 2IBMA 1OJLA 3M6AA 4DSUA 2JGNA 2QE7D 5J5CA 3UANA 1GITA 2AXNA 4QRHA 4HAXA 4DJTA 4F4CA 1QVAA 3CBQA 1DADA 4MITA 1ZM9A 4OQNA 1UJ2A 4AKIA 1HA3A 5JI2E 1BMFA 4M1KA 2HLDA 4CZ2A 4NYMR 5AJVB 1A2BA 2IXEA 2QL6A 2VQSA 2VP5A 2JLUA 2QQ0A 4UNPA 1PVOA 2A9KA 3LXRA 3OEED 1XU4A 3TW8B 4EPRA 3QF4B 4RZXA 2JJ2A 1MRSA 3KFXA 1AKYA 4F38A 1N5LA 2KSQA 2A5FA 1SULA 4MYHA 3PEUA 1XTKA 3SE0A 2CLSA 3AQ4A 1X6VA 3JVUA 4A8JB 3SC3A 1JR3A 2IYXA 2R6CA 1G41A 1S9HA 2Z4RA 2FX3A 3R8CA 2IYLD 1Z0AA 1YRBA 4PO9A 2IXFA 3A8TA 4Q4LA 5IHPA 1PUJA 1M6NA 3B2EA 3OZXA 1C1YA 1T8TA 2VYFA 2IUSA 2Q3HA 4EAQA 2F55A 3X1ZA 4YXWD 2ECKA 3IDQA 1SVKA 5G41A 1JAIA 1MO4A 2QMOA 4ZI3A 1XMVA 1DO2A 1OH8A 4R71A 1QZXA 2EWWA 4IVPA 4NKRA 5JEDA 2ZSAA 1WXQA 3THYB 2HT6A 3ND9A 4WZ6A 3FOZA 3T06B 1E0SA 1LS1A 2RHDA 2UVQA 3FKQA 4FCTA 4NPHA 5CLLA 1NG1A 4XD7A 2O8EB 3B85A 3QPVA 3T34A 5CJPA 2D06A 2A5JA 3SS8A 1PLLA 3QG1A 4V02A 4X8MA 2HCBA 4KFUA 2ODWA 3NIBA 5DYIA 1JPNA 1NMYA 4DB4A 3BD9A 1GL7A 4DLVA 4RSGA 3WYFA 5FL3A 1SVIA 2R6FA 2AK2A 2CBZA 5BYJA 3T5DA 3VU9B 5M04A 2CL6X 3GJ3A 1OPXA 1NKSA 1JECA 2J0UA 1ZMXA 3L0SA 2QAGA 1FQJA 4MRNA 4MRVA 4OK6A 4V0MA 2I3BA 8OHMA 2E9SA 3DDCA 4WIAA 4PHHA 3HWSA 4HAWA 4DDUA 2REBA 4D2IA 2KWIA 1P9WA 2RGNA 3NH6A 2ZETA 3BC1A 1WE2A 1KK2A 1DAFA 4FD2A 2WWXA 4LBYA 4B74A 1FTNA 2WSMA 3WXMA 2VH5R 1J90A 2G0NA 4LGMA 5LB2A 4JBWA 4Q1CA 3LA6A 4JVLA 4LJ8A 1NP6A 4PQRA 1NRJB 4ITRC 4NH0A 1WB9A 2ZI4A 5GJWC 3B1ZA 1CEEA 4URWR 1Z28A 3AF4A 4RJLA 1ZW6A 2C03A 3LVRE 4WBSA 3RVBA 1E94E 3S1AB 3WYGA 2C5LA 1WBDA 2NO6A 3TSZA 2OUKA 4PTLA 3BGWA 3JZAA 4LDJA 1E0JA 2P6UA 1QF9A 5JJLA 5IK2D 1IY1A 2ASEA 2PX3A 4PO8A 3WRYC 1XB2A 4BFWA 2QRNA 2HT1A 1G7RA 3RAPR 3ZLJA 3GLHE 4OHVA 3CRVA 2ZRDA 2RB4A 3EASA 2ZU0C 2HDNB 3D7MA 4KYIB 3PUYA 3LO5A 3KKQA 1RYHA 4HDQB 5DYGA 4C0QC 3ADBA 2J7PD 3OE7D 1E2HA 3EIQA 1RYFA 2OV2A 3EZ9A 3ZDQA 3Q8XB 4L8GA 1KOFA 1XXHA 5IDVA 5GADl 1Y3AA 1XEWY 2GILA 2IF0A 2RGBA 4DZZA 1KAOA 2ZANA 3OE7A 1MO5A 3BE4A 1N6IA 3KXKA 3WNBA 2E1RA 4BFTA 2XTNA 4BWYA 4TMKA 4TQAA 5FL7A 1YQTA 2FPLA 3U2QA 5CDFE 5F9FA 2C2HA 1DOAA 4KFSA 4B73A 1I2DA 1ZU4A 2FSGA 2ZRBA 2J5XA 1WP9A 3CPHA 4AI6A 5FUWA 4Q66C 3G82C 4Q03A 2DFKB 4NCKA 4JZKA 3NHBA 3Q7QA 1E1QA 1XZQA 4O0MA 1FMLA 2WWGA 3GLIA 2QENA 2C9YA 1W2HA 4PZYA 4QG7A 4WXRA 1X8KA 4KYUA 2ATXA 4KFRA 4FW9A 5HCNA 4QBGB 4QL3A 3UK6A 3K70C 4JIMA 4RD0A 4TQ9A 2W0SA 5DSZA 3KQNA 3TKLA 1NVVR 1CTQA 2XNDD 2Q3FA 3MJRA 3K0FA 4Q1AA 4DDVA 3I5YA 2BMFA 4TYWA 3PXGA 4OJQA 5CYOA 1M8PA 2JLXA 4D0NA 1G291 1UFQA 3QUSA 1H8HA 2GK6A 4Q7LA 3SHWA 4KCGA 4HLQB 2GETA 1ZUHA 2GNOA 3W6OA 3PG5A 2RGNC 1ODFA 1IN8A 2A78A 4I1UA 5TMPA 3CWQA 4HYYA 1OIXA 2ZJZA 2QAGC 4TSFD 1G5RA 3ADKA 1XX6A 4W7SA 3W6PA 1Z0DA 4IOJA 2GF9A 5TDHA 2FZLA 3NDPA 3WRXC 3TR5A 3AM1A 3MFYA 2B7BA 1ZRHA 3SZRA 2EFCB 1K5DA 1E1QD 5EE3A 1JJ7A 2A2ZA 4US2R 1XEWX 4PAOA 1CIPA 4MA4A 5AUOB 1ZYUA 2GAOA 4ON9A 1DO0A 2WMOB 4JSTA 4PC1A 4KSCA 1MT0A 3QJYA 4P33A 3SNHA 3AP1A 3NBZC 3GEEA 4CEIB 5BQ5A 1XD2B 3THWA 3FHOA 3V00A 3X1DA 1U8AA 2QORA 2YOHA 3KTAA 2QMHA 3CR8A 4YLGA 4BFYA 1W48A 1K6MA 2NOAA 3IBGA 4E09A 4Q7KA 4WZAE 5D3QA 5H1YA 3IBYA 4LZZA 4IEIA 4ASUA 2AN9A 2BMJA 4A6PA 1ZIOA 3SQXA 1VG9B 1KI9A 4DCUA 5EE9A 2YYZA 1N5KA 4DXAA 2CXXA 1NVXQ 3JZMA 4LJ5A 2GZAA 1TEVA 4LHWA 5JJKA 1L4YA 4HSEA 4UNSA 1QBKC 4NYJQ 4OI1A 2IA5A 3PUXA 3NC1C 3OEEA 4LJ7A 4C0JA 1P2VA 3K0AA 1YU9A 3QXCA 4BQSA 4Q4JA 621PA 3WMGA 5LD2B 2OFXA 2CVHA 4TTQA 1OH7A 4EIWA 3VR2A 2RHMA 1CP2A 4MYCA 1DAGA 4IRUB 2D4HA 3I1FA 3CPJB 3LX5A 4IKEA 3H1TA 3GLFB 3CZPA 3TW4A 3D8BA 3U4QA 5JRJA 4IFEA 1KZ7B 1FNNA 1II9A 3B1XA 3FWYA 1N3BA 2PT5A 3P1JA 2F7SA 4U5XA 1SVSA 2H16A 4FI3C 4JYCA 1M7BA 3N2EA 2NZJA 4D26A 3BB3A 3GJ0A 4TMVA 2GK7A 1Q1BA 4C0HA 4TZ0A 3IQXA 1BS1A 3LQQA 3BFKA 4GMDA 3CB4A 4LJYA 2NO9A 5GVSA 2ZVQX 1LS6A 4XD7D 1AQUA 1T0JB 1CJKC 4M1MA 3U61B 2J7KA 5D3MB 2GHIA 5JCZA 3RS5A 1R0XA 4GPTA 1W5SA 2QT0A 1G7SA 4G5RA 1W49A 1GUAA 3FMIA 1F5NA 2JIZD 4OQMA 5DGXA 4DB2A 3QQ5A 1NN5A 3BS4A 5F98A 2PZEA 2JLZA 5CYPA 2W58A 4GMXA 1XCGB 1KSFX 4A2QA 4YMUA 3MRSA 3Q85A 2ZJ2A 3KQKA 2BHRA 2O8CB 2VSXA 1KJWA 4LK2A 1KAGA 1ZP6A 4BRWA 3MG9A 2IS2A 2ZI3A 1N6HA 3FE2A 4PPFA 4MGZR 5CIWA 5KNBA 4MGKR 4E07A 2AFHE 4KI0A 5CJ2A 1E9CA 5F9HA 4XOIA 2XTZA 1GOTA 2GJ8A 2A5DA 5JS8A 1SVOA 5CM8B 1RJ9B 1XRJA 5JWHA 4IDQA 2EFEB 2XNDA 3LBIA 3EIHA 2WICA 4XSHA 3IEVA 3K9GA 1CF4A 1DG1G 3DZ8A 3OIYA 3SR0A 3TH5A 4PPQA 4U7DA 3ZD6A 4CIDA 3GLIB 2R2AA 1XJCA 1W44A 4C0SA 3IO3A 4K46A 4LOAA 2DWOA 3VHLB 2ZS9A 2IS1A 3VR5A 1SKYE 2BEKA 1JI0A 4F7WA 4DHEA 5LBIA 2P3SA 1W36C 1DAEA 4V0ME 1KK1A 3EZ6A 2ODBA 1T3LA 1R0YA 1AGRA 1CR1A 3FKSA 3QKRA 4O25A 4RZUA 5JHHB 2BEJA 3SYKA 4MH0R 3L43A 1UBCA 1VKJA 1UBGA 2A3RA 1RE0A 2QEQA 5FBRB 1OKKD 2QE7A 4MUAA 4M8NE 5FUXA 4DVGA 4LYAA 1YR6A 2ANCA 1F48A 2MSEB 3FGNA 4OYHA 2ZSDA 5E7IA 3I73A 4PQYA 1RPZA 5E3HA 1VDZA 3RS0A 5JMTA 2IYQA 1OB5A 3BXZA 3DOFA 4HLUC 1JJVA 3N5CA 1MRNA 1U9IC 2VA8A 3QY0A 3K70D 5KSOA 4OL0A 5C4MA 1XP8A 4BRUA 2O5VA 4S35A 3LQRA 4PAQA 1AM4D 3KZ1E 1W2GA 1EFHA 4JVMA 2J9RA 4B75A 1YZTA 821PA 4HB0A 3X1YA 2H1LA 3HU2A 3QENA 2WJGA 1OYWA 1Z6GA 4KJZA 4EFLA 1DELA 4J0QA 3K0SA 3KJEA 3O8CA 1M74A 3J81k 4QJ5A 1V5WA 2ATVA 2C96A 4TLAA 3VTKA 1S8FA 3W9YA 1Q3HA 4AWXA 2F3TA 3K09C 2VSOA 3LY5A 3X1WA 1JNYA 1R10A 1VIAA 2IYRA 1UKEA 5DHAA 4QXAA 3FFAA 3AUYA 5B30A 3A36A 2D2EA 3KKOA 3RSLA 3UATA 3DEFA 3AVWA 2D7DA 1E32A 1D8TA 1Z0KA 3BB1A 2BKEA 4NZYA 4MRPA 4DC9A 2GEVA 4I99A 5KDOA 4LUCA 4B33A 4Q4HB 1YZLA 5G53C 3GLHB 1JAHA 1HTWA 2ANBA 2BCGY 2DPXA 1ZCAA 4DCVA 2I1VB 2WMNB 4POAA 1DPFA 1G20E 1T9HA 1W0KA 2GXQA 5EJEA 4CDGA 2G3YA 3EWAA 5EQTA 2YVUA 3M4YA 1J7KA 3GFPA 2AD1A 2J59A 4UJ5A 3W5IA 4PC3A 4N3NA 5IT5A 4LHVA 3QKUA 2RGCA 4FMCB 2JJ2D 1ANKA 3HYTA 4AC9A 4D82A 4DSNA 4B3FX 2IT1A 4OHWA 3CF2A 3RRMA 3AVVA 4XH9B 1QHNA 2JDIA 2ZRCA 2ZRLA 4JT2A 5G3ZA 3T15A 1OH6A 1I4LD 2RH5A 1ZIPA 2X77A 2N42A 3HJNA 2QI9C 1HYQA 1AZSC 2O0JA 1E69A 1VHTA 1G64A 2P65A 2VP0A 4IOKA 1OIWA 4NDZA 5C46F 1D6JA 4GRAA 2V7QD 4I4LA 4DLTA 3BH6A 3OAAA 1NF3A 4KITB 1FPMA 1UEIA 1GNRA 3SBEA 4GT1A 4D4LA 2BMDA 2UZIR 3M0EA 2ORVA 3HDTA 5TY0A 3THWB 1OW3B 1XD2A 2O52A 4LV5B 1HT2E 1LY1A 4M1SA 3GCGA 4F92B 4H9GA 4M1TA 4X8LA 1G8GA 2GJSA 4GFDA 1GRQA 2PL3A 1NL3A 1OB2A 2JLVA 2WBLC 5BW8A 3ZD7A 4PXAA 2XNSA 4NYJR 4QBFA 5FOSA 3DPUA 1JQLB 4BFSA 3EPJA 3W6NA 1X3SA 2N46A 2ZE7A 1OIVA 1CR0A 4GOKA 2O8FB 1Z07A 4A8JC 2FDCA 2FE4A 2FSHA 1W36B 1KK0A 4XTCS 5P21A 4V0KA 1OFTA 4K8OA 3WMFA 3LX8A 4MKHA 3PENA 3T61A 1Z2AA 4ZKEA 1GVNB 5CDFA 1G9XA 4BLQA 2X2FA 1ZAKA 3A1SA 3CO5A 1KDTA 1CU1A 5DH9A 5JLJA 1DAHA 1H8ED 4B3CA 2IWRA 3OIUA 3P32A 2F43A 2WAXA 3MSXA 1G4AE 2OSBA 4B35A 5KNDA 5KTYA 4XVRA 4RD3A 1OHHA 1DTSA 3GJ5A 1KO4A 2YNMA 4LJ9A 4CEJA 4XSGA 3A4NA 2ZPTX 1E2NA 2OILA 3A1VA 5FBVB 1RRCA 1RVDA 4DCTA 4I81A 4GOJA 4D80A 5K8LA 3B1YA 5DO9A 5JJIA 3B82A 3ZIAA 4G01B 4A4DA 1JXOA 4Q5IA 3AP2A 2ZSFA 3Q5EA 3VKHA 1CR2A 2CJWA 2ZRIA 3SN6A 1GSIA 1E2IA 2ZJBA 4OK3A 1HQYE 1FZQA 1MABA 2PCLA 1SVLA 1TQ2A 4KHZA 4JLBA 1G7TA 4TLBA 2WJVA 5HKKA 1QHSA 1LB1B 3A4MA 2ZJ5A 3CIOA 1IN6A 1GL6A 3O8DA 3QKSA 4LYJA 2QTFA 1QG4A 4JL5A 3AVXA 4I1OA 4BFXA 1E2MA 2ZUDA 1S96A 4HZIA 3L2OB 1K5GA 3TAHA 2OXCA 2WOJA 1IJEA 2WWYA 2B92A 2JLSA 1KSGA 2EFDB 4PC7A 4B43A 4FIDA 2V6JA 3EA5A 4LWZA 4CF7A 2QBYA 3TVTA 1LF5A 4KLZA 4LSGA 1EWRA 4AK9A 5DLQC 4Q19A 2G9NA 3K0CC 2BBSA 1G3RA 2V6IA 5DHFA 5FTJA 4DRZA 5GJVC 1ZD8A 1U0JA 5FTNA 5L3SA 2GVDC 4JLNA 2BOVA 4HB3A 2GXAA 2DWPA 1BYIA 4Q21A 4LC1A 4P4SA 5CB8A 3D3QA 3THXA 3CF0A 5H8WA 1TF5A 4S2EA 1NJGA 4EFMA 2RAPA 1KGDA 4EPTA 5KNCA 5DI3B 2H7VA 2VHCA 3E70C 1P2TA 3GJ6A 1J2JA 1NN0A 1UKZA 3U5ZB 4LBZA 4Q7MB 4GDFA 3HP1A 4KFTA 3ADCA 1NVUQ 2G1KA 3ZVRA 1J8YF 5CLQA 3TRFA 5JEEA 2LKDA 2HF8A 1DG3A 1P73A 1Z29A 2W00A 1E6CA 3GJ4A 1XEXA 4PPNA 3T12A 2REOA 2AXPA 4KODA 3UMFA 1SHKA 2BBOA 4EPYA 5HCIA 1G19A 1KI3A 4B3DA 3U44B 4TLCA 4CEHB 1ZINA 4JSYA 4XVQA 4QNMA 1Z22A 2HCJB 2WIAA 5KU1A 3RRZA 1COWA 5JRZA 2PEZA 1QG2A 2KI5A 2QU8A 4L9WA 5ANRB 5AR1A 1E0AA 2IEZA 2O8DB 4GI7A 1VECA 2O8DA 3H2YA 4C4PA 4RCZA 1SXJE 2XSZD 2OO7A 1E99A 2C9OA 1T3SA 2DR3A 1H8HD 1R5BA 1CULC 1BOFA 2OAP1 4QC2A 4JYBA 3P4YA 1U99A 4XWAA 3D31A 2EU8A 1S3GA 3GJXC 3SBDA 2ZYVX 3AEZA 4R9UC 4C30A 1S3SA 4US1R 4TMZA 3KKMA 1KI1A 4P4UA 2VHTA 2O8CA 5JECA 5JBQA 4FINA 4NU0A 2FMXA 3B60A 4Q4AB 5F3WB 3VAAA 3UIEA 4YMVA 5HKKD 5IRCD 1FMJA 4LHYA 5B64A 2PT7A 1O3YA 1WQ1R 1NLZA 1W0JA 2K5UA 2PH1A 1KI2A 2MSDB 4GP7A 1XD9A 2AWNA 4JBXA 5FI0B 3GLGE 1IXSB 4P31A 2Z6VA 3LDAA 4PANA 3ZQ6A 2C8VA 5J47A 2J0UB 3EPKA 2PLRA 4IJMA 4MKIA 5LD2C 3KUCA 5EZ5A 4A0FA 1KY3A 1EFRD 3IKJA 4M9SA 5FL7D 5KHOC 1FOEB 3AUXA 3MUFA 2FG5A 3SOPA 5KO2A 4Q1DA 3UG6A 2OEPA 4DSOA 4HZUA 2GCOB 1G5PA 1PV4A 2BWJA 2ZQ5A 4M22A 4AYTA 3BFXA 3UPUA 3PITA 3OAAD 4JJZA 4JJKA 4E22A 3ADDA 4WW0A 4QFMA 2FA9A 1N2CE 1AZTA 2R44A 4CEHA 4KV9A 4ZIRA 1CJVC 2NGRA 5TB5A 3B8HA 5J4YA 4HAYA 1FFHA 1VCNA 1OXXK 4QBHA 4LV6A 1ZM2A 3ZGXA 1NBMA 1KYIA 3MCAA 4K81B 3U3MA 3UKDA 1I4DD 3GFTA 3TQCA 1EFUA 1K8RA 5FR1A 4DLWA 3QXSA 4M4SA 4US0R 121PA 2ZAMA 3QVUA 1RIFA 2I1QA 4LJAA 3QG5A 2TMKA 3CNNA 3P4XA 4G5SA 4XVUA 2WKPA 2ZREA 2FFBA 1TTTA 3NBYC 4IDPA 1U98A 2ZRAA 2P0EA 3I61A 1JALA 4EFNA 1XNJA 3RC8A 1E4VA 1TEXA 3AVOA 3LRPA 1R0WA 1T0HB 1NN1A 2HYDA 3CX6A 3G5UA 2XEXA
chains in the Genus database with same CATH superfamily
5EUCA 4FT2A 5LKAA 1H9CA 1GNSA 2LUOA 1IK6A 1WMBA 2Y0BA 4AM8A 3DFMA 5K5EA 2AHOA 1W1WA 3GNTA 4ICIA 2PRKA 4J2HA 1VYUA 4BJHB 3FOAA 4U8GA 2IHTA 3HKCB 5CJJA 3ZIDA 4DDMA 4ZVMA 4F2HA 2JCGA 1L5KA 4ETNA 2W6QA 4GLFA 1B1AA 4KC0A 2PD6A 2A0UA 1JHMA 5L3ZA 1CHDA 3EYWA 3TIFA 2BMWA 1J1IA 2BFDB 5DEIA 1HTTA 3JQ9C 2JI4A 3Q9UA 4G5QA 1Y7LA 2I33A 4DJ5X 1Z08A 3FNHA 4KN5A 5F21A 3JYQA 1WUJS 2PYDA 2XECA 4YR9A 1OXUA 2R8EA 1PSZA 4KWTA 4UXJA 2R7KA 4XPZA 4URXR 5KJ6A 5JAMA 1NVFA 3O26A 2RE8A 3CEPB 1S2NA 3EPHA 1P3JA 2FUEA 3WGTA 8LDHA 5JDCC 4EQZA 3PNVA 1IEXA 1ELOA 1CJUC 1UBOS 1WDTA 3TMAA 4IHJF 3P2YA 2OXTA 1SC1A 3BAFA 1RRMA 1Q15A 1HTBA 1NNEA 1GNQA 3K9WA 1E20A 4KAXA 4S05A 2D74A 3BSYA 4AJOA 5I45A 1AKTA 1VPVA 4HDRB 1EP2B 2BM0A 3B12A 3QPUA 4QLAA 4UXIA 1OI2A 1YBMA 1U8YA 1YZUA 5SZIA 4OXQA 3UWPA 4JLAA 2G9ZA 1EZZA 2XKBA 1FP7A 1LPMA 4QYWA 1E79A 2G0TA 1DQZA 1HNNA 1KTIA 5FPQA 3FIUA 4D3XA 4CF3A 1A82A 1YT5A 2W2PA 4K2HA 3ZS8A 3SQMA 1XFAA 1O97D 2XZDA 3C87A 2JHPA 2RBEA 3G89A 2DGDA 3RYHA 4CCYA 1C4OA 1KOLA 4URVR 3KX2A 4HAUA 3C5WP 3FCSB 5T3UA 4WOBA 4D74A 2G7ZA 4ENTA 3HDQA 1DTEA 2C99A 4NFSA 1GRRA 1JHVA 1HLPA 1MORA 1BAPA 2CXSA 3GD7A 3MCWA 4XX0B 5TF4A 3TQQA 4AROA 3FUVA 1FJXA 2UUAB 1S02A 1KOGA 5FWXA 4EB0A 1E2QA 1P3DA 2R6GA 2WJHA 2IUEA 2WNIA 2WU4A 4EYKA 4C7OB 2GH1A 2CXNA 4JYPA 3BWXA 2NO5A 3KU1A 2A0FA 4R2WA 5KC8A 4P08A 4WZBA 5JZ9A 5AW2A 4W4TA 3CLUD 4WERA 3BIFA 2OCPA 2CXPA 3WFZA 4F93B 2H52A 5K4GA 4OVKA 2HL6A 3S1LA 3W90A 5ADHA 5JRDS 4DMHA 3OIDA 2NO7A 1SC6A 1XYGA 3GNSA 3SYNA 3NI2A 3JRXA 1U0EA 2HHJA 1RC8A 1HSZA 2BLNA 1E6LA 2GI4A 3PRKE 3U3DA 4QGHA 1DV2A 1VG8A 4MVCA 2GPAA 3G2NA 3CSUA 1PJAA 1Q0UA 3HN6A 3NHAA 1NRIA 4QVKA 4IVNA 4P34A 2WLTA 1JHOA 4IWXA 4HRAA 4KXQA 1SUAA 4KK3A 2XMQA 3IKLA 1FBTA 1KEZA 3EARA 2WHYA 5CU7A 4CR7A 5IKPA 2JFQA 2XCIA 3B1KA 3KL4A 1VL1A 3VGPA 3M81A 3BPSA 3A37A 1VPDA 4I7EA 4RTJA 3VVLA 3KSAC 1O08A 2LBPA 4PS0A 3Q88A 2IBTA 5A03A 2IEBA 1UXJA 1GDDA 4ZTZB 1TYZA 2RARA 1E2FA 3VO8A 4DDWA 2DUUA 4ZYWA 1QVZA 4JLKA 1XWIA 1WB5A 3HVRA 4MHTA 3O0DA 1JPVA 2HREA 2DJIA 4YRRA 5J4HA 3S0JA 3JARA 1PR3A 3UNXA 1FTQA 2QG6A 3OF2A 2V3VA 3IMEA 5JLAA 3I09A 2H5EA 4ZEWA 3H5TA 1RHJA 3PLAE 4IO1A 4MCJA 2R3SA 1I2AA 2V59A 3H1AA 2X40A 4JXKA 2ZWVA 2GKGA 3GJ7A 2IH5A 1IJKA 3V7FA 1JBKA 1KAQA 4FE4A 3W7BA 2A4KA 4HG2A 3G79A 1NJ1A 2WD7B 3DOIA 4FEYA 4P93A 4TM7A 1J1UA 1Z6AA 3ZOZA 1KI4A 1M76A 8ADHA 2XA9A 4BNDB 4Q9JA 3TGPA 2YDYA 3LI2A 5HZKA 3GEPA 4C0BA 2QL9A 4OXRA 2V55B 4XQ9A 4D79A 2I4MA 2VPWA 3OH8A 4R2MA 1HFEL 2O6HA 1WG8A 4ND3A 4KOEC 3EVCA 4P98A 4E30A 1IY8A 1X1TA 4JI4B 2G1JA 4LXYA 4OLHA 3HPRA 2GZRA 4HS4A 2HBYA 5IU6A 1L5YA 2B34A 2E89A 3FYUC 2P9JA 1N6OA 4DM4A 1RLMA 3LX4A 2PXAA 3TQFA 2R11A 5NLLA 1NX6A 3FA2A 4JT4A 4PPYA 2CGEA 4QHTA 2CLHB 5CLGA 5FFMA 3W2GA 5ARDA 6REQA 3DR5A 1IY0A 1Q22A 2R6DA 1WAMA 3CX7A 3QELB 4J9UE 3PPYA 2J0SA 3AZOA 3T7DA 1B3BA 3H2BA 4JUIA 1GO2A 2OL4A 5A5FA 3SP1A 1KQPA 1S1CA 3I52A 3FCYA 4NCXA 3G9UA 5JPDA 3OPQA 4URZR 1THGA 1C2YA 5DULA 4YR7A 1HYHA 3VR4D 5ECYA 1IE3A 3O1HB 2O7QA 4E6EA 1LVGA 1YR2A 3F5FA 4Y7CA 1Z63A 1DU4A 5KIAA 3WC4A 2PR2A 1ODLA 2VDOB 1GUFA 3OETA 2D62A 4GUAA 2CCKA 3LAWA 2BFAA 3CLUC 2OCGA 2FR8A 4ACAA 1VIVA 1K8QA 2JFFA 5DJ5A 3REQB 1NZFA 1Z2EA 1PJRA 2C0PA 5H4GA 1AV6A 2B2NA 3KQWA 1XALA 3KKNA 4C0AC 2JLQA 4C14A 1AKEA 4RVCA 4LDQA 3TR6A 5HS4A 2UVPA 2CSXA 3LXUX 3U7HB 5FYQA 3SE7A 3H8WA 4RHFA 1B76A 1S2GA 5A6VA 3TL3A 4ZHQB 1I80A 5HE8A 1NMSA 1JHUA 2DPGA 2Z5FA 3GPBA 2BAGA 3M9LA 4DIFA 1E9SA 1E9EA 1RRKA 1RFGE 3NW9A 4R9SA 2HZ7A 2X6RA 2C0QA 2JNWA 3AERB 4OQLA 3SR3A 3U62A 4F6RB 4Z4CA 3RU7A 2ZK7A 1M2JA 4GW3A 1U5BB 1E3SA 1AE1A 5AI5A 3DZBA 1VPLA 2ENUA 5IWAB 2YV2A 4FILA 1L0BA 1MB3A 2PZBA 3R3WA 4C7MA 1XN4A 3BL5A 1O8CA 4BKPA 5JXIA 5GQSA 2BMVA 4IUDS 3HA2A 4QBIA 1QF7A 3RT9A 4YJGA 5IZCA 1NXOA 3FH0A 3AFOA 4MSUA 3MTEA 3ED5A 3QXHA 1JPJA 1UL1X 1TJNA 3NTUA 4F4IA 5JYCA 1GNTA 1ZKMA 4EYSA 1Z33A 5CVVA 3IOMA 1WPRA 1ZH0A 4K0RA 1ULBA 4C06A 5C8VA 1CIVA 3PNQA 2OM2A 3SS9X 3GLFA 2CT8A 1KL7A 2QIPA 3RUEA 3L0ZA 4UNIA 4BEBA 5C1OA 3EEIA 3PX7A 2LNDA 3OQOA 4DLSA 3OIVA 3R3JA 3E5NA 4J4TA 1H3EA 3N8KA 4D9MA 3A3NA 1XZJA 1JQDA 3AEUB 5F7OA 4BBZA 2PKQP 4PIMA 1IN7A 5LZ2A 4XOUA 5AW9A 4TLDA 5DNDA 4AMVA 4J0FA 2IDMA 1HT3A 2YTZA 4XIGS 2YXPX 1TIBA 2P62A 2V96A 3NDRA 3MB5A 3X1JA 1PGOA 4I3HA 1IUKA 2XCLA 3DS8A 3E2IA 1ADYA 4QQKA 2PGDA 1M6VA 4TSFA 1CUAA 2YV1A 4G4GA 2ZI9A 3HEBA 3I12A 2H1SA 4GG1A 5JMPA 3RIMA 1PJSA 1F2TA 2FPMA 3URMA 1Y42X 1ODJA 1P9OA 3H11A 3W4IA 1QKIA 1LXCA 1FUKA 4K0KB 4P0TA 3T8YA 2BHLA 4ZMSA 1Z4JA 2H2AA 4RD1A 5I8ZA 3DEIA 3O8QB 5KU7A 4HAVA 2PGAA 4Y3UA 1PP4A 4Q00A 4A3SA 3C1TA 3NM6B 1Y4UA 3A9UA 5K45A 3B6MA 4BVEA 3JATB 4Q4AA 4BNTA 1C3JA 1Z2CA 4JB8A 5F1OA 4WVFA 4W8HA 4N5HX 1AZWA 1Z6TA 1JJBA 1YKFA 4J90A 2FW9A 4MVJM 3RHFA 4HQFA 2V8OA 3ZYZA 3H87A 4F8YA 1YTLA 1FDIA 4MWZA 4DIUA 1Q3TA 1QHYA 2FWRA 2M9MA 3D2BA 1N9GA 2BFCB 2F00A 2ORYA 5EZ6B 2ZPUA 2A9JA 5H59A 4GR9A 1TADA 2GPNA 3GDHA 4YN3A 1B3RA 3QNMA 4M21A 2PGLA 2GEDA 4OQPA 5EE1A 3TXAA 4NMHA 4FCVA 2EIXA 3U4CA 1SM4A 5U4XA 3VSAA 3EDMA 4PIPA 4HPWA 1A72A 3AC0A 2DQSA 2J5QA 4XTRA 2D0PB 1GKUB 2GN0A 2H8KA 1H5QA 1V95A 2WHPB 3C43A 1EZ4A 3MM4A 4URYR 3W34A 3AO0B 4AZ3A 2O7VA 4II7A 3IKVA 1UDRA 4Q4CA 5AW6A 1VYVA 1W5TA 2V5AA 4MWGA 1T2FA 2BTQB 3GPLA 3RKUA 4DM3A 1NI3A 2GN9A 3G3EA 3ZHRA 1IN1A 1JB1A 4Q1BA 3T1OA 3ZK9A 3LQ1A 5FOTA 3IAXA 1EVEA 3BE5A 2GD1O 3AB7A 5DCLA 1DEKA 4FSXA 3W5BA 4NU6A 2XRYA 3MAGA 4EELA 1U0TA 2EQAA 3I9V1 1SXJA 2Q5JA 1PJBA 1QQBA 2B7CA 3B6JA 5GONF 2CDNA 2CK3A 1ZWKA 4Q4HA 4WK2B 1SRQA 3CH7A 1AF7A 1ZSNA 2XW6A 3AB3A 3HR4A 4UBKA 3H9CA 4EJSA 2C98A 4K6FA 3KPJA 2XYGA 4Q9HA 3LU1A 2FQ1A 1L7NA 4YP6A 4EKEA 4F3TA 1E9RA 3W3AH 1JKFA 3BRWD 2W6IA 3H6HA 3KDAA 3P0JA 2VHJA 1D07A 4HQLA 1R7RA 4W5TA 2FPGB 3KB1A 3R3VA 3TPZA 2ONZA 1C7JA 2XE7A 4EQ6B 4MLCA 3CG0A 4DGSA 2CK3D 3GARA 2X5OA 2OLJA 4G2TA 1AS2A 5FUYA 3VJLA 1M6EX 2PXCA 1ZVVA 3DD1A 2W9XA 3ETLA 1OXVA 3K4QA 4EI8A 1FVFA 1RADA 1JHQA 4B47A 4B84A 4UTVA 1IN4A 2HQBA 1JE1A 5FBZA 1KI7A 1VA5A 1U6KA 2X42A 2XQIA 4EF5A 4EMUA 4F91B 5MN4A 4MARA 2JF0A 4JUDX 1NUAA 2H07A 5CXUA 1HX7A 2WWHA 4LBWA 1YB6A 1HO3A 3IAS1 3IMKA 3F4KA 5D1HA 1KSHA 1O9HA 1KI6A 1Y1LA 2GXSA 3G7NA 1X86B 3QX7A 4HGNA 5CGZA 3S2ZA 2WJJA 2IEDA 1CY6A 1HG1A 2ZS7A 2AZ4A 4L74A 3T3GA 4A0GA 1ZVMA 3IUMA 3PICA 4YUZA 2K2QB 3RUAA 5BORA 5LLDA 1GM5A 4NYIR 1SCNE 2BV3A 1XLWA 4R6WA 3PCRB 4M55A 1BEZA 1JU4A 4R8RA 3V4VB 3NJRA 4KR9A 3COWA 1KR2A 1Q57A 4JX9A 4D9KA 4U4AA 5DWQA 5JFGA 3AF5A 3ODPA 3EGDA 1JWBB 4GVXA 2VHQA 2GZ3A 1WDKA 1R3DA 4NCHA 1XL1A 4Q1EA 3QUQA 1YI0A 2HF7A 3LPNA 4TT3D 5AM4A 3EG9A 3L93A 4EOGA 1SCKA 1LNSA 1II8A 3RF7A 1E6WA 2VZLA 3LPCA 1LWOA 1W59A 3DZGA 3NR2A 1Z2DA 1AU9A 1ZCBA 3ASYA 3PHCA 3WKEA 1CZOA 1L4NA 3P2KA 4M38A 2D8MA 4RXUA 5J2UB 4IVQA 2JK1A 3BXPA 2XXAA 1KEPA 3GLTA 1CG6A 1X80B 3ZI7A 1NYLA 2IODA 5HTKA 4MJ7A 1AHHA 3O31A 3COJA 3I6IA 1NLYA 1YJAA 4HNSA 3SVZA 4ER3A 3TZ6A 4B4VA 1PV2A 4RK0A 4CM6A 4GIBA 4KP7A 2ERCA 3U7QB 2PL5A 1NV9A 2G8NA 2ZBPA 2SKEA 3BDVA 4LXXA 3QXJA 4V03A 1N0WA 2QGFA 4WEOA 4AP9A 4ZJZA 3M4ZA 3KIPA 4CXMA 5HFJA 4Q1VA 2VPXA 4WLOA 4IQ4A 3ESQA 4MV9A 3OJEA 2BT4A 1N2OA 3LQYA 1NOIA 1JAZA 1QFSA 3LQ4A 4HP8A 3FTEA 3M6FA 3A4IA 1QNLA 1UK7A 3R7WA 3PIRA 3SLGA 2CL0X 5KVCA 3MWKA 4KPEC 1BKSB 3GLGA 3MTDA 2BGLA 5IJ0B 2IEYA 1MEOA 2PV7A 5LLTA 1RWXA 1P0IA 3RUFA 5KX5A 1AZLA 4YK7A 1P5FA 4BTEA 4P6VF 4FP9A 1KRHA 1CK4A 4LCEA 4LBVA 1AS0A 4QQRA 1C1XB 5EXTA 3TXXA 1PHRA 2HBZA 1P2GA 4HAOA 1PSDA 4HNHA 2NNWB 3K09A 4Y8VA 3W9BA 1QS0A 4D99A 1KVTA 3RODA 3LBNA 4LW8A 1I4OA 3QYPA 4YCLA 3CC8A 5IK2A 3F6CA 5JQWA 5IBCA 4RVOA 4OHFA 4BNWA 1TQ6A 4D8TA 3JD1A 5SY9A 4RZ3A 4JNCA 5TMEA 3SBXA 3HGMA 1TPYA 4UTOA 3TW8A 1X0XA 1YRAA 2CVFA 3E53A 3AHEA 4IDNA 2X5KO 3A7DA 4TMWA 2J87A 5EQJB 5IKMA 1TC2A 2Z2IA 4L3WA 2GPWA 4IILA 5FTKA 1JHYA 2ZBEA 5KYTA 2GCNA 3GYBA 1YS6A 2HMYB 3DEAA 5D6NA 5GP1A 2FLWA 1XZMA 4H1WA 2V7QA 1HURA 4MVJH 1KVSA 2EVWX 3AEQA 3AF2A 4R8SA 1Z34A 1RLOA 1BXGA 1OLXA 5AJUA 4D98A 4J7CA 1KKMA 1GPBA 1P2SA 2IDKA 2PXHA 4F7DA 2BIFA 2Q1YA 2NXNA 2ZWAA 3CNLA 4GP9A 4ZP1A 1PNTA 2O1SA 2B3DA 2FR8C 1M2OB 1Q1AA 3PQ6A 4S0XA 4WINA 4G23A 3ZIUA 5CIQA 4ESHA 1NP3A 3MUOA 1ZD5A 4Z86A 5EMKA 2VK2A 1RXEA 5ENDA 5FNZA 3QEJA 5C80A 3K1AA 2EG9A 1ZUIA 3IV6A 2LKCA 1U63A 4JUCA 1T0UA 2WNHA 3BIOA 1XXHB 4MP6A 4U8HA 4WKGA 5K51A 5C3UA 2Z9BA 5DP1A 1BH2A 3L8GA 3MS4A 3KBBA 4V1CA 3DNFA 2WUEA 4JDPA 4M0LA 3TQHA 5JATA 4U2FA 3L8ZA 1WD7A 1UBEA 2B1QA 3A70A 2BD0A 5LZ7A 3ISVA 3KLMX 4F86A 2DRIA 4FGZA 1T4DA 1SVMA 1ZD4A 4M53A 4MV7A 1A2QA 1KZ1A 3F49S 4NL4H 1T4CB 5DRTA 3QVSA 3SLRA 2O06A 3LNTA 5KKAA 4RZ2A 4Q9DA 3U19A 1R12A 5CNJA 3UYKA 1EFVA 4DA7A 2C54A 1H2WA 2OHJA 1B74A 1GTZA 1LNZA 1W9MA 3I8XA 4FS3A 4U63A 1H6BA 4ERXA 2E85A 5EJFA 1KZ4A 2DVMA 1BU8A 2BP7A 3IJEB 1XF9A 2YVAA 1V16B 1DCFA 2D2XA 3CF4A 3KT8A 5F5XA 5HJ2A 1N5MA 3NX4A 5DNVA 1YHNA 3VX4A 2JJMA 4BMYA 3G17A 3RYIA 4BYMA 1GHTA 2D1QA 2ZXUA 4BJ3A 1BVYF 1RI2A 2WWWA 4MULA 4WJZA 4DT1B 2C4WA 2H29A 4TLEA 3RFUA 2QN7A 2IOFA 3L7BA 3H16A 4HX9A 3LHDA 2V4ZA 3OX3A 1AK1A 4G8BA 4JL8A 4LDZA 4QREA 1P2FA 3P2MA 1DJQA 1H69A 1JEQA 5JNLA 1NM5A 4KBFA 4OM8A 2F64A 3DYVA 1Y7PA 4GO1A 3OT5A 2C78A 2HIHA 2P6MA 5B55A 4BGDA 3ZDDA 1J70A 2G40A 2IH4A 1UKCA 3P5BA 2ODNA 4EG5A 5EJIA 5KHAA 4YJ2F 3PQ7A 3NZEA 1VA4A 3S70A 5BN4A 5JYDA 4D41A 1TQDA 3INYA 4PGFA 3DVAB 5CB4B 1WPGA 1ZY2A 3EW9A 3K1TA 4OHOA 3UAZA 1RQNA 5ICFA 4TYPA 3BCHA 2XA2A 4MIOA 1U4NA 2Z43A 4H0FA 4S04A 3PL5A 2UV8A 4KQEA 4EQ6A 4ZDWA 4M0PA 3ZHSA 4Q02A 3ZZMA 3GIWA 3ZHBA 1B1CA 3DVAA 2FH5B 3MTIA 1M33A 5LJIA 3AVYA 4R9VA 4M0KA 3HMQA 2WKRA 4LJRA 1A9ZA 1GGKA 4KOAA 2OORC 3HZHA 4LJ4A 1V11A 1WSWA 4MW5A 3WYNA 3ZWOA 5BWNA 3MBOA 3P9XA 4DC0A 2ZWPA 1W5FA 4ZCLA 3D3KA 4RPKA 2ZWMA 3CNOA 3FUWA 2J5RA 2NVOA 1CQJB 3SZMA 2Q3MA 3L7MA 4KMSA 4N0QA 2V7WA 4I4NA 1N36B 1T3HA 2YBEA 2ZR9A 3AMVA 1J56A 2O7RA 3IQHX 4XUCA 1PJLA 3U40A 1EM8A 2I3GA 1DWUA 3PZBA 2Q3JA 3LPDA 4TLMB 3OT1A 5DI3A 1B8NA 1N2HA 1OLSA 2BKUA 1B42A 3FFTA 4I55A 1I0IA 2WD9A 3P9KA 3M5WA 5GONA 4OEHA 1IN5A 2JDID 3STTA 3R0QA 2DX7A 4UCFA 3EF1A 4DR6B 3CVWA 5FF9A 4F6LA 2FEXA 5EE0A 1CQZA 4ZIRB 3AINA 1OD6A 4IZHA 4JBIA 1ONNA 2DQKA 2VJDA 4JITA 4OAOA 3OQ1A 4YLEA 2QXTA 2L69A 5GMOA 3QQPA 3OQBA 2DXIA 3IIKA 3NM5A 3QKRB 5DISB 5ES4B 1QWOA 4JVNA 2GEKA 3HLKA 3MWDB 5K3FA 1PN3A 3FWKA 3LY7A 1WSBA 3DOHA 1U3CA 3OQJA 1F8YA 2YWJA 2ZIZA 3ZE2B 4AKEA 4M98A 3RJTA 2D2IA 1VL2A 5HKLA 4CQJA 3UXMA 4BV9A 3K7EA 4M83A 4NAUA 1D5CA 1KEUA 1XTQA 4JA2A 1T5SA 5YASA 4BC1A 3L4SO 5C9ZA 3KOOA 3U1VA 4QQNA 4AG3A 3IQFA 2WPDA 4BASA 3OKAA 2IIVA 3OWXA 3U7RA 3V9AA 2RK4A 3NVKI 2FU5C 5F76A 5FPSA 3OT4A 4WRRA 3GDFA 5HBRA 4EYQA 1TUEA 1YAJA 1GFIA 3HYRA 2FW8A 1Q1QA 1UJ4A 3DMTC 2Q3EA 3FKJA 4D9IA 4OQZA 1CJTC 4QOSA 2CXTA 4XDYA 3I01M 4K9SA 1A9OA 3PJGA 3RRYA 3CX3A 4BUZA 3L8FA 3RH0A 4O2RA 3VNBA 4NJMB 1PAUA 2R68A 3QFHA 1LX6A 1ZI8A 1FTWA 1Y9JA 2QQ5A 3AVPA 3D5TA 3RSGA 5EKSA 2VTKA 2RGEA 5C5DA 1AMOA 2JIPA 4EA6A 2FZKA 2Q9AA 2RBGA 3VBCA 2YCLA 1ISJA 4J75A 3TI7A 1U1IA 4BU0A 3PJFA 1RPNA 2SNIE 5L3RA 3U7EB 1HETA 2GZDA 3AERA 3COYA 3I4LA 3OOEA 4Q37A 1E4OA 2IF2A 4TSKA 2OKCA 4TWIA 1MNQA 4XVHA 1Y9DA 1NW6A 3EC2A 2Q50A 1FSZA 3AWIA 1JHZA 2BGNA 2CHGA 4PQFA 4B85A 2DR0A 3MJHA 4HXGA 2XXBA 1TLTA 4JR2A 4N9WA 2Z8YM 4CCWA 2ZEJA 3RC3A 3R6GA 4YDHB 5FPTA 2KYRA 3W3ZB 2HJ9A 1NR7A 3NOXA 3LWNA 3TBKA 1OU4A 1W9HA 1XRPA 3ETJA 3MK31 3FJOA 3HM9A 2P6RA 4OL9A 2JB9A 1B2RA 5B3JC 4UREA 1THMA 2OCXA 4WASA 2AG8A 2IYSA 2RGXA 3DMGA 2ZM5A 3MRXA 2FPKA 3OMLA 1QH8A 1N6KA 4CI9A 2PBRA 3C3BA 2AKAB 4F2WA 2NZ2A 3IT2A 1F7UA 3RIXA 1WXGA 1T25A 2CJXA 2FZGA 5A3JA 4BWFB 4O4HB 5HZMA 1QHIA 2FUKA 2HJWA 1YZHA 1WMEA 1PGPA 3MT0A 2JVJA 3AF3A 3P9PA 4HMQA 4D8UA 3GYGA 5J1SB 4BKRA 1X77A 4HEQA 3NHFA 1G3IA 5F78A 1M1NA 1NFFA 4HTAA 3O8NA 5DASA 1L5QA 2MMCA 2XX3A 3OFNA 1X7WA 3WJ2A 3HM2A 5K0NA 1OV4A 3S68A 1DDIA 1JEOA 4DJJA 2RD2A 1S4MA 4JJ7A 5CXSA 3P71T 2Q4TA 2MSKA 4KXNA 4CMHA 4E3WA 3DFZA 3UCEA 5JAOA 3FCXA 2ZJAA 4OGWA 1ESDA 3BMQB 2BTEA 2O19A 5AVRA 1TM4E 1WDLA 3F3YA 4HOYA 3WWYA 5EJ9A 4Y18A 2JLCA 1P7CA 2AMLA 1BDMA 1GAJA 1W96A 3OM1A 4PICA 4U7GA 4OXIA 3A9RA 3GH1A 1CUBA 1OGIA 4C2UA 1MC8A 4Y2SA 4RTSA 4Z49A 2NV0A 3H2KA 1CFZA 4ZCMA 2M32A 4R3WA 1DUIA 2VRWA 4COOA 2J08A 1HDRA 5FFNA 1E2JA 1NQXA 1NULA 3ASZA 1G5IA 3GEGA 3MS7A 3F7TA 5ILOA 4IIJF 4MWDA 1C81A 1PL8A 4ZGBA 3F3KA 4EI2A 1EVKA 2C1XA 1I5OA 5I7OA 2VQ6A 4Q9LA 4R0MA 2R85A 3C85A 3G8DA 3KQTA 3UMBA 4AMBA 2AD5A 2CXQA 2GA9A 2PKQO 4C4RA 3E7XA 3H8SA 5EGSA 2EL9A 2HK7A 5HRAA 4GMKA 4HQNA 1WWKA 4HUQB 4LRUA 3COSA 3D3WB 1GPLA 5LMZA 5IMSA 4O8ZA 5FB3A 1BDJA 1N3YA 4BLWA 3HJFA 5T41A 4BKQA 2LDBA 4MV5A 1T5TA 4NY1A 2QMZA 3KT0A 4J2TA 4X3PA 3HDHA 4HFRA 2GN6A 4YDSA 2FNAA 4PONA 1MV8A 3QRWA 2AR9A 3ANTA 1VXRA 2W2TA 3EVTA 4MQMA 1QTNA 3DLCA 1BWRA 3I04M 3AV0B 3V9PA 3BQ9A 3CE6A 1XD8A 1VG0B 2OVFA 4C3VA 4OPMA 5FIUA 4B3HA 1G8HA 3RIGA 5HE9A 4KNVA 1SKMA 5K0LA 3OQ6A 3RVQA 3TW6A 3WSTA 2X76A 1XZDA 4CKBA 5KYUB 1CUHA 3C6XA 1V3UA 4HEA1 3HVIA 4NX2A 4XYEA 4I19A 1ZJYA 3VYUB 2XZTA 2IYVA 1COZA 2ONCA 4K8RB 1JTVA 2OQ2A 1TKBA 4ND5A 4AO6A 3PGXA 4BP8A 3UOWA 2EAUA 4JU8A 2ZJ8A 3IEKA 3P26A 3RIEA 5AK0A 4EUSA 1F60A 5SV2A 2HY7A 2ZB4A 4ZVLA 2C61A 1O4WA 1GPAA 1MX3A 1JIVA 2XYVA 1DNPA 3OC6A 3UMVA 1ZGJA 2SHKA 3R3UA 4N0EA 1R4MA 2Q6TA 1G9SA 3VMMA 5B4VA 2EYUA 1G0NA 1M1YE 1NZJA 1E1RD 1U5CA 2X0NA 4TRMA 4U2KA 4X91A 2VUTA 4OHZA 4ALJA 4TKLA 1QONA 1EM8B 2GFIA 4R1SA 5LJLA 1AQYA 4GNKA 1P8JA 4MUJA 2MIIA 1P61B 2FE1A 3FUXA 2ZYWX 2NN3C 4R2HA 4RHUA 4XX0A 1RMYA 2HA0A 4XPIB 5CH3A 3T95A 3TPCA 4AMZA 4E0BA 4HUTA 2DLDA 2UUCB 1UADA 3M7IA 3U7FB 1H1DA 2OAEA 1RIIA 3L4BC 4ITUA 4ODIA 4HX5A 5DK4A 5E2IA 3RWBA 1T1JA 4RTQA 1MB9A 2HA5A 1ZH8A 2D5CA 2VJCA 3EC7A 1UFRA 4O2LA 4DMGA 5L3QA 1ZGAA 1IQPA 3R3ZA 3WGZA 3UT6A 2PAFA 3ZWQA 1S1MA 3MS2A 2OC9A 4G0VA 3ZZNA 5HW0A 3F73A 5J1TB 2C7VA 3MYRA 1W36D 2ZIUB 4YRFA 1P7ZA 4TPKA 4RETA 1X13A 5T3YA 3QEAZ 1HDIA 1YS4A 1NZDA 3AY7A 4KQKA 4MTLA 1RYMA 4PYLA 4YCAA 3MJ4A 3RC9A 1V3TA 3AFNA 3UMSA 5BMVA 3SHTA 3H8JA 4JKOA 4ENQA 4PHTA 1N0IA 4GDMA 1O87A 1ND6A 3ZUGA 2AX4A 1U0LA 3CH6A 2DBVO 1D2RA 1QR2A 2J41A 4I9UA 4JB0A 4LMRA 5C8YA 1W87A 3VUEA 4B3RB 3K9HA 2ZRHA 3UXYA 1ZBDA 2VP4A 4AKHA 3MTAA 1TZCA 2NUPB 3B36A 4YAJA 5DBHX 1O6FA 3H3JA 4LHZA 1SHTX 2DLCX 3NBQA 3S2GA 4N7RA 2PMWB 2E4VA 4G37A 1DZ3A 1R15A 1VP3A 2D1YA 3OZTA 4BXOA 3GLIE 1EG7A 2PM8A 2NXWA 1JFFA 1HOXA 3M3HA 5AHOA 4C01A 2UZ4A 3QVKA 2NUAA 2XUHA 2BKVA 3DAYA 4MWTA 1QHXA 4UPEA 3QHAA 2QGNA 1E5XA 1NXPA 1Z2NX 4LOJA 2VNHA 3MOGA 5JD4A 2DFDA 1VE3A 5KSZA 1EDDA 3A06A 3CXRA 3HKCA 3O8BA 2YJNA 4HWSA 2OOSA 3EGXA 3LK7A 5C31A 3ACBA 3DFFA 1T6XA 3KV1A 3PT9A 4HI0E 4I1VA 4KRFA 4OLAA 3OF5A 2B6HA 2FSVA 2PBZA 4DV3B 3OJFA 1B8PA 4ED9A 3ZCPA 3ZK7A 4OQFA 3NT4A 4LSMA 1ZGGA 1ZJ6A 2XQKA 2ZRFA 2AI2A 4V0QA 1ZC4A 3HLYA 5KAPA 1QIFA 2JL1A 3N2KB 3E2MA 4BVKA 3FLMA 4HS9A 3OMWA 2QJTA 2ERXA 4WT7A 1SUDA 3UJ9A 1KJIA 3BXGA 1M1ZA 4Z51A 2LDXA 3LKVA 1QC5A 1RDFA 1L8XA 2Q8PA 2WUVA 4PBTA 5JNSA 2YZMA 4K88A 3UJNA 3OY2A 3TUZC 4C3ZA 4RQUA 1DG9A 3TIVA 2YHUA 1TPZA 4JOCA 4FC7A 4GX0A 5CA1F 1MHPA 3AI3A 5DHRA 2CFSA 3WKDA 2WYUA 1NR5A 3TKAA 2XZOA 3C1UA 3HKDA 4Q16A 4BQPA 2BPOA 1M5TA 1W46A 2OHXA 2VT2A 5JSZA 2AOUA 1OYYA 4AZ0B 4E4TA 1W47A 2CUKA 4R05A 2OESA 3WTCA 5ARBA 2EHJA 1GDTA 1XMIA 1I7LA 5BN4B 3U09A 1OZHA 3HYNA 4IP0A 1L7RA 3UWDA 4F5EA 3L8MA 1RRGA 1ATIA 1L7PA 4OSPA 3V55A 4YCCA 5JYEA 2A1TR 2A5YB 1YC5A 3WIOA 5JISA 2PJUA 1UQRA 1G8FA 2F6RA 3GL9A 3I0ZA 3OIGA 4OBXA 5FUVA 2BVNA 2DR2A 4QVIA 5TVGA 3DWGA 4N8SA 1Y7HA 3SAJA 3CTMA 4BO2A 2RAFA 4BJ1A 3IBCA 4ZPXA 3TX6A 5TMDA 4XARA 3E0XA 1XQ6A 4LQDA 4RMJA 1PG2A 3EIOA 1K89A 5CVCA 1CCWA 2H6EA 2PANA 2I2WA 4RY9A 3G8AA 3KYDA 3PEVA 4DARA 4G4JA 1XMPA 3IXMA 2XB4A 2A59A 2F1KA 3GFOA 4G0ZA 4IZOA 2C04A 2AJ8A 3DBRA 4URUR 1CBUA 5SZKB 4KR6A 3W4KA 1HLFA 1ZZEA 3IC5A 1GLGA 4XIFA 4EK9A 3IUJA 4BV8A 3U3OA 3PR1A 1YMUA 4EMSA 5GZ1A 3NB0A 4GE3A 4IIHA 3CG4A 1G8AA 2RHBA 2P6NA 4A8HA 1TJYA 3G5TA 1PNVA 1K5HA 1UODA 2ROQA 3GQBB 4CODB 4DM7A 4YYZA 1FX1A 2GM5A 2C31A 4DA0A 4E2ZA 1Z68A 2FFAA 4RKEA 1QIHA 1WV1A 2FMHA 4JHLA 5A4AA 3DTYA 5I7HA 2VJKA 3I83A 4E12A 2WAYA 5KWJA 2XUZA 1P4RA 2HU2A 2JI9A 2X2PA 3H9QA 2RJOA 2YXLA 2VUHB 3QHPA 4IIBA 4OB6A 1CJCA 3UMCA 3W06A 4Z8XA 4G1CA 4PLTA 2B98A 5K3BA 5LCXA 1OSNA 3SKXA 4ROSA 5KYWB 1MQ9A 3VR1A 2O2CA 2OV4A 5KWVA 5CK4A 1W19A 5KYUA 1Z6XA 4NBVA 4MEAA 5B1IA 3REFA 1SELA 2ZIGA 4TZ6A 2HRQA 3LC1O 4M9XA 3QOFA 2RC5A 2QSJA 4O63O 5A9SB 3H1EA 8ABPA 2GHRA 1PDWA 1CWUA 3WY9A 1BCRB 2DUNA 5JXWA 1GA1A 1H2EA 3UC9A 1RU3A 1FEZA 4X8HA 1J0XO 4ALNA 4LNUA 4RJIA 3VH4A 3ZJ4A 3NWJA 3ANMA 4A6XA 2GVZC 4HDRA 2GBPA 3TNDA 4CTKA 4L8LA 5H4HA 6Q21A 3JVVA 4UFNA 2Z4TA 1NJ5A 3O8RA 4IV8A 4FJ2A 4EHFA 1I3KA 2YHAA 1EB8A 2FQQA 1J5PA 4BCCA 2UUOA 3KYDB 3OOYA 3LZ6A 1RM3A 3KFVA 4YTEA 2B8WA 5E6SB 3LZCA 1E2PA 3QVXA 4V38A 4FYWA 3ZWVA 5J3JA 2WWRA 3UBMA 2HV8A 4BLRA 4GNRA 1IBSA 1Z2PX 2G9QA 4KB5A 4MO2A 1NMQA 4XM2A 3C8ZA 1U2GA 2B83A 1WVGA 1ML4A 1R4NA 2EFGA 4AZWA 1RKUA 5HSGA 2ZM6B 1U02A 2C2KA 2VF8A 1O95A 3BAZA 3PV0A 2WG1A 4FHDA 4BO7A 1CNFA 4AXXA 3LL7A 2JAHA 3HB1A 3STUA 1GRNA 4QOFA 4JOSA 3E5RA 1DWQA 3R7DA 1JZTA 3P9QA 1JEEA 3U80A 1UWLA 4IXTA 3E23A 3SKVA 4EW1A 4FQ5A 4IIXA 1FYEA 3QELA 4HATA 1SXPA 3BCRA 2HZBA 4AP6A 1FRZA 1SA0A 2F4VB 4YONB 3IUSA 4LOKA 3EOZA 3NEJA 5ITZA 3NWOA 3MQFA 3H0KA 1SU8A 3BXHA 4QEDA 5ALGA 4YT4A 1R8QA 1OAKA 2DHCA 3C3YA 2OFFA 1XQVA 1HE2A 1M9NA 4XASA 2W83A 4GZMA 2DPLA 1QOPB 3VO2A 3IJPA 3OFVA 4O2AB 3HB7A 2YFHA 1KOJA 4DUZB 3OJWA 2I4OA 1NVAA 2GCIA 3MIIA 3O03A 4HSGA 1RYDA 1CNMA 3RDPA 5A5VA 2XB2A 2FWAA 2QUAA 1R9JA 3FM9A 1YB1A 4OP3A 3TLMA 5DU2A 2X1VA 1VHQA 4UM9B 3THOA 1W4RA 1GNPA 1M0EA 1G20B 3IO5A 1UIRA 2WOOA 4OY3A 2X0IA 3BFPA 4GSKA 4RVSA 1WCV1 3IVXA 3L8CA 3EJ6A 1NJ8A 5U1PA 3TOCA 3S8YA 3RAJA 2HPAA 4QYIA 4UHHA 5DSTA 2GZHA 5IHXA 3IR7A 4UE2A 1VKZA 4RVUA 1FP2A 2Q3DA 1HDGO 1X1CA 3HUFA 1RYNA 2QMUA 3Q0TA 1E7QA 2EFJA 3BGVA 1D09A 1E2DA 1XRSB 5E3IA 2I66A 4NICA 2B5OA 4BTVA 2HJSA 3BILA 2QTZA 5LQRA 3IIIA 3H04A 1QPBA 2Z56A 4Y2QA 4HL6A 4U39A 3SQDA 4C0WA 5CEEA 4AG5A 4DWJA 5EP3A 3KJGA 1ZQ9A 2NQTA 4BFVA 1Y5LA